4S0TD

Structure of human pregnane x receptor ligand binding domain bound with adnectin-1 and compound-1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
91
Chain Sequence
ADLEVVAATPTSLLISWPPPYYVEGVTVFRITYGETGGNSPVQEFTVPYWTETATISGLKPGVDYTITVYAEMYPGSPWMDIQPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Developing Adnectins That Target SRC Co-Activator Binding to PXR: A Structural Approach toward Understanding Promiscuity of PXR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Nuclear receptor subfamily 1 group I member 2
total genus 10
structure length 91
sequence length 95
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s0tD00
4P5TA 2F58H 3QIBB 1CLZL 5DXWA 3NFNA 4P2RD 1BVLA 4EVNA 1P5VA 3QCVL 1EZVY 5I76A 1UGNA 4UQ2B 1KLUA 2WSKA 5JHDB 4UUJB 1A6PA 1KIPB 3K8LA 4IOIA 2C1PA 3PHQB 1KOAA 2QJDA 1T3FA 1A9EB 3IXAB 3BWAA 1Y6KR 4LSPH 4HLJA 4O02L 4WW2A 4G43B 4OZIF 3NTCH 4XWOC 5EC2A 4G6ML 3IGAA 3NCJL 3QHFL 1PZ5A 3RVVC 1PYWA 2IAMD 3O81A 4ERSL 1NBVL 1JHTA 3RZCD 5BZWA 2H41A 2IADA 5CUSL 5CEYA 4LVEA 1XGPB 2BCKB 3TPUA 1IGYA 5IBLD 3ORJA 1DVFB 4OM1H 5DUPH 1FYTA 1N2RA 3JWOC 4OGZA 1JNLH 4NN7B 5IBUG 1X9QA 1VKXB 3TO4B 5EIVA 5E5UB 4AG4H 4E9LA 2ZJSH 1QRKA 5LBSH 2FZ3A 1CXFA 3BYYA 3DECA 2F5AL 1I7TA 3DO3A 2Y1VA 5I1IL 2IWGA 1J0IA 2IPUG 1NFDB 3WSQL 3QG6A 1K8IA 2IPTL 3W5MA 3QQ9C 2HT2C 1K2DB 2EC9U 4YBLB 5C0JB 3PG2A 1TVHB 4XVSH 3C2AL 2A83A 4Y4FD 3QDJE 4UT6L 4Q2ZA 5F7DA 4ZYKA 4WFGE 1D6VL 4QGTA 4G8IB 1FGVL 1JE6A 3L5WB 1BQHA 4K9EC 3ZO0A 3K2UH 3CLEL 2ZUYA 5LGJA 2VZOA 1JRHL 2VABA 5F7UA 1D6VH 1UVQB 3IXTB 5AUMB 3BD5A 1GZPA 3LN9A 1G6VK 1M7XA 4UT7H 3BH8B 5K59E 4XWGL 5BVPH 4NC0B 5HHOE 3KPNB 3ARZA 3Q6FA 4P46A 2X5PA 4LBEA 4NDMA 3GI8L 5KS9F 3MBEA 1NFDF 3V0WL 4YJZL 1Q94B 4PJDF 3U82B 3ZDXE 5LXGL 1EJ6A 4QGYA 1BBJA 3X12A 1AGBB 3ZE2E 4PYGA 1L7IL 2LVEA 4NKOB 5JNYA 4EXKA 1NJ9A 5GRJL 3SO3B 1WT5C 2V5SA 1DE4A 1LO5B 3PWVA 5GRWA 1C7SA 4PD4J 5HYJD 4NO0D 5HGBB 5I1CH 2O93L 4R7NB 3W82A 2XTJC 5HVHB 3ZKQD 5GGTL 1BJ8A 3WJJA 5JIIA 4K3DH 2F9BT 1XH3A 1U95A 1HCVA 5B4MD 3MJGX 3K81A 4PJBE 1N4XH 3L1OL 3IAQA 3EDDA 1NC2D 1ZT4B 1KB9K 1KYOK 2FNBA 3SE4A 3W0WD 4X6BB 3RWFA 2ZP0T 1NGXB 2X7LA 4ZOBA 2NXYB 3SPVA 1MLCA 3NIFF 1OM3H 5DRXB 2BRRL 5ICYA 3EOTL 1H3PH 3RWDB 5A16A 5F9AC 4QEGA 3S9DB 1A5FL 1HSAA 3VDBA 1YYMH 2FJFA 5E7FA 3G08A 1JYNA 5A2FA 4E5XB 4UMGA 2OMNA 4I48A 4JZNB 4LSTH 4DN3H 1E27B 2B39A 2OLDA 3TBYB 1WBXB 2D4DA 1SEBA 1N0XH 1IC7L 1YEEH 4K3GA 1IT9H 1JFQL 2FR4B 3M8OL 3EZ8A 1QSFD 3SJVB 2DL9A 3L6FB 3QUMA 2DD8L 5DJCB 4CMMA 5M95B 3EKCA 3MV7A 2IALB 4K23L 4MXVE 3LPWA 4JO2L 1HKLH 5I17B 2YPLE 3G6AA 1MFCH 1FZMA 2EIDA 1OP3H 1AD0A 5T1DL 1G6RA 1D5BB 3CVIL 1JTTA 3MODH 4Y5XB 3FMGH 4FTVA 4FQIH 4UDUB 3BZDA 3MLSL 2A6JB 4QTHA 5GGRB 3LKQA 5JPMA 3QZWA 4HUUB 1BD2A 3DMMA 2IANE 4XP1L 5DA4A 1E4XH 2A73B 3RWCA 3MV8B 1G7MA 3FZUC 1AGDA 5ICZA 1K8DA 1SYSA 4GG6F 3NZ8B 2WBJA 3BI9X 1D5XA 2VDNH 3B5TA 2ICWJ 4FFWC 2AJXL 2FEDD 5K9OA 3IVKB 3MRNB 2M2DA 4KRPD 4Y2OA 2EC8A 1HXYB 1VENA 3N85H 1F3DJ 4OI8A 3NA4A 5KAQG 1ITBB 1JYWA 1KJ2H 1XGUA 2FRGP 5DZOA 3FO1A 1BF8A 3ZE0F 1DBMH 2AXGB 4UTBH 3B9AA 3CC5B 3GBNH 5TF1L 4TUKL 1WBYB 1NCAL 3ARQA 3O0RH 3G6DH 4UDUA 4M6MH 4IOFD 2PXYD 1N3NA 5C0IA 2X4UA 1GGTA 5C71A 4FABH 5TE7H 5IB4B 4XHJD 3X3GH 1A47A 3V79C 4AEFA 3BKMH 2QHLA 1H3GA 3B3IA 2XWBA 1HIML 4KTDH 4YO0A 5IB3B 3OX8B 4I5BA 3B4NA 5F44A 4MWFA 2XQYG 1CG9A 3FCTA 4LARH 4IRSB 5IBTL 4LLAA 3L6FA 1L6XA 3LEVH 2X4OA 3GKZA 4P3CL 4XAKE 1YUHB 5GS0L 2HLAB 3BXNB 4ETQA 5C0DB 4P5TC 4LASH 3WLBB 5HHQB 3O3DB 4FHBD 3VMPA 4KK9C 4Q7DA 2P7TA 3U7YH 4DAGH 4MXWH 1RU9L 1RZIB 1DEEB 1ACYL 3H9SB 4U6XA 5GJTH 3WXWL 2C4FU 4JM2F 4C58B 4YGAB 5TGBA 4BZYA 3L5JA 1K9TA 1ZA6A 3C2AH 4APQA 2E9IA 4PTTA 4RAUA 5KOMC 1HNFA 2VLKD 1UZ6F 1T03H 1MHEA 5ALBH 1ACZA 5HVFB 3C60A 3HFMH 4JVWA 4JFHE 4LVHC 2NY7H 1ADQA 1F42A 1N64L 1XR8A 2LVCA 1HDMB 4JKPH 4NRZB 1CD0A 5TE4L 3QWOB 4FQ2H 1L7TL 5E1AA 1KEGL 5EIIB 1AE6L 4M6OL 1N5AB 3WFCH 4LRNL 2VDKH 1MWAA 2EKSB 5KSBA 4GMSH 3AM8C 4XMKH 4NO5B 2R1YB 3ARBA 4N5EC 3GMMB 1CCZA 4P2CG 4PJXA 4HBQA 3KPSA 4NHCL 4L8DA 3ROOA 2VLKE 2CPCA 3E1F1 2A9NH 1BZ9B 3WKNA 2Y7QB 4N0UB 1RK0A 3WN5C 4M9OA 4DKFL 1VACA 1B0RA 5B8CB 3H8NA 3LMJH 2R8SL 2HRPL 3AREA 5HPMA 4NQVA 4P2QD 4YQXL 3DBXA 2O5XL 3U6RB 4N8VB 4ENED 4HXAL 4M4PA 5FUCC 3AB0B 5FUZL 5C0AE 3VE0A 2O5ZH 5JA8B 2V5YA 4U6VH 4GXUN 3NCYP 3EOAA 5EC1B 3WIFA 4YDKH 1NCBH 1ODAA 3GKWH 3TT1L 4HUXA 4AYFA 4JRXA 1YEFL 3PGCA 1JZ4A 1YQ2A 1NPUA 4XP5H 4JG1H 4EUPH 2ZUVA 2BOCA 1BFTA 4PJGE 1T1YA 2ZPKH 4BFGA 4ZAKB 3SDCA 3VFUB 2R1YA 5T1DH 1TJIL 3CVIH 3DV4A 2UUDK 4XMLH 5AAMA 2FYYB 5EU6D 1SJHA 3OAZH 4PTUB 4EN3B 2DQCH 4KUCD 3W2DL 5C0JA 2PW2A 4Z95L 2GUOA 1WWWX 1OW0A 3QDGE 4WJ5B 3V4VH 4EJ1C 4YHPA 1QA9A 3RDTD 3GI9H 1WCQA 3E6HA 3HZVA 5D7LE 1KPVA 4U0QB 1RY7B 1I7TB 4OFDA 5FECA 1MOEA 1FSKC 5I19L 5F9WB 3F12A 1UACL 4WTWA 3TP4A 2A38A 2FZ3B 4JFDD 4L1HA 3WHXA 2E6QA 2ZUQC 5FYJD 3F6LA 3V8OA 1KG0B 4C59B 3H9SE 4RGOH 1SY6H 2H3NB 4U1MB 1B90A 4HUMB 3FONA 5DWUH 3P4OB 3S5LA 4GKSA 1R5VA 3QNYB 1U6AL 3WLBA 4JGUA 1KB5B 5I73B 3DUUA 1ORQB 1BFVH 1BQLL 3QIUD 4MJIE 1KPUB 2HLAA 1YMHA 3IDJA 4HFUL 4ETQB 2EE6A 2XKNB 4I0KA 2XA8H 3BUTA 3EGSB 1G9NC 4PJCB 1YQVL 2NY2B 2R9HD 4EOWL 2EYSB 1I3VA 5CBAB 3QAZC 3B6SA 1GAFL 2C4FT 2IJ0C 4ZUTA 5HGDA 3TT1H 1NGQL 2ATKA 4O2FB 1GVIA 4XGZB 3TGXA 5L0QB 3CH8A 4GRLA 5DJ2A 4KGJA 1I8MB 4HS6B 4LGSB 1R3JA 3A6CL 5MEOB 4WW2F 5IB2B 3EJZC 3C6LB 1Z6JT 1U3JA 1JPGB 4NQSA 1JF5A 3GMRA 1F4WH 4L9LB 3HE7A 2AXGA 3DV6B 2VQ1B 1MH5B 1MHPH 1NH6A 2YZ8A 1X5XA 5J12B 3OAZK 5DJ2B 1HOCA 1RZKC 2VLMD 1T04A 5T33H 3T0EA 2ATKB 1D5ZA 1F11A 3OB0K 5C0CB 3AS0A 3U7YL 2QADD 3FO9A 1JV5A 3OKDA 1FFNB 1SYSB 3JUZA 4N0YL 4OCRL 1YMHB 3IDJB 4M02A 5D7SH 3OKOA 4YXLH 1FIEA 3CFEA 3DMMB 4HUUA 2QL1A 4MGXA 3L3DB 5D6DA 3VXSD 5HHVL 3S35L 3U83A 1GGBH 4WEBH 4GRMA 1I1AA 4V2BA 4PJIA 2DMCA 5EU7C 2GAZB 4FQLH 3BT2H 3SDXA 4EIZC 4M7ZC 3BJLA 1UH4A 5HTSA 1KNOB 4K71B 1ZLVH 2DWEB 1MHHB 3SBWA 3BKYL 1DBBH 1ZS8B 4A2MA 1F4HA 1ZHBA 2H6PB 4RFOL 2LABA 4YDVA 5FA3B 4FFWD 5ICXB 5F7YC 1JYXA 3D0VA 1H15B 4WO4B 4HULB 1I9RL 1KJ2A 1WC7B 1DBBL 1DBML 5IM7B 3RTQA 1KFAL 2VDQH 1TETL 3ZYIA 4DKFH 3ARVA 3SDDD 3QH3B 1SEQL 4GRWF 1S9VB 4QTIL 3RZCC 1CQYA 4IRJA 5HY9B 5FKAA 1P1ZB 3SE3C 1ZWIB 4PGDA 3T08A 4BA8A 4HKBB 4KVCH 3LDBB 2I9TB 4K94H 4O4YL 2Z93B 3MRLA 3AY4C 3L5XH 1T5WA 3F6IA 4BK5A 4PB9H 4ZFFA 5IKCB 4ZODA 1U8OB 3FOMA 1G1CA 4G6AC 2X4TB 4CJ1A 4YHLH 4I1NB 6FABH 4XBPB 2JE8A 3GIZH 4ZSOA 1EVUA 5MI0C 2G2RB 3C5ZC 1WCBB 4TQEL 3ET9F 3VXUE 3AREB 4KQ3H 4R26L 4G80A 5IGXL 5KSUA 4BH7B 4EBQH 1UXWA 3S4SA 2LAGB 5E8EB 1LO5A 3PWVB 4Z7UF 3D69A 3MR9A 3QI9A 4TNWK 3KNBB 1SM3L 3VXPB 4L8SA 3S7GA 4ZFGH 5JO5A 3AAZB 4QY8B 3CUPB 1UFUA 2J2ZA 5FOBA 4E0RA 3QWRD 3Q48A 1T7YA 1ZA3B 5DD5L 4G6JL 1AI1L 1N5AA 5CP3H 2GSGA 1YMMA 3DSFL 4ZSOB 5SWSB 4Y19B 4XBPA 3MRFB 5JHDE 2NY5C 2MSPA 3ULVH 2BX5A 4PJ9D 4YIQB 4X6DE 3PHOB 3STLA 2A6KA 3PDDA 3VFOB 3VFWB 5AUMA 5I6XB 2NTSP 2W9LA 2PR4L 5J06A 5H35A 1XF1A 1HILA 2DJSA 3GMOA 2X4NB 2MQCA 3MOBL 4FG6C 1CD1A 3VFMA 43CAA 1EO7A 2QSTA 1MCWW 4QCIA 3RA7H 4G9FE 5FYKL 3G04B 3QUZA 4OCXL 1TPXC 4OD1L 1OB1A 3CVHL 4CKVX 3S96B 5HYFA 4RIRB 4DCQA 2FX9L 3O4LE 5EUOF 5JHDD 1OAZL 1GZQA 1J1OL 3RNQB 1P7KB 3BGFB 3RTQB 4LEOA 1RIVH 4OCXH 4I77L 3LB6C 1UWGL 1K8IB 3BSZL 3L3IB 1DQQB 2UYLA 4PR5B 1CK0L 4ZD3L 2PF6A 4LGPB 1O0VA 4HGMA 4LHJB 1QTYT 1EA9C 2VXQL 5FK9B 4W6YB 5DEFA 3MV7E 2CUIA 2E7BA 1RUQL 1FE8H 3DXAA 2VKXA 4MWFB 5C0GA 4HH9B 1AXIB 3MLZL 4LP5A 2PW1B 5DD3H 2Z4QA 1OHQA 1J0JA 3HUJB 5HHME 2CK0H 3LKNB 1FL3A 1R5IB 1N6VA 3V4UH 2BSED 4AIOA 3P73B 4OZGB 2VAAB 1H0DB 4J3SA 3G5VB 4MJ6B 2DICA 4XWGH 2EDKA 3NCMA 4G6JH 4K7PH 4OT1L 5GGSA 4C56A 4CADA 3RVTC 3UBXB 4IMLB 3SKUD 1G7LA 2O5ZL 2VXSH 3DPBA 3MRDB 4LRIA 1VGEL 2DM4A 1BQHG 2AXFA 5FHAL 4BQ9A 5HD8D 1B0GA 1UA6H 2GTZB 4OLYH 1D5XB 4GSDL 4HMCA 5BOZG 3VD4A 3DHMA 3KR3H 3F7YA 3U48A 5IQ7H 1QBLL 1G7MB 1BBDL 4W70A 3MV8A 1W2KT 3WNLA 1IAOB 1LK3H 1TTFA 3W9DA 1QLEH 3OZ9L 3ZMRA 4XP4L 4Z7OE 5J1AB 4CVZB 4NZTH 5J7CC 4BFBD 1ZEAH 5C2BL 1OSPL 4PRBA 2VISB 1VHPA 4XNYH 1LO4L 2X89A 5FFLA 4HS6A 4HZLB 1AD0B 1EV2E 1CK0H 4G5ZH 4FFYL 4MA7L 5I17A 3BP6A 2IAMC 3CGTA 1QFUL 5DT1L 4LLYA 3BPNB 4P4KD 3P0YH 1MEXH 2EDJA 5EUOE 5FF6B 1HEZB 3MLWL 3DVNB 1U2HA 4UT6H 4JVUA 5HHMD 4Y4KA 3LRSB 1U8JB 5EUKB 3EFFA 1YYML 4WEUD 1FP5A 5J9PA 4KV5F 3VXNB 3FONB 1XGRA 4E5XA 4V1DA 3RP1A 1BQLH 1JMZA 2R23A 5GJSL 4X5LA 2VSDA 3V8CA 2DBLH 2FWOA 1EAPB 1BOGA 3EOYG 3X14B 4CGTA 2CIKA 5GGVL 2QEJA 4X4MA 4NM4H 4MJ5B 4M7LT 4U1GC 1YNLH 4FQXC 5KVEH 3RGVC 4X7CC 4JGMA 1JRHI 3SDAD 3S37H 4HJ0C 5D5MB 5C09B 1P7QB 3QO0A 3HPLA 3VFPA 5D6DC 4Z7QF 3T3ME 3T09A 3WIHA 1XH3B 2SEBB 4KXZI 3L3GA 4RMSA 5MP6H 4EN3A 5I16A 1JPFA 1XF4A 2XG5A 2NY3B 3DSNA 2FBJH 3NIDF 3V0AC 4GAJL 4LVNB 4MX7B 1J8HA 2DLIA 3P40A 2N4IA 4MB4A 2FEDC 1UM4H 3R8BB 3MRPA 1XR9A 3DVFA 1H3XA 5EC1A 3G5YA 4U4BA 4Y5XC 3D5OF 1FO0H 5LBSL 1RJLA 3L3HA 3X12B 4JFOB 4HF5L 1CFBA 2C7UA 4JDZA 1G9NH 4FOMA 5DQJB 4G8EA 2HAZA 4RZCB 1JZ7A 2I5YH 3CFDB 5C0AA 3QUKB 1FAIL 2VKWA 2WUBL 4HBCL 3QCTL 1MREH 3EYSH 2HH0L 3ARUA 3QNZA 4J12A 4YZFF 4PIRF 1QSED 3VGAB 4P9ML 4AZ8A 3BPNC 4HC1A 2W0PA 1Y0LA 3T65B 2B0SL 1BZ7B 3VXRA 4RX4D 4NNYB 3IFNL 3FQUB 2XTJE 3KHOA 1Q9WB 4NO5A 5DZNA 1KCSH 1U9KA 5DRNA 2WUCL 4JFZL 2DYPB 4OZFG 5KVDL 5I1IH 1TVHA 1PEWA 2FH8A 5C08D 4ZNCD 4D94A 3LD8C 4NKMA 3ZT7A 1HKLL 1GGIH 1FCGA 3GRWH 4ZUUB 4F33B 3QEQD 5CCKH 1RULL 2ESVD 3FTGB 3HRZA 2WWKT 4YUEL 4ZTPH 4XWOD 2BSRB 1CVSC 4UBDD 3ZDYF 3BMVA 4RA3A 5GSVB 1A7QL 1UCBH 1NC4B 5C6WH 4JKMA 4I3SL 4LSTL 4OCSH 2J8UF 4JN2A 4PS4H 4Y16A 3R1GH 4Z95H 5FYJE 5D6CA 4KHXL 4NNXB 4JFHD 1NEZA 5TGBB 5EZOH 5ALBL 3VH8A 4ETYA 3QEQA 1JPTL 3BZ4B 4GBXC 2FX7L 2OM5A 4KUZH 4GBXA 4IIQC 5C08A 4JJHA 2GK0B 3I6LD 1RZKL 5DK0B 3IKCB 1OTUC 1Q9KB 2G5RA 4RX4A 4Y19E 4JZJA 5L8LB 3FQRA 1RJZB 5D2NA 3AXLB 1ZMYA 4ZQKA 1EMTL 2MKLC 4HWBH 1XCQA 4X80H 5F7NC 5FGBA 3O3BB 2EDLA 4MSWA 5DJAA 1X6LA 1LILA 3MXWH 3ARBC 1X6NA 4YHOH 5K93A 2OSLB 4I3RH 3D1MC 1K4DA 5L2KB 4Z7VA 2V17L 1TCRA 3E8UL 1NFDE 4LCWE 2BVPB 4ELKB 3I3BA 1J1XL 3MCG1 1N8ZA 6CGTA 4JFYA 2OK0L 1A7NL 1K3IA 4PV9B 4TRPH 1E6OL 2ADFH 4KQ3L 2VLKB 3EAKA 4P2YA 5DD1H 5BW7C 4Y2DC 1D6EB 2I60H 5FB8A 1BM3H 3UJIL 1J8HD 1OT1A 4CU6A 5GS3A 1OOAA 2DQIL 4JM4L 3FB6A 3RQ3A 3WDJA 4OZFB 1Q9LB 1XGTB 4UAOC 3QZWG 2R9HC 1A3QA 1CE6A 2OS7A 4M61B 1S9WA 4MS8D 4EN3D 5HHPA 5LKNA 5CP7A 8FABA 3UBXI 3TA3B 1JRHH 5KS9E 5BV7B 4LLWA 1N59A 4EI6B 3VXRE 2H2SC 1HCFX 4WGVB 3SDAA 4KVNH 3WE6A 4Y2DB 2AXHA 3BP5A 5F7FA 3ALXA 2UZYB 3LS5H 1G9MH 4JFQA 2KZWA 3G6AB 4K8RC 1YNTA 1KEML 2RB8A 3OSKA 3WUWA 1KF9B 4Q0XL 2NZ9C 5TQ0L 3RWJB 5FO7B 5GGUA 3PE9A 5DVLA 1MFCL 4PJDB 4V1DD 3SY0A 4UT9L 5KW9L 2B4CL 4I48B 5DGRA 5ADPL 4NN5B 1A4JA 4BZ1H 1LP9A 5KVMC 4NO2A 4P4KA 5I1CL 1SVCP 1YEHH 5C7XL 2DDQH 3EYOB 4XPBL 2OMBA 1W0VA 4G5ZL 2FEEI 4GXUM 2G9HA 1MCWM 3MLXL 4AIXA 1NBVH 1QQDB 2Y07H 5GRZA 5DUBA 4GBXB 4OGXL 1QBMH 4KI1A 1M05A 3O6ML 3RBGA 4L3ED 4N1EA 1NEZB 2R69H 4CNIA 4NUJA 4PB0H 4XCCH 3EYUH 1M7IA 4HLZH 5E5MB 3IDYC 1SY6L 2ICWB 1G9NL 4HIXL 2VLLB 3SDDC 5HHOD 2P8LA 3L3JB 3KVQA 1I8IA 3SE9L 5F71A 1DN0B 4OLVL 1GL4B 2R56L 2HMID 5FCSH 5JNYB 5ETUB 1BGXL 4NKOA 4C56D 2PN5A 4EN3C 1NGQH 5DRNB 4LAJH 5C0EB 3V5KA 1OWWA 5ITBH 2W0LA 1CICC 4KJYB 1C12A 3KPTA 1OSPH 2R2HB 3DMMC 4UQ3A 4DGVH 3AS1A 2IFGA 2J88L 3F7VB 4X9IA 5INDA 4LRIC 3RU8H 4M6AA 1CT8A 3DXAD 1X4XA 1A9BA 3O3EB 2G75A 2IPKB 4UT7L 1BQHB 4G8EB 3I9GH 3DETD 3LKRA 1F00I 3BUYA 5M7QA 2WBKA 5DUPL 3QO1B 4PPTA 9CGTA 2A83B 5KSAC 4XX1G 5F1NA 2JLLA 2H45A 3GB7B 2FH6A 3DYMA 4OTXL 5GZOD 1B2WL 2ATPB 3GMNB 5L88H 1K6QL 5F9DC 1N6QH 2YSSA 5E00A 2DTML 2QADB 3EYVA 1JNHA 2VDRH 4KDTC 1INQA 2P46B 3M45A 4QHMB 1R3LA 4WWKB 3T4YB 3VG9B 3KYNB 1QLRA 4QHNA 2HLFC 3BW9B 3HUJE 5INCA 2LU7A 2A9ML 1C1EL 3VCLB 5BMFH 4OJFL 5I16B 3NFPB 1TDQA 3UX9B 3O4OC 1FO0L 1IKFL 1H8NA 1IEBA 4D0DB 5BS0E 2IH3A 4H1LA 3GJFB 1SYVB 5D7JC 1YMMD 5CJXC 4Y4KC 3JWNC 3EOBB 1KCUH 5JW4R 1ZLWK 1NMBH 1GIGL 4FZ8H 3QEUA 4D0CA 2F8OA 3LAFA 1CICB 4DUWA 1G7HA 3MACL 1AGFA 3WFEH 4DFIA 3FB7B 1KTDB 4WHTB 3QI9D 2Q8BL 1HN1A 3ILQD 4NUGL 2DTSA 4KJQC 1IBGH 4LAQH 3QEGH 3CX5K 1NEUA 1C7TA 1TJGL 2ZCHL 2C26A 2CDEB 1A0QL 4WV1B 1KIPA 4PP1D 4ORZC 3LDBC 2IQ9H 3UZVB 2BJMH 2QHRH 3PGDB 4LAQL 4OLXL 5IFHH 4R3SB 2R2EB 5F9JB 4Y4HB 4JM2B 3PWJB 2HTLC 2EDXA 1IZJA 4LLYB 2Z31B 4JKKA 4AT6B 3BQUD 5HBBA 3OXSB 4M7JL 4ZPVA 1GGCH 4X6CF 4BYHA 4GAYB 2X4PB 4KKNA 4E42B 4H26A 3OBAA 2DQUL 1KFAH 1JHLL 4OM0L 4M6NL 2MMXA 4IRJD 2ICCA 4BH8A 2GSIA 4OQ1A 4LLUA 1GCFA 2BOBA 4JRYE 1EBAA 2HTKC 2DKSA 4OSUL 1UEMA 3AB0C 1RQ5A 3C08L 2EDHA 3AGVA 4TYUA 1QLFA 4WI5A 2OYPA 5EZIL 5IHLB 5F9OH 4N1HB 2XPGA 1CIDA 4TUKH 1RHFA 3UTTD 3NCBB 3QNXA 4Y88A 4TSCL 1RULH 2D7OA 3IAPA 1CFTB 3RRQA 5B8CC 3TJEH 5A3ID 3OAUL 3HPJA 2EDQA 3KXFE 3QEUB 2LTQC 5JHDA 2OI9C 3V5DB 4U0RB 4ZUVB 4JHAH 1I1AD 4CW1A 3G5VA 5IBTH 2JCCF 3DYOA 2YKLL 3VXSA 3GSQA 1OGAA 3TBWB 2ICWI 1BLNB 1R5IA 4O4YH 1P4BL 3LKNA 4Q6IC 4MS8C 3UBXG 1LMKA 3MRQA 4HWNA 2I24N 2NR6C 4EUPG 4M1GH 1INQB 5C0GB 3FT4B 4MVBD 5HYQB 5DI8A 5H2BA 2JIXB 2VLRA 3GMNA 3T0ED 1HH9A 1UCTA 2YEZB 1OTSC 4PJHE 2VDML 4CAGA 3O41A 4B41A 2NY6D 1SJEB 1XF3A 4BKLB 1KELL 3HE7D 3QAZB 4JQVA 4BELD 3M8OH 1TPXB 1MCEA 2P49B 1XIWC 1AGCB 5IB5A 1EEUA 2X41A 1Z9MA 3ILPB 5ADOL 1CD1B 3VFMB 4NZRH 2X4NA 3MFGB 1HYRC 4MB3A 5J56B 1KJ3L 3MPCA 3QUXC 4GRLD 3S36H 1U3HC 3U4BH 1GGCL 2C3VB 3ZKXB 4UQ3B 3R4DA 1P84K 2X70A 5DWUL 4IDJL 1N26A 4J7RA 4G8GD 5B21A 1H3WM 3CXHK 4P2OB 1IC1A 3QIUA 2DN7A 1XF5B 2GSGB 2AEPH 2EIEA 2D9QB 4L29B 3SKMB 1ZA3A 3WFDL 4PFEA 3ZHKA 5BVJA 2ORBH 2Z92A 4O58H 4DZ8B 5JOPE 5ETUA 5TFSL 5C0BE 2GYSA 5AYQA 2FSEB 5J11C 3L3JA 5E24E 2P8LB 4DVRH 3BHBA 4OKVB 3KGRA 1G7IA 1UXWB 3S4SB 3GJFH 5IF0B 4JFDA 1U8MA 4U6HA 4PP2A 5IG7A 5EN2A 4WU7B 1HXMA 1X5ZA 3MREB 3RL2B 5A2IH 1T7VA 1S7SB 4G9DA 4YR6B 4JFEA 4XVJL 3REVB 3MZGB 3IF1A 3OHXA 2DS4A 2X4TA 1A6TB 1UJTA 2CLRB 3JWDL 1MJ7L 4LSSH 4YNYB 2FGWH 2FGZA 1KBGL 5D1XD 3NIDE 5EU6A 4N0FA 3GSRB 2JCCA 2R0ZH 5JA9A 4JPIA 4KK8D 1YEFH 4PGDB 4G6FD 2DQJL 3MOQA 2B7DT 1Z9SA 3BO8B 1FPTL 3WN5B 4UIMA 2EE3A 1E4KC 1KIQA 1FNHA 2PCPA 4NZUH 4QRPA 1IFHH 3OB0H 2AQ1A 2XKSA 5T5FL 4GSDH 1CGXA 3BD3A 3BKML 2D03H 4P2QA 3GI9L 3BMWA 1MCFA 1I3GL 3ARED 4NHCH 3PP3H 3WUWB 4XPGL 5C0RL 4FG6D 5DR5H 3HKFA 1MHHA 1WAAA 4EKXA 2VQTA 4OFYA 2BNUA 3ARFB 5MP6L 1DQJA 2VUOA 1L7TH 3C8KB 3VWKA 5CIPB 1WTLA 1F4XL 3ARBD 4QXTA 5C2UB 4HKJA 3QIWD 2P24A 3JUYA 8FABB 5FCUH 5T1MA 5HHPB 3BRFA 5DD3L 2ARWA 4GRWB 2NXZD 3OV6A 4MD0A 2NY3D 3RPKA 1SMAA 3I6KA 1M71B 4NT6B 4HLZG 1QRNB 2J8UE 5FYLE 5MENE 1LEGA 4P3DB 1R3HA 3G6JB 1F6AA 3MBXH 2AK4A 3C60D 2BNQD 3NMEA 3CD4A 3KYOA 1T03L 3C08H 4OBRA 1SHMA 2VLKA 3LH2L 4R6UA 4MNHB 2Y5TB 3HCVB 5T3XD 4D8PA 4NKIL 2B5IC 2VH5L 3JWOL 3S34H 1JN6B 3GHBL 4P5MB 1AQDB 2I07B 4QRSA 4APQD 1FNLA 1AY1L 3HE7B 1MRDH 4YDJB 3MNWB 4LSPL 3OAUH 5D7IF 1JWMA 5IIEB 5CZXD 4A6YL 3ROLB 5I66A 1R3JB 5F3BB 1CXHA 1MHCA 2VLJE 4Y1AA 3FHQA 4GG8A 4O2CA 2H1PH 1SBSH 5TE6H 3F62A 3LV3A 4ZFOL 4M93C 2C9AA 5EB9A 2NY2C 4XPGH 1FNAA 2GEEA 4OM1L 1FNEA 4P4KC 1JK8A 3VXTB 3EGSA 5DDHA 2DQEL 4U7SA 4OIIH 4U1IB 3JVGC 1W72H 5ACLA 4XC1L 5CJQH 4MJ4A 5FIEA 1ZLSH 4Y4HC 5E08L 1JHLH 2CJUL 4EI5D 4HUKB 5FYLL 2VZ1A 3ALWA 4HMEA 2HWZL 3VI3F 4CL7A 3T1WA 2LV4A 1HHHA 4MJID 3WFHB 5J89A 3NIGF 5KANG 4NNPL 2J4WL 5F3BA 4ELMB 3B2UD 4QXGH 2ZSWA 1C5DB 3GEWB 4RFNC 1G7QB 5CMAB 1D9KA 2R1WA 3DURA 1A22B 1GIGH 4FZ8L 4Z7WE 1UYWH 3P77B 4M7LH 2Y23A 3QR2A 3WFBH 2Z8WC 4HKXB 1S3KH 1PGRB 3REWA 4N90E 2I07A 4OCMC 4PBXA 3CK0H 3D3VA 4PLKD 3A6CH 4ZUUA 4RDQF 4YHPB 1ZANL 1F58L 1T0NB 1TJGH 4MB5A 4ZNEE 3BPCA 1BD2D 5F97E 1WAAE 5EU3B 3CFJA 1SJHB 5DF0A 4ZTPL 3ZTJG 1CDBA 4LLVB 1QBAA 3MLRL 1AH1A 1MI5E 3FQUA 4EOWH 4FTVD 5I1DB 2ARJQ 2C1OB 2NW2A 3U0PA 2NY0C 4UOJA 1OT2A 4Z0XA 1HHJB 2BVUA 2GK2A 4MMZC 1KV3A 1B4RA 3VWKB 1U8HA 4XMPH 4OUUB 2YBRA 4OZGF 2UWEA 3VGEA 1QG3A 3UPRA 3MJ8A 4XP5L 3JV4A 3JV0A 1QSFA 2OL3H 3QUYC 5LGHL 1FRGH 4WRLA 5GPRA 4N8VA 1NBYB 2IGFH 2OR7A 5EUOA 1X5KA 3PWLB 3DUSA 4JPVL 2E6JA 1FPTH 5BOPA 1E4WL 5CFHA 3MRPB 5CD3B 4Q74A 3BN3B 1FORL 1LGVA 2Y36L 5CJOH 1MCOL 4YEFA 4OF6A 2ZUXA 2X1OA 5D96B 1OCWL 2XTJB 4NKDA 1YJDH 2UZIL 4EDWH 2XZAL 1EEZA 1MWAB 2EKSA 2XZQH 3G5XB 3W0WA 1AXSB 2RFXA 5GHWL 4I0PA 4PJ7F 4AK1A 4J3UA 4K55A 4PGBA 35C8H 4NRZA 3QXWA 1NLBL 3LN5A 3PL6A 15C8L 4NM8H 4H0HB 5CIPH 3BESR 1IQDB 4WFHE 3O9WA 4GW1A 3WS6A 1A6ZA 1Q0YH 3Q5OA 3QDMA 5J13B 2PO6B 3NIFE 1EAPA 3X14A 3BSZH 1HXMB 1FG2A 1MCHA 5EN2B 3GNML 1KB5L 3H9SA 4U6XB 2R29L 4KRPC 2GFBB 1IGTB 4IHOA 1CDUA 2N1KA 3GHBH 4ISVA 2YMXH 3BHBB 2MPAH 4OLVH 2XA3A 1CLOL 3KS0J 4ONFL 5FO9B 5IT2L 2WW8A 3RI5F 2Q8BH 3MO1A 4PRID 1RU9H 4Y4KB 3QQ3B 4HPOL 5FF6A 4R4FH 4YE4L 3SCMA 4LSUH 1EERB 5HHXH 5IHBA 1PY4A 5D1XC 1PDKA 5MI0B 3OL2A 3U30B 1DL7L 2CXKA 4WUUE 1NBZB 5IV2A 2JKXA 2VDLL 1LK2B 4LCIL 4UT9H 5KW9H 4JR9L 1KTLB 3BDYH 3KYMB 3PNWA 5A2LH 4OZIA 4JN1L 4KKLC 5B38B 5I0ZA 1U8LA 2CGRH 4Y4FA 5AG9A 1W8NA 2IMNA 3WMSA 4OIAA 2B5IB 3LHPH 1RUMH 1AO7B 3ABZA 1WLHA 5I19H 3ULVC 4U05A 4NZTL 3QB7C 1UQSB 5HSFA 4TVPH 2PETA 2E7HA 1A6WH 1RZ8A 3O41B 4XCFH 1OSZB 3MRDA 5F89B 3ARGB 3QPQC 2G5BB 3V95A 4C57C 3TJHD 4W6WB 5GGSB 4RBPH 4YHLL 2IBZX 4BZ2H 1QLEL 3OZ9H 5HYEA 5JDJA 1FYTD 1RUAH 4TSAL 3SKJL 2NX5D 2XN9D 3VFNA 3MUHL 1AGEB 4WU5A 4GKZB 2WWMD 2E9WA 3BP4A 3P73A 4NWUL 4OZGA 4ZXBD 3TH4T 1KSRA 1PQZA 4PJFA 4RAVB 2D31A 3LRGA 1MJUH 2OTUB 3INUH 2Z35A 2IAMA 4HS8L 1I3UA 3UCRA 5CEZE 2HFTA 4FZEL 3VJ6A 3IDGA 5DJCA 3E3QC 3SE8L 4B50A 1KACB 3UC0H 1DQQA 1UWXH 2J6EA 3OF6D 3L3IA 1MEXL 1PX4A 4J6RL 4NQDA 3IDYB 1GC1L 3GSXA 3RY6C 4KK9D 3MODL 3AROA 5TDOA 4GMTH 2X40A 1QD0A 3KAAA 4DQOL 2H26A 1J0YA 5DMYA 3KPPA 3G08B 2FCBA 2VNCA 2BDNH 4P5TD 4JANB 2LU3A 2FJFB 4P99A 4PGCA 2CO6B 2FD6H 43CAB 4P23C 2ZCKH 5KVGH 1HILB 3QDJD 2EEAA 4LK4A 3BPLB 5CSBA 5IWLA 1KTLA 4NPYA 43C9A 4E41B 2YK1L 4JJ5A 4ERSH 4YHML 4RGOL 1MCNA 5SX5H 2A6IB 4YXHL 4DGIL 2NY0D 3TV3H 5A40E 4G9FA 1A7PH 4NN5C 3S88L 5K9QI 4PRHA 1CGWA 2F5BL 4NCDA 1T1XA 4KKAD 1DQDL 5CSZA 3AAZA 3K0WA 4JRWA 1U8PA 2ZCHH 3FB8B 2BHYA 2CK2A 4FFVD 1KCRL 5GRXG 1N5YL 1DTUA 4YC2C 2FO4A 1DANU 5E8EA 5JUEH 3IDXL 1ORSA 2APBA 1BIHA 3CSGA 2Q3AA 1EUUA 1OF2B 5DJ8B 1QP1A 4K9EL 1I9RH 3HG1E 4I18A 4HWZA 3H9HA 3TJHC 1C5BL 4P3CH 1ZLUK 3FRPA 1RZFL 4H25A 4I2XE 3FQTA 4JFFB 5EO9A 3LEXB 5IGXH 3LN4A 1A5FH 3QDGD 5ISZB 3DX6B 4R8WH 5HDLA 4PRHD 4LEXL 3UZEA 4G9FD 5CSGA 5EOQL 4YXKL 4PGBB 4HBCH 1A64A 4QYOA 3DX9B 2EKJA 4JCLA 5KS9A 2DIAA 1HWHB 1HSBB 4XAKD 1EGJA 1DR9A 2VE6B 4JFPB 4F7TB 5GS0D 3L5WA 5D72H 5INCB 2EYRA 4ZYKB 2ZG1A 4Q2ZB 3QDJA 3EYVB 5DFVD 2QQKH 4YHMH 2O5YL 2OXGA 4KKCD 4N8CH 3L3OB 3CX5J 3RWHA 3D0VB 2BY1A 3T2PA 4ENEC 3UPAA 1X5AA 2VOTA 4IRZH 5DEGA 1I7ZA 5IW6A 1JZ8A 1ZS8A 4NQDD 4NN6B 3BPLC 3BUYB 3O2WL 2KKQA 3OF6A 1RSFA 1ONQB 3ZDYE 1H8OA 1MRFL 1PY9A 3PJSA 3UO1H 3N9GH 2IPKA 1VKXA 1RK1A 2YN3A 1MSPA 1F6LL 3ALPA 3L3KB 3QG7H 5EORH 4OSUH 5H94A 4PJIB 1A1MB 4HAGA 2B1AH 3TPUB 1Q72L 2XZAH 4Z0XB 3L3DA 5F7WC 4ZXBA 3V5HA 1Z3GL 1F58H 5E99H 3JTTB 3RGVB 2FBJL 2NX5A 2XN9A 5C0EA 3JV5A 5KAQF 4HUVA 4B53A 1C08A 4PJ9B 3EFDH 4PJAE 3BWAB 4F2MA 1T2QL 1BFOA 3C6SA 4DVBB 1NGZB 1WSST 3U4EB 2EIZB 4AIZB 4QNPF 2AAVA 1U92B 2YOCA 1ZE3C 5D93C 3F7PC 3P77A 4LVHB 2ZG2A 1ROWA 4J1UB 1KN2L 3HZYA 1ZT1A 1G84A 3EW3B 1OY3B 5DSCA 2ZSWB 3LH2H 3LD8B 5E9DB 2K7PA 4G6AD 1U41A 4R4BB 5LQBH 5HXMA 1DLHB 4XNZB 1EGJL 3MRCA 1U8KA 4UV4H 1FJ1B 4O9HL 5CBAA 1NCDL 3PGFL 3TYFB 5KG9B 1MHPL 4PJXE 3UYOD 3HR5B 1JPST 2YZ1A 4UB0H 2MOVA 3MGAA 4MDIB 3BISA 5KVDH 3VGAC 1MFEH 3AY4A 3ARXA 4H5SB 4NC1E 3IRZA 2H1PL 4OF8A 5TH2B 1CBVL 1CFSA 4Z9KB 3SCMD 4HFWB 4X0KB 3QNYA 5GZNC 5KJRL 3ZT6A 5CEXB 4PRIA 2NY7L 3BP7A 1VEPA 1D3CA 1W0YT 1MFNA 1MHCB 5LCVL 1MREL 2ERJC 5HYSA 2GW5A 3GDBA 3EJYD 2DKUA 5ABDE 1LO3H 4XP6L 2D03L 1Z9OA 1WGOA 4YHNA 1C5CL 3F12B 3H9SD 2N56A 5EZOL 1G0XA 4YDJA 1A7OL 3NGBC 3ECBA 1QO3B 2RR3A 1DFBH 3QDMD 4OGYH 5D4QA 2GT9A 3TBVB 2W60A 3V6FA 2XQBH 3O9WD 1MNUL 4JFQB 5ESAB 3WS3A 5F1OB 4U1JB 4Y89A 3UJJH 2Q87A 2H32A 4LDOB 2AQ3A 3PL6D 3SDAB 2DLTA 1ETZB 1WWBX 2R4RL 1UKTA 4KK5C 4JQXC 3SDCC 2VR5A 1MFBL 1YECL 3BIAX 4IIQA 4K8RH 2W38A 4JO4H 4U3CA 4I0PD 5FUCE 3CFCH 2EDNA 5T1MB 2A2QT 1J8HE 4GMSL 3H0TB 2V5RA 1YDPA 2XV6B 4B5EA 4X6CB 1BJ1J 4LCUA 2JB6A 1KJ2L 1RHHB 4G7VH 3MJ9L 2DI7A 3MV01 1FGNH 1BX2B 1SBBA 4HDIB 5I1HL 2AJUH 1NAKH 2XXMB 1KIRB 1CD8A 4PLOB 3T8XA 1FG9C 5DHYB 4POZC 1ULVA 3LVEA 4CMHB 2DBLL 1IC5L 4WWID 5E0QA 1SQ2N 4NBXB 4F9LC 4U1HA 3SJVE 1FRGL 5I1KL 5DMKB 4JO3L 3FRUB 2NY4D 2A6DB 5B3JF 5DJAB 1AR1C 3TEUA 4PRAB 3GMMA 3WHE1 3TZVD 2EEBA 2J12B 4QHLB 3LPGA 5GS0H 5BZDB 2HFGH 1JGDA 1FLRH 5I1LB 3LSOA 3S4SG 3P9MB 1I4FB 2DOCA 4LLDA 2X6MA 3QWOA 1JTPA 2FIKB 4FQHA 2Y25A 3BEWA 5EZLA 3V7AE 5ITFA 4Z7QE 1Q9OA 1FN4A 4YX2L 2AEQH 5ID1A 2HMIC 1A6TA 2ZCKL 5I30H 2DDQL 1C16A 4GXVL 2AI0H 4MDJB 1MCPH 1JGEA 4GQ9H 3D3VD 3EJZD 4U6TA 4NHUA 3MROA 1ZA6B 3V7MA 3S97C 2CDFA 3AREC 1YEDB 1LEKB 4WDIB 3GK8L 1IEAA 3J8F7 1NGWB 1D9KD 1DQTA 2AJ3B 3IDMA 4W6XB 1HQ4B 5ID1B 5JXAL 4MA3A 3NACL 3HR6A 3K74B 2WIIA 3U9PL 3VD9A 4MJIA 4ZPTB 3ARRA 2HT3C 2RIKA 2FIKA 2AERT 1YEJL 1YUHA 3QCTH 2BNRE 3UTSE 3WNKA 1JF6A 3O6FD 3PDOB 2AV7A 2ADGA 5BJTA 5HDQL 4EI5A 1J86A 4DKAA 1NL0H 3ZTNL 1INEL 1QFHA 5L0QC 3FKUS 1BFVL 3LEYH 3Q3GA 3P4NB 1KJMB 1QNZH 3RVTD 1JYVA 1Y0LB 4Q9QH 4HWUA 3FL7A 3ULVD 1JUFB 2FHBA 2D7QA 1IZKA 5JIHA 4D9LH 3B5HA 4Y1AD 3CFDA 1AQKL 3VGBA 2CDGA 2HT2D 3FO1B 1BEYH 1RJYA 3W11C 3LPFA 3IAGC 4K7FA 4WW2C 3QULB 1XCTB 1LE5A 2NZ9D 4JFOA 4M9PA 4HIIB 4GKNA 4KFZC 5K59F 3C2SA 4WI2A 5CWSA 5SX5K 3UEZA 4LCUB 5L9DH 1IGCH 1K8DB 1AGDB 2X1WL 3O6LH 1WTGT 4YHZH 4KY1H 5D8JH 1F2XK 4PJFF 2BNQA 2KZ1B 2AK4D 2WINB 3CVHA 5J8OA 4W68A 4K9EH 3NBNA 1XZ0B 3LKQB 1V7NL 1MLBB 1NMCB 1RUPH 5DJXB 2GITB 4N0YH 4OCRH 3AFLA 2J8OA 3DX8B 2JB5H 1RIUL 2ZOKB 4H20L 1JPFB 3N85L 5FO8A 3B9KC 4HIEB 1S3KL 1TQBB 3LOWA 3RVUD 3QIWA 5IMMB 3QO0B 4HXBH 4IOSD 2OTPA 2AKRB 4PRPD 1DQLL 3VWKD 1EZVX 1NGYA 4X6FB 4NSKB 1INDH 3QFJA 4FQCH 4KQ4L 4B0MM 4U0RC 3QUMB 4OFYD 3OJDB 4LSQH 1UM5L 4YHNB 4J3XA 5D1ZB 5GXBB 4I8DA 1E27A 2P8PA 3TH3T 5GZOC 3OGCA 3ME0A 4PY7B 2R23B 5DJZB 2D7NA 3C9NA 3C5ZB 4DVRL 4Q9BA 4AL8H 2B1HL 1FVDA 2HFEB 4QRPD 1I1FB 4OCYL 4HFWA 4X0KA 32C2A 4PB0L 1UCBL 1EGJH 4MDIA 4F15B 4DGYH 5FYJU 4EEEA 3HR5A 1WK0A 4BSWB 5FDYA 3ARFD 2DMBA 2PYEA 4AEEA 3E6FA 3EO9H 4OZIE 5GRUH 1MFDL 2OL3B 3CSBA 2NX5E 2XN9E 1XGQB 1KLGA 3GM8A 5D2NE 3QHFH 1GC1C 3HAEB 2DQHH 4WI4A 4G42B 3RKPA 1MRDL 5D1XA 1BJMA 4X6EA 5EO0A 4OFVA 3WFEL 5KJRH 2BVQA 5CJOL 5DC9B 1MFAH 3PWJA 4KUCF 4F8TA 5T3XE 2VXSL 2YK1H 4R90L 1FFPB 1FZJB 2AGJH 4JFED 5E8DL 3QEGL 1AR2A 5KANI 3VI4F 3K3QA 3CVHB 3MNVB 4JPWL 4UDTB 4ZUSB 4KRPB 4XAWL 1ED3B 4F2MB 1YC7A 4JDTL 1YYLL 4JFXA 3RX7A 3VW3L 2JJWA 2JF1A 2K1MA 4JPWH 3G5ZA 3K4AA 1S9YA 3FN0L 3K1KC 3PP4L 2R15A 2ZUUA 5F9WC 3F58L 1EUTA 2DB8A 2GJ6E 5DK3A 4CN4A 3QRGL 3QUML 4TNWF 5L88L 5DTFB 3BH8A 3PQYB 1CD9B 4E41E 4F7MB 3VXSE 1FZOB 4IOFC 3QRGH 2R1XA 3B2UC 4G8GA 4F80A 2VABB 1GYAA 4IRSC 3FT2A 3NFPA 2OJZL 1FL3B 1N6QL 4Z7OF 1FIGL 4ZAKC 3HI6H 3MA9L 4ZD3H 3BH9A 4YHIB 3EO0A 4H88L 5AZEL 3C09C 1LWRA 5IQ9A 4HH9A 2KQMA 3DXAB 4H8WL 2AW2A 4WTZA 2Q86B 1FVCA 4EI5B 3P9LB 2AV7B 1EH9A 4M1CD 5SV3A 2OL3L 5LGHH 3RNQA 4H0GA 3RWEA 2WIIB 5B22A 1IGJA 2AV1B 4GMTL 1I1YB 3STZA 4R2GD 3IU3A 1MFAL 2VN7A 4YWGL 2NY3C 5DURD 2AEIT 3IDMB 2IPUK 2VZTA 4GH7B 2VLRD 3U0TB 1HNGA 4G7YL 3GMOB 3VA6A 4CRPA 2YRPA 1A9BB 2PXYB 3IKKA 2CLVA 1M6OB 1JGEB 5IJVA 1DQMH 2B4CC 3VXME 2F54A 3CDCA 1CQKA 1XGPA 2NY0B 4U2ZA 4XVJH 5DD0L 2O61A 2CK0L 5FM5O 4HWBL 1AI1H 2IF7A 1IJ9A 4NRYA 5ISZA 5JDSA 1OGAD 5ITFB 1JHTB 4X6CE 1NEZG 3CFIC 4R26H 2DQDL 1VADA 3I3DA 2EO9A 3BD4A 1MI5A 4PRNB 1JZ3A 2AK4E 3SQOL 1WFUA 4QY8A 3OKKA 2UZXB 1QYGL 5DFWH 5TPWL 3TM6A 2PTUA 1LO4H 5IROC 3P30H 4RFEA 3UTPE 1FH5H 3D69B 3QI9B 1BZQK 1N7ML 4UUJA 1UM5H 3WNPA 2L0DA 3UTTA 5I76B 2VLLA 5AZ2L 1D5MB 3I85A 3RVXC 3EDKA 4W4OA 3MUZ1 4FFZH 3RUGF 4P5TB 2B20A 3U79A 4WHYH 4X6EB 3QUMH 1T2QH 2E8YA 2YUZA 1E6JL 1ZHNB 4OD2A 5HYJE 3TBTB 4UTAL 5EH1A 3QIWC 3O2DL 2CUHA 3TH2T 4WTZG 4X4XB 4ZO9A 8CGTA 1KUMA 3HNVH 2X42A 1WIUA 3RI5K 5HHNA 3BIKB 4M8QB 5JZ7D 4FQ1H 5KTEH 4J3TA 4JB9H 4L4VD 4URTB 4BSWA 5JR1L 1Z5LB 2G9HB 2Y5EA 1T4KA 2NXYC 1YDPB 5T1LA 3VG0L 4F15C 1ZLVK 3CPLA 4QWWC 3BQUA 1F4XH 1WV7T 3OKYA 1YPZA 5DT1H 2D3VA 4PGCB 3T3PE 1DQML 5D7IA 4AY0A 5D1QB 2FLRT 5FKAB 4G8FB 1JGVH 4I13B 5MHSD 1MWAH 3ARWA 1WEJL 4YZFE 2BVTA 3OGCB 5MEPA 4KXZH 2OP4L 4NP4L 1GAFH 4TTDD 4ONFH 3FQWB 3RUGB 3LKSB 4WI7A 5TQ2L 4OLZH 5EBLA 1Y6NR 3MXVH 1FE8L 2D7MA 1H15A 4PJDA 4IRZL 5CGYD 3VD5A 5DRZB 4CU8A 1WT5A 5LXGH 2NY5H 4WY7H 4JM2C 4KMTL 4PGEA 3U7WH 1REIA 3B5GA 4KMLB 3L5IA 3LKSA 3AM8A 2AVGA 3SDXB 1K4CB 4LP4A 5IVNA 4FP8L 1NKRA 5FM8A 4LMQI 2Y9RT 4NIKB 3WLWC 1S9WB 5JW5A 1V5JA 3HB3C 3NTCL 3ES6A 4H5SA 3LQAC 2EDRA 4M6OH 5F89A 3D39E 5CD5C 3MLPA 4JG0L 4UAOB 3WIHH 2HJKB 2QQLL 5CJBA 3A6BH 5C6PB 2RJMA 3I6GA 2H32H 3T0EB 3U46A 3T0EC 1NCBL 4JFYB 4CBPA 4LKXA 1YJDC 1MH5A 4H20H 4R2GB 3EOTH 1OP9A 1R6VA 1KENH 4K3EL 4Y4FB 4JG1L 1U8LB 4PJBF 3NIGE 5E8OA 3VG9C 3ZE1E 3OR6A 2BNQE 1WBZA 1FLTX 1WWCA 3LQZA 1ZTXH 4HCRH 5DC0A 5F7KC 4KVNL 2DQTH 1M1SA 3JV6B 4R7DB 4R0LB 3D39D 3VRLF 3BKJL 3KPMB 4DN3L 5IBUB 3T2QA 1KC5L 4XGZA 2DLFL 5FGCE 4OLUL 2NNAB 3B6SB 4ZUTB 2FEEL 5HGDB 4DGVL 1MI5B 5BV7H 4YFLI 1CGTA 4HUVB 1HHGA 2ADGB 3KLAA 1P4LA 4XMPL 1F3RB 3TESA 1OTTD 1WAAF 3RKDD 1BQSA 4ELMF 3GGWA 5J1SC 2UY6A 4O02H 2VLRE 4FP8H 3IDIB 5ADPH 4XTRC 1R5VB 4I2XB 3SDAC 4L4TE 1AR1D 4UU9A 5IJVB 5H94B 1YEHL 2CLVB 4HT1L 1KG0A 4Q9CA 5HHOA 3WEXB 2JIXD 4G3YL 4AM0B 5LQBL 3U0TA 3CXDH 3A67H 4ODHH 5T3ZH 5TFSH 4JFFE 3MLTB 2BMKA 3OQ3B 4MYWB 1MY5A 3IU3B 1I7ZB 1MCSA 1DBJL 3ETBF 2FATL 3PL6B 3FTGA 2A9MH 3LN5B 2VDNL 3QIBC 4L3EE 4WFHD 4L3EA 4F33A 4EBQL 1KJ3H 1WFNA 4WEMB 1LNUA 5C8JA 3TNMA 4XH2B 3P9LA 4U1LA 3QEHB 1IGFL 3EYUL 1FVCB 3DV4B 4J3OC 1FORH 3H42H 4QHLA 4A6YB 4B7IA 1T7ZA 1ZLSL 3EO0B 4Y5VC 2ARJA 4LVOC 4ZS7L 4HHAA 4LCCC 3TN0B 2ICEA 2A6DA 4ZFOB 3S98A 4PP1C 2W9EH 1A6VH 5KS9B 2I25N 1CXLA 4MAYB 1OP5K 4OF0A 1CL7L 2DF3A 3KDMA 4LF3B 2XI9A 3T1FA 5JPNB 1W0WB 2EDBA 2GHWB 3EIFA 1KIRA 25C8H 3MV9E 3U6RA 1A4KA 4NJ9L 4YPGB 4M7ZB 5EULV 5C07E 5IR1A 2R2BB 1JGVL 3TO2A 1NAMB 3NABH 5B8CA 4CDHA 2JB6B 1B0RB 1P69B 3QQ4A 4NO3A 5EOCH 1AIFB 5JOPD 1ED3A 3CDYA 5ACZA 1FC1A 1AQKH 5GS1C 2E8ZA 3LZFH 5HPOA 1KCKA 3W9EB 4XC3L 3CZFB 4XP9L 4NBZB 1P4IL 2FO4B 2V5TA 5I15H 3U0PB 1CTOA 4KROC 4XCYB 2MHAB 5GGVH 1FO0A 5GRVL 1FV1B 2ENSA 2BVQB 4LLVA 1KXTB 3T0VA 3L5HA 2H32B 4UBDC 3HFML 4PJAB 1NAKL 5CJXA 1KB9J 5JOEA 1P7QA 1RPQA 3F7QA 2BSTA 4D9QE 3EYFA 1A3RL 1A02N 1JJUA 2XYCA 4Z6AT 4YHYC 2X4SB 4HKXA 4D9RE 2K9UA 4MJ5A 4U1KB 3RIFK 1H5BC 5DRWB 5J6GB 3O3UN 2H8PA 5C9KA 1FH5L 4PG9A 4UV7H 5I1JH 4ZO8A 3TF7C 5E08H 3MLRH 5ESVB 3TCXA 4I9WE 1RZIA 4D3CL 4R96B 1UB6A 5AWNH 4HIHA 2KH2B 3B2VL 3EZJB 2IANB 1MVFA 5KSVA 1KENL 1D9KC 4NQDB 1F4WL 5AWNL 5DQDH 3RHWK 3MV9B 3RBSA 2J3SA 3TZVB 4U1IA 5C07D 1G0YR 4MQTB 5B39G 3ZYOA 4Y19D 3HAEH 5EBMB 3VJ6B 2EDTA 4QT5A 2CIIA 2M1KA 5DK2A 4FS0A 1CZ8H 4YO0B 3TYGL 5IB3A 3QIWB 4PJ7B 3WJJC 3O0RL 3RJDA 4HIEA 5I8CA 1ND0B 5ANMB 2V2WA 2NXZB 5FO8B 4GBXD 2AJZA 4PREB 4UINH 3BVNB 2OR8A 1CZ8L 2ZOKA 5T1KB 4PRPE 5HI3C 4O51A 4LSVL 4CVZA 4L5FL 4YDIL 4Z5RA 2KL6A 4QOKE 3V0VA 4TPRH 2Y5TA 4Y16D 5JR1H 3CAFA 3GBLA 4HEME 1H3UA 1MAKA 4JLRA 1NCDH 3SGJA 3MRNA 2NY5L 3MGTB 5F93C 2APTA 3RL1B 3MBEC 4MAUL 4WUUA 1LE5B 2ESVA 3NZ8A 5DUML 1RMFH 4PLKC 2O26U 4P5KB 4QXUL 1AO7A 1AO7E 2PR4H 1VFBB 1VFOA 1PKQE 5J4MA 4TVPL 4FFZL 1F3JA 1U3HA 1VGKA 5F9OL 2AEPL 1X44A 5B38A 1NBQA 3NPSC 4OZIB 1JUFA 2PXYC 2NZIA 2WV3A 4Y5XA 3SE4C 4GW4B 3C8KA 3VXRD 1VEOA 4QF1A 3BQUC 5HJ3B 1QSEA 2E27L 5E2WH 4PJHB 1HQRA 3JBG7 3FAXA 4FQ2L 5C0AD 4DEPB 5I8EB 5EU4A 3SCMB 4F3FA 2N7AA 3VI3E 3MA9H 4DJMA 2BK8A 1JWSA 4UIMB 3S96A 3HC3L 2APFA 1V05A 3UYPA 5TQ2H 2VJXA 4X99A 3WSQH 1PSKH 1A1NA 1TQBC 1ZHKA 2BY2A 3S3PA 4Z7WF 1A14L 2AS5M 2VE6A 4F7TA 2J8HA 1F02I 5H35B 3MYJB 4N5ED 2R56H 4GW1B 1CR9H 2HKHL 3VFOA 2A6KB 2YD6A 3L95B 5JLZB 4O5LL 4JDVB 5JQ6L 2CRMA 1HHIB 3PV7A 3LEXA 4JFDE 3SCMC 2PTTA 4I0PB 5SWZB 3MYJA 3KXFB 5E2VL 1KJVB 4S0TD 2VB5A 3P9MA 3LSOB 4X9FA 2DQFA 3ESUF 3CUPA 1NUGA 2B2XL 4X99B 1F13A 1YEKL 4HSQA 4Y0GA 1G9EA 1WJ3A 4FXGA 2Q8AH 3MR9B 4RGND 4JZOA 5K9JL 3VFTB 4Z7WB 2PNDA 5DZLA 2ITCA 3DUHA 1UA6L 4M5ZL 5FKPB 4G80B 3WJLC 1VESA 4OZHB 2YD9A 3HC0A 1T1XB 3DUSB 1WZ1H 4PYHA 5IQ7L 3T8XB 4PJHA 4CVUA 1KB5H 1CDYA 5I9QC 1B2WH 4Y4KD 4ORGA 3MBEB 3QIUC 1EHLH 1KJVA 5HJ3A 1BX2A 1IGFH 1FAIH 2PTTB 1CGSH 4DW2L 5D5MF 4ZUWB 4XZUA 2HVKB 5IK3B 1UM6L 2DLGA 3UDWC 3LEYL 3PWUA 5DJ6A 2WAHA 4X9GA 2X89D 3D25A 2C1OA 5I1DA 4N0CC 4MA7H 4P5KA 4O58L 1FDLH 1A1NB 5TDOB 3U7AA 3HNTL 4JQVC 2HN7B 4RMWA 1LO0H 2EXYD 3HC3H 4MD5A 3MV8D 4YGVB 3X17A 2XFXA 4WO4A 4J2XA 3INUL 3M17B 3D3VB 4HG4K 5FA3A 4MNQA 3OG4B 1OQXA 1IBGL 2XTLA 1XF2A 2Q3ZA 3FT4A 4GAGL 4L1DA 1FZKA 1AJ7H 5I8EA 1D9KB 2R1WB 2PYFA 1HQRB 2PO6C 4RA0C 4QRRE 3TO4A 1X5HA 1PQZB 2HKFH 4BUGA 5DYOB 1W72B 4M62L 4AEIL 3BP4B 3HI6L 3BP7B 4PJ7A 5HHXL 5K33A 5CEXA 5DD0H 4POUB 1IGYB 5C09E 1Y6MR 5AYUL 1GGUA 3B9EA 1G0DA 5CINH 2BFVH 1ZVYA 2V9QA 3ZYJA 1FLRL 3HZKB 3ARDB 5DD5H 1IM9D 2C5DC 1YJDL 2HRLA 1NDGB 4JPKL 1FFNA 1RVFH 5DDHB 2BFVL 3D0LA 4JY5H 5SWQA 1IGIL 3O6FC 3TYFA 5KG9A 1RZFH 1GGYA 2HYMA 4U2YA 4YWGH 3O8XC 4RCAA 4WW2B 4TNVK 3T0EE 3TCLA 3IXAA 4HIHB 3RL1A 1TVBA 3NA9L 1WF5A 4R4BA 1U36A 1X5LA 3R06A 1JMXA 4DUXA 1KLUB 4Z76B 1J0HA 1IAKA 1PFCA 2DRUA 2XA8L 3S35X 1WZ1L 4JG0H 5DMGD 5CZKA 3V0VB 2BOBB 1JPGA 4NQSB 3MJ6A 3QUZD 1X7QB 3IFPA 2ZKHL 4H0IA 4WFED 1FYHB 4XNMA 3QJHA 1JNLL 5FYKH 1LEIB 1DSFL 5D72L 5C0CD 1T6VN 4QRUA 5T1KA 3TJEL 5JHLH 3RTQC 3KYAA 1KN2H 2DWDB 1VFMA 3D85A 3Q5TA 5DFTA 1CFVH 3BKCH 3RIFF 4OFPA 4PJAA 4FQCL 4FFVC 1NANI 1C08B 4PJ9A 1LEGB 3IS0X 4P3DA 5D1QD 1OAXL 1QYGH 4P9MH 5GRUL 1KPUA 3HG1D 1MFBH 1YECH 2DMKA 4K8RL 1HIMH 4KTDL 4QTIH 4FQXB 4F7EB 3BGMA 3DRQA 3WUWG 4ODWA 5I73C 1NUDA 3QWRA 4GKSB 2J8UA 5MENA 2P24B 1FFOA 5EDXA 4X8JB 5IVXA 2A1WL 4NO3B 5IBLC 1EEYB 1WFOA 2RHEA 4IM8A 4RGNB 1QKZH 3D18B 1AXTL 4R96A 4K7PL 4OT1H 1X4YA 1CDGA 3WV0A 4ODXA 3RJQB 5I2IA 1CICA 3OGOE 2C3WA 4K8RD 4NQXA 1TIUA 1JL8A 1OAKH 4P2QB 2UZIH 4EDWL 1EO8H 4N68A 3E6HB 1AD9B 1IE5A 3GJFA 3H7BB 2PCPB 3EYFB 2PW2B 1KIQB 2OJEA 3KG5A 4XHJC 4GW5A 2P47B 3LRHA 1EEZB 5F6IB 1S7QA 4LNRB 2ZJSL 1P9MA 4OAWB 3GO1H 3GUTB 4KAQH 4Z8FH 1J05A 4XC1H 3EYSL 2C3XA 4X6DA 5TE4H 1DANT 3BEVB 1RIUH 4XPBH 4LHQB 1GGBL 5C92A 4MXQC 3MRHA 4BFIA 2DQDH 4KHTH 2JCCB 2ATPA 4RNRA 4OD1H 3GB7A 4PV8A 5DD1L 3SDDA 1G7PB 2VSCA 2EXWD 3DI2B 2YUWA 1PLGL 2X4QB 5CD5D 3WNNA 3RTQD 3MRRB 3IF1B 1I8LA 2NW3B 4RWYL 4YPGA 3RVXD 4AM0A 3JV4B 4MA1B 2NY4B 2UWEB 3UPRB 1LE9A 1OGTA 2HTLD 4KTEH 5JPNA 2GJZA 4U6HB 4UU9B 2XIDA 2CLZA 5E8PB 3UAJD 4AMKH 4L8DB 3BGMB 3DRQB 2UVEA 5IOPA 4A2LA 4LPVA 1TQCC 3DOSA 2HFFA 4HUWA 3DIFB 2RGSA 5C6TL 4MCZB 4PRHB 2ARJB 4XPAL 4YUEH 5GGQH 1MVUB 4XP9H 1IM9B 2NY1B 4HKZB 4PJEA 2EXYC 3QEHA 4NN6C 1AFVH 3KPMA 3VMNA 2GCYB 2X70B 4HGWA 1OQOA 2R69L 2IH1A 5GS1B 2DQHL 3FHAA 5CLWA 4F57L 3IFPB 4N8PA 2V5MA 4H8WC 4N8CL 2X1XR 4OF5A 4RAUB 5E6ID 1RJCA 2BMKB 4ZOCA 3S37X 4OV5B 4NUJB 5TPWH 1UADC 4AH2B 3SGDH 3R0NA 5D7KD 5L8KB 4EUPB 3Q1SL 4HG4J 4HV8B 1HWGB 3SEPA 4X8JA 5IVXB 1KT2B 4L4TB 1TTUA 5SWQB 3VW3H 1P6AB 4BQCA 4MMXC 1U3ZA 4P49A 5C0DA 2XQYK 3BXNA 5J12C 5E56A 5BRZA 1NCWL 3FFCA 4N1CA 2YRZA 1JZ6A 5DI8B 3TN0D 3RAJL 5KSAD 4IRSA 3FCTB 4P4KB 4XNZC 3PABA 3CFBB 5HVGB 4UILL 5HI5D 1JVKA 1YEJH 3SE8H 1GH7A 3NAAH 2A0LD 5ESQA 4M48H 3WXVH 5IB4A 2EDDA 5I66B 4MNGE 1WISA 4S11A 1IAIM 1YQVH 1BHGA 1EK3A 2J5LB 4WFFE 4D9QD 4QRUB 2VZUA 5ISZE 4JO3H 5IFAH 4LGRB 4GAFB 4QRRB 1QFWH 3LIZL 2YN5A 3RWJA 1GXEA 4MNQB 1L0QA 4HJJH 3HCVA 4HQQH 4LFHG 3MRBA 4PJ9C 2HN7A 4Q9RL 5KVEL 4X83A 1NSNH 1IAIL 3FQWA 1R3HB 1DUZA 3G6JA 5D71H 4C54A 1M71A 4NT6A 3MLSH 3OKNB 3RDTA 2D2OA 3I6GB 3D0LB 5I71B 2GJ6D 3GSNL 4YHKH 3QZWB 4M61A 3ARDA 3HZKA 4RAHA 2A6JA 4QTHB 3Q2CA 4LLUB 3SDCD 5JW5B 4TOYL 3EYQD 2NY4C 3FB6B 5L7XH 3I84A 4K23H 4JHAL 2W91A 2EDWA 1LK2A 3BIKA 4XPHL 3FQNA 4JRXD 5D1ZD 4X4XA 1JIBA 1RAMA 3S36L 1OAZH 5H37G 4XAWH 3DHJA 1FZKB 4G6KH 4YDLC 4GG6B 1XF2B 5F9JA 4M48L 1NL0L 4YQXH 5GIRA 3VXOA 3ZTNH 5I1GH 1KYOJ 2FL5B 4KDTA 1XIWB 5I1HH 4YHZL 3HS0B 1IRAY 4QHKI 1FFQA 2YD7A 3BO8A 4M5YL 5C0FB 3KYKH 3V4PL 1VEMA 2IFFH 4Y4HD 3D6GA 3NACH 2A9NL 2RBLA 3LEVL 3PUCA 4PJXF 2PO6A 3KXFA 5I6XC 3KPSD 2CJUH 4NBYB 4K07A 3P4MB 3GK8H 1J1XH 1H3VA 3BQUB 4TSBH 4PJCE 3AC0A 3FFDB 5HI4C 3WHE0 3QHTC 3L95A 5IK3A 3EOBA 5C08B 3OXRB 3MA7B 1J9CT 1SYVA 1ZGLM 4ZOAA 1NCUA 5EOCL 5IVXE 4EI5C 3VGHA 1H3TA 4UV4L 4QHUB 2GQHA 4G9DB 4AEHL 2E6PA 3MREA 3RL2A 4WU7A 1RFDH 2BJML 2QHRL 4JAMB 1GHFH 2WK2A 2VO5A 4YEEA 4F7CA 3T4YA 3UTQA 5TF0A 3W5NA 3CJJA 5F8QC 1G7IB 4J6RH 3IJHA 4KI5D 5GSVA 1N64H 1K3ZA 4TTGA 3STZB 4JFZH 4GS7B 3HRZB 2K7QA 1CDJA 4DGIH 1TJIH 1NMCC 4F7PB 3JWOH 1BOYA 2Z92B 3UTSA 1YY8B 1A2YA 1TZGH 1E28B 2XRAH 5CZXC 5EU4B 2FB4H 1P7HL 2I26N 1U58B 2Z0BA 4MLSA 5GGSY 1EO5A 3QIUB 4CVXB 5E1HB 2CGRL 2JJSA 3BAEL 4PJFE 3QT2A 3SGJC 3VU2A 2NXZC 1MPAL 1QSFE 1JZ2A 1MJJA 1AP2B 3P0YL 2UV3A 5IEKA 3FT2B 1L9MA 1GZPB 2R0KH 2QQQA 5DLMH 5JLZA 1U3HB 2AABL 3DGGB 5FDWA 3OPZL 2VYRE 3FMGL 3KLHC 2PXYA 4OF3A 1AHWB 3CZJA 2W65B 2AABH 3T0BA 3QUZC 4PJ5E 4KJPD 3PIQB 3CFJB 3G5ZB 1QACA 3OJVC 4PY8J 2OZ4L 2P43B 3LS4H 4YBLC 1Q8MA 2VDRL 2NY6B 3MRJB 3QG6B 3Q1SH 1NFDA 4KKCC 1J10A 4Z5RB 4ZS6C 4D3CH 3UTZB 5MEQB 4NZUL 5IHZA 2WBJD 1E4XI 4K71C 4O51B 4M4RA 1G7QA 5CMAA 4K3EH 4ZG1A 2QQKL 1MQKL 4TVPE 3DMMD 3FB5A 3O6KL 1FNGB 4S10A 3MFFA 4L5FH 1ZGLA 3HB3D 4NM8L 4QF1B 5DQ9A 3SOBH 1M05B 1A6AB 1YC8A 2OJZH 2BCKA 1KPRA 4XPTH 1KCVL 4Z18A 1XGQA 5F7EH 3VWJC 3RIAF 2IADB 5CEYB 3WXVL 5E9DE 1I8KB 3G9AB 5BS0D 1VGKB 1T7WA 1MRFH 1VFBA 3P0VL 2FX7H 4LNVA 1U8QA 5ITBL 1DLFH 2FWOB 1A21A 3MV7D 5EC2B 2YD4A 5AYUH 4FNLH 1OAYH 1T5XB 2HVJA 4XXDA 1I1FA 1EVTC 4LPWA 4HK3N 2AJYL 2NTFB 1TVDA 3CU7A 4QOKD 1AC6A 1S78D 1VSCA 2RCSL 4L9LC 4Z77B 1J8KA 5J9PB 4PJBA 4UQ2A 4OCSL 2E7LA 1M7DA 5IIEA 3VXMA 3OWEA 3ZE2F 2G60L 5EUKA 5B39A 5F88B 2E9BA 1UC6A 3QIBA 2ZSVB 5DRWA 5J6GA 1HEZA 2E27H 3VFRB 1F4YL 4Z78A 5D70H 1X3DA 5E95B 1T2XA 3X13A 4QXUH 4DOHE 4HIJA 1G7JB 4CMHC 1ND0A 4YDLB 5D1XB 3O2VL 4YFDB 1RI8A 2BVEA 4RFOH 1UB5B 3U7WL 1S7XA 5HGHA 3CDGA 3OKEA 4MQSB 1KLGB 1NC2A 2JJUA 3DX8A 4ODUA 4QT5B 3X13B 2EICA 3BZFA 4PB9L 4X7SL 5EBMA 1FO0B 4JGJA 3NCJH 2E5EA 4LLQA 4ESKA 4Z7VE 2EECA 3DX7B 5F3HA 5C6TH 5B39B 2HT3D 4NQTA 3VDCA 2RAMA 3VXMB 4WV1C 1N4XL 3L1OH 2Y06L 4NO0A 5HYJA 3LQAL 3OR7A 1SMOA 2IPTH 1NAMA 5JUEL 2HT4D 2WNGA 3C9NB 3UC0L 2BZDA 2JJSC 2XWJB 1AGFB 5JQHC 3MRMA 4KKAC 1PEZA 4K7FB 1G7HB 1U8NA 1A1OB 3C5JB 3GRWA 3UTTE 5C9JA 4PG9B 2QLVB 3D2UB 4LF3A 3VMOA 3TZVC 1I8KA 2H9GA 1QKZL 3F65A 5ELIA 3THML 5L2KA 5L2KE 3MBED 3GIZL 4QRPB 4P46D 3I2CL 5JTWA 1U8IA 3K2MC 2Q8AL 1CLYH 1IARB 2EDEA 3VCLA 4MSWB 4M00A 4QLRA 4QWWD 2NCMA 3OJMB 2DJ4A 4MHHG 1IFHL 1DDHA 5F1IA 1R3LB 5ERWA 1YNKH 3GI8H 4HX1A 1CIUA 2DQEH 1S9KC 1CLYL 2M8XA 4PG2C 4U1LB 1MCPL 4JPIB 4JZJB 2FJGA 4PR5A 3RVWD 2UYLB 5CKAA 3IKCA 1LD9A 3CLFL 5CEZL 3CZFA 5DJYB 1Y18B 2GK0A 1YN6B 4RIRA 4DCQB 1A3LL 5CWSB 5IJKC 5ALCL 2XZCL 3QRFM 5GHWH 5DD6B 4WDIA 4GKNB 4GG6E 2QR0A 3U9PH 3QULA 2CXGA 3KWWA 4L8BA 1S7SA 3O3EA 5E6IC 5I74B 2VDPL 4M5YH 2Y07L 4PP2B 3O2WH 5TDNA 3KJ6H 1U8MB 4JN2B 4Y16B 4MDJA 3T1FB 3VFWA 2Q7YA 3VWJB 4HPYL 2AJUL 4MAYA 1Q0YL 1EDQA 1ZANH 5IW3A 4FQHB 3O9WC 4MCYB 3PWPA 3O4LB 4P57B 3WS6C 1AP2A 4JPKH 4NKMB 4F58H 4G7YH 2KBGA 3SKMA 1IGML 1R3IH 1KJMA 5I1AA 1P6FA 1KCRH 4I18C 1N5YH 3RZCA 4KK5D 3GSNH 4YHKL 12E8L 3BFOA 3CIQA 4P2OA 1CLOH 1FIGH 5F7EL 2P42B 5C8JB 3PDOA 1LNUB 1BZ7A 3VXRB 3UTSB 3ZDZF 4V2CB 2E7LC 3IB4A 3UAJC 4R0LA 3PWPB 5FGCB 3TFKC 3OKLB 1UWEH 5GRYA 1VCAA 1LVEA 1ES0A 3RX5A 3VWJA 4MA3B 4JHBA 3RY5A 1WIPA 1FL5B 4C83B 4Y16C 3UTQB 3O2DA 1DSFH 4CNIB 1YY9C 5CKGA 2CDFB 4MZ2A 4P2RA 1S7RA 1OAQL 3KLDA 4HH8A 1BPVA 1S78C 1OAYL 3R1GL 2R0ZL 1XF3B 4KZDH 4JY5L 4OLZL 1UACH 5C3LD 4S0SD 3MRLB 5IWLC 2Z93A 4XMLL 3NGBB 4KJQD 5BV7L 3NH7L 3FFDA 5FUOL 2DBJA 1F8TH 4NO2B 1A7RL 5DHVB 3KLAB 2IG2L 1YN7A 3F58H 3H3PL 5GISL 1A4JB 3NH7H 5FUOH 3KPRA 1B3JA 3EO1B 2ZKHH 3SGKA 2AP2A 4PRAA 1HHKB 1WWAX 4JB9L 4QRPE 5CS7A 3ARYA 4PGEB 2BHUA 3MCKA 4HC1H 1CF8L 1IM3B 2W60B 2Z31C 3VD3A 1BQUA 3MOAL 4WCYH 3D2UA 5D7JA 3PHSA 2CIKB 3BP5B 2OXHA 3CVHH 3KS0H 2OCFD 1I9EA 3EDEA 1U8NB 3SDXE 1FFRA 5FCUL 3ZE1F 4QRQA 4L3CB 3SN6N 4PRIB 1Q0XL 4N90D 25C8L 2ZOLA 3TA3A 5BV7C 5C0BB 4YFLF 1QHPA 3KPQB 3ES6B 1U8JA 3EFDL 1XEDA 4LIQH 4JEGB 5I75C 2NY1D 3FO2B 4LLQB 1TCMA 2FJHB 5D93B 1JCKA 2XNAA 4R2GC 5EFIA 2VH5H 3L7EA 1T66D 4P46C 3S34L 4KH2A 5FV2A 3BZEA 3WDHA 1MFEL 3BIBX 4ZPVB 4U1JA 1E4WH 5I74C 1QPXA 3OXSA 4P23A 1ZHNA 1I7RB 4WFFD 1RVFL 2R0LL 3V52L 3S37L 3V7AG 3S3JA 4DOHB 5T5NG 4UNTA 3QUYD 5IB2A 4Z78B 3VFRA 5E2JA 5J1AA 4AQOA 2ZSVA 5ENWB 1MCRA 1NGZA 1M7DB 1HHKA 2LAAA 2W9DH 5F1KC 5HYSB 5EZJB 4YBQD 1WVZA 1I1RA 1F4YH 4PJ8B 4I4WB 5IFHL 3UYRL 2EYSA 3Q6GL 4S2SB 1I8LC 5FYLH 3PV6A 4X6DF 1P84J 2NX5B 2XN9B 5DMIH 1G7LB 1V7MH 2C3GA 4IMLA 2EC9T 4LFHD 1B0WA 3U0WH 3FFCB 2EH8H 1EHLL 2X9WA 4C56B 4CADB 3T3PF 4TULL 1ZT7A 4U33A 3S5LB 1Z5LA 1R0AH 1CDIA 2WP3O 4MJ6A 2V7HB 4X7SH 4S1DD 4OCYH 1KLFA 4X7TB 1VDGA 1KPRB 2NYYD 3QQNA 1MY7A 3ULUD 3IFOA 3KPRE 4NNXA 4P2RB 1LO2L 1A7OH 1NLBH 4OD3L 4R8WL 4AH2A 4JREC 1ONQA 4NQCD 2VDQL 5TE7L 4DK6A 1JNHB 3TLRA 4R4FL 5DEFB 1I1YA 5DEGB 1IGJB 4RGNE 3RWEB 1WQVT 1D5MA 4ONHA 1EHXA 3WIIH 5IHZB 2J7LA 4PGZA 3SQBA 2QSVA 1A6UH 4RFEB 4M1GL 1MJ7H 4LSSL 3ULUL 2NY6C 2R0LH 3V52H 3IDXH 2FYYA 3KJ4B 3QBTB 3QO1A 1OB1B 3RZCB 4L8CA 5E8DH 2XOTA 2EYRB 3DIFA 4HUNB 2I9LB 4TUJB 5HHVH 1AHWA 4WEBL 1DVFD 1FC2D 1KTRL 3O4LA 3PGCB 3BDBA 4NWTL 2R1XB 4NRYB 5JDSB 5IOPB 1FZOA 4HUXB 5DHXB 4NM4L 5B4MC 1JP5A 1A1MA 1C12B 5TDNB 5CINL 5GZND 4JCMA 4GRWH 1WZLA 2C7UB 4H25B 1MCCA 1NCWH 3PJSB 2QR0B 4FRWA 4ELME 5D9SB 4YXHH 2P5WA 2VC2H 5DJ8A 1LDPH 1YN6A 2X4QA 2AV1A 5HGGS 3VXPA 1Y18A 3V2AR 3KNBA 4ALAL 3LS5L 4KKBD 1BZ9A 4UDTA 1BVZA 3DROA 4F7PA 4GS7C 1QBBA 4I3GA 1NFIB 4LHUD 4OM0H 1F90L 2NY1C 4P4RA 4X7EC 3AS3A 3BE1L 4Y5YC 3LS4L 4MVBC 1XF4B 4HK0B 5C0BD 4WHDA 1NKOA 4G9FB 5L8JB 4NZJA 2CRIA 4LU5L 3MNZA 3OAYK 3IFOB 3HPLB 4JO1H 3BDXA 1HSBA 2EE9A 5C09A 5IHUH 2Q76A 4G8GB 1QZ1A 2WWMC 2OL3A 3B9KB 3E6FB 4WIQA 3S88H 1T5WB 2V7HA 2Z31D 3GHEL 3H7BA 3ZHLA 4LU5H 2YA1A 1XFPA 3QA3B 3MA7A 3PQYA 1FNFA 4XPAH 1MHEB 2HP4A 3EHBC 3VXUD 4LEXH 3T0AA 1U6AH 2YPLD 3TC9A 1KN4H 4B7LA 1QFOA 2VL5B 4JANA 1ZKAA 3H9HB 1LP9B 5HHMB 2VAJA 4I18B 1S5IL 1IT9L 1XGRB 5DJZA 3GMQB 3MJ9H 2V6HA 2YUVA 3CCHB 4D0BB 5L7XL 3UZQA 1PX3A 5IM7A 1QRNE 2J8UB 5MENB 1WC7A 1T1ZA 3BGFC 1O7VA 1XIWA 4FN0A 2X4OB 3HMXL 5GIRB 1RURL 4FQXA 3VXOB 3DO7A 1FZJA 3TV3L 1FFPA 1ZHBB 3BZFB 1OLZA 2H6PA 3BPOB 4L8SC 2IAMB 2BC4A 2ZZUT 3GMPA 3MV9D 1CE1L 2F8VA 2NXYD 3UROR 1QR4A 3UPCA 4Q0XH 5DLML 3BX7C 3BKYH 3HAEG 4HK3J 4N9GA 4OZHE 5E2VH 3C8HA 1I75A 2Y36H 4LLWB 1L4IA 3QUXD 4GRLC 3L7EB 1FGVH 2WIMA 2PYEB 1DFBL 2GITA 3P4LA 4OGYL 3HE6D 1WBYA 1UKSA 3CFKB 4JRYA 4ONGL 5CGMA 5E8NA 1X7QA 2WINA 4NGHH 5GGTH 3ARGA 1Q72H 3S8WA 3PXJA 2VITA 2D0HA 3F7YB 3T2OA 1HINL 3VGDA 1RZ8B 2NTFA 4L3CA 4LSQL 5JXEA 4O2EA 1QPPA 2IBBA 2IG2H 2P5WE 4NC2B 4OGAD 1N8ZB 4MXQD 4FMKA 2YHGA 5JW3H 1OAUL 1NDGA 3UBXA 5FYLD 5JPMB 3PXHA 5GGRA 5D2LE 1IAIH 3QFJB 1A7NH 4TRPL 4X6FA 1NGYB 3JWDC 5MEOA 2IAND 4QRRA 3KYMA 3PNWB 1OAUH 2WZPD 4L4TD 4ODVL 5EBGA 4XCNA 4OQTL 4TULH 1K6QH 3EUUA 3H3KA 4JVPA 2BY0A 4ODSH 5FGRA 5FM5M 1H9VA 4RAVA 3SE3A 1A7BA 4PJFB 2PW1A 1XCQB 2F58L 3QXVA 4GKZA 1HYSC 1AGEA 3RGVD 3AXLA 4OQTH 1VGEH 3FQRB 1BWWA 1YN7B 1MLBA 2OZ4H 4XRCA 4OLUH 2DL2A 4MJIB 4ZPTA 3BAEH 3D87B 1S7UA 1EJOH 3DUUB 3T0DA 2JTDA 1T89A 1I7UB 3WDIA 1R5WB 1OSZA 2V2TA 5TDPA 3CLEH 2H3NA 3QG7L 4W4OC 5EORL 1IGTA 1IEAB 3VH8B 2L4OA 1UQSA 1RZKH 1RURH 1FG2B 5J6HB 5J3HD 1CLZH 1HSAB 2IQAB 2ZUSA 4Z0BH 4X7FC 3VI4E 2MWCA 4U6YA 4OZHF 5J0BA 4OFIA 3T4AA 1MLCB 3DSFH 3SPVB 3B8SA 1T22A 1FN4B 2APXA 4K3DL 4MHHI 1KPVB 3I02B 3LKPB 2XXCB 5EG6C 1O7SA 1RV6X 3MRFA 4LQFH 1VPOL 2VDPH 2FECI 1YMMB 3MV11 2A77H 5EA0L 1BFSA 5SWSA 5EU7E 1NBZA 4EIGB 5CHNB 1JPSH 5JOFB 1GOHA 1NCCH 1V3JA 4E0RB 5JMRA 4J4PD 2DAVA 4NNYA 4WUKL 4N8VG 5BJTB 2ED7A 4CN1A 3C5SA 3OG6B 4XNQA 1TMCB 1I3RA 3S6CA 5C0ND 3DTXB 4FQJH 1BM3L 3UJIH 3V4PH 3GHEH 4FXGB 1GRWA 3MRGB 4QOKB 3O8XA 3WO3B 3MZTA 4IHOB 1PD6A 3PWLA 1WCBA 2GFBA 4RZCA 4XT1C 4KV5E 3WFBL 4AMKL 4JM2D 2V2XA 3KWWB 2X9XA 4GLRH 4QHUA 2ERJB 1QSFB 3SJVD 5SWZA 4PG2A 1D5IH 5DD6A 2CR6A 3MLVL 4MLIA 3P11L 1GC1H 4TPRL 3X11B 1JTOA 2ZCLH 4N0UA 1G7PA 5EIQA 4M7JH 4MX7A 3ROOB 5JIPA 4GOSA 4RFNB 4PJXB 3MRHB 4BFIB 3G5XA 3W0WB 4LCCA 3RWIA 3ZSTA 5F1IB 5C0FA 2HKFL 3MLZH 4PS4L 5F6IC 4YAQA 4K3JL 2MJWA 1HI6A 1ZHLA 4XPFH 1NQBA 5SWZD 4AJ0A 1I85C 2VLJD 3SO5A 1T0MA 1U91A 3ECBB 3H7LA 1AD9A 4S1RH 3C60B 3JVGA 4UOW1 3B83A 3CSYB 4BQBA 4NKQB 4NWTH 4IS6B 3KLHD 5DHYA 1C5DA 4K3HA 4M5ZH 1KNOA 1X5IA 2VIRB 4J3VA 2XWJA 1NDMA 1VB9A 1FYTB 4DN4H 1HHHB 3E0GA 2MQ3A 4V1DB 5JW3L 2V7NB 1DEDA 1QEWA 1RHHA 2B0SH 3OR7B 4RWHA 4N5UA 2BRRH 5H8DA 3O3AB 1X5JA 4PRDA 1CFSB 4J4PA 2XTJD 4NNPH 2BNRA 5IP4A 1JPSL 3PQYE 3H0TA 3RFZC 1H5BB 4HJGA 3GIVA 1BECA 5HDOA 2P48B 3ULVL 3P11H 1FNEB 3RDTB 3OKNA 1NUFA 1F11B 2MQ0A 1NC2B 1L9NA 3RAJH 2F74A 4K7PY 3CDGB 3ZE0E 1T04B 2V17H 1QNZL 1S7XB 3VFGH 3VG0H 2MFNA 4PJ5A 1CL7I 1UB5A 3LV3B 4XC3H 1FAKT 5C0CE 5C1MB 5EWIH 4HZLA 1F97A 4I3SH 5DFVC 1MCQA 2ADIA 4L9LA 2X4RB 5I8OL 4KJWD 5C0IB 4JHWH 5DSCB 1LEIA