4S0TD

Structure of human pregnane x receptor ligand binding domain bound with adnectin-1 and compound-1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
91
Chain Sequence
b'ADLEVVAATPTSLLISWPPPYYVEGVTVFRITYGETGGNSPVQEFTVPYWTETATISGLKPGVDYTITVYAEMYPGSPWMDIQPISINYRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear receptor subfamily 1 group I member 2
publication title Developing Adnectins That Target SRC Co-Activator Binding to PXR: A Structural Approach toward Understanding Promiscuity of PXR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 91
sequence length 95
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s0tD00
1NBZA 4HUXA 4JRXE 4G8FA 2P5WA 2VDPH 1LO3H 3KXFE 3RWEB 3QWRA 3TT3H 2ARJQ 4I77L 3ZL4H 4PJ7E 4JZNA 4XCCH 4Y19E 5I17A 3ZYJA 2WUCH 1RUMH 1CGWA 3AS1A 1QSFD 4WWKA 1CS6A 2EKSA 2ZUWA 2AJUH 2OZ4A 5D72L 2HFGH 4J6RH 2X2YA 4JZJA 1NGZA 1QUNA 5EC1A 1AR1C 3PGFH 4XCFH 2R15A 4O58H 1CU4H 1I8KA 4XTRD 4DKFH 1QG3A 4ZODA 4LASL 3ALXA 5HPMB 1ZVHA 2PTTB 4PB9H 1MCPL 1D5ZB 1YUHB 4MJ5A 4BQBA 2W0PA 1RUQL 2ENYA 3QDMA 2IH1B 4QXUL 4QRPA 4Y16C 2GKIA 1ZEAH 1YQVH 2CIIB 4PV8A 3HG1B 3ZE0E 4GG6A 2D0GA 3PHOB 2K7QA 5I8CA 2PXYB 5DVOA 3GIVB 1TTFA 3CAFA 4UV7H 4D9RE 3D39E 3W11C 5DJ2B 2HP4A 3FOLB 4LOUC 5DR5L 4APQB 2GY7B 1Q0YL 4K23H 3ECBA 1HQ4A 2NXYD 1QO3A 1FDLH 3OX8B 3ROLA 3QAZB 4XAKD 4PJCE 5I8KH 4WV1C 4HKJB 1KCRH 2F5AL 5K9QG 1V7ML 1AO7B 3QIUB 1SMOA 5EBMA 5HVHC 4Q6YA 3OF6D 3SN6N 1HSBB 3VWJB 2G9HA 5ANME 4ESKA 3UBXG 2WW8A 3BPNB 1UACL 4WI8A 2H1PL 5FO7B 2OTUA 3P73A 3SDXE 2EH7H 4XP1L 2NZ9D 5EIIB 3VRIA 4HKZB 4JN1H 2KDGA 1VKXB 3ZDXF 1G9MC 3DSNA 3UPAA 4ONGH 4KMTH 2JJSA 2RQ8A 3HA0A 3F12B 5FIEA 5FDWB 5M94B 4JFXB 2O5XL 5IQ7H 4RNRA 4L29A 5JQHC 3TIEB 4GG6F 4QRUA 1NUGA 4R4FH 2YWZA 4X4ZA 2OTWB 5HSFA 1YNKL 5IMOB 1GZQB 4HBCL 2COQA 2DQEL 5FHAL 5LXGL 3TNMA 2MSPA 5B3NA 3CU7A 3U1SL 3IXAB 2NLJB 4HDIA 4MAYB 4WO4D 3C5ZD 4L3ED 4GKSA 4XPFH 3LMJH 4Z7VA 1E0OB 4XC1H 1JIBA 4XWOD 4BM7A 4OAWA 3AS2A 4FTVE 1UEYA 4G42B 5HGDB 3IRZA 5D1XD 4Z7OF 1LEKB 5CWSA 4UBDD 5DWUL 1UJTA 2XKUA 1J05A 4H26A 3ARQA 4N0FA 5CD5D 1NANI 1F2XK 1A64A 4GH7B 1EZVX 2SEBA 2YD8A 4KJYA 3MYJA 3KYKH 1CFTB 1SYVA 5IFAL 2E9JA 1EHNA 5GGSB 4RAVB 1HXYA 2XWJA 4NZRL 2IPTH 1AGBA 2M1KA 3IETA 4WEBH 4WIQA 2YPLE 4K9EL 5JMRA 2ESVB 3CH1B 1QKZH 2DWEA 5H2BA 5JTWA 5E8NB 3QZWB 1IL1A 1IQWH 2AW2A 4P23C 3ME0A 1S8DA 3ZZ1A 2W38A 2J6EL 4XBPB 1QSEE 5GSVB 2Q7YB 3AS0A 2AAVA 4KRPD 5TPWH 3LKSB 1OAUH 1JRHL 3D0LA 2BSSB 2FZ3B 2WBWB 3EZ8A 5DJ0B 3MCKB 4F58H 4Z7VF 1BEYH 2V17L 3WUWG 3S4SB 4ETQB 3B9KB 2Q87A 1DBML 1NUFA 4KTYA 3BJ91 5CILL 2ITCA 2MKLC 1TPXB 3LKOA 3QO1A 5TJWK 2XWTA 3CMOL 4PJAB 4LAQL 1J0YA 3C5SA 5GS0C 1EPFA 4KI5C 2G5BA 3B6SB 1XF3A 1FGNL 3V9FA 1V3KA 5CIPB 3NTCL 4PGEB 4CMMB 1FSKC 1YC7A 1CL7I 2WBKA 4E0RA 1DL7H 4JFYB 1FFOB 1VCAA 1EK3A 1FNSL 4K7FA 4JZOB 4X8JB 2I5YH 4XC3L 3MNVB 3RIFK 5FGCB 1NCUA 2X40A 1K4DB 1U8OB 2R4RH 2X6MA 2GSGB 2V5RA 1B0RA 3L7FB 4ONHA 4P5TC 1JGUL 4LSSL 1AQKH 4HZAA 3W81A 1WIOA 4MNGA 4PJ8B 5I1LA 4NZJA 4R96B 5D7LB 1D9KC 5M7QA 1WWCA 3OGOE 2YWYA 3CFJA 4FXKB 2F53D 3WE6A 4HIIA 1T6WA 2E6PA 3NCMA 5AZ2H 3HAEH 3LN4A 3H9ZA 3CX5J 5E00B 5E56A 5IMLB 1AQDB 3O41B 1QBAA 3D85B 4Y0GA 4ZXBA 2AABH 5EU6E 1MLBB 2VXTL 1S9YA 1JNJA 1XR9B 3OR6B 5JHDB 4H5SA 4MMZC 3X14A 4EI5B 4IEFB 4ODXB 5GGQL 5IVXB 1IAIL 3ULSA 3Q0HA 4LCCA 4S10A 1S7RA 1U8MB 3MMEA 5GGTH 5DZOA 4C59B 2DLHA 1I9JL 3R8BB 4RWYH 3UTZB 1GRWA 2V9TA 1XH3B 4LLQB 4P2RA 1OTTD 3UX9B 4NQDB 4F80A 3G6JB 2PW2A 3RKPA 4XP6H 1MCOL 2E9WA 3D3VE 4U1KB 4KUZL 4LLDB 3VXRD 1UH4A 4PRDB 3VD3A 3LS5H 4J4PC 4KXZI 5E08L 1INEL 3SDCB 1ZGLP 4FQIL 1R5VA 1FO0L 4UU9A 1Y18B 3G5VA 3HE7A 3F5WB 5FK9B 4L4TD 2GT9A 1HCFX 2PYFB 2VLKB 4PJEA 5I76A 1J11A 5IIEB 3U7YH 5IJKC 5HHVH 2BFVH 4QOKD 4HS3A 3CJJA 3BZEB 3WS6A 2VQTA 1G9ML 3BKYL 1N0XL 1KTLA 1YMME 2CMRH 2HKFH 4RDQF 4PP2B 3EAKA 3DO7A 4KROC 2C5DC 4OZFG 4R2GD 1SY6L 3P0VH 1UZ6E 2ID5A 3BYYA 5GGTA 1JZ3A 5EU5B 3OKMA 2Z92A 1C08B 4TN9A 2BOCB 3DX8B 2XKSA 1BOYA 4YBLB 1ES0A 2APVA 2GY5A 3GSUA 4YDJA 1U3YA 5FYJH 4JFHD 4OM1L 4L3AA 4IOIB 5T1KD 1UFUA 2IPUG 4X6DE 4KZDH 2Z4QA 2R1XA 1S7XB 1NH6A 4NKOB 4N1EA 1T6VN 5HDQL 3X3FL 2NY1B 5FUCC 2R56L 4MCYA 3I02B 1F4XH 4NQCB 3VFRB 4PJEF 5GISL 2XFXB 4IRSB 2DMBA 4XMKL 3AC0A 1I3UA 4X9HA 4X80H 3CD4A 3WXWL 5B3JF 4XPGL 1UKQA 1L4IA 2I9TB 3I6KB 4M1CC 4MJ4A 4JJ5B 5I6XB 3Q2CA 4RBPK 2J2ZA 2Q20A 4WU7A 1B4RA 4RMQA 2QQKL 5CZVL 2DLEA 3NZ8A 1GVIA 4QCIB 3QEGL 4KJPC 2QKIA 4NM8H 3IJHA 4NQTA 3CGTA 3GBLA 3KPSE 4J3VA 3S36H 3QUXC 3ZKXC 5EFIB 2OMBA 5TQ2L 3V6BR 2ICEA 4X8XA 3TO4A 3GRWH 1CDGA 1HH9A 1R3LB 4UZGA 5ESQA 4K55A 1K3ZA 4JFPA 5GS0L 4OCLC 5HI3D 1FVDA 1MCEA 3SKNB 4DN4L 4EKXA 5DRWB 4OZGE 3VXQA 3FO1B 3DUHA 4ZS6D 5TGBA 4R7NA 4X4YA 4Z7UB 3KYMB 5C2UB 5DJXB 2XKNA 5C09B 1X5YA 3HPJA 4JRYD 4H1LH 1X7QA 4LHJB 1XFPA 2NX5E 1A2YB 1ZAGA 1XGYH 2LE9A 5CLTA 5CEZD 3RIFF 1ZS8A 4HWNA 1GHFL 3HZVA 4NRZA 4M8QA 4LSVH 1OAQH 3C6LB 4XXDB 4M61B 3RGHA 3OV6A 5KSBF 4GBXD 2IAMD 1FYTD 5H35A 4PJ9C 1BFOA 1TZHA 5CKAA 5EB9A 4DCQA 3TN0D 1UKSA 1VFBB 1CZ8L 1S78C 4MYWB 3MV7A 1WCBA 1Y0LA 1E4JA 2CKBH 1OGAB 4HHAB 5IMKA 3SE8H 3MRCB 4BKLA 5GGSY 1KJMB 1IAKA 1FLTX 2V7NB 4QRRD 4OQTH 4WGVB 3GRWA 3MROA 4XVJL 5I1AA 4DZ8B 3FOMB 4U3CA 4NT6B 1ZT1A 1KTDA 3F6IA 3HI6L 4RBPH 1MY7A 2AI0L 3ULUD 4R9HA 3HE6D 1BQHA 2AGJL 2C3VB 3FB6A 4XBEH 4YDIH 1V3MA 3E6HA 4RFEA 1EH9A 1EXUB 4NKIL 4HPOH 3QG6B 1JZ8A 3O6FB 5C0AB 4WFGD 3FFCA 1DUZB 5JHLH 2I9LA 2Y7QB 1RZIB 1ZLSL 4JG0H 2YA2A 1LEGA 2X10A 2P8PA 5C0DA 2KQNA 1FNEB 4TTDD 1X5LA 1CBVH 2PN5A 2J8OA 3WFCL 3RAJL 1BD2B 4QNPF 4M7KL 3ARDB 3GMRA 4WI7A 1ZK9A 3SE4A 4BH7B 5CSZA 3PIQA 4UT6L 4DGVH 2FYYA 1M7DA 3MGTB 1QLRB 4GKOA 3MRFB 4MHHI 1Q9OA 3KPPA 5JW5A 3TBSB 1WFUA 1B88A 2FL5A 5I1DA 2YPVL 4C83B 3MRBB 4M6NL 4NZDA 3LQZA 2UY6A 3PGDB 2DJUA 5DSCA 4JFDB 4NIKB 8FABA 1I9IH 4ZTOH 4AG4L 3S97C 2MHAA 3QNXA 1B6DA 5EOTB 1WWAX 3DPBA 4KMLB 4DUWA 3U7WH 3PDDA 4L4VD 3QQ4A 5I66B 1S5IL 4ODWA 1AO7E 5BXFA 1CFSA 1FC1A 4LQFL 4WW2A 4OFPA 2N56A 2IGFH 5IR1A 1XCQB 1KENL 1KIQB 4LCWA 3RWJB 3W9EB 5GSRB 4XH2A 5FF6A 1HILA 1OSPL 1WBYA 1GSMA 1A5FH 2NPLX 1HZHL 4FFVD 3VFUA 4NP4L 5E8OA 4M5ZL 2XTJD 3ARBD 4JVUA 5KG9A 3WXVL 1I7RA 1EBAA 2ARJB 3HS0A 3IT8D 2V6HA 2VJXA 1X4XA 4OD1H 1D5IL 2ZPKH 4PBVC 1VACA 3BGMA 5J56B 4Z7QE 4C56B 2OBGA 4Y5YB 1FIEA 3F7YA 1SJEB 3TVMD 4LNRB 1K2DA 4ALAL 4IHOB 1OLLA 3NIFE 1TCRA 3H42H 3ORJA 3B83A 1T7WA 3REWA 1RULL 3FO0L 1HHJB 3BRDA 4RFNC 1NQBA 4HJ0D 4G6JL 3DTXB 1A6ZB 1V05A 1VEOA 3IDNA 2BY2A 2VE6A 4ZPTB 1PDKA 3O4OC 2DI9A 4P4KB 5IMMA 1PG7H 4WNQA 5LGJA 3DX9B 4WHCA 5CCKL 4F15B 2YD1A 4ODHH 5D7IF 4BQCA 5D7KD 5FECA 3QNZB 4TOYH 5D1QC 3CNKA 5GGVH 1J0HA 4QYOB 1KT2B 1U58A 2XZCL 5GGRA 1WFNA 5IF0A 5CBEA 1YDPB 5DMGC 4P2OD 2P8MB 1OY3B 1HKFA 2LU7A 2EYTB 4KY1L 1MVUA 4U31A 3L5WB 1J1OH 4YO0A 2D7MA 2VWEC 5C0JA 2ESVE 5E4EC 2B4CC 2JCCB 2JK5A 1TQBC 4AEHH 4GT7A 4JKWA 4ZPVA 3UTSB 1SEQH 2EYSB 5LQBH 4YBQC 4M8VA 2VKWA 3M45A 3Q5YA 1OLZA 3BD5A 4S1SL 1N4XL 1W8OA 2VR5A 3LSOB 1F11A 3DOSA 4LVNB 3HNTL 4F7MA 1FZOB 1KXVC 5KVFL 1KB9K 5F44A 4K7PL 1PG7W 1I1AC 1VGEL 1BOGA 1I3VA 4I3RL 5DTFA 4WGWB 1E4XL 3BP7A 5D96B 4TRPL 5DK0B 3IFPA 5J11C 5T1LB 1KBGH 2HKHL 3QT2A 3NH7H 3SJVB 1EJOH 1ZHKB 3ZKMC 5F9JB 5GS2H 5FO8A 1QA9B 3E3QE 4JM2D 3D2UD 3MLXH 1V7NL 1CK0L 5EO9B 3T65B 1S9XB 4L8DA 2C4FU 4PV9A 5INDB 3JV0A 1K5NA 1FV1B 2IQAA 3GSOA 4ZAKD 1R0AL 5FGCE 1A47A 4U1JB 4FQHA 1KXTB 1P1ZA 1FLRH 3LZFL 4OD2A 2NYYC 1EJ6A 2WMPA 4XCEB 3BT2L 4NO3A 2XY1A 4DQOH 5IBUG 2VLMD 5DJ8A 3B9VA 4JG1H 1RJYB 4L8CB 3MOAL 5C1MB 5A40E 4PG9A 4JE4B 3MRKA 2GITA 2RFXA 4MD4B 3VFWB 3U0WH 2X05A 4UINH 3VGEA 1PZUB 2JIXD 5T3XE 4XGZB 5DGRA 5JHDE 1XF5B 1WCQA 3K3QA 3L5JA 4M7JL 4W4NA 4KHTL 4HEPG 5IVXE 3KWWB 1A6TB 2HFFA 4PRHD 3ROOA 2FATL 2IJ0C 3M1BB 5E9DB 4G6AD 5E2VH 3BKML 2H26A 2HTLC 1RZJC 1LNUA 1UG9A 4H20H 4G9FE 3U2SA 1WZ1H 1LQSR 2A9NL 1N64L 5LGHL 3RU8L 4RQQB 3VFSB 4ZUWB 1C5BL 4PGDB 4S1DC 2YD5A 1S3KH 3EZJB 3WUWB 2OR9H 5I8EA 3RL2A 3VG9C 3HUJF 5A2FA 3V2AR 1FG2A 2AVGA 1X4ZA 4HGWB 4O02L 4WV1B 3IXTB 3QXTA 4HKBB 2C1OA 2AK1L 1JZ2A 3U36B 4FQ2H 3EFDH 4MWFB 1EGJL 3TBYA 1MFAL 1T20B 5E24E 5HVHB 4P9MH 2V7HB 1FO0B 1QEWA 2HT4D 3M07A 3C8HA 1MF2H 1IAIM 3ESUF 4Y4FA 1PW3A 4YHYC 2HFTA 2XTLA 3DURA 4LSPH 4O9HL 3L5IA 4PLKD 1JHLH 3IF1A 1KPRA 2ZSVA 4NN5C 3T2NL 1BM3L 2Z31D 1A9EA 1WWBX 2FNBA 3C6SB 1PY4A 5DJ6B 1FN4B 1KPUB 1GC1C 1NAML 3LRSB 5JDSB 4ZUSA 3TV3L 5C0ND 1U8KB 1FHGA 1T03H 2O26U 4OGYL 2BZDA 4PJBF 4JDZB 3I6GA 1GGBL 2R0KH 5I1HL 2D7NA 2IF7A 4XTRC 1RVFH 2Q3AA 3MBEA 5AZEH 3P4OB 4I18C 4G5ZH 4LCYB 5H37H 1UT9A 4IIQA 1MWAL 2FJHA 4C4KT 4D0BA 4JRXA 3AREA 1XGUA 5DQJA 3KXFA 4DWHA 4KU1A 5J1TC 4LFHD 3O3UN 4W81A 3O11A 3SGJA 1E4KC 1AD0B 1A7BA 5D7SH 4I9WD 5KVMC 3BGFC 3HZYA 5EN2A 2DM7A 4P57A 3ES6B 4X7FC 2CGRH 1U8HB 3RY6C 5K9OA 5E8PA 1NAKL 4NQCE 2ZUQC 3F58H 1XR8B 3S88L 2DL9A 4Q2ZB 3PJSA 1HHHB 1TETL 4EUPB 3DX7B 1P53A 1ZGLB 3QUZA 4Q0XL 2NXYC 4LEXL 3GO1H 4M3KB 1I85C 5E99H 1FJ1A 3IGAA 2CO6B 2EYRB 1W72H 4YXKL 2VDNL 4MXVE 5JPNB 4JANB 4KTEL 2FR4B 1YNTB 4X9IA 1Q8MA 1A1OA 1KB5L 2B4CL 4YHNB 3CZFB 4U1SB 4POUB 2R0LL 2A77L 3WS3A 5JZ7D 4TSAL 5EIVA 3IDJA 5LCVH 2CJUL 5SWZD 3EOTL 4P23B 4UQ3A 3D39A 3O3DA 1A7PH 4HIJA 3BD3A 3MLWH 4X99A 3RDTD 3RVVD 4WY7H 2EH8H 1KPVB 2BOBB 1MHPL 5JO5A 2XA3A 5DJYB 1DSFH 1B0GB 1F90H 5JOPD 4PJ7F 4PJCA 3QUML 4ZFGL 5FKPB 2BVQB 3L3IA 2ZUYA 3CMGA 1FL3B 5D4QA 4N8CL 1REIA 4X9FA 5C08D 1EFQA 1MIMH 4RGND 3U6RA 3UMTA 5GRZA 4BZ1H 2P1YA 5ANMA 2EIBA 3MRIA 1ZWIA 5DQ9A 3TYGL 3MZGB 1JZ6A 4Z7UE 3WKML 5L7XL 4U6VL 5C09E 4S2SB 4G3YH 1TZGL 1NCCH 2JJTC 4U0RC 4WO4C 1W72A 3C5ZC 2P5WD 3EGSB 4XZUA 5C0FA 3H3BC 4HWBH 3MGOA 3QWRD 3FQRA 1RZ8A 2B1AH 4YFLF 3ZE0F 1HDMA 2H32H 4P5TB 4WWKD 4XRCA 4OIIH 2X7LA 4G9DA 4WU5A 1QYGH 4UBDC 5E5UB 2F58H 4KKLD 5K9QI 5CD5C 3VD9A 2VISB 1D9KB 1OGAE 4G6FB 1CCZA 3T4AA 3GJEB 1AJ7H 5CLWA 2BNQB 3O0RL 3QISA 1H3PH 4PRBA 4GKZB 4PJCF 3TFKD 5IK3B 3UBXI 1BZ7B 1W0WB 4F9LC 2V5TA 3RKDD 5BW7C 5C92A 4OKVB 3U0TB 5KAQF 2EE6A 4M5YH 3QDMD 4H0GA 4FTVA 3F7VA 4QRPD 2KBGA 3WIIL 1ROWA 2EEDA 1UA6H 4N0RA 1RZJL 3L5XL 4X98A 3OTTA 3HMXH 2I60L 3GIZL 1YEIL 3HNVH 4NJ9H 1UYWH 3SDXF 2GCYA 5D5MB 4YGVA 3W0WE 1OCWH 3UJTL 4KRPC 1GPOH 5I1IL 1NJ9A 5BS0B 4LPVA 1CD8A 1OAYL 3AM8C 3LEXA 1IAOB 4JDVB 5DRZA 3BI9X 2CRYA 4GQ9H 4HWBA 4CUCA 3ARRA 4QWWD 4U6YB 3RNKA 3WYRA 1UENA 3BDBA 2YPLA 25C8H 4KMQA 3MOBH 2EDHA 3BMWA 3O2VH 1YN6A 2Y72A 4MSWA 2EC8A 2QQLH 2IC2A 4NSKA 4LKCA 3HR5A 1IKNA 4MDIA 1OARL 2LVEA 1QSEA 4R97C 4KJWD 2ICES 1NGYA 3FFDB 4I13B 4LRNL 4K07A 4Z6AT 4JFDE 4GW5A 2PYEB 3VFGL 4N8VB 3OPZH 3QHFH 2IFFL 3MC0A 3BW9B 2ATPA 2PCPB 4YHLH 3QEHB 2Z8VC 4TVPE 2AJVH 2OX5A 5C07B 1B6UA 4E5XA 1GC1L 1T83A 3JWOC 4CVUA 3O3EB 1MCNA 4PG2A 4M7ZB 2VN7A 3WNOA 2XQBH 1CE6B 1G7HA 4UIMA 2DDQH 3L95A 2YSSB 4HIXL 2EDOA 2XZZA 4MNHB 4QF1A 1VGKB 2AJ3A 3BESR 4B7IA 5I1JL 3DETD 1FZMA 2VDLL 3K7UA 3PXJA 3NFNA 4KQ3H 5F7LB 4QHMB 4W6WB 1JGLL 3MJ7A 4MJ6A 2EEAA 5GRJH 5JW4Q 3EJJX 1XF2B 2K7PA 4LP4A 4N90E 4H88H 1S7WB 4JLRB 4AL8L 3HFML 3ILPB 3VFOB 4C56E 4MQ7A 2HJKB 3BQUA 1YEFL 2VDOL 4A2LA 2Y06H 5MEPB 5J7CC 1FNAA 4OCRL 5KZCB 5ITBL 5E94A 4NC1E 1AI1H 2WUBL 3MRPB 1S9WB 2P8LB 2OSLA 3V7MA 4JKMA 4LCUA 4ENED 4R26L 1OTTC 3VJ6A 5I1KH 4Y8AA 3RGVB 1UXSA 2P45B 2XIDA 3NA4A 4QRQB 1ADQH 4G6MH 4MB3A 5EU6A 4NPYA 1I75A 5EZOH 2F15A 3IDIB 3BIBX 4B0MM 2ENSA 1MNUL 3JVGA 3SCMA 4MQTB 3LHPL 3CSPA 2I24N 4OSUL 3GHEH 3AFLA 3TEUA 3LKRA 1T5XB 2HH0H 1KOAA 5B38G 3JV4A 2GAZA 4GAGH 2IG2L 4WHYG 4K3DH 3GEWB 2VLLA 4PRPB 5HDLA 4CNIA 4LCIH 5IEKA 2WBJA 2VDQH 3QUXB 3ZKXB 1EFXA 1WC7B 5CP3H 3DVGB 1TZIB 1Z5LB 3D3VA 1QTYT 4Z77A 1JTOA 1TJGL 3EOBB 2JCCE 2I25N 3MR9A 4R2GC 2APTA 5HHXL 3QUKA 3RA7H 1X6NA 5BQ7A 1T7ZA 2Y07L 3IFLH 3HLAB 1H8SA 1U0QA 4FP8L 1G7QA 5IFHH 1NUDA 2JLLA 5CEXA 4M62H 4GRMB 1ADQA 3T2QA 1KIRA 1YMMA 3G08A 2H6PB 1LO4H 4NO2A 2DWDB 3CZJA 1JWSA 4ZOCA 5JR1L 1HHKA 1OM3H 2NY0D 1JGDB 4KRNA 1KLUB 3GSXB 4LAJH 4F7PA 4LF3A 4PJ9B 3GSQB 1KB9J 3SJVE 2X9YA 1S9VB 4Z7WF 1NCAH 1U8PA 3T4YB 1S7QB 5FA3B 1X5FA 1ZTXH 3VXPB 4IDJH 5CP3A 2A6DA 1FVEA 1T5WB 3K80A 1KF9B 2X9XA 3MODH 4ZXBD 1JYNA 1VSCA 3I6LE 3I9GH 3QFJE 1DCLA 5F96H 4X6DA 4I4WA 3AVEA 5EA0H 3FT2A 1GGIL 4GKNA 4C55A 4U1MB 4U1IA 5E8DH 2GK0A 5I8OL 2ICWI 3TBVB 3BMVA 3TPUB 3OGCB 2EDFA 3IJYA 1ZHLB 1F3DH 3T1FA 4P2RD 3MRJA 3U46A 5ICZA 3STZB 5I75C 1O5DT 1HXMB 5TE4H 1KJ3L 4ZFFA 5HHOB 3FT4A 1OGTB 1MFBL 4FZEH 1UZ6F 5CINL 4GO6B 3RQ3A 4WUKL 5ERWB 4JB9L 4V1DA 4EI6B 1Q9KB 1Q9WA 3QEUB 1GJIA 4TULL 1PQZA 5HI3C 3K0WA 4L9LA 2FJFB 3OB8A 3VFTB 1T1YB 1U95A 2Z8SA 4MA3B 3IDGB 1D3CA 3S37H 1QVOA 4XPHH 3RWCA 2DQTH 3HE7D 1P2CB 3CSGA 2NTFB 1FIGH 3KPSA 2W0KA 3EFFB 3L3DA 4TNWK 1IEAB 4NKMB 5AYQA 1D5MA 2BSTB 3DGGB 2CSPA 1S7UA 3FO2B 3PWJB 3EBAA 4X6DF 1DBAL 2BVPA 4HC1L 3JWOL 4F9PC 4ZS7H 5I18H 1DBKL 4GBXC 1ZT4A 3TN0C 1DANU 2PW1A 1IQDB 3LV3B 4ZO7A 5C7XL 4OZGA 1KTKE 3OJDB 3GMMA 1I7UB 3BP5B 4PJHB 3EYSH 1JBJA 2X4TA 3GKZA 4NQUA 3ABZA 2NX5A 3MLVH 4XHQA 2V5MA 3WHXB 1QFWM 5CJOL 1JPSL 6CGTA 4P9HH 3AU1A 3GK8H 4YJZL 2R2BB 3QH3B 3BVNA 4XNQA 4NRXB 3EYFB 3UZQA 4WJ5A 5F89A 5MEOB 3QRGL 4GW4A 4PY7A 5FUZL 4JKPL 4NWUH 1WISA 3HE6C 3VI4E 3WFEH 3FB5B 3V7AG 3C08L 4PTUA 5L6YL 5ENWB 1XIWA 1AXSB 3C87A 5C9JA 2WSKA 1FE8L 4RFNB 4X7SL 1JPFB 4YC2C 4D8PB 2W0FB 1F02I 3WNMA 3EOYG 2C7UA 5TE6L 3FRPA 3LVEA 7FABL 3RWEA 1MWAB 4OCWL 3SDAA 5IB4B 4TSCH 4NNXA 1Q0XH 3O4OB 1CE1H 1P7QB 5DS8A 4DKEH 3KHQA 4U4BA 1WV7T 4OZGF 4XPTH 2D7QA 5MEQA 4TUOA 3MRHA 3PDOB 5B39G 3WCYA 3QBTB 1J0KA 5SWQB 2VH5L 2JE8A 4OUUB 1MCQA 4MNQE 1QR1B 4G8EB 5JIIA 4IMLB 3UTPD 2PTTA 3ARVA 3MX0A 2C26A 2P44B 1YUHA 5FYJD 5BV7H 5HYQB 3I3BA 4FXGB 4F7EA 1TDQA 4NGHH 3TO4D 2IH1A 3WN5C 1WICA 4WTWA 5EBLB 4EVNB 5E4EB 1KB5B 5DJZB 1JHKH 4XNXH 1TQBB 3EW3B 4HUKB 3PHOA 1FORH 2IQ9H 2PXYA 3GIVA 1ZT7B 4JHWL 5IGXL 1QFUL 5EOCJ 5DJ2A 3ZTJG 3WJLA 4TSBL 1ZVYA 4APQA 2YPKB 2HVKB 1O7SA 5DRNB 4FXLA 3LOWA 3OX8A 1P4BH 2QEJA 1IFHH 2XTJC 3ARBC 3KGRA 4ODVH 3HMWH 1I1AB 5TQ0L 4NCDA 1F5WA 3QUMB 4LU5H 1FL6B 4LLWB 1D5XB 1AO7A 3NN8B 4AQOA 3QIUA 3QCTL 2Y4SA 4KVCL 3IDYC 3RL1A 1HSBA 1P5VA 3VWJA 4KI5E 1IGFL 3PDGA 5J11B 1UCBL 3FKUS 3P30L 3AXLB 5AYUH 3MV7D 4RA0C 3GMLB 5DD1L 4HJ0C 5EOQL 5C0CE 1XGRA 4Y1AB 4XP9H 1NCNA 2A83B 43C9B 1FH5L 2JJUA 2XWBB 2BCKB 2XZAL 5FDWA 4JFXA 4WHTB 5D70L 3NABH 2R2EA 3LAFA 1F4WL 1A3QA 2OTWA 2PO6A 1N7MH 4AEIL 1BBJA 4UNTA 3QQ9D 1BHGA 1KG0B 2X42A 3BIKB 4YWGL 3DYMA 5AG9A 5IBLD 5ICYB 4J8RA 3OKOA 2X4OB 4X5WB 1RJLA 5BVJB 1CGTA 3KPRE 3FFCD 4P2OC 4CN6A 1DQJB 1E6JH 1LK2B 4F33A 4RMTA 2NLJA 3L3OA 1FZKB 1TENA 2BSED 5CAYB 3EUUA 2YEZB 5J1SC 4N9GB 2D0FA 3BSZH 1M6OA 2DQIH 3FQWA 4O2CB 3ZT6A 5HHPB 1LEKA 2DQJL 4OGAD 5GZND 2VDKH 4JFFB 4QGYA 4YHML 2J7LA 2XYCA 5EU7E 5JXAH 4HWZB 5CIPH 4FFZL 5BRZB 3TJEH 1FFQA 4MXWH 4K7PY 1CFTA 5CP7A 5CEZL 1ZXQA 1BPVA 5J6GA 4NC2B 5IBTL 4Z7QF 3RUGB 2WIMA 2FD6H 4IOFD 3VA6A 1AIFB 4O4YH 4MX7B 3ZKSD 3ZMRA 2X41A 2XA8H 3PP4H 4GLRH 3FAWA 2DIJA 2BVOB 1KJVA 5FYKH 3C8KB 5GSVA 5HI4C 4LCWD 4LSUL 1FGVL 3LKSA 4YHYB 2BDNL 2PYEE 2BSSA 2BVTA 5DJ0A 3MCKA 3AMKA 1LP9A 4ZAKC 5TH2B 5T3XH 2P5EB 5KW9H 4OF7A 4XXCA 1WZLA 4FG6D 5C07E 4NN5B 3SY0B 5FCUL 3BH9A 3BEWB 3UO1H 3WBDA 4K8RD 1IM9A 5D8JL 4I8DA 2J88L 5EU4B 1A14H 4WWID 3CFKB 1GL4B 3P11L 4MD0B 4PGEA 1N6VA 4CMMA 1CF8H 3V0VB 3GJFB 4Z8FL 4KHXH 1FFOA 5JXEA 4I18B 5HYIA 5KVDH 1AHWA 4JZOA 4X8JA 5JW4R 3HKFA 3L3HB 3VWKC 3PF2A 1K4DA 1U8OA 4F37K 2P43B 4JVPA 3HB3C 2YD2A 4XBGA 4OLYH 4FQQA 3P4MA 3BGFB 4GXVL 4D9LH 1GGTA 1MQKH 4KKAC 3SE9H 4RMUA 3O3AA 4R4ND 2H8PB 1X3DA 2PTVA 5IKCA 4XCNA 4FA8A 1JZ7A 4R96A 4YAQB 5FUCE 3NCFB 3SGKA 12E8H 3HHRB 2X4NA 2ZUQB 2VQ1A 2W91A 4FXKA 3E8UL 3S5LA 5JA8B 1A7QL 3IDXH 4UTBL 3U0PB 5E00A 1EVTC 5IMLA 1HYSD 2NXYB 4OTXL 4HV8A 2A73B 1MLBA 3T1WA 1XR9A 3GM8A 1UWXK 3U4BL 4EI5A 2CK2A 4ODXA 5IVXA 3CCHB 5TDPB 3O81A 4XPBH 4HD9A 4FRWA 4AMKL 3BPOC 2HT4C 2XQYG 4G9FA 4X4XB 4PRPE 1XH3A 3ZDYE 1C5DB 1INQB 2KL6A 5CJXC 4LPTA 5DRXB 1UM6H 3D87B 1WZKA 2IFGA 3B2VL 5KVEL 4QKXB 2VZVA 4U1KA 5EUOB 2Z31C 4LLDA 2CLRB 4G80A 4HLZH 4PRDA 3SGEI 3S8WA 1PLGL 4HUVB 1F3DJ 1J88A 3O3BA 4OBSA 3SDCA 4PRAB 3G5YB 4BSVB 1G7IB 5C0NC 1T22A 1Y18A 4UB0H 3VD5A 5FK9A 1BLNB 4EJ1C 3V4VH 1H3GA 4NYLA 3WLBB 2PYFA 4RZCB 1QBML 3KJ6H 1BGXH 3MREA 3VI3E 4Z5RB 3JWDH 2P48B 2PKDA 1T3FB 1KIPB 3B9DA 5DK2B 3R1GH 4U0RB 2VOTA 1ODAA 5F1IB 2VZTA 4WO4B 5IVXF 3C5ZB 3CLFH 5ADPH 4PP2A 3RWGB 3CVHL 1IC4H 3PE9A 1A9BA 2C3XA 2ZOLA 2PR4L 5F8QC 2FSEB 4HKXB 3MNWB 1Z9MA 3MLSL 1VDGA 5EU5A 4WI3A 1C08A 5MHSD 3Q3GB 3PABB 3DX8A 3DYPA 1MLCA 2CUMA 4ZQKB 1XGPB 3W2DH 3RX7A 4EQ3A 3AROA 3WIFA 5C6WH 3CVIL 5LBSL 4UQ2B 3IFOB 2MOVA 3TGXA 1YNLH 1GIGL 4LPWA 4CADB 4MDJB 3W39A 5JORB 3IAGC 3ARFB 3HRZB 4ZTPL 2R8SH 4C54A 4ZFOL 1HINH 2A0LC 1K8DB 4I0CC 4LLYA 2VITB 2EDBA 2ZUSA 1S7XA 2EKJA 3MCG1 5JW4M 4NKOA 2Q8AL 2C1PA 3UDWA 1WGOA 4U3XA 5FGBA 3DSFL 4M1GL 2D03L 4NQCA 5B38B 4Z9KB 4OCYL 3DV6B 1T1ZB 2XFXA 2OL3A 1KN2H 4IRSA 1Z3GH 35C8L 1UWEH 5GS2D 3RDTC 3RVVC 3EDJA 2R23B 3NFSL 3HNSL 1FAKT 1I1YB 4D9QD 3RZWA 1W0YT 4TTGA 1A0QH 5FA4B 3IYLW 5IB1B 3W9DA 5HHOE 5CBAB 1T0NB 2EDTA 1MI5B 1M7IB 4HPYH 4LL9A 3HC3H 4PUBH 3N1MC 1BFSA 5ESVB 3EYUL 5DD0L 1LD9B 15C8H 5F7KC 4OLXH 4RGNC 2G75B 1OSZA 3LS4H 1RFDH 4GW1A 4QCIA 1RIVL 1XCTA 2AV1B 1R3HB 4X5XA 1G6RL 3KJ4C 1OB1B 4UILL 1NCBH 1GOFA 4R97B 1UM5H 3GNML 3S34L 2OTPA 2WM0A 4Y4FD 2UZXB 1JZ5A 1R3IL 1EMTH 2VZOA 1IILE 5T33L 3U82B 1NFDB 3H9SB 4EXKA 3I50L 2CDGB 4FQJH 4C57C 1AC0A 1RK0B 3VA2C 4DN3L 4RAUB 2Q6WA 2QLVB 5I2IA 3OQ3B 4HFWB 4GAYA 1FPTL 4JO1L 5DD5L 4IRJC 3KNBB 3TIDB 3FO1A 5D72H 3WFDL 1E6OL 3BWAB 1AXTL 1JI2A 4FNLH 4Z7UA 1NGQL 5KS9B 1F3JA 4PJHE 5DJXA 3BYTA 2F53B 2IMNA 4KC3B 4DFIA 4F7CB 4QT5B 4YHZL 1A2YA 2DQFB 4XMLL 4MXVF 1IC7L 2YUXA 2R29L 3OSKA 1ZLWK 4F37F 4JRXD 3RKDC 1JE6A 3ARED 2NW2B 3KXFD 3BHBB 4FS0A 1TXKA 5T5NF 3SKMB 1T0PB 4LFHG 3MCLL 4XXDA 4M61A 4MLSA 1NEUA 1WIUA 2OK0H 5J13B 1G6VK 1PGRB 5D6DA 1KJ2L 1VFBA 4TUKL 5E03A 1OGAA 4HHAA 5J9PB 3V0AC 1H3UA 2ZCLL 4U1GC 1L9MA 1KJMA 4BH8A 4Z78B 5FKAA 5DR5H 1Q0YH 3KDMB 3PV6B 3QUZD 3VXMB 4U49A 4QWWC 1ED3A 4DZ8A 5IWLC 2F8OA 3KYOB 3WHE1 4DW2L 4NT6A 5ID1B 1SVCP 1J5OL 5E95B 5CEYA 2LQRA 3L3KB 3QDJA 1RHHA 4Y8DC 1DLFL 1RMFL 2F5AH 2FECL 1TJHH 1NBYB 1IGCH 1BJ1H 4Z7UF 2BNRE 1S9KC 2JJWA 2GYSA 3O6FA 4KJWC 4D9RD 3D39D 3VW3L 3U4EA 3G9AB 1DUZA 3RI5K 3W0WA 1RZIA 1J1PL 2H1PH 3PGCA 1FNEA 2DL2A 4QOKB 3CH8A 4YHKL 1GOHA 2X4PB 1SM3L 3ULVE 5HYJB 1A1NB 1J8HE 3VCLA 1UM4L 3ARDA 3CSYB 5LWYL 2VWEE 2X1OA 2O5XH 3RPIB 3MGTA 3MRDB 4R2GB 4LIQL 4LKXA 5IQ9B 1YNKH 3NCJL 4X6FA 4U6HA 4C83A 2OR7A 4ISVA 4HBCH 3MRBA 1XGTA 4BZ2L 2DQEH 5FHAH 3PGDA 5LXGH 4JFDA 1U8JB 3RHWK 1JK8B 3UTOA 2DQGH 5EOTA 3U1SH 1ZLWH 3QDAA 1A1MB 3STLA 2XICA 3LEVH 1KACB 2CLZB 1HH6B 5I66A 1F4HA 5KJRL 3QSKB 1JP5A 2W65B 2E7HA 1I4FB 2GUOB 5B22A 3U9UA 4F2MA 5I15L 3S35X 2FEEL 5FM5O 1ONQA 3IDUA 1FQ9C 3QJFA 1XCQA 4LPCA 5DWUH 4K2UL 3W9EA 4ENEC 4Y1AE 1A7RL 5C2BL 1CICA 2IALB 4UT9L 2ARJA 4RX4A 5DD3H 3F62A 4MXQC 3L3GB 4QRTB 3KLHD 1I1FA 3J8F7 1RZKC 4C56A 4Y5YA 4FTVD 4LNRA 1HHGB 4Y4KB 4K9EH 2DRUA 1JPGA 1WEJL 4GAJL 4HAFA 1CFVH 4JFEB 1G1CA 4ORGA 4PLJC 1ZHBA 4U0QB 1KCLA 2ZG2A 3MRLA 2DN7A 3DTXA 1JYVA 5IFJA 1A6ZA 4PRIE 5JA9A 4DFHA 4CU7A 4OLZL 5I75B 1JRHH 4H25B 3WLWD 2NY6C 4DKDC 3WFBL 1B2WL 1GYAA 2V17H 1RIHL 1XT5A 1MFEL 4P4KA 5EPMA 3DX9A 2YC1A 4G7VL 4JO3L 1TITA 2YPLD 4OCXL 4MA8L 1MHEB 5CMAB 1A6AB 3QNZA 3GSNL 1LO5B 5I74C 3CMOH 4WVRA 1L7TL 2UZIL 4PGCB 4OZIB 5T1MB 1KT2A 1ZVSA 3WL9B 1QSED 2LAGB 1FGNH 4H0IA 1NMAL 1QRNE 4OF8A 4KDWA 1MIEL 2P8MA 2C4FT 2V2XA 2EYTA 4B41A 3G04A 3MV8B 1WWWX 1BWMA 3RUGE 3L5WA 1FNSH 1Z9LA 3LKQA 5CGYD 4XC3H 3VD7A 4GRWB 4PS4L 5C6TH 3ALWA 4NO5A 4QTHB 2NY0C 2O5YL 3HCVB 2FX7L 3DJ9A 5L2JB 4AH2B 3QPXL 1MFNA 1JGUH 5BO1H 2HMID 4LSSH 1NL0H 3G5XB 4CU6A 3TN0B 5ECJE 2DM4A 1ZA3A 3SQBA 4PBWD 1MCKA 5F7EL 2QR0A 3BZ4B 1BECA 1IE5A 4YDVA 3GB7B 2HJFB 2LABA 5L9DL 5EZJA 5DHVH 2BNUB 2D31B 2P5EE 4ZXBC 4QRRB 4BUGA 5I1GL 3ZKNC 1U8IB 4JFZL 2VXTH 3GGWB 3CDCA 1NLDL 3MUZ1 3BQUD 1WFTA 5GGQH 1IAIH 5FOBB 4LCCC 2DS4A 2DBLL 3I3EA 3HE6B 3NPZB 3SJVA 3VGAC 3EO0B 1ZHKA 3MRNB 1QA9A 2XV6B 2YXFA 5EO9A 4ZYKA 1S9XA 5INDA 4BUHA 1VADB 4F8QA 4MB4A 1JGEB 1I7TB 2CRMA 5EU6D 2JCCF 3QFJA 2GJ6A 5GRVL 1T21B 2HJLB 1MCOH 3SKOA 1A6WL 4KUZH 4CBPA 4ZD3L 1CGVA 3TESA 3SCMD 5FDYA 2Y6SD 3LN9A 4J6RL 2N4IA 4K71C 4L8CA 3CXHJ 3HN3A 3PGFL 4FQIH 1FO0H 1SBSL 3Q6FB 3HE7C 4DK6A 4DKFL 4WW1B 4X6CB 4MD4A 1QFPA 1GH7A 1X5KA 4U1LB 2WBJD 2GTWB 2EXWD 4OF6A 4Q97A 1O0VA 5DHVA 2J3SA 3WS6C 5MP6H 1EFXD 3R06B 2EDDA 4ZUUA 3LRGA 1G9MH 3BKYH 4JO2L 3D3VD 3C2AL 3CFDA 1I7ZA 1N0XH 2FH6A 1A6TA 1ZEAL 1YQVL 4IRZH 2VL5A 4L4VB 1T2JA 3WN5B 2B8OT 4KUCD 3FQNB 3M1BA 4OLWL 4OV5B 1NC4B 2UYLA 4AT6B 3IKCB 2CD0A 3MRMB 5CS7A 1AD9B 3SOBL 2DJSA 2XPGA 3P77B 4LSQH 3QIWC 4PGDA 4YZFE 4Z0XB 3RHWF 5K59E 3KPQB 5DMKB 2VABA 1N3NA 2AK4E 5GGUA 1JTTA 2XTJB 3ARBB 2OYPA 5LVEA 1YMMD 4CKVX 4HGWA 4WV1A 4OM1H 3IXTA 4FABL 1W8NA 3EIFA 3IAQA 1T1XA 3D18B 4OZHB 3BZFB 2AXFB 2BSRA 4MWFA 1UVQB 3MRGB 4EDWH 3IDYB 3OKYA 5HDQH 2CIKB 3X3FH 2O93L 2VYRE 5FCSH 2R56H 3QUYC 4X83A 5EUKB 5L88L 4EUPH 4O2FB 4XMKH 4LGSB 4ONGL 5IB5B 2AJZA 3WXWH 2P46B 4XPGH 4BZYA 1RZKL 5DJ6A 3RWFB 1KPUA 5J57B 4ZUVB 3P9MA 4R4FL 1MCIA 3CVHB 1FNGB 5JDSA 5JW3L 3V52L 3AMLA 4XWGH 1Z0NA 4RDQG 2HWZL 5CZVH 1A4KB 4JDZA 1DEEA 3B3IB 4GRLA 4X7TB 3QEGH 4NBZB 4Y4HA 2OCFD 3P4OA 4LCYA 1SJHB 3BUYB 4XP5L 2EO9A 2JJVA 3SDDA 3T2PA 3IS1X 1D6EB 4P2OB 1TTGA 1AP2B 2O61A 2KH2B 5TQ2H 5EC2B 1AD0A 4WFFE 3TO4C 1OP3K 3ES6A 4ZFOB 4CDGC 2R1WB 4TUJA 1U8HA 1T89A 4UI2A 4V1DD 1MUJB 4CDHA 3JTTA 1IC5L 1K9TA 1RU9L 5GS0H 3EYVB 4Q2ZA 4YHPA 4DN4H 4EUPA 4MNQA 4IS6B 3DX7A 3KPSD 4X5LA 4JAMA 4B50A 1M4KA 3HI1A 3F7QA 2UV3A 5DEFB 4L1HA 2EYRA 1JV5B 1QSVA 4JANA 2FR4A 1MI5E 3QJHA 4YHNA 1CG9B 1ZA6B 4J3OC 2VXQL 3VI4F 4U2YA 1IQWL 1RJZB 1AY1L 3B9AA 5CGTA 5DC0A 3T04D 1CFQB 3G6AB 2IBGA 4JY6B 1G6RB 5TPWL 1OAUL 1RZ7L 1VPOL 3D2UB 4EIZC 2H2PD 5DJYA 1B0GA 1BJ1J 1NFDE 1PSKH 2PUQT 2NX5D 3H9SE 1KELL 1TVDA 3VFNB 1YMHB 4N1HB 4IJ3C 1IEBB 5SX4H 7CGTA 1MJ7L 4XVJH 1FL3A 4AK1A 4G8IA 5C0BE 4K3EH 2VXSH 5E2UL 2FRGP 5LAXB 5CSGA 3QQ9C 1CI5A 3KPMB 4NHUB 3HI6H 4FFYL 2AI0H 1K85A 3EDKA 4G7YL 1J1XH 2AGJH 4QXTB 5IBLC 1FVCB 3NVQA 3OKKB 1XIWD 2DIBA 1INDL 5C0CA 2FX9H 4BK5A 5DMYA 1LDSA 1JF6A 4RMWA 1ZLSH 1F6AB 3UPRB 3GI9L 2JIXB 3KYAA 3VWKB 3MLZL 3N9GH 3SDAD 3WFCH 3RAJH 1OP3H 3SE4C 1Q1JL 5EU3A 5KANG 1DUYA 2ZP0T 4M7KH 4PRHB 1AQKL 4UT6H 4NRYB 4OGAC 3P9WB 3QXDA 1KLGA 4KVNH 1NPUA 3VH8B 3LIZL 2P47B 4HS6B 1JUFB 1KJ2B 4P46A 4TNVK 3MUY1 3RBGA 3GJEA 3BIAX 3MO1A 4UDTA 5T3ZL 3FTGA 3V6ZB 2DKUA 5AZ2L 4X4ME 1NBQA 2YPVH 2Q7NA 3KPRA 1NGXB 1IGTB 5IK3A 3VXME 1HCVA 5KSAA 1AGCB 2GJZA 5BJTB 4IOFC 4MA1C 3U0TA 2RAMA 5B8CA 1KEMH 1EAJA 5DJCB 3CK0L 3H0TA 4L8BB 5GGTL 4KI5F 4WW2C 2X4UA 4LQFH 5DA0B 3UTQA 2PXYD 1H15B 3D9AH 5IG7B 3BPOB 5FHBL 4AM0B 4APQD 4LBEA 1KENH 5HHNA 4LNVA 1IAOA 4HQQH 1MAJA 3RVWD 1OSPH 2A9ML 2VL4A 3RBSA 2YD3A 4U6YA 5HYJE 4ZFZB 4M5ZH 1EAPA 4HUUB 4FG6C 2JB6A 2DLGA 4RSVA 4NKDB 2DKMA 4J4PA 1D5IH 3T0EE 2P7TB 1AO7D 3QIUD 4K8RC 3KPNB 1UH2A 3KPTA 1V5JA 3VWJD 4ALAH 3CXDL 3MFGB 3NMEA 1PYWB 1AR2A 3FFDA 2DTSA 2NZIA 4OLEA 3U7YL 2W9EL 5FFLA 3FO0H 2OQJB 4JGMA 2CDEA 2PYEA 4N8VA 4HFUH 3JZ7A 4KJQD 2PCPA 4G6JH 3RWHB 2GW5A 3TO2A 2VLRE 5AAWA 2WP3T 4MHHG 3OAZK 3PNWB 5C07A 1RAMA 1AGFA 5D93C 1NMCC 2X5PA 4O2EB 3O3EA 4QHNB 3IJSA 1MAML 5F3BA 4R4NC 3CX2A 5FM4A 4HXBL 2PO6D 4XI5C 5DF0A 3GSRA 4K3GA 3C9NB 5IB2B 5E6IC 5HVWA 5KTEL 1BQHG 5GPRA 1FP5A 5IM7B 1CR9H 4OLVH 3IS0X 5DZLA 2XZCH 2D7OA 3MFFB 1HYSC 3K1KC 5BMFL 3DYOA 4JLRA 4KY1H 3P0YL 3ILPA 2NY3C 4KZDL 4FFWD 2W60A 2HJKA 1IGYB 2HRLA 4LSTH 5MEPA 1S7SA 3QULB 2B39A 1G0XA 1EBPA 5J3HC 3MRPA 1S9WA 2P8LA 4JFEE 5SWZB 1X4YA 3X11B 3L1OL 1XMWA 4QXGL 3RDTB 3RGVA 4S1SH 4PGBB 1I8IB 4X80L 2GJJA 4UV4L 3HNTH 1TNNA 4N0UB 1KEGH 4KQ4L 3RWIB 3TNNB 1R5IB 4FZ8H 3VGDA 4K7PH 2J8UB 1PKQB 2HFEB 3AAZB 3JTSA 1PFCA 4W6XB 1VGEH 4I3RH 1E4XH 1HOCB 5C08B 3VXOB 2VDML 3KPLB 4RGNB 1T5XA 3O9WB 3AUVA 1YEDA 3DIFB 3GSNB 4OZIE 1IM3A 4PRPA 4PTTA 2HKHH 1BQLL 4AIXA 3KJ4B 5HY9A 1ACYL 1LEIB 1HKLL 1LE9A 4WUUE 3DVGA 1EUUA 1V7NH 1CK0H 3MV8E 4J1UB 2WZPD 4F57L 2VIRB 4YQXL 1P9MA 2W9LA 3GRWL 5DD6B 1WBZB 1NBZB 5F1SA 4G8FB 2P5WB 1R0AH 4GRWE 3IVKB 3CDGA 3OAZH 3EOBA 1FBIH 3I84A 4YLQT 2CLVA 1G7LA 3BT2H 2EKSB 4O5LL 3DRQB 1IM9D 1T4KA 4ONFH 3R8QA 2F54B 4IRJB 5HVFB 4HCRL 1AFVH 3MOAH 1AKJA 1JYWA 2VR4A 4KTDL 5GS3A 3SPVA 3ALPA 3RP1A 4HX1A 3PQYA 1S7VA 5JXED 1V3LA 2V2TB 4YUEL 4JO4L 2YS4A 4MJIE 3OMZA 3S96B 2X1XR 3ZHLA 3GSXA 1JPST 3QDMB 4M7JH 4PJIB 3QIBB 4NWTH 1U8NA 1OT1A 1GXEA 3GSQA 2FATH 2MNUA 3EKCA 4KK5D 1OAXL 1NFIA 1VFAB 4DUXA 4GG6B 1PBYA 4MD5A 1NBVL 4TNVF 1KCSL 4KK8D 1S9VA 3X12B 3BKMH 3SE8L 4JFQA 2D2OA 2FB4L 1OP9A 3MLRL 5H8DA 1J0JA 3T4YA 5MENE 4U6XA 4U1GB 5J89A 2B7DT 4MQXD 6FABL 2ARWA 3RU8H 1C5BH 3ROLB 5T3XD 1LILA 3H8NA 1V3JA 4QGTA 4PJ5E 5INCA 4LHUB 4BFBD 2G60L 1KC5L 4EI5D 3VXSE 4O02H 3FQTA 2AKRA 2AK1H 1DANT 2Y5EA 3EO9H 1CDBA 5JUEL 1XZ0B 4P5MB 3VI3F 3JV5A 3TPUA 1EGJH 1MFAH 5E7FA 4KK6D 4X6CE 4G9FD 1ZHLA 3SGDI 3NAAL 4Y4FC 3STZA 3DMMB 3P73B 4HF5L 3DNKA 2APFA 4RFOH 1N6UA 1NGPL 1CBVL 2VLJA 5JW4N 1G9NH 5HHOA 3VRIB 3HRPA 3BISA 1UXWA 3T2NH 3F6LA 3UJJL 5ERWA 4L4VE 3QNYA 4RNRB 4DEPC 1AE6H 4EI6A 1Q9KA 4K8RL 1CT8B 4ODTH 4UOW1 3SDCD 5KSUA 4LLAA 2YUWA 4DVRL 3VFTA 4EN3A 4MA3A 3IDGA 3TV3H 1P2CA 2NTFA 5ELIA 4OGYH 1JWUB 2ZJSH 3EFFA 4Y89A 3MUGB 4NKMA 1GGBH 5I1HH 3MBEC 4DGYL 3PWJA 1IGJA 3MXVH 3FO2A 1NLBL 1DN0B 5DUBA 2KZWA 1CQKA 3WDIA 2XTJE 3WIHA 1MWAH 1ZSDA 1B0WA 4HDIB 1AXIB 3SGJC 5IEHB 3V4UL 3NACH 4OAWB 3LV3A 1EGJA 5GS1C 5CWSB 2A6IB 2ITDB 4P2CG 1I7UA 1NAKH 5KSVB 1J05B 3UYPA 4PJHA 1JMZA 1QNZL 4XNMA 1OL0A 1FC2D 4N0FB 4PJFB 1TETH 2CXKA 1Q72L 3OKDA 4I5BB 4Q0XH 2SEBB 4KJYB 3REVB 3TH4T 5L2KA 1J8KA 1SYVB 3ULVH 4OD1L 1G9EA 2R2BA 5D2LB 1HXYB 2VDNH 1U93B 1QFWI 3EYFA 5DFTA 4KTEH 2BRRL 1AGBB 4D0DA 5DVLA 3IETB 3RZCC 4NUJB 1KB5H 5D7JC 3H42L 3IU4H 1E27A 3N1FC 2R0LH 2DWEB 4XT1C 4RRPA 1R3JB 3MRRA 2A77H 5EORL 5C0IA 5L8JB 4NQCD 4TSAH 1T66D 5ENWA 2CJUH 1AXSA 3EOTH 4IRSD 4R7DA 4D8PA 4GUPA 4PJBE 2W0FA 3CFCL 1OPGL 4D3CL 2MQ0A 3MA9H 2XNAB 1I8MB 4JJHA 1MWAA 2X4QB 2B2XL 1MHPH 2J5LC 5FYLD 2NY6B 2XXCB 1IAMA 1P7QA 4OM0L 2NCMA 3QUMH 4ZFGH 4ODHL 3PL6A 1A6PA 2DLFL 2ITCB 4PB0L 1MREL 4N8CH 3QO1B 3PDOA 5I74B 3D25A 4PJHF 2BNRA 3C5SB 5EWIL 2K9UA 2QL1A 1VEMA 4G8EA 3TYGH 4FQPA 5L7XH 3JUZA 4U6VH 5JQ6L 4PREA 4BSWA 2HLFD 2YMXH 3SKJL 5HYQA 1J1OL 1J8HA 3VXTA 4JFOA 4WCYL 5AUMA 2VNCA 4U1HA 5F6IC 1BF2A 1HIML 3VRJB 4R0LC 2NY0B 2RCSL 1ZT7A 5ESAA 1UKTA 5I16A 4MNGB 1BMGA 3GJFK 3QG7L 2HVKA 3E0GA 3L9RB 5DRNA 3ILQC 5IESH 1P7KA 3CFJB 3WE6B 2OM5A 3O0RH 3OKLB 5ALCL 5LJYH 3LN4B 3FCTA 4BQ8A 3HC4L 4HULB 1BFVL 3DLQR 4L3CB 4ZXBB 4Q9QL 5F1NB 3QUMA 5B21A 1FL6A 4YGAB 3QI9C 3NN8A 4CVZA 4WDIA 3TWCL 3K46A 1QSZA 5F97E 3ULSB 5C0GB 4HWEH 4LCCB 3WIIH 1S7RB 3MMEB 4OGXL 4YX2H 3AXLA 1UJ3A 2LU3A 2V9RA 1RZJH 3VGAB 3L5XH 1OGAD 3GIZH 3LQMA 3MLXL 4NO0B 3S9DB 1TQCC 4Y1AA 3ULVF 2E27L 3NCYS 3UJTH 2XWBA 2BCKA 2NXZC 3WLWC 1TLKA 4M6OH 1OAYH 4WHTA 3OKEB 1QLFA 3B2UD 3ARZA 4M1DL 2YUZA 2E5EA 3X3GL 2VUOA 4PRHE 3QDJD 4YIQA 1N5AA 1MCBA 3MV01 4JG1L 1KG0A 3RTQA 4K71B 1BZ9A 1R5VB 3OR7B 1IKNC 2ADGB 2X4OA 4UU9B 3BFOA 3ELAT 4ODUB 3G5VB 3HE7B 1OARH 3EDDA 3O6FD 3PHQA 2GT9B 1DQJA 3ARWA 3W0WD 2YD7A 4PRIA 5I76B 1WTGT 4LRNH 2Z35B 1VEPA 4HS3B 5H37G 4OI8A 1HNFA 5IW1A 2GTZB 2YEZA 2IFFH 4N9GA 5CGYC 1KTLB 2GSIA 1U3ZA 2W59A 3O45A 3ARDD 3V5HA 4UAOC 2OXHA 3DO7B 5HHPA 1GC1H 4PG2C 4KI1A 3M8OL 4ELMB 1B4JL 1NCWL 3MACL 3L7EA 1RZFL 3RY5A 5KAQG 4O00A 4NZTL 4H20L 4UIKH 3FB7A 4HWZA 2Z92B 1WZ1L 2R4SH 3FN0L 1QRNA 4ERSH 1ES0B 3GJFH 5I1JH 4JFDD 3QIWB 2VDLH 1CXLA 3ARGC 1JGLH 3RUGA 1CXIA 3SO3C 1I9EA 4TVPD 2BHZA 1UADC 4IMKA 1MH5A 2EDWA 4AL8H 3DXAE 3V5KB 3NA9L 3BQUC 5HYEA 4F3FB 2Z4QB 2R1XB 1KCVH 1YEFH 4HBQA 4LIQE 4PJDE 4OCRH 2A38A 5ITBH 2WUBH 3QUYB 3K8KA 4K3JH 4MVBD 3WJJC 1JHLL 4R26H 5F6HJ 1CICD 4P59L 2P5EA 1JNHB 5DT1L 4RX4D 4HIHB 3VXUB 4N90D 2APBA 4XAWH 3D0VA 3R0NA 3PWPA 4C56D 2JELL 3MRQA 4V2CB 3SCMC 2CXGA 3U83A 2Y6SC 4WU7B 4X6EA 1T03L 3LHPH 3RVUC 5E8EA 4OSUH 4CU8A 4RISH 3NZ8B 4L9DA 2HT2C 2MPAH 4O51A 5EG6C 4S1QL 5DA4A 1RVFL 1A21A 3V0VA 4OF0A 3RX8A 3GJFA 2IG2H 3IJHB 2IANE 4I18A 2WBJC 2EIDA 3RUGF 1L7IL 2EXWC 1CDIA 1LK3L 4YR6A 2HA1A 5GRWA 3WSQL 1SJVA 3UXFA 4Y5VA 4P4KD 4ODSL 2H8PA 5BOPA 1TJGH 4N5UA 1U3HC 3RY6A 3U9PL 3QDGB 4YAQA 4CW1B 1CLZL 5ESQB 5SWZE 4TPRL 1FVDB 3V6OC 2IH3B 2Y07H 5C71A 4X4YB 1JGVL 4FP8H 2XKNB 1KCUL 3HPJB 3FONA 5HHME 1X7QB 5SV3A 4ZG1A 2X1QA 1AGEB 1U6AL 2EIZA 2YBRB 2J8UE 4QRSB 3CCHA 2B1HL 1M05A 5JR1H 4L8SC 4DOHE 5H35B 1JMXA 1TZHB 4DCQB 4X4XA 1A7PL 1PEWA 1ZANL 2FEDD 1OAKL 3MV7B 5C0RL 2EH8L 4PD4J 1QPPA 5IMKB 4NCC1 4OB5L 1UB6B 4BKLB 5I19L 2EIEA 1IAKB 1G7JA 2AK4A 2P5WE 5E2JA 4IJ3B 1XF4B 3S3JA 3G6DL 3TA3C 4PRAA 3G5YA 1ZT1B 3GHBL 3MLTA 1DE4A 1KTDB 4GG8B 4P99A 2V5YA 1LDPH 3BN9D 5GJSL 2F54E 1GGIH 1BQHB 3SJVD 3FB6B 3S98A 4RZCA 2AEQL 1LMKA 5I8OH 3BP4A 1CDYA 4RFEB 2E7MA 2EDQA 1T3FA 1Z9OA 3ZE1E 1NCCL 3BDYL 3ZTNL 3LQAC 1G7MB 5C0DB 3FRUA 2B1AL 1J0IA 5E7BA 4GQPH 4CL7A 3I6LD 1KJ3H 2FSEA 3QFJD 2D4FA 2GJ6D 4PJIE 4HKXA 1MFBH 3MNWA 3GMRB 5CSZB 3PIQB 1ND0B 1Q94A 1QYGL 4WUKH 3Q3GA 4JB9H 3PABA 1M7DB 2DI8A 5FO9A 1XGPA 2QSCL 4TULH 3RNQA 1BIIB 1WFOA 2GK2A 4YZFF 1AJ7L 1IKFL 2FL5B 5I1DB 3IFOA 5K59F 4P0DA 1EO8L 4MDJA 5JORA 4Z7WE 4XVTH 3ARFA 3HRZA 1Z2KA 3LQZB 5DSCB 8FABB 3QCUH 2E9BA 1K8DA 5EOCL 3QA3A 2VITA 1DBAH 1HNGA 2MHAB 4MA1B 3QNXB 4KZEL 4HC1H 2XACC 1TFHA 2V5SA 5IVZA 5CJQL 3UEZA 2H9GA 5JLZA 1CTOA 1JHTA 5BXFB 1DBKH 3DV6A 4WW2B 1T1ZA 2XOTA 4CJ1A 4NJ9L 3DV4A 3PG2A 5FV1L 1ZOXA 5C7XH 1YY8B 3RVTD 3W11D 3HAEA 5JNYA 1D7FA 2H2PC 4XH2B 2C3GA 5FA4A 4LLVB 5A16A 1DFBL 1T0NA 1X9QA 5CJOH 5KG9B 1MI5A 1M7IA 5MI0C 1JPSH 1DQQB 3HS0B 5H94A 3PWLB 1CDUA 1U8LA 4PRNB 1VACB 4ORZC 2EDRA 3O2WL 3QR2A 3BO8B 3QRGH 2AV1A 4L4JA 1DLHA 1K2DB 4JKPH 3HZMB 3H7BB 3V6FB 2CK0L 1MCFA 1OB1A 4OI9A 4NCC2 3RJQB 3C08H 3REWB 1XIWC 5L6YH 4MS8D 4LGPB 1MRFH 3PXHA 3QHFL 3CC5A 1FE8H 1NFDA 4X7SH 1X44A 3VMOA 1ITBB 2DQHH 2VZ3A 5EBWB 3H9SA 2C4XA 3Q1SL 4HIEB 3IDNB 4PJGE 7FABH 3SDAC 3W82A 3BXNA 4HC1A 4OCWH 5D93B 1FFNA 1NMCB 2ERJC 5C0BA 4NN6C 5DHYA 1BX2A 5TE7L 1OWRM 4K94H 3EJYD 2Y5TA 3KNBA 3BWAA 2ZWLT 3DUUA 3GMOB 1LVEA 5E6IB 1TTUA 3UTTB 4DVBA 1MEXL 4GRLD 3G5ZB 4Y4HD 4KQ3L 1Z0MA 4PJFE 1YEJL 4Z95L 2DQFA 3BEVA 4HUMB 2P42B 5GRJL 3SDDD 3KPOA 4UT7L 2DIAA 1YEHL 2WP3O 4P9HC 1MVUB 3O8XA 5D2LE 4FMKA 2ORBL 2NY3B 4YO0B 3TYFA 2OJEB 2Y06L 4M02A 3HZKA 3M17A 1DVFC 3H9HB 4AYFA 4JQXC 5F7NC 2L0DA 3KG5A 5KSBA 1DQTA 4CN1A 5CJ5A 4U33A 2OJZL 2VC2H 1RURH 4NZUL 1VFOA 4URTB 3WJLC 4JHWH 5IGXH 1QFUH 1NFDF 4MNQD 1TVHB 4Z78A 3QFDA 1F11B 4OD3L 4NKQB 3RVWC 1ADQL 3GMPA 3VXMA 2XRAL 4F7MB 2KUTA 4G6ML 3P9LB 3LY6A 4X9GA 3KYOA 2HT3C 3LH2L 5ID1A 1RD6A 1DBBH 2ZUTA 1T2QL 3VFMA 1U42A 5TQ0H 5DTFB 2E9IA 1NBYA 3BP7B 5DMIL 4KVCH 3QCTH 3VWJC 5KS9F 4GAGL 2Y25A 3IFPB 1H5BA 1IGFH 5KANI 2DTML 1UCBH 3P30H 5F88B 4N0CD 5DD1H 4KJQC 5EOQH 2X4PA 4YHIA 1CDCA 4XVSL 1S5HB 5BV7C 5HYJA 4YK4C 4OF3A 1K5NB 1FH5H 3LPFA 1EEZB 2ICCA 3CSYA 2NW3B 1YN7B 2XZAH 5JIPA 4FQHB 5D70H 3QEQB 2BJMH 3RPIA 2Z91A 3T0EA 3DI2B 4M4PA 1BVLA 1F4WH 2PO6C 3TT1L 1CLCA 5IQ9A 3RA7L 4AEIH 5GS0D 4KI5D 3ARYA 4IDLA 5FM5M 3MRKB 5GIRB 4GMTL 4LPUA 4KGLA 5C0CD 4M62L 3LQAL 3DBXB 1NC2A 4OLUL 2VLRA 1A1MA 3FRPG 1SBBA 2LTQC 1HH6A 1KLFA 4FFWC 3GMNA 1OM3L 5DO2D 3CLEL 3PWUA 4NNYA 4YPJA 1I4FA 5C0EB 1RK1A 2HFFB 4YDLC 3ROOB 2DQJH 2AJXL 4YHMH 2L7UA 1A3RL 2H26B 4P46D 1T1WA 1KIUA 4H1LA 3DO3A 5GRXG 4YDKL 4FFZH 3KPRD 2DM3A 3NIGE 3WEXA 3L3GA 1CD0A 5KSAD 5F96L 2AJSL 5FAAA 5I8EB 5IBTH 5SWSB 1IBGL 4GRWH 1FRGL 4Y4KA 1TCMA 3HG1E 1HWGB 5ACZB 4P5KB 2VZUA 2VXVL 3TCLA 3VG0L 3MLYH 3DVNB 4JFEA 2CKBA 3TBYB 5DJAA 5T3ZE 3C09C 2R69L 4Y4FB 4LSUH 3DURB 1FGVH 2ZCKL 4OQTA 1MCJA 3HPLA 1U92B 4H25A 2BDNH 2GEEA 1DEDA 3CIQA 4RA3A 1KPRB 3QYCA 2ZSVB 3KVQA 4XXCC 5E1HB 1A9EB 1I3RA 4XNUL 4WRLA 4BQ6A 5FCUH 3LDBB 4J4PD 4YNYA 2EEBA 1A6AA 4DEPB 4ELME 4BQ9A 2NY7L 1LO5A 1U36A 5D7IA 3S7GA 1G7PB 4XPHL 5D8JH 5GRUL 2UVEA 4B5EA 2XG4A 2J88H 4QY8A 5KBNC 5ISZB 1YPZB 3P11H 4WUUA 2ZG3A 3MBEB 4HS8L 2PYED 5JXEC 3MV8A 3QXAA 4Z8FH 2J4WL 1AHWC 3I75B 4D0BB 1VA9A 4JRXB 1XGUB 2OP4L 4PFEA 5C07D 4QTHA 5JPMB 3VRLE 3O11B 4JQIL 5L2JA 4Z76B 1C1EL 2R2CA 1GGCL 1MQ8A 4P57B 4GXVH 3G5XA 3LB6D 4JREC 4KK5C 5K9OB 3RY4A 4KK8C 5E8PB 4LVOC 1HQRB 4Q6IA 3SGKC 5GS1B 3QO0A 3BZ4A 4R8WL 4WI6A 3MJ8B 4P4RB 2DKSA 1BAFH 4MQXC 3GB7A 3CFEA 1A7QH 4UTBH 3O2DL 4E9LA 4OTXH 3VXUE 4Q9RL 3IGAB 4E41B 4MJIA 3MYZA 3GGWA 4EI5C 5ICXA 1PZ5B 3U4BH 1A1OB 3WO4C 4OIAA 2FIKB 5IHUL 2E6JA 5FOBA 3RZCB 4EXPX 5D7JB 2XQYK 4OZIF 2ZUXA 5KZCD 3WS3B 3MRNA 4KK6C 1A7NL 3B4NA 4G8GB 4AMKH 4UQ3B 3O3DB 5MENA 4NNPL 4X99B 3RGVD 3T77B 2I07B 1VADA 3MV9B 1JGEA 4GRWF 1CLYL 4CMHC 1I8LA 3K2MC 4NQVA 1NCDL 1Q0XL 3B2VH 4PJ5A 5D1ZC 5KVEH 2HJLA 2APXA 2HLAA 1CYGA 3VXSA 5A3IC 1WBXB 1PLGH 4XPTL 3V4PL 1QFOA 2O5ZL 3QDGE 2IADA 4QHUB 3UBXB 2QHRH 2MCG1 3U6RB 1C7TA 1RPQA 1K8IA 3Q6FA 3IKKA 4X6CA 3MRIB 4PRPD 3VE0A 1ZWIB 4U1LA 1YJDC 1QBMH 3R06A 5BV7L 5EH1A 4NGHL 2EE9A 5M95B 4Q9BA 5C0FB 3MGOB 4OV6F 3S35L 5F6IB 3CVHH 2PR4H 1HDMB 1NC4A 4R0LB 4PJAE 1U8QA 4ZUTB 1SYSA 2A1WH 3IKCA 5DGQA 1HEZA 3MRMA 2E7LA 4XRCB 3FQXB 3MLSH 1AD9A 3TZVB 3WUZA 2X7LB 4G9DB 4MMXC 4WU5B 3T2OA 5TDOA 1WAAE 5F7DA 2FX8H 3QXVA 3ETBF 1AKJD 2D4DA 4YXLL 1P4BL 3T4AB 3CVIH 1IFHL 3MUHL 5DMKA 5LBSH 3PQYD 2CDFA 4JDTL 1GIGH 1JJUA 5BZWB 1EV2E 1IRAY 4I0PA 4ZTPH 1F4YH 1MCDA 1WT5C 2UVFA 3IU3B 4LU5L 4HW6A 3HUJA 1SVZA 5DQDL 4UUJA 4UNVA 3D18A 3QI9B 3UDWC 5DEZA 3BH8A 2AEIT 5FGBC 1C7SA 4X6CF 2AXJA 5D7LE 3DSFH 5FYKE 4M1GH 2D03H 5EUKA 4IRSC 4X98B 4OCYH 3V79C 4O2FA 1D6VH 5GXBB 4TQEH 4M48L 4HG4K 2GCYB 1TQCB 4YGVB 3S5LG 5IB5A 3NFSH 1NJ9B 2AERT 3HNSH 3ZLQC 2NXZB 5DRZB 3CUPA 4ZUVA 4YXHL 3CVHA 1Y6NR 5FB8A 4X6BB 4Y16B 2YPLB 1NDMA 3EYUH 5GGVY 1YN6B 1YYML 3O4LB 5TFSH 4G43A 3CDFA 1QR4A 4NSKB 1RIVH 4X7TA 4LKCB 3HR5B 4MDIB 4JQVA 2NY5H 3DRTB 3HC0A 4PJBA 2FGWL 2WQRA 4NQDE 2RGSA 4UILH 2BP3A 3GNMH 3S34H 1AP2A 2HLFC 3G6JE 2ZSWB 4GW5B 5I1EL 5T33H 2VLJD 3T8XA 5HHOD 2ATKB 2ATPB 1MFCL 5CUSL 3I50H 4ZFOA 5IW6A 4HJGA 4ZMAT 4N0YL 4E5XB 1NDGA 3AB0C 4UAOB 1MUJA 2VDKL 4DN3H 1G7HB 1OD9A 3L95B 2Q76A 4EN3D 1IZJA 1FPTH 4JO1H 5DD5H 2VLKE 4IS6A 3GDBA 1NFKA 1E6OH 5C8JB 5HGAA 2F74B 4QF1B 1NGQH 2LFGA 4ZOEA 2J12B 1MJUL 1JV5A 4LQ1A 4YHZH 4XMLH 5EZIH 3QP3A 3ARGB 1IC7H 1GGUA 2FD6L 5L8KB 5FUOH 3MLUL 4OZ4B 3SO3B 1ZA6A 2QQNH 2MQCA 1EA9C 5KVGL 4O4YL 4AJ0A 1RIUH 4NQSB 5D2NC 1RJZA 3V5DB 4JGJA 1N6QL 3BQUB 4JPVL 3T0AA 4M7LL 3PP4L 5F9OH 1KJ2H 3G6AA 4TUKH 5E94B 5BCAA 1G84A 3BKJL 4NJAL 1EVUA 4JHAL 4LCUB 2ZCLH 2YN3A 3VJ6B 2OLDA 3OG4B 3VFNA 5T3XL 5HGHA 3GMQB 5L2KD 1IEBA 3B2UC 4PJ7A 4Y19A 5EU6B 1MHCA 2MTPA 4CVXA 1H3XA 4U7SA 1PD6A 4DW2H 4HLZG 2UUDK 1J5OH 1QLEL 3N1PC 3KPMA 3SCMB 4NHUA 3MPCA 1QFHA 1RMFH 1YEKL 1K6QL 1PX3A 4QXTA 1RY7B 3BKCL 1B9ZA 2J1KA 4DGIL 5C6PB 3BWUC 5CZXD 2ADIA 3UTTE 4F7TA 5HGBB 4Q74A 3OKKA 1CF8L 5IHBA 3JV4B 2VLLB 3PWVA 4KHXL 4CNIB 3VW3H 3JWNC 3S6CA 4PYGA 5IEKB 2MMXA 2WBJB 3CFIC 3UPRA 3JV6A 3VWKA 2FLBT 3NCCB 3FT3B 4YHKH 1SM3H 1UC6A 4OLYL 3ARDC 4Z77B 1P7QD 2DAVA 9CGTA 1MQKL 3SE9L 1UM4H 3PL6D 2BHUA 3VH8A 1U3HB 4HS6A 3CU1A 12E8L 1KJ2A 5DC4B 4LIQH 3TH3T 3QUKB 2BNRD 3V6ZA 5BQ7B 2ZCHL 3NCJH 4OFDA 1YJDL 5F8RC 2FJGA 3PV7A 1XEDA 1NGXA 4BZ2H 3BAEL 1G7QB 2NZ9C 1DTUA 3VFPB 2EDXA 5CEXB 5ADOH 1P84K 3ULVD 2ICWB 2AXHA 4KRMB 1ZGLM 1J8HD 1YMMB 1S7TA 4N9OB 3G08B 5E6ZA 3T0WA 5DJCA 4OZFB 2PTUA 4L8BA 1JWSB 4WFEE 5KJRH 1HHKB 4MLIA 5HBBA 2EECA 5T5FL 2WINB 4L8SB 4YBQD 5I15H 1G0YR 2QJDA 4LEOB 5E5MA 4AM0A 4POZD 1N59A 1DQML 1KUMA 4MVBC 3SDXA 4K2UH 3TBTA 1MCLA 1FSKB 2VMFA 4YFLI 1CICC 1A7RH 4ZFZA 1CFBA 1FVEB 2A6DB 2Y1VA 3VMNA 4UT9H 4NKDA 2XN9B 5DLMH 3QEQE 4XWOC 5I0ZA 3DXAA 5D1XC 4GXUM 4I4WB 4Y5YC 3TA3B 3KPNA 2R1YB 5HDBF 3T3PE 4GKNB 3OXSB 4PJDA 4U1IB 1PYWA 1WEJH 2GK0B 2OL3L 1Y6KR 3Q5TA 4GAJH 4NC1C 5HYSA 3KJ6L 2DM2A 3QHTC 3E6FA 4HH9B 5CSBA 2XZQL 2E7BA 4OCSL 4Y1AD 4QLRA 3RWHA 3U46B 4QTIH 5ICZB 5FYLL 3PNWA 5TF1L 4HUWA 4OLZH 1IC4L 1FAIH 2R2HB 4O2EA 5GRVK 1YY9D 4QHNA 2NYYD 3GM0A 2X4RA 4F15C 4EQ2A 1RHFA 4OCXH 4MA8H 4V1DB 3RTQD 3C9NA 1N26A 1PQZB 1E4WL 3GSNH 5ALBH 1L7TH 3WV0A 1U95B 2UZIH 2WV3A 3FAXA 5C0AE 5IM7A 5GHWL 2HG5A 1BVKB 2R0WL 2IANA 3MFFA 3KPSB 1C16A 1W0VA 4PRID 3N85L 3B5TA 3L3DB 1MIEH 1D5MB 1J7VR 3QDHA 5SWSE 1BD2E 4XB7A 1J86A 1MRCL 2H32A 4P3CL 4MA7L 4PS4H 3QULA 2O5YH 4PJDF 1HSAB 3QWOB 1DBJL 3L6FB 1Z3GL 4HZLA 5EO1B 1MHHB 3RWDB 4JPKL 2FEDC 1GZPA 3QQ3B 4LVNC 5GJTL 1QRND 5F7EH 4LLMA 4RGOL 4NFBA 2UWEB 1CFNA 2RB8A 4S1DD 2X9WA 3UC0L 2NX5B 1R5IA 2J8UA 5L9DH 5EDXA 3AAZA 5IV2A 2F19L 5MI0B 3AU1B 2DYPB 5I1GH 4KROB 2YZ8A 3BVNB 4JFZH 4XNQB 4A6YL 3VXOA 1NLDH 3O9WA 1Q38A 3BN9C 3DIFA 3GSNA 3HMXA 5IW3A 3P4NA 4I48A 1LE5B 2DBLH 2E8YA 4Y2DA 5TF0A 5E2WL 4WTZA 1YYLH 5ISZE 4PTUB 1LEIA 1YPZE 3B43A 3WFHA 1XIWB 3IDMA 2DD8L 2X4SA 5DZNA 2H3NB 5C9JB 1D5BB 5J1AA 2VIRA 2C7UB 4NHCH 5DD6A 1WBZA 2P5ED 5EZLB 5IVOA 4FQJL 1N8ZB 1N5YL 3IVKA 2YD6A 3QXUA 2P24A 3SDAB 5ILTL 4NNXB 4NQXA 1B3JA 1ORSB 3F8UB 1OOAA 5DVNA 3K74B 2ERJB 3PWPD 5DS8B 4NN6B 1CDJA 1A6WH 1EEQA 3QPQD 4BFIB 4ZD3H 3DRQA 1DJSA 3O6LL 2F54A 4IRJA 2D3VA 5MEQB 4FNLL 4R3SA 1CGUA 1ORQA 4TUOB 3MRHB 3LKNB 4Y5XC 3GSWB 2Z93A 3QB7C 1SBSH 4HJJL 1HI6B 2DI7A 5JOFA 1OAZH 3OHXA 2D9CA 1QZ1A 2J8UF 3CFBA 43CAA 2V2TA 3BPCB 4H0HB 1EEUA 2HVJA 4E41E 1CGXA 3S96A 3EO1B 4F7EB 3VFVB 1F4AA 4JO2H 4PJIA 3C2AH 2OK0L 3D5OF 3QIBA 2BK8A 1NANH 4HMEA 1DVFB 1F45A 1VFAA 1L0XA 2NY2D 3FZUD 4OLWH 3WDHA 1C12B 3X12A 1ERNA 4G8GE 1LO2L 5DDHA 5F70A 2GI7A 3RVTC 3SOBH 5F7MC 4Z7WA 2X70A 3MV9E 4NC0B 4XCYA 4XNZC 4TVPL 4LHUA 5IWLA 3FL7A 2ZKHH 4NDMA 3UTSE 1TJHL 4FABH 1IGCL 1PG7X 2Q86B 2H2SD 1MPAH 1XZ0A 1BVZA 4P5MA 3RL1B 1NEZA 3ZE1F 4Y88A 4MS8C 3DMMA 5L88H 1OD7A 1NSNH 3O6KH 2AQ1A 5DUML 3NCBB 1XGRB 4P2QB 4Q9CA 1EEYA 2AK4D 5BV7B 4PJIF 4W6YB 2GIYA 4YK4B 4RGMC 2R0ZH 1I9RL 1RZKH 1WSST 2R2EB 1CT8A 1J18A 3DROA 1CL7H 2NTSP 3EJYC 4RMRA 5HVGB 2PO6B 5JW3H 1RUAH 3V52H 1BBJB 4HMCA 1IT9L 5DURB 1FL5A 2HWZH 1JWUA 3DECA 4OFVA 2OS7A 3MUGA 4GRLC 4Y4HC 1TNMA 4DZBA 4J8RB 1DN0A 3OKOB 1EERB 1RJLB 3SDDC 4XP5H 2DQGL 5DUPL 4F33B 4PJGA 1JFQL 1BP3B 2WANA 3L3OB 3LEVL 1T0MA 3OAYK 3OZ9L 3EOAB 4WTXA 2LTQB 5IEHA 1U3JA 3CPLB 4DJMA 1M6OB 1T89C 2DLIA 3FQWB 4FQXA 4YDLB 4HT1L 3NZHL 2A6IA 2ITDA 3ZE2F 1UB5B 5KSVA 1IC5H 1QHOA 2MWCA 4NN7C 3O6MH 3KHOA 1RU9H 3FO9A 4PJFA 3NCEB 3SHSA 4DK3A 3I2CH 4I5BA 5CKGA 1W2KT 3REVA 3ARFD 5DD3L 3NPSC 3H3KA 5CP7B 3BE1L 2HRPL 3V0WH 5J6GB 1ZKAA 5D2LA 4IBLT 4WFFD 5ID0A 1U93A 3ARTA 2IWGA 5F3HA 2WQ8A 3MBXH 2PNDA 1IEHA 3TPKA 4NUJA 5BZDB 1MRDL 5E9DE 3EYOB 2VXQH 4HG4J 1R3JA 3O4LE 1CFVL 1AY1H 1N2RB 4WEMB 4ZS6C 3C5JA 1KJVB 1KGCE 2XNAA 4KXZH 4N0CC 3C09B 4J2XA 1I8MA 4PJGF 2X4QA 1RZ7H 3DWTA 1VPOH 1U2HA 1LP9B 1KELH 4HXAH 3AS3A 5E2TL 1MI5D 2CKNA 2E3VA 4UOJA 1MJ7H 2IAMC 4HWUA 3X13A 2DQCL 3BH9B 5E2UH 2A74A 3INUL 4I2XB 1IM9B 4FFYH 4PJFF 3C60A 1P4IH 4G7YH 1C5CL 4XNYH 1X5GA 2FIRT 4EOWL 1INDH 3DVIA 5D2LF 3H9SD 3KS0H 2W9DL 1AHWB 3VXNB 1T04A 3GI9H 4HH8A 5C6TL 1F13A 5DO2C 3MLZH 3VRJA 3OAYH 5IBUB 2IEPA 4XBGB 5C0BD 3ULUC 2WWMD 4FQQB 5BO1L 3P4MB 1NAMB 1NL0L 1Q1JH 1QP1A 3O3AB 5TDNB 5HDOA 2RBLA 4JREB 5IKCB 4ELKA 4XCNB 4LVOB 3LIZH 4P46C 5DJDB 3L9RA 2X4NB 4U2ZA 3Q6GH 4FQ1L 2VQ1B 1CIUA 1DDHA 2WWKT 5T3ZH 4GSDL 4NFCA 3S5LB 3OKLA 2DB8A 4TTDC 1CD1B 2DMKA 3NCYP 4H8WH 4KKBD 5KSAC 4L3CA 1UQSB 4KK9D 4HV8B 5F1NA 1K4CB 3O8XD 2BY1A 2VRAA 5B8CC 3MSPA 1CXFA 3WO4B 3CK0H 5C0GA 1CVSC 3OXRB 5EU7C 2GHWB 5D1QB 1JN6B 4NO0A 4G9FB 4KKCD 5BVPL 5FHBH 5HPMA 5AWNL 4EUPG 3T0VA 1D5ZA 4NUGL 3VXMD 3OKEA 4CMHB 2A9MH 5A2JH 5D1ZB 4S0SD 4G80B 2CIIA 2VXUL 3HG1A 2NNAB 3GBNL 3O3BB 4HSQA 3WO3B 1VERA 3OR7A 4AIZB 2ADGA 1T22B 4ODUA 3V6OE 2Y23A 3FOLA 3CXDH 4LMQE 3EYQD 4NYLB 1IGIL 1L0YA 3A67L 5A43C 2W9EH 3MREB 4P49A 2Z35A 4FFVC 2Q8BL 5MP6L 2DJ4A 2GTZA 1SEBB 5HYJD 4HKJA 2YK1L 5K9JL 4IRZL 5FGSA 1A7OH 4D0CB 4JEGB 3TVMC 1A9BB 4W68A 2ZOLB 4M7ZC 3T0ED 5CD3B 4ELMA 1MAMH 3LB6C 4HXBH 3BUTA 3HTLX 1P84J 4LSQL 1MLCB 5FO7A 4KDTA 5KTEH 1CQYA 3NIGF 3MXWL 3WIFB 3QIWA 5EIIA 4HKZA 4RMSA 3L5HA 4XHJD 1VKXA 3GI8L 5K33A 2FBJH 1NC2D 3W39B 3F12A 2VLRD 2IBZY 1II4E 1M71B 5BMFH 2XN9E 2YD4A 2WIIB 3B9EA 3BJLA 3SQOL 4ZNEE 4UMGA 2QADD 3TIEA 3H7LA 3P0YH 3WNNA 4WI5A 3V5KA 1H3VA 2H41A 3A6BL 4LLYB 4F3FA 1Z9SA 5IMOA 4EDWL 1GZQA 3N1QC 2C1PB 4JY5L 3C2SA 4NQEB 3QUYA 2OL3B 2YKLL 4X0KB 3OAUL 2BNQE 3L1OH 3RGVC 4QXGH 1VESA 2DQUL 1CGSH 2BX5A 3IXAA 4JPWH 4MAYA 1JNHA 4HIHA 2B5IC 4UV4H 5IP4A 3VXUA 3WKNA 3W9DB 4KQ4H 1RV6X 4G42A 5HGDA 4ELMF 1AGDB 4XWGL 4Y4KD 4U1NB 4V1DE 4I3SL 5CGMA 2HYMA 1OSZB 2Y36L 4GW1B 2VDMH 4PJXB 1XCTB 4XPAL 4JFED 3X17A 1U9KA 1J0ZA 4WFHE 4X5XB 5D5ME 5C9KA 4TNWF 1BQLH 5BS0E 1ACYH 1HKLH 1LWRA 4OBRA 5GGSA 4RAVA 3VRLF 1P9MC 3VG9B 4F57H 4YQXH 3FN9A 2ESVA 1G0DA 1J12A 3CH1A 5E8NA 3QZWA 3GSVB 3FB8B 3AB0B 3QDGA 4CW1A 3FMGL 2Q6WB 1YEGL 5I2IB 4LVEA 4GAYB 2IH3A 4XBPA 4O5LH 2Q7YA 3GBML 4JHBA 4JM2C 3LKPB 4HCRH 1KFAL 5DVMA 1F3JB 2FZ3A 1RUPL 4I0KA 4KTDH 4WUUD 2UWEE 2VO5A 1AGEA 3MV8D 1WK0A 2YBRA 4N8VG 4QRSA 3S4SA 3B9KA 4ETQA 4QHLB 3JUYA 4OT1H 4YUEH 4JO4H 1MJJB 3IB4A 3GKWL 4L5FL 3ULUL 4YPGB 1QSFB 4PJAA 1ZLUK 5D2NB 4A6YB 3B6SA 2CPCA 2AS5M 5DC9B 4LLUB 2B0SL 5I30L 1OAXH 1WAAA 5DHXB 5CIPA 1NBVH</