4S0TD

Structure of human pregnane x receptor ligand binding domain bound with adnectin-1 and compound-1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
91
Chain Sequence
ADLEVVAATPTSLLISWPPPYYVEGVTVFRITYGETGGNSPVQEFTVPYWTETATISGLKPGVDYTITVYAEMYPGSPWMDIQPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Developing Adnectins That Target SRC Co-Activator Binding to PXR: A Structural Approach toward Understanding Promiscuity of PXR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Nuclear receptor subfamily 1 group I member 2
total genus 10
structure length 91
sequence length 95
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s0tD00
2IQ9H 3FQXA 2G2RB 4G7YH 2OR8A 4MLIA 3SPVA 5DVLA 2OJEB 1Z9MA 5KG9B 1ZGLA 5DEFB 2V5YA 4DEPC 3QAZC 2JJSC 3FONB 4LKXA 4N8VB 4PBVC 3SDYH 3LD8B 3OG4B 5I8EB 4EUPG 2J3SA 2QSQA 3HPLA 5L2KD 5BV7C 4F7EA 1IAKB 2RJMA 5IKCB 4XPFH 4Z7VB 3BZFA 3MRKA 5CMAB 3VFTA 4NFBA 5DK3A 4QRQB 4PY7B 3PGFH 3MOQA 2HTKC 4OIAA 3JV0A 4WY7H 5HYJE 3NH7L 1A6TA 1U3HB 3KXFE 4P4KD 3FAWA 1BD2A 2FBOJ 1AKJD 3HNVH 3MRBA 1FFPB 4OQTL 2KH2B 3UYPA 3H9YA 1RHHA 2Y4SA 2V2XB 4PY8I 1VGKB 1GOGA 5HYSB 4K8RL 3B2VH 1SBBA 4F7PB 4XBGA 3BYTA 4GG6B 4TULL 2PTTB 3T2QA 1V3LA 3P4NB 4EQ2A 4OCNC 5GJTL 4G8FA 2J88H 3ARTA 5E8DL 3LKSA 5CJXC 5DJ8A 2DWDA 1JZ6A 2FO4B 5TPWH 4F2MB 2WWMD 2X70A 3P9LA 4WW2B 3AM8C 3O6MH 1M05A 2XTJB 1N6VA 3INUL 4W4OC 4ZNEE 4KUCD 5CBAA 4Y5XA 4G9FB 1X4ZA 3CDYA 4BM7A 1OAXL 1IRAY 5IMKB 2ORBL 4M8QA 4AIZA 5CCKH 1AXTH 1YY9D 2HWZL 2C4XA 4CVWA 4NO2A 5BV7L 1MHCA 1I8LA 3MV8E 1R0AL 2DQJH 4G6FB 1XF3B 2ESVA 3CFKB 3HAEG 5L0QC 3I6LE 4FFWD 3NZ8B 2YN5A 1KCRL 3SE8H 5KJRH 1U8NB 4O02H 1G9NC 3MACH 5KBNC 2FX9L 3WFEL 1QZ1A 4I3GA 3IAGC 5IBUG 4J3XA 1VFMA 3LEVH 1KJMB 2EO1A 1XFPA 2GJ6D 5D1XD 2PW1B 3VXRA 5GZOD 1ZHLA 1JPFB 2I5YL 3D2UB 2DKUA 2CGRH 3MGOB 4H20L 2WQRA 4HIXL 4LFHG 1P5UA 5SX4H 4W70A 3KAAA 4YHOL 3HMXL 2APWA 5LG1A 3HUJF 4RGOH 2W92A 4UAOB 1I9EA 5I6XB 5DEGA 1Q0YL 1YNKH 4XBPA 3MLXH 1R3HB 4UIKH 3KJ6L 4H25A 3BKMH 3QZWB 4OZFB 1B88A 1INQA 4OB5L 5E9DE 1IQDA 4HIEB 3U0PB 1P7QA 4M6ML 5BS0A 1YDPA 2R29L 1ZLUK 2YD4A 2P5EE 5C6TL 1AXSA 4X6FB 3QHZH 5T3ZD 3IFLH 2AI0H 2Q76A 4AEIL 3WS3B 3V6OC 1YPZE 5C0BE 2XACC 4ONGL 4JM4H 3OB0H 3GKZA 4MA1B 1T03H 3WL9B 4HUUA 1A1NB 2VLJD 2F5BH 4YHMH 5EA0H 3VXSA 3JWDC 1P2CA 3QFJB 5KSBF 4IJ3B 4OKVB 2VL5B 4MLSA 4P99A 1WZLA 1LVEA 3QG6B 4PJBB 3CD4A 1KEMH 3AM8A 5JHDA 4F8TA 4U6XA 5HYEA 2DYPD 2A9MH 3KGRA 3SOBH 5D2LA 3V6ZB 3QEQA 4XTRD 4QXTA 3MLPA 1TQCB 4ODTH 2UWEA 1JI1A 3H9SB 3TJHC 4NO3A 4Y4KA 3MNVB 5FYLL 3TEUA 1OCWL 3ULVH 5DD5H 2VLMD 2YC1A 1T2XA 3O3EA 4JO2L 2X10A 3DIFA 5SX5H 5TE4H 1U3HC 5E56A 4RCAA 2FHBA 3WS6C 5CJQH 1LK3L 4HWBA 1B2WL 4EDWL 4YUEL 3HI1A 4LVNC 1CYGA 2O93L 4GKNB 1MCJA 4UDTA 5DO2C 4P3WA 2D0FA 3PXJA 2IPTL 3LPWA 4KDVA 1J0ZA 4MJ5A 3BKJL 3FB5A 4O00A 2VITB 3H8NA 4X7FC 1PY9A 4JN1H 2EXYC 2JJSA 1LO5B 1RZIA 3BISA 3Q3GA 1HEZB 2R1WB 2VE6A 1DUZB 3KWWA 3OJ2C 2OP4H 2DICA 2FECL 4NJAH 3LKOA 4Z0XA 4PLOB 3I84A 2VXSH 5BOZG 4NQDB 4ZFFA 1I1AC 4OGZA 5CUSL 2EYTB 1RZKH 3T8XB 3FRUA 4KC3B 1NLBL 3RRQA 5IEHB 4X5XB 4XAWL 3IFOB 2BSRB 3GI8H 2HT2D 2APTA 1OSPH 3EFFA 43CAB 5DURB 5ADOH 5DFWH 5DT1L 5IB3A 4L8DB 3VA2C 4CMHB 1D6EB 1NANH 5T3XH 1X5ZA 1W0WB 4NKMB 1MCIA 3P4OA 4ZO6A 4E0RA 3MV8B 1HI6B 5JOEA 3NH7H 1T04B 1ZLVK 3W39A 1MCBA 1TITA 3FT3A 2KBGA 5HGHA 3IDNB 3STLA 4GKZB 1RVFL 1SBSH 4OQTH 3NN8A 5L7XL 1KBGL 1SYVA 5IB2A 4N0YH 5L2KB 3EOBA 3V95A 2BVPB 2VXUH 3GSRA 5ICXA 1BEYH 2PF6A 3C5SA 4OCSL 4QWWD 4P4KA 5B38B 4ZQKB 2ZJSH 2O5YL 4ZS6C 2YUZA 4JZOA 1J0KA 1PD6A 4M7LH 1RJLB 4PP2B 4TVPD 2P5WE 3DETC 2H32A 1JK8A 5DJ0B 1EBPA 3ILPB 4Y88A 1R3LA 3D85B 4NQDD 3PGCB 2VLKD 3V0WL 4GKOA 4HUWA 2A1WH 3IJSB 2YPVL 1PJ9A 1YQVL 2VN7A 3BDXA 4GG8A 3TO4A 4HWBH 4KJYA 3WLBA 2GITA 5HVWA 3M8OL 5J11C 3RVVC 3S36X 4JY5H 3MV7E 4PJCF 5JXAL 3O6FA 5CEZE 3NBNA 4CVZB 1CDJA 4MJIE 4M6AA 3RGVC 2CXKA 3JVGC 3VMPA 5EIIB 4DKEH 1ZT7A 3STBA 4FMKA 5HHMD 1I1AD 3CH1A 3O2DH 5EORL 4NHCH 3H7BA 1CK0H 1YJDH 4GRLD 4LHUB 4PRHA 4BSVA 1DQMH 3VXRE 5BVPH 5E2VL 4ETQA 1SYSB 1IJ9A 3B9KC 3L95A 5FIEA 3ARZA 4YZFF 1DJSA 3D1MC 2H3NB 4PJDB 4BK5A 5EOTB 1HDMB 2FZ3A 4EJ1C 4F33A 1T21A 1TJGL 2MMXA 3CFJB 1I7RA 4P2QE 4QYOB 4MA3B 4AK1A 1VGEH 5HHQB 1DEEB 3HMXH 2FDBP 1JGDA 1WF5A 4JFQA 1A5FH 4LKCA 4I0PA 2O5ZL 2HRPH 1PW3A 3V6OA 5CZVL 2ARWA 3FN0H 1CICA 3N9GH 2Q7NA 1A22B 2V17L 4WFFE 4LSDA 4TOYH 4JZJC 1PLGH 4PJHE 4K7PL 3DMMB 4X99A 2CXGA 2C3VA 4Y4FA 3L3HB 2F74B 4WUUE 1I3RA 2Z9TA 2CLZB 4G3YH 5BQ7B 5GZND 4U1IB 1JHTA 1OL0A 1K6QH 4G6KH 3OR7A 4XHQA 4DVBA 2VABB 4QRSA 2VDLH 4KY1L 2JJWA 3KLDA 4XGZA 4Q2ZA 2EIBA 5F97E 3TNNA 3AUVA 4KK9C 1IC7L 4FNLH 1WVZA 3DSNA 4KKBD 5GIRA 3OAZH 4C56B 2EYRB 2VAAA 3BUYB 3TP4A 4WUUD 4UOJA 1MRFH 4HT1H 4S1QL 3QEQE 4LLVB 3KPSA 5DRWA 1Q9LB 4CN1A 5DQJA 3AY4A 1YMME 4ZAKB 4LMQI 1R5IB 1WFNA 3FFDA 2E5EA 1NC2B 3GMPB 3WKML 1HQRA 2UZIH 4YDJB 4PRBB 4I0PD 4JJ5A 4XP9H 2R2BA 3IDIB 4Z7VF 4D0CB 3IXTB 3D69A 3H42L 4M02A 5IBUB 5M94B 5D1QA 1WTGT 2CO6B 3O9WD 3BYYA 5K9QI 3EYSH 5DUMH 2VYRE 5HHNA 2BOCB 1BQHA 1EAPB 5FDWA 5JORA 1I7ZB 1WWBX 2ICCA 3U7YH 4QY8A 1PFCA 1GPOL 3GJEB 2D31A 3OL2A 5L2KE 1HILB 3HRZB 3IFNH 3VXOA 3WHXB 5CEZH 4L3EE 4JFZL 2O26U 3TA3D 4GAYB 3TM6A 3V79C 4OD3L 4FQ1L 5T1DL 4Y1AA 3QUML 5HI4C 1XIWC 5T5NF 2J1KA 3TBWB 3LRGA 5L9DL 4OLUL 4R0LA 4KJPC 5IB5A 3MRNB 4MD4B 3S35X 2W0PA 3LKPA 1RZKL 1T22A 3PWPE 3MUJA 4U7KA 4RGNB 4CNIA 5DHVA 1MRCL 5CD5D 3D18A 1BHGA 2LABA 5GGTL 2XZZA 1XCTB 2EECA 1T6WA 2XZCH 3CFBB 2Z4QA 1EHLL 3EJZC 3LQAH 3PHSA 4JQIH 5TQ2L 1A7PH 5MEOB 4OZGB 4RWHA 4ORGA 4NGHH 5TE7H 1JF6A 2HP4A 4U49A 4ELME 4JLRB 3WS6A 2DKSA 2IMNA 4CVUA 4XTRC 3SGJC 5L88L 4LSUL 4XMLL 1QR4A 2F54A 2ITCB 2WIIA 4ODUB 1RJYA 1UZ8A 3OGOE 4JY6B 4YQXH 4CGTA 3DECA 1BIIA 4EQ3A 3HC4L 4U1NA 4XPGH 1NL0H 3F7RA 5DQDL 3FFCE 3L1OH 4XNMA 1QFOA 2IQAB 2QSCL 3RWCB 2P42B 2PO6B 5ACZB 3MRIA 2IQ9L 1MFEH 1RIHH 2LVEA 4UB0L 2YD9A 3ARFB 2ADIB 1KEGL 4NNXB 3BSZL 3D25A 3NCMA 4M43L 4IRSD 5JW4R 4FP8L 5C0JA 2YRLA 2AVGA 2HVJA 4N0FB 4L29A 1H5BB 3I3EA 1RK0B 1X5AA 3MV9E 4RZCB 4YK4C 5DGRA 1T3FA 3RNKB 4MJ2A 4XBEH 5HDQL 1ZE3C 5E8PB 4ZTOH 3VWKC 3O11A 3WO3B 1KXQE 3SGEH 5DVMA 1MAML 4NN7C 2FYYB 4NPYA 4OCWH 4MAYA 3G6JE 3MV7A 4OGYL 4LF3A 3PHQB 5FV2A 4G6MH 3VH8A 3REWA 5C0BD 1WBZA 1FGVL 2B5IB 2WUBH 2CK0L 1CTNA 2CJUH 4U1SB 1UQSA 3G6JB 2QR0B 1S9YA 43C9B 3WLWC 3QXVA 1ZWIB 3MXWH 4HWEH 4PJ8C 2GSGB 3MFFB 3NFSH 3K1DA 4KVNL 4N0UB 4MA7H 3QT2A 3BZEA 2P5WB 5E00A 1KJVB 4EIGB 4EIZC 2AK4D 3S37L 3DRTA 1BX2B 3V4UH 3D85D 5BZDA 2CH8A 1IGTA 2VZ1A 4DWHA 2NR6D 3QFDA 4WO4D 3V5DB 4M1CC 3WIIL 4ZFGL 2GSIA 5BVPL 4AQOA 3VWKD 3ECBB 5DMKA 2DKMA 1IGFL 2VXTH 3EZ8A 1VACA 5IG7B 7CGTA 1FFNB 1TVHB 3CPLB 5IQ7H 4P2QA 5EPMB 3HUJB 2F58H 1JRHL 3H0TA 1I1FA 4O4YH 2FL5A 1I9IH 1HN1A 4OM1H 5SWSD 3CU1A 2UWEF 4W4NA 5DRNB 3UDWA 2H1PL 1EFXA 3FO9A 1UCTA 1T7VA 4ZTPH 2ORBH 5CP7A 3T08A 3T4AB 1CDIA 1I9JH 4Y4FC 3RX8A 1CFNA 3C60D 2Y5TB 5ANMB 3IRZA 2J5LB 3Q5YA 1NMBL 1G7QA 1TQBB 3MCKA 1DBJL 3AB0B 1BZ7A 3FCTB 3T0BA 5KSAA 4H88L 4DTGL 5ICZA 3MLTB 5EU5B 4OKDA 3SY0A 4L4TA 4X6EA 4PTTA 2ZSWA 4HKXB 4CN6A 1BFVL 4G3YL 4Z76A 5I1IL 3CFEA 5HHOE 1S78D 1DL7L 1E28B 3MLVH 3SDXB 4MHHI 3W2DH 32C2B 3X14B 3M17B 1JPTH 4YGAB 3SCMC 4NQCB 3LKQB 3DYOA 4E9LA 1JNNL 1RUMH 2WUCH 3V4VH 4QT5A 4FQHA 3ET9F 4HF5H 5HYJB 3KPSE 1CG9B 1QKZH 4FZEL 3OTTA 3ARRA 3VWKA 4G8EA 3UX9B 4KI1A 3BHBA 1AQDB 4RGNC 5DRXB 1JGEA 5HHPA 2PR4L 1FVCB 1I1YA 4HJGB 1MJJA 3HMWH 2ADFH 1JZ4A 1XZ0B 4P9HL 3NCJL 2BY1A 3RJDA 1S9XA 5TQ0L 3WFZA 3RL2A 4YHPA 5ITBL 4I0PC 1MHHB 5B39A 4J12A 5INCB 5GZNC 1R5VB 4QTIH 4TUJB 1H0DB 3O2DA 5D7JB 3C60A 4HWZB 4D8PB 1IMHC 3O3DA 1KPVA 2R23A 4DK6A 1MCOH 4JRYE 5IMLB 1FYTE 1CD1A 4NNPH 4OZHE 3VRIA 4YDLC 3QWOA 4KQ3L 3ZLQC 2H9GB 1JF1A 4Q9QH 3B8SA 3VDAA 3KVQA 4BQ8A 2EDFA 1PAMA 2CLRA 3RJQB 2ICWA 2A0LD 1D7FA 4WEBH 4Y5VA 4MMZC 5GRZA 4K71C 3TH4T 1U58A 3MLWH 1XF4B 3VJ6B 4H0GA 2DQGL 4P2OD 4Y4HA 2CLVA 4F7TB 3U4BH 3FZUC 2Y07L 2DF3A 2W65B 5JXEC 3ULUF 2XTJC 3HZYA 1MUJA 3QFJD 4Z0BH 2UYLA 3PWPA 4OAWA 3PP3H 3RIFF 4L5FH 3IU3B 4OZIA 2OJZH 2GJZB 1FH5H 5TE4L 4QEGA 3HE6A 4YHNB 1BQUA 4L3CA 5MERB 4OZIF 3DVGA 4OCYL 4X6DE 5H37G 3IRPX 5D1ZD 3AU1A 4NRXA 4WO4B 1MFDH 2FX8L 5IVXA 1A0QL 1K5NB 5FK9A 3RVVD 3CVHH 5JHLL 4P59H 1IAMA 1RUQH 1T1ZB 4X9HA 2P7TA 5CKGA 5SX5K 5CEXB 5D2LF 2AK4B 2NY0B 3AC0A 1D6VH 3ZO0A 4WU7B 1OAXH 5F96H 2K7QA 3C08H 2KDGA 5GS3A 1R6VA 3RIFK 1G6RL 2W0KA 5AG8A 4WENB 4OUUB 4XPBH 2CKBH 3G6AA 1LEIA 2BNQE 2CRYA 4JFDE 4RMUA 3W9DA 3V5KA 5LXGL 5CUSH 4LAQH 1RIHL 3WSQL 1A6AA 2BP3A 4U3CA 3RI5K 3MRGB 4LP5A 4WV1A 4HJ0D 2VIRB 4HS6A 4YE4H 1P7QD 3HZKB 5D6DC 3MLUH 3QDME 5H2BB 2XWTB 5AD0B 4M8VA 1CCZA 4N8VG 2Z8VC 1JWMB 1RZFH 4P5KA 2BNUA 1TJHH 1CGSH 3CLFL 4R96A 2AJSH 3CK0L 4UT7H 2VDPH 2ATKB 1IEBB 3UTZA 3CSYA 4WFHD 1CZ8L 1Q9WB 2CIKB 4LLYA 5J6HA 3RAJL 2OL3B 2NXYC 3MODL 1WT5A 1DANU 3GSNH 5GISL 4U2YA 1FG2A 5GGVL 1JUFA 5JLZB 3HS0A 2DBJA 1MIEL 4RIRA 4GW5B 3T1FB 3TA3A 2Q8AH 3MV9B 3LS4L 5TDPB 1PGRB 1E4WL 4E42B 4IIQB 4L8BA 1JYXA 2DYPA 2Z8SA 4WFGD 3E8UL 3OR6A 2R29H 4Q58C 4FG6D 4HC1A 3NFNB 3CIQA 5E2WL 4B5EA 1MREL 5EU6E 4XNXL 3F6LA 3JXAA 3ROLB 3VXUB 3QDMA 5E5MB 3T1WA 4O2CB 3OXRB 3KYOB 4Y5YA 4TSCH 1UB6A 1X5LA 4OM1L 3GMRA 2OXHA 1QQDB 3I6KA 3X3FL 3MGTB 1FNAA 4RMQA 4AZ8A 4QO1A 1RFDL 1EJOH 2A0LC 3QXAB 2DMBA 4ELMB 5FGCE 4I1NB 5L8KB 5TFSL 2P24A 5DJDB 3JWOL 4IM8A 4R97C 4H1LB 1QBMH 5CFHA 1QFWH 3RWJA 1KB5B 5KS9B 5IEKA 6FABH 2EIDA 4MAUH 3ULVF 1HCFX 4I8DA 4NO0B 1QRKA 3PP3K 2DI8A 1KYOK 3A67H 1EO8L 1DQDL 2I60L 3RTQB 4Y19D 4LEXL 3D0VA 1A2YA 3E6FB 4CMMA 5IWLA 3F7QA 1XGQB 2BSTA 1KTDB 5HY9A 3QEUA 3DPBA 3MBXL 4ZNEA 3FQTA 5JQ6L 4HIHB 2GIYA 1G7PA 2GQHA 4JR9L 1GGBH 1P4BL 2R0LH 3CLEL 1XMWA 2V2TA 1IGYB 3WIHL 3VFOB 1JPTL 3CCHA 1AGEB 4HEPG 3L9RA 1ADQA 3GKWH 5F3HA 1NLDL 1EX0A 2ICES 4J1UB 2W07A 3DSFL 4U7MA 3L5HA 3GMNA 4QHLB 1IKFH 5T1LD 1S7XA 4JN2B 5E99L 3PWNA 5EO0A 4ZFZB 1O7VA 4R7DB 1EK3A 3SO3C 5E08H 5HHXH 3ALWA 4LIQE 1U8QA 3QCUL 1BVKB 4PG9A 1TVDA 1EMTH 3K7UA 2C1OB 4G8GE 2FATL 4G8IA 4DKAA 4DGIL 3ZDZF 3MRCA 1T66C 1D5BA 4JHAH 1U8KB 3I50L 5IM7B 1D5IL 4HBCH 4U1JA 3NCYP 4GQ9H 1TZIB 1XGUA 1U8OA 3KHOA 4XC1H 2H6PB 5IFHH 1GOFA 1GAFL 3LEXA 1BM3L 4NT6A 3TZVC 1EEUA 1YNTB 4Y4HC 4HG4J 4OZHF 3OKLA 2R2HA 4ZSOA 1KIPB 1S5HB 1EFQA 2ZOLB 3BI9X 3QDAA 4HDIB 4DOHE 4LVEA 4U1HA 1QD0A 4WFEE 3WV0A 5B21A 3BAEL 5LBSH 1RUPH 3U9PL 3WNMA 2CMRH 3F58H 4ACPA 4KPHL 1XH3A 2DQGH 3CH8A 1EBAA 3ARWA 1CGXA 4BSJA 1WFTA 5EOCH 3HPLB 2WSKA 4M9PA 5L7XH 1IGML 1ZXQA 3MUZ1 4F15B 1FL3A 1H8NA 3L6FA 3HE7A 3RA7H 4K9EL 3VXNB 4N5ED 1NUFA 4PP1D 3UZVB 3D39A 5IOPB 4PY7A 4GRLB 4C83B 4YFEA 2GK2A 1GZPB 2AK1H 3MRRA 4M6NL 1A6TB 4G6AC 4P46A 3PDGA 1Z3GH 2A2QT 2V2WA 3ULSB 2E3VA 4JO4L 5JZ7D 1PYWB 4WU5B 3MRBB 4YBLC 2NY4D 5CILL 2IAMB 2WBJD 3QDMD 4I4WB 4NQXB 4R8WH 1REIA 3BIKA 2V2XA 1VGKA 5HYSA 3TFKC 4PGEA 1TFHA 2QEJA 3M8OH 1CE1H 3MRLA 3PJSB 4PJ5E 1N59B 2IH1A 2XWBA 3BPCB 3C08L 1T0MB 1INEL 3T2OA 4KQ4L 35C8L 2CKBL 1IC5L 3RY6C 1FC1A 2ID5A 4WI6A 2W9DL 3WNOA 1YUHB 4YHZH 3LKSB 1T1XB 4BFBD 1H3GA 2IG2L 2ZUYA 5ALBL 3GSNB 5GGSY 1HYSC 1MAKA 5DVOA 1NUGA 1MVUA 5DJZB 1M05B 1PG7L 3SDDB 2AV7B 1UJ3B 2YK1L 5CJBA 5H94A 5HYFA 5KOMC 4OJFH 3MUGB 2VDOL 3AY4C 4HK0A 2VSDA 1OVZA 4D9QD 4JKKA 2EEBA 3SDAB 1A3LL 2LU7A 4R90H 2X7LB 4E41D 4DN3L 4HQQH 5HTSA 1A6PA 2AJSL 4LLMB 4R4FL 5LGKA 3HLAA 4ODSL 1IEHA 5IR1A 5D7LE 4RAVA 2Y06H 2D7TH 3RDTB 3QUYB 1HHGB 1OB1B 1P69B 1WWWX 1AR2A 4HMEA 1WBXA 5ESQA 3PDOB 4NUGL 5IGXH 3C9NA 1FC2D 5I8KL 1Q1JH 2MQ0A 4NNYB 2XYCA 4TUOB 2B20A 3BSZH 3VXRB 4QRPE 3BKML 1AJ7L 1KLGB 3MGOA 2UZXB 1O7SA 1MJUL 1TVBA 2E9BA 2DTML 2GW5A 5HI3D 3JTTB 5C9KA 3SGDI 5KVFH 1N4XL 3D3VE 2I5YH 3QUZB 4H20H 1R3HA 1MAMH 5C07B 1GGYA 1T89A 1FAIL 3SJVD 1MWAB 1INQB 1IGJA 3P3YA 4GW4A 4ZD3H 2M8XA 4LLWB 4KMTL 1DTUA 3T2NL 5IBLD 5JMRA 5DR5H 5I1EL 1XGRB 1S7RA 1RZGA 1G7MB 4AMKL 1AI1H 1Z5LB 2DM4A 4J3UA 1AXSB 4DW2L 1FO0L 4KTYA 3VFUA 3TN0A 4OB5H 5EZLA 3THMH 1DSFL 4GT7A 2A83A 3U6RA 1I4FB 4DEPB 1KB5H 1UB5A 1HYSD 5B3NA 5MI0B 2QBWA 4YFDB 1KV3A 3I02A 5FKAA 1LK2B 2E8ZA 3SOBL 2DL9A 2NTFA 4IRZL 3FO2B 5DD1L 5EUOB 4WTWA 3WNPA 3EDKA 4E41B 3OB0K 1NEZG 1U8IA 4JCMA 4L9LB 4WI9A 1TIUA 2GAZB 1VKXA 4GUPA 4NKDB 3O3AA 5JQ6H 5J8OA 3QG6A 5I1JL 2EE2A 2AS5M 2WWKO 3TIEA 1N6UA 4ODHH 1IT9L 4J8RA 1I7UA 2GJ6E 5I76A 3BFOA 1AGCB 3EYVA 3N50A 1ZT1A 5FUOL 5DD6B 5EC2A 4POZD 4QXTB 4I18C 4PRPA 5EZOL 4UTAH 4MB5A 5IMOB 4MS8D 5IHBA 2P8PA 2G5RA 1ZHNB 2OSLB 1CFQA 2QJDA 5E08L 2ED8A 2E7LC 5I8CB 3B9VA 2Y7QB 3V0VA 1EMTL 4ODTL 4X4XB 1MEXL 1S7SA 2PYFB 3U2SB 2BC4A 1J9CT 4L4TD 2XN9A 4BSWB 3C5ZA 3G5YB 1XCQB 4JO3L 4YZFE 1RULL 5LGJB 4PJ8A 1VEPA 3QH3A 4BFIB 1KENH 3IGAB 1JRHI 2C7UB 5K9KB 1GGCH 4YC2C 3OKMA 1GXEA 4XCFL 1JWUA 1K4DA 1MRCH 2CIIA 1B2WH 4HIJA 1EHAA 3MJ8A 1HWGB 2QQNH 1CTOA 1ND0B 3QXTA 5AUMB 2R1WA 2VE6B 5F71A 2W1NA 5A2KH 3BP4B 2MWCA 4RX4D 4U4BA 3GMOA 3KPOB 5DFTA 3I3DA 2R56L 2X4RA 4L9DA 4ZFFB 3KPPA 3C5JA 5FYJH 5EWIH 2J8UA 3GIZL 4ZOAA 1CL7L 3GZKA 4X5XA 5DFVD 2CKBB 4WHTB 3DNKA 3HI6H 2LAGB 3BKYH 3G6DL 8FABB 1T66D 5ADPL 4XPTH 3RA7L 4BKLA 2YD8A 3C6LC 1WEJH 4QXUH 4M03A 2AEQL 3QCTH 1W0WA 3VXMD 2W0FA 3QUXD 1JNLL 4KHXL 1EV2E 3S4SA 1FN4B 1LDPL 1HI6A 3JWOC 4MQXC 2DWEB 5DT1H 4YIQA 2IWGA 1IEAA 4JM2B 1Y0LA 3TNMA 4UNVA 5IHZA 5KAQG 5C70A 4Y5XC 5F1IA 1JPST 3STLB 3RL1A 2EEAA 5JHDE 3QRGL 1SYVB 3WFHA 1DVFB 4EN3D 1NSNH 4B7IA 1UC6A 3TZVA 3A6OA 4LAJH 5TE6L 3H7LA 1JTPA 5GRXG 2YPVH 1E4XL 1BBDH 1V3MA 5IK3B 3R8QA 1UEYA 3IF1B 4LIQH 4KQ4H 1FNGA 1JPSH 2AJYL 3W81A 1J0HA 1JK8B 2QKIA 4U1GC 4D0DB 2JJTC 4HLJA 5D1ZC 4LCIL 2R0ZH 2BVUA 5T5NG 3RP1A 1R3LB 3UTPD 5DK0B 1PEWA 4JFEB 4G8GB 1P4IL 1RZ8A 4KJQC 4OD2B 3HZMA 4Y4KD 4DKEL 3NA9L 3VW3H 2NZ9D 4MQXD 4IDJH 4LSRH 5I1GL 4KUZH 3FO1B 2XV6B 3AB0C 2YK1H 4KDTC 1NBYB 3ARQA 3QEGH 4K94C 3BGAA 4JFEE 3O45A 3NCCB 2I24N 4IOIB 3C5ZC 3L3OB 4HKJA 3EO1B 2F9BT 1FNSL 1YEEL 3L7FA 4HHAB 3DLQR 5EFIB 2B0SL 2VKWA 2X1QA 1UWGL 2F53B 3DX7A 3MYJB 3OX8A 1NCAH 3QIBC 2FLBT 1T83A 1D6VL 3QIBD 5FXCH 2B4CH 2XZQH 5IFJB 5C71A 5KANG 1AHWB 2PYED 4OF8A 5IB4A 4YHLL 2ENYA 2HN7B 4LHUA 4XX1E 2NY3D 5SWQA 4PRAA 4JFDA 5EN2B 4GS7C 5C0AD 3UTTA 2YMXL 3UTQA 5I6XC 3QIWB 5A16B 5B4MC 3JTSB 4LSTH 1BOGA 5C0GA 2P4AB 1AJ7H 3PWJA 3V7AE 3RZCA 4JKLA 3IJYB 4UQ3A 3SE3A 1PLGL 2DB8A 5DZOA 4AG4H 5T1KD 5J9PB 1BFOA 4PJHF 4DAGL 1J87A 3D39D 3VXUD 1UEMA 2A6JB 3WN5A 4I0PB 1KELL 15C8L 4JEGB 4OF7A 1YY8A 3PIQB 5D2NE 3QDJD 1CICB 4PGBB 5GGUA 4TTDC 1BBJB 1DN0B 4OLXH 4Y19B 3C6SA 1OD9A 4MJ6B 4JPIB 4XCCH 3TYGH 5EOQL 3DMMA 2ZCKL 1A5FL 1UM5H 4YDIH 1FSKB 3F5WB 4TYUA 4OBRA 1CLOH 3S3SA 5E94B 5I1LB 3BQUA 2FWOA 3L3KB 1KFAL 4QF1B 4X80H 5ID0B 5AG9A 2VABA 4CDGC 2PO6D 2CRMA 3L5IA 1L7IH 5BZWB 4Z8FH 2Y1VA 4FTVA 4HUNB 5C07E 4M6MH 1X6NA 3MMEA 2BVQA 3RNQA 5FOJA 2EH7H 4GLRH 1L7TL 4C56A 4FXKA 4LBEB 2VAAB 4M61A 1XGPA 4XP4L 4CMHC 3BEWA 1ORQB 1NKOA 4ZFOB 2QQKH 4LNVA 2LV4A 3NCFB 4PJCA 3NCYS 5CSZA 1FZJB 4KQ3H 4MXQC 1QPPA 2DQEH 3IAQA 5C0CE 5T33L 1JGUH 1KXTB 1N8ZA 1RU9L 4J4PA 3ULUL 1CDGA 2NNAA 3P4MB 1U93B 4LP4A 3OAUH 1A7QL 4PJAF 4ZPVB 2P46B 1R5IA 1MQKH 2DJSA 5KOVC 1JP5A 1FZMA 1NC2A 1A9EA 3GMPA 4WEBL 3GHEL 2NY6C 3PQYB 5I74B 4N9GB 4PRBA 2HT3C 1QSEB 4W68A 4PRIB 1Q72H 4JJ5B 4Z7NF 2G75A 2GTWA 5DO2D 2A6KB 5HGGS 4JPWH 1EXUA 4FQJH 5EUKA 5SWZB 3WIFA 1F58H 4BZYA 2JF1A 2X4TB 4NN5C 2HG5A 3VXQA 5IJVB 3J8F7 1NAML 4PJ5D 3SHSA 5BVJA 1LO4L 4X9BA 5JORB 4CADB 3L3JB 1HSAA 1I7ZA 3OGCA 2WAHA 4LHUD 5HI3C 3ILQD 2W60A 3BE1L 4PJHB 5IW6B 5SX4I 4FFWC 4PJFB 1N0LA 4WUKH 4NWTL 5ALCH 4A6YH 1LO2H 1ZT4A 5E5RB 3GKWL 5F6IB 2I25N 4Q7DA 1Q8MA 9CGTA 5ITFA 3TT3L 2WM0A 1C08A 1P4LA 3RQ3A 1C7TA 5IB5B 2CO7B 3T0VA 3LKPB 4Y5YC 3CSBA 4OZHB 5DTFB 2GTZB 2XWJA 3RIAF 1H3TA 4XP5L 2IANB 3EKCA 3OZ9H 3U4AA 4DN4H 3NPZB 1HSBB 4OV5B 2H8PA 3Q2CA 4JGUA 3K81A 3BGFC 5TPWL 3CFBA 2O5XL 4PJ9A 3GSXB 2Z4QB 2ZUSA 1F3JA 3V8CA 3I50H 5I8OL 3LV3B 1DE4B 4LAQL 3BIBX 2GFBA 3QIBB 3MRHB 3TVMA 3KPMA 4XPAL 3ZSTA 4XC1L 4LSPH 5AAWA 4YR6B 3BWAA 1J7VR 4OSUH 5EBLA 5EDXA 3LDBB 1UJTA 4NHUA 1ZHKA 1MCLA 1MNUH 1ZHBB 1NEUA 5DD0H 1KN2L 4PJGF 1WCQA 4P0DA 4OZ4B 5HVHB 2RCSH 1KCRH 5CIPA 5F7YC 1BQLL 5KJRL 1JYVA 1UVQB 2YD2A 1YEFL 2V7HA 1F11A 2HFGH 3BAEH 2C3HA 3DUSA 3CFCH 4ZUWA 5AYQA 4XNQB 4X8JB 3ZT7A 5C0JB 4P2OB 3BP6A 5IVNA 1KPUA 2W9EH 3DGGA 3HTLX 3MNWB 1ZA6B 4H0HB 2GJJA 1FNFA 5TF1H 1IZJA 2ZNXA 5HI5C 5LCVH 2CK2A 3MXWL 2OBGA 5DD3L 3NACH 5EC1A 4DZBA 3F12B 5BRZE 3GUTB 3DXAD 4Z7QF 8CGTA 4WWKC 1VADA 1WZ1H 2FSEA 5DHYA 4KUZL 4K23H 5D2NB 3QWRD 3REWB 4K3HA 5C2UB 3WEXA 1FAKT 1NDMA 1HHKA 3IJHA 4ZOCA 4C58B 3CMGA 3QEHA 3QSKB 1QFWI 3PWLB 3IDYB 3S96B 1PKQA 5DMJB 1FPTL 2NLJA 3G9VA 4B53A 5A2IH 4TNWF 1JYWA 2FRGP 2H2PC 2P5WA 2VLJA 3BPOB 3UTSA 4Q0XL 1K2DB 4ZXBC 1U6AH 3SE3C 1F6AA 3CJJA 1J05B 4ERSH 4ZFOL 5JXAH 2NW3A 3SQOL 4NKQB 5IG7A 3BW9B 2EDKA 2EE9A 2XG4A 5IV2A 2X41A 2NY0D 1ZVYA 1CI5A 3EJZD 4X6DF 4HMCA 4B50A 5AEAA 4BUGA 1EFXB 3FO9B 2MPAH 5IBTL 4NCC1 1NGXA 2Z0BA 5JZ7C 1IGFH 5F9JA 3UBXG 1BQHG 5C9JA 2ADJA 2VLLA 2YR3A 4PJBE 1YEJH 1ETZA 5D8JL 1BVLA 3VFSB 5JIHA 4ENEC 5ESAA 3LEYL 1ZS8A 3WE6B 5HYQA 2ATPA 1BZ7B 2EDDA 3FCTA 3LIZL 5ICZB 1CWVA 1NLDH 4L4TB 5EZIL 1MQ8A 1H3PH 1VGEL 4XCCL 2GK0B 2KQMA 2Z31D 4YUEH 1T5XB 3TYGL 4MQTB 2GKIA 5DVKA 5I1KL 3QA3A 2DIJA 2Y36L 3Q1SL 4NZUH 2G9HA 1P84K 1E4JA 2A9NL 5JA8B 3BKCH 3GGWA 1R3JB 4G80B 4MHHG 4YGVA 4EDWH 2A74A 1S9KC 1ONQA 3SDCD 2R1XA 2BDNH 2I27N 3CSGA 2XXCB 4JPVH 4WHYG 32C2A 4HSQA 5TH2B 3BGMA 1ZLWH 3EYQD 3LKQA 2AJUH 3HPJA 1KJ2L 3CX5J 4J2XA 3ES6B 3QO0A 1OTSC 3O3UN 1N4XH 1UXSA 2R4RH 2R2EA 4FQHB 5DJAB 5D1XB 1QOKA 4J7RA 4CJ1A 4DFIA 2HAZA 3PWUB 4F15C 2AXFB 3H9HB 3RZCC 2N7BA 4YNYB 3BHBB 4HPOH 4G43A 4L8SC 4NZJA 1G9MH 3VDBA 2NYYD 4WWKA 3ZKNC 3L7EA 4Z78B 1MOEA 1EFXD 1SJEA 1PBYA 1JGUL 1RU9H 2VXSL 4JRXD 1WISA 3W9EB 1DBKL 1C7SA 3PV6A 3AXLB 4P48A 5C08B 4YO0A 1LE5A 2VDNH 3R06B 4YXHH 2XFXA 4OFKA 3GSUA 2DDQH 2JK5A 1J88A 1Q0XH 1FL6B 4CL7A 1GGIH 2VAJA 1F58L 4MNQD 3O8XA 2IALB 3OF6A 4JZJA 1IQWL 3SKJH 3P30H 5EO1A 4ZYKA 1HKLH 4UBDC 2CLRB 2DI7A 4JREC 2V9RA 4NNPL 4ODVH 3MLYL 1BEYL 1BF8A 3T0EC 2FHFA 3S36L 4CW1B 1YPZF 2OJZL 2Z35B 1PSKH 4LPCA 3DXAA 3MRMA 1H3UA 4JO1L 5DJ6B 3I75A 5E2TH 1I75A 3OKNA 2FD6L 4Y2DA 2VXUL 1LO0H 3N1QC 4RQQB 1MFDL 3IU4H 5DJXA 1TZGL 4OZIB 1KG0A 1OP3K 1CE1L 4JKPL 1T4KA 2QADB 3BN9C 4XP5H 4Y2OA 2OR9L 1DP0A 5FA4B 3O3BA 5MP6L 1KGCD 4UMGA 5E8NA 1EAJA 5LAXB 5B3JE 2AK4E 1ES0A 1N5YL 1D5ZB 3HE7D 3WUWB 3SKNA 5E9DB 1YQVH 1RJZA 2RHEA 3P0YL 4NC1C 1UZ6F 2X9YA 5DVNA 1KJ3L 1Q38A 1HXYB 4LPUA 3IDXH 3VMNA 5MEQB 1N3NA 3G5XB 4NQSA 4KDWA 1HCVA 4Z7UA 3LVEA 1XGYL 3WFDH 5DQ9B 1CIDA 3X13A 4HS3A 2J88L 3M1BA 1D5MB 3ABZA 3MFGB 2HKFH 3G6AB 3VXTA 5C0CB 1NCWH 4M5YH 1QRNB 4ZAKD 1GIGL 1WWCA 2IGFH 3IDUA 5IIEA 3TPUA 3QISA 2FR4B 3BESR 4PLJC 3I6GA 4L8SA 3GIZH 2BY2A 1CDHA 4MQ7B 3IETB 3BH9B 2Z8RA 3NOIA 3QR2A 3S37X 4AIXA 3BEVB 2FJGA 4UTBL 3S35H 4JRYA 2HVKA 4S1RL 4UILL 3TV3L 1FL5B 1MCWW 3PG2A 1A6ZA 2BNUB 5DD3H 1T20A 3MRJB 3HE7C 4Y16A 2CUHA 1K3IA 2FX9H 3WFEH 5BV7H 1MJUH 3HAEB 4WIQA 3S98A 1Q9WA 1KPRA 4IS6B 4K23L 5EU3A 3PUCA 1KN4H 2OL3A 2ZPKH 4HUXB 5FFLA 4NBZB 1AGBA 1Q94B 3QG7H 1U3YA 2VLJE 2RGSA 5F7NC 1RUAH 3AS3A 4GW5A 1CGUA 3EHBC 4HFWB 1GH7A 1VFUA 4NQED 3OXSB 2IBBA 4Q0XH 4YHIB 4E42A 2DIAA 1KCKA 2FH6A 4XT1C 3X3FH 3OR6B 3VXUE 4Y2DC 3GHBH 2CK0H 1WBYB 1WICA 1NJ9B 5IF0A 3VFVA 5T3XE 1E27A 5FM5M 3C8DA 2E7HA 1R5WB 2A6IA 3SQOH 1F4XL 4LVNB 5HGAA 5JW4Q 2EYSB 2XNAA 1Y6KR 4IRSA 5F21B 3UROR 2LU3A 4JZNA 4QOKD 3DX9B 3VRJA 2YD5A 1WIUA 4NZRH 1CFBA 1DUYB 1QEWB 3GSWB 4X7CC 3BRGC 3TJHD 4C59B 1E4KC 5DUBA 1J10A 2VXTL 5I17A 1QSZA 1OF2B 3C6LA 4LNRA 2F54D 3K4AA 2G60L 4PJAB 4ODHL 2B4CL 2XZQL 3U79A 1QBBA 3DTXB 3VD9A 4BQ6A 4XH2B 3TGXA 5H8DA 3W0WB 4YPGB 4NZTH 4KZDL 3W11C 2YUVA 4S1DD 3KPNB 1QR1B 5ILTL 4JFXB 1CFVL 1U92A 2J8HA 1DFBL 4MAUL 1GPOH 4GRWE 2F5BL 3EYOB 1PZ5A 4X0KB 3KNBB 1CFSB 3HB3D 1VESA 3ME0A 1G0DA 2ENSA 5IFAL 4HIHA 1NMBH 1IM9D 5DUML 1H3VA 2OTWB 5IP4A 1IGYA 4KRPC 1B0GB 1N0XL 4HEME 1TTFA 5KTEL 1AGEA 4OGAD 5D1QD 5FYLH 3QZWG 4OZFG 3WHE0 3QNZA 3HA0A 5D5MA 3LOWA 5L9DH 3SN6N 2GUOA 1GGCL 2VO5A 2YD3A 3WMSA 4ZFZA 3T3PE 3VFMB 2VXQL 3LN4A 2AERT 1O0VA 2C3GA 1AO7D 2P1YA 5B8CB 1LK3H 4K07A 4OT1L 5I18H 5T1MA 1H8SA 4NQVA 4JO2H 3IKCB 3MLZL 4UT6H 4NC0B 3UJTH 5IM7A 5JW5A 1J1XH 2YPLB 2DQFB 3OKKB 2ZG1A 3IDMB 4XRCB 4UT9L 3SDCC 1OAZL 3FQXB 5FHAL 2OJEA 4RMTA 4LSUH 4PB0H 5DEFA 4R3SA 2B4CC 3MA9H 3MX0A 4G5ZH 4LPVA 2PTVA 4OZGE 3OKLB 2QTEA 4H0IA 3BPLC 1F6LL 4PJXF 4L1HA 3SE9L 1HHHA 4PRID 5E2JA 5IKCA 4EI5C 5J11B 3O9WA 2ZOKA 2X42A 4LEOB 4K9EH 2HWZH 2MJWA 2AJ3B 1IZKA 3HC4H 4FMFA 5C8JB 4ENED 2DBLL 1G6RA 3ULUH 4F8QA 4KXZI 4PJDE 5ADOL 4IRJA 1KEGH 4L8CA 3P73A 4FP8H 4ZTOL 1TZGH 4PJXB 1CD8A 3HE7B 3S5LB 3NGBB 4KPHH 3VXPA 1SY6A 2IH3A 1FVDA 1X4YA 3LKNA 2NY5L 2NY0C 4QHUB 3U0TB 1OW0C 4GRLA 4QXWA 2D2OA 3EO9H 1JPGB 4P5TB 3X3GL 1GZPA 1VPOL 4OCRH 2JJUA 3QIUB 1QNZL 1J5OL 1KXVC 4HIXH 2P8MB 3VDCA 4OIIH 4EI6A 1NGWB 5GRUH 3VGFA 5GS1C 4G8FB 3NA9H 5I1AA 5LQBL 4M6NH 3GO1H 3QIWC 4BK4A 4Z7VE 5DDHB 3JWDH 4N0YL 4GRMB 2VISA 4M7LL 5D7KD 1A7RL 3CVHB 4PGDA 2YBRB 3FB6B 2CDFA 4GLRI 2D0HA 5A1AA 1HIML 4JM2D 4HCRH 4NO2B 4PRDB 4HS8L 3KLAB 1A3LH 4R90L 1I9IL 2R0KH 3IFLL 1HWHB 4BQ9A 1S8DB 2VLME 4U6YA 4ZUSB 1XR9A 2NX5B 3K2MC 3NZ8A 3U30B 1LGVA 1IKNC 3WJLC 4HK3N 1TJIL 5E24E 2G5BA 1MCPH 3RWGA 4YHML 3I3BA 4G6JH 4XB8A 5I16A 3B6SA 4OUOA 4PLKD 3B9KA 5CS7A 4UIMB 3QWQB 3N1GC 3QHFH 1JPFA 4PJ8D 5KANI 1JN6B 1QSFB 2NY5C 5EO9A 2CRZA 4PJ7A 5ANME 1KN2H 3EOAA 4A6YA 1OB1A 1ZLSL 3QNYA 3BPNB 3MO1A 3W0WE 4H88H 4PJ7F 4OLYH 1CE6B 5KVDL 3UTOA 3B9EA 3VXMA 5DEGB 1TJHL 4UT7L 2I07A 4H25B 4AENA 2VQTA 4PJGB 4C57C 1ZVHA 1CLZH 3UO1L 1TVBB 2DLFH 2P8LA 5HGBA 5HHOB 1ED3A 5I30H 4OCXL 3MBEB 1KC5H 4JDVA 5JO5A 3X12B 3HAEH 3C09B 1L7IL 1VHPA 4G42A 4TOYL 3WS3A 2JCCB 4QRRB 3D87B 2BCKA 1ADQL 2DTMH 1T80A 4WV1C 3RZWA 3KYKH 1FGNL 5E2WH 1NMCB 2EH8L 4HJJH 4HUUB 1G7MA 3F7YB 1JGLH 3GEWB 3VXSB 4IRZH 1P2CB 1FAIH 1G6VK 1DQQB 2NY6D 3DURA 1VCAA 3VFUB 2HKHL 3UTSE 4ALAH 4X4MA 5CIPH 1I4FA 2DD8H 1QTYT 4X7DC 4E41E 4EN3B 1MF2H 2H2SC 2NXZB 3L3GA 1A4JA 4N0CC 2J7LA 3VGBA 3I02B 5FKAB 3P2TA 2Q6WA 4QRTA 3W5MA 3F8UB 2NTFB 3FO2A 4G7YL 3MYZA 3S8WA 4KRPD 2WP3O 5H37H 1JFQL 2UWEB 5DJYB 3MNVA 4UTAL 4NKDA 1I8IB 5DA4A 2FJFA 4NFCA 1XF1A 3VFPB 3UC0H 2MPAL 5IBTH 1HOCA 4Q74A 3VGEA 1OGAD 1A1MB 4FQQA 3CZJA 5K59F 3I85A 5D71H 1T1WA 3HI1B 1IAIH 4TSAH 1YEGL 1RULH 4WY7L 3AROA 3TBVB 4P5TC 1CFQB 4HC1L 4TSBH 1P9MA 3U1SH 5IESH 1W8OA 4P2RE 1DR9A 3QIUC 1JL8A 4MAYD 3UTTE 2BMKB 3FQUB 3QUZD 3S88H 5JHLH 1A02N 1I7TA 4OF5A 1B0RA 4UOW1 3KWWB 4WEMB 4KH2A 3QH3B 3FFCD 4BFIA 3HG1D 4JDZA 2YXFA 4ODXB 1LNUB 2I26N 3BRDA 3WNLA 4QRUB 3CVHL 3T8XA 2HFFA 3GDBA 4HIJB 4X4YA 1BPVA 2YA0A 5EWIL 1CT8B 3QUMH 2A1WL 4ZUVB 1GHFH 1FZOB 3VWJB 3MBED 2FJHB 4EDXB 1IAOB 2GCYB 4H8WC 2JCCE 4QRRE 2DRUA 4GQPH 3PQYE 5DLML 3GMOB 4FXGB 1YPZA 3WSQH 1TLKA 1NMAH 2X09A 3KXFD 4GRWH 4J3SA 4PTUB 4QXGH 5C09E 3TVMD 4Q9BA 4MNGA 2FIKB 3QPXH 5FM5O 2LQRA 4NC2B 4NKMA 3P4OB 1Y6NR 2YN3A 2ERJC 3T77A 1YEDA 4D0BA 1IL1B 1KLUB 4PLNC 1QO3A 1YMMD 5D2NC 3GRWA 3OJDB 3U46B 4X7EC 2FEEL 3CK0H 4WHYH 5DHVH 3OAYH 4BKLB 5FYJU 3IDYC 1U9KA 3MXVH 1V8HA 3O6KH 3FOMB 4BYHA 2A38A 3LQMA 5KVGL 5B38A 3LEVL 5L6YH 4NGHL 5TE7L 2W9EL 3CDGA 3GB7A 3CLFH 3ZHDA 1LEKA 1TDQA 3G04B 4LSQL 2GT9B 3GJFB 4PP2A 5GRUL 5HGDA 5K9OA 1FDLH 3F6IA 3ZE1E 1TCMA 4MVBC 4C4KO 1AGFA 5DC4B 1W72A 5HYJD 1HH9A 5C09A 1U2CA 3VW3L 2FD6H 2MKWA 2XY1A 1UJ3C 1YECL 2X5PA 3V4PL 3IF1A 4KUCF 4X98A 4WJ5A 2ZUQB 3IB4A 5E0QA 4LVOC 4Z18A 3TCXA 4D0DA 2PW2B 3K3QA 2NZ9C 4TSCL 4U1MA 1RZ8B 1ZOXA 4J6RH 4FZ8H 5INDB 5HD8D 4XBEL 5MI0C 2F54E 3BDYL 3VD7A 1RFDH 2AI0L 3RDTC 4UQ2B 4HWEL 4XCYB 3ZHLA 4ETQB 4Z7WA 1BLNA 3R8BB 1FGVH 4LQFL 2H26B 3OKEA 3LKRA 4Z7WF 4LSTL 1WUNT 4EN3C 1V05A 4UDUB 2Q7YB 5FGCB 5A2FA 4LEXH 4CU6A 3WIIH 2DM2A 3AFLA 1J1PL 3B3IA 5HHQA 4A2MA 4BUHA 1KTLB 2BVOA 3I6LD 3UTQB 1I8LC 1U42A 1I8MB 5FKPB 1WK0A 5FF6B 4LKCB 1NKRA 3IDJA 3GMQB 3HFMH 1UH2A 3IDGA 4ODSH 2Y25A 1MH5B 1NC4A 4F3FB 3T65A 7FABH 5T1LA 1JRHH 3C2SA 1OCWH 1U8PA 2Y36H 3IJYA 5FO9B 2B1HL 4YEFA 4OLVH 4TNVF 1ZSDA 1GGBL 5J9PA 3DO7A 4X99B 2H1PH 2C3VB 2EKSB 3K1KC 3DX6B 5TDNA 3Q6FA 5F7UA 2R1YB 4XWOD 5I19L 1JHTB 2BDNL 4DVBB 3NZHL 4LRNH 5D2LE 4GSDL 3PABB 1YEHH 4XGZB 3UBXB 1R24A 3D9AH 5GGUB 5FB8B 3E3QC 1BBJA 5GRVL 2DTSA 4ONFH 3AREC 1QVOA 4BZ2L 4PJGE 1ZANL 4DGIH 1C16A 2VSCA 3SCMA 2MHAB 1EHNA 4YFLF 3ZTNH 2YD7A 3SDXE 3Q0HA 1J86A 3BQUB 2ESVD 3CFDB 3BUYA 1U8LB 5IMMB 3RGVA 1E4XI 5FOBB 4RDQG 1ODAA 1X9QA 4IOSD 1SM3H 2DM3A 5KSAC 1OP9A 1OARL 3MROB 1H9VA 3LRSB 4X7SL 1BZ9B 3S9DB 1YQ2A 3BN9D 3QB7C 2VC2H 4LCUB 3MMEB 1KIRB 4JFDD 1M7DA 1PG7X 1YYML 4PJIE 1CFTB 2EXYD 4XZUA 2DOCA 3QPQD 5D7LB 1EHLH 3HI5L 1ACYL 1T1YB 1VDGA 4TNWK 1HHJA 3O41A 3CX2A 1KOAA 4HUVA 3DVFA 4UU9A 5D1QB 1N8ZB 3AS1A 2HFTA 3MRDA 4N8VA 2FLRT 4POUB 3ZSSA 4Q9RH 5FV1L 5FDWB 2AEPH 4ZO7A 5J1TC 1A9EB 3CZFB 4YXKH 3S36H 2A6DB 4PRIA 1N5AB 2CKNA 5CMAA 2X4OB 3GJEA 4V2BA 5SWZA 3T0DA 5GJSL 3WHXA 3UMTA 3KLSA 2J2ZA 2HG5B 1JHKH 1U3HA 1EDQA 3VXQB 5IJVA 4TVPL 5J1AB 4N5UA 3V6OE 1N64H 4EVNA 4IHOB 3QDGD 4JPWL 4B0MM 1NEZA 4LARH 4ONOA 5C0AA 2V5RA 1KF9B 5IW6A 5HJ3A 4PJFA 1OAKH 5ECJE 1T22B 4RISL 4ZUTB 3PXHA 1N5YH 3KJ4C 5DHVB 1R3IL 4XBGB 2ARJB 1LP9A 3PGFL 4NQTA 5HSFA 1RSFA 1Z0MA 1NANI 3VFRB 4J3TA 4GG6A 2PTTA 4WW1A 5T1KA 2IFFL 5CHNB 4WUKL 5ALCL 3ZDXE 2V7NB 3T09A 4Y16D 1TETL 3QDGE 4RAUB 3O2VH 4IJ3C 3A6CL 5FECA 3I2CH 4OZHA 3HNVL 2XWJB 1IC5H 3VXSE 3OKOB 1FH5L 1OGAA 2XQBH 5EUOF 3QDGB 2F54B 5ALBH 1F3JB 3LV3A 5IMKA 1Q9OA 1BIIB 4JJHA 2GFBB 2R9HC 4XNMB 4M5ZH 3S6CA 1A0QH 1NFDA 3BWAB 3O6KL 1RZJL 3CVIL 4NNXA 1FYTD 1YMMA 4C56E 2NY2C 4M7JL 4X6BB 4LSVL 4GBXB 1ZHBA 1OWWA 1OP5K 4MNQB 4L29B 4PJCE 3TIDB 2APFA 3K80A 4NUGH 4OSUL 2QHLA 1CF8H 1T3FB 3VFGH 5GPRA 5EU7C 3OBAA 1KJMA 4NZDA 2CSPA 4P3CL 1RV6X 2VDRH 3EZJB 1SJHB 5DSCA 4LF3B 5AAMA 1F2QA 4Z7QE 1Q1JL 3DGGB 3ARDA 4XMKL 1CIUA 4XX1G 2BZDA 3MACL 4RA0C 3H9SD 5I0DA 1S9YB 43C9A 4W81A 1XR8B 5IHUH 3TYFA 4P4KC 3MODH 1TJGH 1E4XH 4PYHA 3T2NH 4M9OA 2JIXB 2X4UB 4HZLA 4LDLB 4JRYD 1MIEH 3N06B 4HIEA 4MSWB 5BZDB 4K9EC 3O4LD 5BS0B 1U3ZA 1P7KA 4GS7B 4ZD3L 3UTTD 1WITA 1U8HB 3LS4H 4U3HA 1HQ4A 3U7WH 3HE6D 4Z7OF 1JWSB 4Z77B 3TFKD 1TVHA 1YC8A 3CPLA 2VLJB 4FZEH 2QADD 2C3XA 4G9DA 1K2DA 5F3BB 4U6VL 2CRIA 1IILE 5KSAD 1HNGA 2JB6B 4APQC 3KPQB 4K7PH 4LCWE 4N9OB 5JIIA 4N68A 4HCRL 1KIQB 1NCDH 4NWUL 2Y5TA 5T3ZE 1U8MA 3WDJA 1GC1H 4AJ0A 2EDHA 4PJBF 1YMHA 2IFGA 3TN0D 4QTIL 2LE9A 1A7OL 4DGVL 3N0PB 3AGVA 4WDIA 3NCBB 4E5XA 3QHZL 4OGAC 5D1QC 2Z91A 2QHRL 2NY4C 4LLUB 4UV7H 4NN5B 2Z93B 3QUXB 1TJIH 2OYPA 5I1JH 3ULVC 3MCLH 4B41A 4I48B 3QEQB 3HC3H 3RX5A 3JV5A 2PXYC 3VFSA 3CFEB 3QHFL 1X7QA 4KJPD 5BW7A 4S1SL 1CXLA 4OQ1A 3WE6A 5FCUH 1JNJA 4P57A 3B5HA 1YEHL 3F7VA 5A40E 4Y16C 3DIFB 5BJTA 4LHJB 4NC1E 3RU8L 1IVLA 3BO8A 5E03A 5A2JH 4HKZB 5D8JH 2BSSB 1ZANH 3TCLA 5GSRB 5TDOA 1FIGL 1OPGL 3MOAH 2QQLL 3A67L 3QEQD 5KVDH 3MBXH 3EOYG 4DZ8B 1PX3A 4P9ML 5HYJA 3GGWB 1NAKH 1BFTA 1R3JA 4GKNA 3REVA 1FE8H 1JGEB 3UO1H 4DKFH 4HJGA 3DSFH 4MD5A 1I8KA 2MSPA 2ZCKH 1C12A 2HJFA 3QQ9D 4OCYH 5EBMB 2A73A 3DROB 5BRZA 4X6CF 1DUZA 5FYLE 2Z31A 4HBQA 5FYKH 4PRHE 4B7LA 1OHQA 2FX7H 4FQLL 3LQAL 5C2BH 1A7BA 1F02I 3ZE2F 2ZWLT 4FQ1H 5T1DH 5JHDD 4X4ME 3C8HA 1L7TH 4C55A 5C08A 4ALAL 1J18A 1XIWB 1LE5B 1V7MH 2EO9A 4XPHH 4HWNA 5JW3L 3R06A 3PGDB 2IPKA 3NPSB 4G7VL 1D6EA 4GAJH 4Y5VB 2YXMA 2C1PA 2VQ1A 5F72S 1XF4A 3NA4A 4YH6A 4JO1H 5DS8B 4F7TA 4JZJB 4R4BA 3VXSD 1UT9A 3HZYB 3RVTD 3SE8L 5CZKA 5EO1B 3WIHA 2AKRB 1E6OL 5MEND 4RRPA 3FJTA 1NSNL 3ARSA 3EOBB 1ZLWK 3D0LA 2DQHH 2Z35A 4OI8A 3FN3A 3OKDA 1KSRA 3MRMB 3C5SB 1OT2A 4D3CL 3FFCA 3DGCR 1WV7T 2Y9RT 4JZOB 1FYTB 5CP3H 5EH1A 4WTZG 1K5NA 2ZUWA 4L3ED 3O2WL 2E7MA 3SJVE 1OGAE 3MV8D 3QULB 1UM4H 4H8WL 4HWUA 5C08E 4S0TD 3ILPA 3ARFC 1RVFH 4RMVA 4LCYA 5CWSA 5F6HI 3KYNB 4YAQB 1JZ2A 4HUWB 5E4EC 2VQUA 3SJVB 5J4MA 2GI7A 2BERA 4MJIB 4KJYB 3DX8B 3WLBB 5HD8C 1H5BC 3WUWA 3SKNB 5F1NB 1U95A 1NCAL 4JFPA 1LEIB 2J8UF 4XNXH 3R1GL 4NQCE 1A1OA 5AYUH 1N7ML 1RZJH 2EDJA 5MEQA 5F44A 4KU1A 1A6UL 1A9BB 3S34L 5F1SA 3RPIA 4G9FD 5KW9L 4RMRA 3H7BB 2OZ4H 5CJ5A 1S7TB 2XA3A 1T03L 2CJUL 5GRWA 3SGJA 4LGSB 4XCEB 5DMYA 5L2JB 2APXA 1X5FA 1OAUL 2YSSA 3HR5A 3QPXL 1FBIL 1AD0A 3ARGA 5MEPB 2ATKA 5I71B 3TBTA 1QFWL 3CSYB 1HDMA 4PD4K 4U1LA 4HKBA 4P5MA 3RVUC 1WC7B 3AMLA 4Y1AD 4OV6F 4K7FA 4FFVD 3TJEH 1I7RB 3BVNA 4XMKH 3ZTJH 1JBJA 4TRPH 1A4KA 1JUFB 1DEEA 2V5TA 1AQKH 5F89B 1RZ7L 3BX7C 2O61A 5H35B 1T20B 4GOSA 5A3ID 5E2VH 4Y16B 1MI5E 3NABH 4PV8B 4XAKD 2EDYA 1G7LB 5I1CH 5CGYC 4YXLL 4O9HH 1G7HB 3F7PC 4EZMA 3S35L 4L8BB 4OCXH 4QOKB 4XXDA 4APQA 3LHPL 3NFNA 3E2HB 2BHZA 2NXZC 1I9JL 2Q86A 2D7TL 1UCBH 1RUKL 2B7DT 5KVMC 3VXUA 5EOQH 1I3RB 4I18B 4DKDC 2YPLD 3OXSA 4LCWA 3GK8H 3RVUD 1UB6B 1CLYL 1AKJA 1DBJH 2YWZA 3HNSL 4PJDF 2R8SL 2CUIA 1QKZL 3MGTA 4ELMF 1RAMA 4KJQD 3UJIL 5I2IA 5LJYH 3QXAA 1WBYA 2V17H 4XC3H 2JIXD 1E27B 3FT4B 4MD0A 5ISZA 4CVXA 1MIMH 1VB9A 1CBVH 3HCVB 4FQCL 1X6LA 2BNQD 1D5IH 4HBCL 1TZHB 4HLZG 3FKUS 4HD9A 2PUQT 4XNUL 2Y23A 3ARDC 3KPSB 3SDDD 2OTUB 5I1HH 2PN5A 2QQKL 1Q9LA 1ZEAL 5I15H 1MQKL 3D0VB 1OOAA 4AM0A 3THML 1M7IB 4F58L 3TWCL 3UDWC 1D9KD 3EO0B 3AMKA 3VA6A 3HC0B 3GNMH 1FFOB 3GI8L 1RD6A 2BSTB 1IC7H 1OF2A 3T0EB 5KSVB 2HT4C 3QQ3B 4D94A 4UUJB 3GSOB 4FQJL 5HVFB 1NCCL 3TC9A 4I3RL 2R2BB 3KYAA 2AV1B 4D0CA 5D71L 3V6FA 1MRFL 4YPGA 3RU8H 2K1MA 3IXAB 2ADFL 1MELA 3L9RB 1MPAH 3D3VA 4TSAL 4TN9A 1FP5A 5F7DA 2X4PB 2YUXA 1FCCA 3GMNB 3TN0C 1BQHB 1EAPA 1IGMH 1UM6H 3B5GA 1J8KA 4X0KA 5GGSA 2EZ0D 1MHEA 1UXWA 4KZDH 2XKSA 1VFOA 3VXOB 3PP4H 4JY4A 1IT9H 2Q8BH 1A21A 4AH2A 1H15A 4Q9QL 5FYJE 1U8KA 4JFFA 4F37F 2FIRT 5CGMA 4K3GA 3DI3B 4PJEF 1QA9A 1MCQA 2G2RA 3U7YL 3MA7A 4KROC 5T1MB 4M6OL 4NQVB 3WXWL 4LKXB 2NMSA 5FM4A 2X40A 3LY6A 3IKCA 3ISWA 4V1DE 5F7WC 3B2UC 1Q9KA 3PNWA 3SCMD 1ZLVH 3FMGH 3SE9H 1INEH 4HIIB 2SEBA 2VZVA 2OMBA 4JB9L 4JY5L 2O5XH 4OZGA 1NGZA 4U1HB 3KXFA 4F9PA 5I66B 4ORGB 4O5LH 1TQBC 4QRQA 4JLRA 4OLUH 3DOSA 1GSMA 2VH5H 3C8KA 3L5WA 5FO7A 4EBQH 3LH2H 2FBJL 1H3XA 2YHGA 4YE4L 1K4CB 3O9WB 1FFPA 4S0SD 5DD0L 2VDNL 4LEOA 5ACZA 4KHTH 4HH9B 1ROWA 5KVGH 5TQ2H 2QADC 3D39B 1BQLH 5GSVA 4HUMB 3GJFH 1I3GL 3RWHB 3D25B 2NCMA 1MFBL 3AS2A 2BNQA 4DFHA 4APQD 3SKJL 1UWXH 2HVJB 5JOFB 1B6DA 1AP2A 1CU4H 4NP4H 3VGAC 4OIIL 4PRIE 4RGNE 3O2WH 3P0VL 4OLWH 5HI5D 3VGDA 1MWAH 2R69L 3RKDC 1FVDB 1WCBB 3OV6A 4K55A 1KLFA 3DV4A 2AJZA 5FGRA 4P5TA 2VLKB 4QXUL 1HH6B 1S7QB 2AJXL 3ZDYF 1N59A 1LO0L 3UYOD 3QXUA 2IH1B 2XWBB 1KYOJ 2X4SB 3RUGA 4G9FA 4PRNB 1CR9H 4C54A 1NGWA 2ESVE 3BP5A 1C5CL 2BOBA 1HIMH 4R26H 5I1AB 4HS8H 4JKPH 1MHCB 2J8UE 3ZE0F 4N0UA 1EVUA 4Z7NE 3V52H 2ZCHH 4POYA 2ESVB 5E00B 4GRMA 1P6AB 4JFYB 1MCKA 3KYMA 4KY1H 4GG6E 1JV5B 3LN5B 4M3KB 5KW9H 4YDLB 3MUGA 4NM8H 1D9KA 3HUJE 4G6ML 3SDAA 1H8OA 1S9WA 3ECBA 5C09D 1FFNA 4Y4HD 5EPMA 1S9VA 4H1LG 1S8DA 2E9WA 4LK4A 2QV2A 1HYRC 2XQBL 4U6YB 2R0ZL 2FL5B 1MFAH 4ZUSA 2HMIC 4WGWB 2D9QB 1A47A 4OM0H 3UAJD 2HKFL 4I2XB 3ARGD 4ZO9A 3B6SB 1CFNB 2OI9C 4PJ7E 1MHPH 1W72H 3QCVH 5ANMA 2D9CA 2WLYA 3C9NB 4UIMA 4XBPB 3W82A 4NBYB 4NNYA 4TUOA 5JIKA 3IVKA 2UZIL 1G7QB 3MCKB 4LCWD 4AEEA 5IQ7L 1KTKE 1CL7I 4KDTA 5EO9B 5CJ8A 4JM4L 1CLZL 3U0PA 5HHMB 4GKSA 3U9UB 3OHXB 4OCLC 3BKCL 1OLZA 1W2KT 3VXMB 1MJ8H 4X6FA 3JWOH 2I07B 2PTUA 1T83C 2Q76B 3GBMH 4NSKB 3K4DA 3SE4A 3WKNA 5I74C 4MWFB 4GW4B 3UZEA 4LMQE 4EOWH 2R4RL 4MB4A 1RZGB 1A1NA 4DVRH 1NPUA 4AG4L 4HMDA 2VERN 3LZFL 3WHE1 4U05A 3DVNA 1F4YH 1I9RH 4OKVA 2VL5A 2HYMA 2A83B 4OLXL 1GYAA 1KULA 2NY2D 1UB5B 4G8EB 2R0LL 1KELH 5C0IB 2VDQL 4K3EH 3CC5B 1CDCA 5IFHL 3GI9H 4U33A 4E41A 3RL2B 1QBAA 3EYFB 5D7IA 2D03H 4A2LA 5INCA 5IW1A 3DBXA 5E8EB 4M1GL 1DBKH 4HWZA 4D8PA 4N5EC 5KSBA 2CDEA 4U6HB 3O3EB 4BH8B 4F7MA 5ERWA 1V3JA 1GGTA 4S1DC 5I76B 4NKOB 4KTEH 1CL7H 1ZA3A 2B39A 3B2UD 1CDBA 3QWOB 3ZDZE 1RUPL 2E9JA 4XMLH 1JF1B 3ESUF 3HRPA 1H3WM 1NDGB 1K8IB 3BD4A 2FGZA 2P8PB 2X2YA 2Y72A 5L8JB 4N90D 4NIKB 3VE0B 3H3PL 2A77H 3CFIC 2ZNWA 3FB5B 2VITA 1U58B 3VJ6A 2VNCA 2XKUA 3MCLL 2CLVB 1S7SB 3GHEH 1T1WB 4LCCB 2ZCLH 4JQXC 1DFBH 4ZOEA 4W6XB 3G5YA 1OSPL 2UYLB 4Z0XB 4HUKB 3VD4A 5BMFL 1WSST 1AIFA 1E6JH 4N8CH 5CAYB 4JO4H 4GBXD 5IROA 4PJEE 3O4OC 5E4IA 1D5XB 4P9HC 2RIKA 1XAUA 4LOUC 4L3CB 4PLJD 4KZEH 5IEHA 2DJ4A 1GHFL 3BH8A 2FGWL 4Y2DD 2R4SH 2I9TB 3AU1B 3BMVA 5DLMH 4WWID 5KS9F 4JDZB 4L8DA 2DL2A 1MCDA 4KK5D 3RKPA 2P7TB 5JDSB 3ROOB 1PKOA 4RWYL 2R0WL 4X4YB 1XGYH 3ARXA 2W9DH 4LL9A 4ZUVA 5CJOH 4LPTA 4DUVA 3ZKMC 4U3XA 1T04A 3MLZH 5DYOA 3V4UL 4EBQL 8FABA 4XWGH 1OGTB 3QEGL 3FT3B 4FXGA 4WFHE 3IDNA 2VZTA 3LRHA 4YJZL 3O8XD 3WFDL 2COQA 4PJ5B 1M4KA 1JMZA 2FIKA 2DMKA 3ZT5A 5SWSA 2W0FB 3N85H 5F9WB 2EC9U 3T77B 2XT1B 4G6FD 4I3SL 2VIRA 5L6YL 1S7VA 4ZQKA 3HZKA 4UNUA 1IEAB 3TNMB 1PG7W 1NMAL 4FQ2H 2VZSA 5TJWK 4PB9L 2BVYA 5F96L 4AL8L 3E3QE 2PXYA 1HXMB 3RDTD 2H32B 4OLWL 1A6VL 2BVTA 3GM8A 3FOMA 4FRWA 5JW4N 2VR4A 4UILH 3SO3B 1XF2A 4XPAH 5A3IC 5I9QC 3OAZK 5BS0E 4X9IA 4HX1A 3IFPB 3V7MA 4MCYA 4R4NC 4DTGH 3C5ZD 1FO0B 3GJFA 2KL6A 2FO1A 3CUPA 5C1MB 2ARJQ 4O2FA 3EYUH 3LPFA 5CEYB 5EIIA 1UYWL 4FQXB 1RY7B 3G5ZA 4KK8D 1W72B 3V52L 3SDCA 3ZE0E 4F37K 4MX7A 1KCSH 4P46C 2AQ1A 5DMIH 3GHBL 2QQQA 2VDPL 3CH1B 3UYRL 1NBYA 2VR5A 2ICEA 1BF2A 3O45B 4JFOB 1BJ8A 2PCPA 1BWWA 4QTHB 4J4PD 3GIVA 4XVSL 2WUCL 5FUCC 5GGVH 2H3NA 4Z7UF 1KFAH 2HRPL 1DBMH 3M07A 3V8OA 3P9MA 1MY7A 2DQIH 3CFJA 3RZCD 2YRPA 2NQCA 4UQ2A 3ZKMD 4QYOA 1WZ1L 4XCYA 4JFDB 1LDSA 2NXYD 2Z92A 4OFIA 2EXWC 3R1GH 1IM3A 5KZCD 1ULVA 4M93B 2WNGA 3NIDE 3RWJB 4HGWB 5EZJB 1SEQH 5F1OB 3GRWH 4P23A 1G84A 4WUUA 3RZCB 3EJJX 3VFWB 2P43B 5DJ2A 3BZ4A 4MAYC 3DETD 3B3IB 4MNGE 1B9ZA 3MOBH 1BFOB 4JAMB 3NFPB 4ODWB 4S1SH 5C0DB 1C8PA 5FKPA 2CLZA 5BQ7A 1XGQA 2QSVA 1DLFL 5FUOH 5EU6B 4QRSB 4XMPH 1MH5A 1NC4B 3SGKC 4XNZB 1O5DT 4S1QH 2YUWA 3D9AL 1U8PB 2V2TB 1GC1C 3C6SB 4ONFL 2R15A 1QSED 3LEYH 5JNYA 5E94A 1QFHA 1LO4H 1S7XB 4JN2A 1F90L 1RZJC 1YEJL 2ZUVA 4R7DA 3PABA 1X5JA 4NRYA 2ZP0T 3VWJC 3MRPB 2ICWJ 4PRPE 1BVKA 4PG9B 3CLEH 3S7GA 3BXNA 4O58H 5F88B 2VJXA 4TVSa 2KQNA 3X17A 1U3JA 4H5SA 4Y8DC 5E1AA 2MFNA 1XGPB 3FFDB 4WW2F 1ORQA 3RGVB 4JPVL 1HQRB 1A8JH 1ADQH 1HHIA 3H6JA 3QXDA 3L5XL 1KJ2H 4RFEB 3SPVB 1OTUC 3MPCA 3MRFB 1JHLH 5EU7E 2NNAB 4ZPVA 1LE9A 4NQDE 1CFTA 1S5HA 2ZOLA 4FQCH 1X5IA 4HPOL 4F7EB 4GAJL 2OR7A 1IAKA 2PXYD 2RFXB 4G7VH 4HXBL 4I77L 4QRPD 1HHJB 3O41B 4QY8B 3LMJH 3VFTB 1MCFA 4EXKA 1QUNA 4V2CB 4RMWA 1QHOA 2VLRE 5DXWA 3VG0L 3QNXA 5FA3A 3BP7A 2HT2C 1LDPH 5F9AC 3HG1A 3LSOB 1WZMA 1CVRA 1UACH 1V5JA 2FB4H 3KPLA 2X4OA 4Z95L 1RHHB 4QCIB 1BGXH 3SBWC 4XHJC 3K8KA 4JFFD 1CXKA 2BNRA 1HKLL 2W9LA 2ZUQC 4F7PA 2FGWH 3DMMC 4HAGA 1AO7A 1XCTA 2LTQB 5TE6H 3VCLA 3QQ4A 1OLLA 3P4NA 1PYWA 4WU5A 5DWUL 3P11H 3QI9D 1NEZB 4FQXC 3U36B 1QNZH 5C0AB 1J5OH 5GJSH 2D7MA 5E2TL 4I4WA 2XPGB 1MRDH 5ID1A 3C60C 3BIKB 1JHKL 3FQNA 2VUYA 4XB7A 4F2MA 3P9LB 1YEKH 2WP3T 3IU4L 3PJSA 2ARJA 4JFFE 5GZOC 4Y5XB 1KCVL 5BXFB 1DE4A 5T1KB 1IE5A 4GRWF 3EGSA 4AIZB 1PZUB 4WI2A 4OGXL 3MRHA 4H26B 4RAUA 3P77B 3MRIB 4AT6B 2DQTH 4O51A 2OZ4A 2L0DA 3OKOA 4PJIB 5ESVA 1GJIA 1MVUB 1VA9A 5DJZA 5B22A 1UJ3A 2Q3ZA 4U0RB 3G5VB 1RK0A 2V5SA 4HK0B 4DOHB 1PY4A 4OZ4A 4M93C 4RZCA 1ZK9A 1QBLL 1NFDB 2V7HB 1VENA 2X7LA 1QRND 3O11B 4LLMA 4MCZA 2PW1A 2YZ1A 4HV8A 4MAYB 3TJEL 3MV7B 5IW3A 5I1GH 3JSSA 5FHBL 2NW2B 1YNLL 2OM5A 1Z9OA 5D7SH 2FH8A 3SKMA 2F53E 3RDTA 2OK0H 1WBZB 3V7AG 5ISZD 4BFEA 1ZA6A 1JI2A 4HG4K 4GXUN 3NABL 5DMGC 4TQEH 3UJJH 4EUPH 3KPRD 1I1AB 2ADGB 4DN3H 5SV3A 3EAKA 1AHWC 4NQEB 3RKDD 4YHLH 4JQVC 5BCAA 5K33A 1CU4L 4NP4L 5JPMA 3ARDB 4HXAH 1P7QB 2DQUL 1A6WL 4PP1C 2Y06L 3Q1SH 4NZUL 3VG9C 1PKQB 3UBXI 3QUZA 4KJWC 5IT2L 4OLZL 5F7LB 1NGPH 2VXVH 3H0TB 3MV01 4Z7UE 3GSVA 5LWYL 3SBWA 3Q6GL 4HPYL 1J8HE 3DRQA 1F6AB 4KRPB 2J12B 1T2QH 2WIMA 4PREB 1CXFA 3I9GH 1Z5LA 4XP6H 4FHBD 2HTLC 3TN0B 1K9TA 3GMMA 3TO2B 1WAAA 3JV4B 1KT2B 1CICC 3GRWL 1J1OH 1TTUA 2XRAL 4JANA 4ONGH 5EU5A 3W2DL 2JB6A 3PWVB 5KZCB 4PD4J 4CBPA 4K8RC 4X6EB 5F8RC 4BA8A 5CD5C 4JM2C 2FEDD 2Z8WC 5C9JB 2ADJB 4FFZH 1LEGA 2VLLB 4PY8J 1EPFA 5EUOA 4G6AD 3GSQB 4JFHD 3U7AA 5ESAB 3BD5A 4ZS7H 1NCNA 1DVFC 1FO0H 4EI5D 2ATPB 3AS0A 2H45A 1DBBH 1RIVL 5IB1A 1NFDF 3QUXA 4J8RB 5LGHL 2UUDK 2CMRL 1KB5L 3FB7A 4K2UH 4NQCA 1HK6A 3QYCA 3SGEI 2WINA 4WNQA 2G60H 3NMEA 3QO1A 2EXWD 2EC8A 3WNKA 5EC2B 1JIBA 4R2GB 4HC1H 5SV4A 3ARPA 4RBPH 1X7QB 5IMOA 2XN9D 3EDFA 5DD5L 3MJ9H 3VWKB 1ZHNA 7FABL 5GGTA 4MJ5B 3PP4L 1C5BH 5I8CA 4YHKL 4V1DB 3W11D 4HKZA 1G9MC 3CXDL 3V0VB 2FCBA 4Y0GA 1LO5A 5E2UH 3L3DB 1EO5A 1IBGH 4GW1B 5D1XA 3C5ZB 2WBJA 4RBPK 4KRMB 1R5VA 4TUJA 5ILTH 2EICA 4PJ8B 1YN7B 4NQEE 5D6CB 4P23C 4JG1L 3O3DB 5AZEL 2R23B 2BFVL 4GXVL 5K9KA 1MLBB 1F8TH 1JWUB 2CIIB 1CD1B 4WEUD 1SJEB 1IGCH 1PKQE 1NAKL 1U36A 2EDNA 5M95B 5AUMA 1URLA 2RBLA 2WQ8A 3W9EA 1D9KC 3P40A 1AY1L 4RMSA 3RBSA 5HI4D 3MLRL 3BP4A 4YO0B 1KCUL 43CAA 4I9WE 3QUMB 1GL4B 3VU2A 3WXVH 4YX2H 5GS1B 3RHWF 2XFXB 1MSPA 1FCGA 2NY2B 5E6IB 3KPTA 2JK5B 3MRQB 1FL6A 2VC2L 2IG2H 5C3LD 2J8UB 5F6IC 4P49A 4UT6L 1F4HA 2W65A 1HINL 1CLCA 2CKBA 4WHTA 5DA0B 2EDEA 1RK1B 4OZFH 2C26A 1GOHA 3W39B 1E6OH 5HGHB 1OM3H 5C2BL 4JRXB 4ZUUA 3NN8B 2L7JA 4M5YL 2BVPA 3KS0J 1EEZB 4YHNA 4OF0A 1JVKA 4JM2F 3KJ4B 1FN4A 5DS8A 1VEOA 4FABL 3H9ZA 4R4BB 1VSCA 2VDMH 5IJKA 3AREA 4IRJC 1P84J 2MQCA 4JM2A 5CBEB 5FYJL 4NRXB 4WO4A 3TPKA 1MWAL 4X83A 3JZ7A 1MVFA 1YN6A 3BD3A 1NBZA 1KBGH 1KG0B 1U91A 1UM4L 3H2WA 1L0XA 1BD2D 3O4LB 1CR9L 4ZNCD 1U41A 1MNUL 2UZYB 1ES0B 4LLDB 5TGBB 1IM9A 2UY7A 4AIOA 4ZAKC 4MNHB 3TF7C 3FQRA 1E6JL 3W9DB 2VZOA 4CVZA 1UFUA 1RZFL 1OAKL 2OI9B 5CWSB 3MRGA 1N3NB 1Z0NA 5C0AE 1A6UH 1FPTH 4K3JL 2OL3H 5D72L 4HS3B 4OCRL 2OQJB 3NIFE 3GBNL 4J3WA 4PRHB 4BSVB 2XWTA 3BDYH 5J57B 5C7XH 1U95B 3EO1A 3L7FB 4HHAA 4Y89A 1JWMA 1A1OB 5IIEB 2F53A 3DX7B 2FR4A 4PJDA 4Q6YA 2NY4B 5F1KC 2H32H 1A9BA 5LQBH 3KPSD 1YNLH 3BH9A 1W8NA 3WJLA 1EO7A 2FJGB 4U1KB 4NBXB 1S7TA 1WWAX 1N7MH 4PRAB 2NX5E 4JRYB 3MR9B 3HS0B 1FL5A 1A6ZB 1AD0B 4MXWH 4JFQB 2XKNB 2HJLA 3MV9A 5TDPA 3ARFD 3HAEA 5C0GB 1KNOA 4NYLB 3O6ML 4ZXBB 4X7TB 4EUPB 3W5NA 4IIQA 1G7IA 1U6AL 1Z9SA 3BIAX 4MDJB 2BXZA 4P23D 3FB8A 4PB9H 3ELAT 1A6WH 4QHNB 3ZT6A 1EVTC 2AGJH 3L3HA 1V3KA 3GBML 3UPAA 2I9LA 5D93B 3UTSD 1HZHH 4OLZH 1EZVX 4ELKA 3OR7B 4M7KH 4PV8A 5BO1H 4MVBD 4Y5YB 2HJKA 4FFYL 4LPXA 1F00I 3PDDA 3I6KB 3MZGB 1V7NL 4O02L 1DANT 4QOKA 4XXDB 4APQB 4FQIH 4MJ6A 1X5GA 3F5WA 1OP5H 2N7AA 1ZLSH 3RBGA 5I1CL 3N1PC 1RIUL 4KI5C 4WRLA 4JDTL 3U0WL 4P5TD 5ID0A 3RVXC 4OTXH 5JMOC 4IRSB 3LIZH 4NO0A 5BOPA 3DX9A 4ZDHA 2X9WA 1JNHA 4FQPA 5I1HL 5HPMA 1QEWA 3GSWA 5JOPD 1OARH 3SGDH 1FZKB 2D03L 1ZTXL 4IMLB 4GMTH 1DDHA 4MD0B 4CVXB 5T3ZL 5CZXC 1ACYH 4ZAKA 4CMMB 2ITDA 3QEUB 4M1DH 3OMZA 3BEWB 3KYKL 1CXHA 3DTXA 2N4IA 1FZJA 3W0WA 3VFOA 3D69B 4K94H 1CBVL 1M7IA 2P5EA 4P2OC 4J1UA 4JFXA 3QDJB 3NAAL 5ELIA 1F13A 2B5IC 2PNDA 1FFOA 1GC1L 1EEQA 3T0EA 2HTLD 2YOCA 2ZSVB 12E8L 3WKMH 1B90A 4S11A 3H3PH 4UUJA 3GSOA 1SHMA 4Z5RA 4Q9RL 5JR1H 1SQ2N 3PHOB 4I9WD 4DGYH 1KTRL 1B0GA 1JNLH 1EXUB 1HILA 2XZAH 1QRNE 3HRZA 3IXAA 2EKJA 4GH7B 3V0AC 3DUUA 3T4YB 3QI9A 2X4TA 2BXYA 5BVJB 4LPYA 4CADA 4N8CL 4HGMA 3QBTB 1C1EL 4U1JB 3TBWA 4TVPH 1RI8A 4R0LB 4C4KT 4YLQT 3BPOC 5LBSL 2NY5H 5DF0A 3U9PH 1Q0XL 5DI8B 5KG9A 4WTXA 1ZGLB 3O6LL 3T0ED 1IGCL 4NO0D 4L1DA 2XIDA 5IBLC 4MJ4A 3FAXA 4M7ZB 2E7BA 1DZBA 3UCRA 3MSPA 1FFQA 3LCYA 3U83A 1RMFL 1CICD 4Z7VA 1JPSL 1J8HB 2HFEA 1QA9B 4Y5VC 3G08B 1YEGH 3ZL4H 4XVUD 3TO4D 3DWTA 3WFCL 3ULUC 4YWGH 4S10A 5D7LD 4YBQD 1NBQA 4NWTH 1W0VB 4MDIB 4NDMA 2ITCA 2WIIB 3P0GB 3JUZA 4DCQB 1RJYB 2FBJH 1ACZA 4N0CD 3TT1H 4U1NB 4QKXB 3VXNA 2FNBA 2PO6A 3KXFB 5I66A 5IOPA 3ARFA 2ADIA 2VR9A 3RPKA 5EBLB 5KAQF 1OAYH 1MFBH 4NHUB 1X5YA 1CXEA 5DZLA 3HN3A 5E6ZA 1KIUA 4P46B 2WBJC 3ULSA 3STZA 5SWZD 4QHKI 1V7ML 2AAVA 4O5LL 4MXVF 4G6JL 4RNRB 5DMGD 2DWDB 5CINL 4MNQE 5GSVB 3PL6B 1JPGA 2X70B 5DZNA 4WW2A 5C0ND 1MCHA 3ALPA 1F4AA 2WBKA 3MRLB 1BREA 4XNQA 4P3CH 1ZKAA 4X8JA 3BPCA 2P48B 2HLAB 4NUJA 4PJIF 1AP2B 1N2RB 1P1ZB 1WT5C 3MXVL 3MNWA 4X6DA 5C0EA 3G6JA 1S3KH 1WCBA 4RFOL 1YUHA 5FYJD 5JQHC 4QNPE 1QFPA 2BY0A 2VLRD 3BZEB 3GSNA 4LSQH 4PRPD 3GUTA 3CFKA 1HH6A 1S7QA 4U2ZA 5E7FA 3B9AA 2OL3L 5D72H 3CFCL 2X4SA 3RUGB 3CVHA 5F9OL 3WEXB 1TMCB 3WFBL 3VI3E 4S1RH 3OG6B 1Q0YH 1YNKL 3NIFF 5C7XL 2BOBB 1C5DA 2JLLA 3KPRE 1G7JB 1NBVL 1NC4D 3S96A 1DBML 3KLAA 4L3EB 5DMKB 4FOMA 1ZHLB 4NOFA 5IR1B 4YBQC 2R2CA 4TTGA 3K2UL 1K8DB 4PUBH 4M48H 3T4AA 3O6FC 1S9WB 4EI5A 2NW3B 3QDHA 1F97A 4Y7MA 2QHRH 2R9HD 2X89D 1N6QH 3LN9A 4RFNC 5KSAB 1QLRB 1IQDB 1OAQL 1S5IL 2ZG3A 4PJ7B 4YEEA 1OTUD 2C4FU 2DLHA 3QNYB 4JKWA 4PTTB 2EEDA 4I2XA 5KS9E 5D7IF 1AI1L 1QYGL 3ZDXF 4FA8A 2DLIA 1ETZB 1XIWD 3MJ7B 1F4XH 1M6OB 1DSFH 5F7EL 2XG5A 1J1PH 3IVKB 1F3RB 1QG3A 4OM0L 1G1CA 5IVXF 5IFAH 3X14A 1I85C 1MHPL 1W72L 3QCVL 3WL9A 2PYEB 1MI5D 5B3JF 3MBEA 3PE9A 4X5WA 1X3DA 4R0LC 5EZLB 4P2RA 1BJ1H 1CG9A 4R2GD 4G80A 4YGVB 1XF5B 2F53D 5K9JL 3X11B 5MHSD 3U6RB 2R1XB 2JKXA 1AQDA 1BFSA 4WW2C 5DRXA 1MJ7L 5HHPB 1DLHB 3HFML 3F7YA 3TZVD 1CQYA 1QSFD 4URTB 4LRNL 2EZ0C 4D9LL 5FYKL 5T3ZH 1U8IB 3ZMRA 1EHXA 5EOCJ 5EZOH 4NO3B 2GJ6A 4UINL 3E0GA 4Y4KB 4ESKA 2FHCA 2GAZA 1VKXB 2YC1B 3FN0L 2VZ3A 5C0BB 1KPVB 2HLFC 4EEEA 1NCBL 2EIEA 4G43B 3TIEB 3LS5L 4LASL 5C0IA 1LMKA 5J1SC 3ZTNL 4K94L 3VRIB 3CC5A 3KR3L 3V5HB 4N0UE 4JE4B 4M4RA 5TQ0H 3HZVA 3O9WC 3MUHL 3PV6B 5D7IB 4PRPB 1E4KA 2HT3D