4S0TD

Structure of human pregnane x receptor ligand binding domain bound with adnectin-1 and compound-1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
91
Chain Sequence
ADLEVVAATPTSLLISWPPPYYVEGVTVFRITYGETGGNSPVQEFTVPYWTETATISGLKPGVDYTITVYAEMYPGSPWMDIQPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Nuclear receptor subfamily 1 group I member 2
publication title Developing Adnectins That Target SRC Co-Activator Binding to PXR: A Structural Approach toward Understanding Promiscuity of PXR.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 91
sequence length 95
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s0tD00
1TTFA 4LF3A 4M3JA 2R0WH 4XCCH 5E2WH 1YEFL 5AZEH 1JTPA 4Y4FB 5IMLA 4PJ5D 4QOKD 2OTUB 3EDFA 4HKXB 1MI5A 3QCVL 5IW1B 3BSZL 1NFIA 1RU9H 2NX5E 1BVZA 1JNNH 4OBSA 5D7LE 2WK2A 4JQIL 4X7SH 3GGWA 4M1CD 5GS2D 3K74B 3FT2B 4LHJB 1CDJA 3IXTB 5FO9B 3MV7A 1SYSA 1DTUA 1OW0C 4DN4H 1C12B 4XP1L 5HGDA 1NUFA 3IB4A 3J7HA 4XGZB 3DVGA 2CLVA 1NEZG 4BQ9A 1NPUA 3OR7A 4PJAF 1CF8L 5LGHL 1YQVH 2D4DA 3EOAA 5ALBH 3SY0A 2HVJA 3QQ9C 4I8DA 3KJ6L 1XIWC 2RCSH 1E27A 1JTOA 5IW3A 1AY1H 2J3SA 5IESH 1T66D 4PJ8D 5E6ZA 2ENSA 3T2OA 1J1XL 4PJBF 1PSKL 5F1IB 1M05A 2DJ4A 4XAWH 4KTEL 1L0QA 2LTQB 2NXYD 5JZ7C 1K3ZA 1CGXA 1HK6A 1MCJA 1TZIB 5GGSA 2ZUTA 4NUJA 4DGVH 5IG7A 2EIBA 3QQ4B 5DI8B 2R0KL 3FMGL 2RGSA 3BPOB 5EC2A 2EXWC 1KNOA 4LEXL 4OD2B 3BDYH 5IBUG 3UTZB 5FGCE 2NTFA 5AUMA 2BNQE 1FGVH 2C7UB 3U7YH 3UX9B 2DM3A 3PDOA 1S7UA 2R8SL 4G8GB 3QP3A 3P0YL 1MFNA 5BRZB 4K7FB 3MRDB 1F13A 4NKIH 3FB8B 1ZLVK 2DD8H 4I18C 4G9FA 5HDLA 1U95B 1FCCA 3ZL4L 3B9EA 3IAQA 3QG6B 4HX1B 2F54B 2AK1H 4DAGL 2ICEB 4OCXH 4WUUB 2LU3A 1I85A 1WIPA 1XF1A 1MJJB 3MOBH 3TBYA 3T77B 2J8OA 1VDGA 3KPOB 2G5BA 4L9LB 1MWAH 3CVIL 1RQ5A 1SMOA 3TT1H 2GSIA 4NJ9H 5MEPB 3O2VH 1CLYH 5EBGA 4BZ1H 1MVFA 3UAJC 1P6AB 1DBKL 3PL6C 3IJYA 5I1IL 5KTEH 3BDXA 1W0YT 3FO2A 3VFUA 2AEWA 4WTWA 1OARH 2W0FB 2P5EA 1OTTC 3QNYA 3BT2H 3LEXA 3R1GH 1DBAH 3WIFB 5FM5M 1GJIA 2VABA 3UBXB 1OP5K 4YEFA 3BZFB 1AD9A 1OP9A 3H2WA 3GSRA 3MGAA 2MCPL 4ZTPL 5I2IB 1GHFH 1ES0B 1WLHA 3Q6GL 3U6RA 3QNXA 5L7XL 1I7RB 5DJ8A 1MIML 1W72B 2H26A 5EU6E 1AGEA 4G8GD 4D0CA 5GIRA 3RVWD 1LK2B 1KB5A 3R06B 3HCVB 2Q7NA 3KJ4B 1T1ZA 2XFXB 2P44B 1A0QH 2EO1A 3STBA 2FO1A 5D2LE 1BBJB 4BYHA 4K9EC 4X6DB 5L0QB 1MY7A 1CI5A 1S7XB 4OFYD 1FL5B 3DIFB 1YEKH 3BKMH 2W60A 5TH2A 4XBEL 1J9CT 2X70A 1GIGH 1RZGA 5BXFB 4Y2DC 1KBGH 3K8KA 1BZ7A 4LLDA 2XG4A 4K55A 2MHAB 3VGHA 4DKFL 3OKEA 2R1XA 3LEYL 5IV2B 1CDHA 3MJGX 1L7TL 3T2PA 5F3HA 3SQOH 2ORBH 2E6PA 3IJSB 1AGFA 3DVIA 1ORSA 2DLGA 4HEME 1AKJB 5D93C 2WUCH 4OUOA 5E2UL 3PXJA 5DD0H 1GL4B 2FJFB 2OR9L 1JFQH 1KJ2B 1OWRM 4JM2F 3W39B 3OXRB 2DQEL 3NCJH 4NO0A 3LKSB 3QEGH 4NO3A 4D2NA 1EZVX 1FO0A 1XGTA 1RZKH 3MCG1 3ULUF 1CE1H 3DX9A 4LPWA 4OIIH 1Z0NA 1ZEAH 4PD4K 3SGJA 3L95A 5FYJU 4HDIA 5A2LH 1QSFD 4M1CC 3MFFA 3CCHB 1JUFB 5E24E 1KACB 1WGOA 12E8L 3ROLA 3MRKA 4PJ5E 4QOKE 3TLRA 4XBGB 3T0EB 4DFHA 1P69B 1TJHH 3RTQA 1DJSA 2VDOH 4U6HB 3TA3A 3O2WL 1A6VH 1IRAY 2J5LB 2HLFD 5C8JA 3MMEA 4H5SB 5I1JL 4R3SA 2PF6A 5TDOB 2XZAL 5ID1A 1T66C 1MUJB 4J3TA 3BN9D 3FB7B 4PJ8C 1NGXB 1DL7H 1T1XB 1II4E 3R0NA 4LKXB 3DETC 4Q9RL 3MJ7A 5FV2A 4LCUA 5CKGA 4OGYH 5J8OA 1HI6B 1T21B 1XR9A 4O4YL 2FX9L 2ZPKL 4GRMA 4Y4FC 35C8H 1T7ZA 5D5MB 4RBPH 5EPMA 1W0WA 2VLRB 4WW2B 3RWCB 3F5WA 4XP6L 3KWWA 1BJ1J 1PJ9A 3VFTA 5B8CA 4NYLA 5BVPH 5FYKL 5DRNB 1QEWB 1MWAB 3A6CH 3TH4T 2X4PB 3BEWA 3OAUL 4YPGA 2Q8BL 4JM4L 3CDYA 4KHXL 4ACPA 4OQTL 1KT2A 3G5ZA 2DQUH 3PP3K 5JW4M 2IADA 3JUZA 3MLZL 3P0VH 3F7VA 1P6FA 2CR3A 1N5AB 1V8HA 4FFZL 3O41B 4Y1AD 3T0ED 2PYFB 3KPSB 4XPFL 4YUEL 3VXSB 2B1HL 5SWSB 1LVEA 1FZMB 3M17B 1U8MA 4M6NL 3FQNA 4WUKL 1MFAH 3CDGB 1J86A 2PW2B 3LZFL 1OD9A 3MCLH 4EIGB 5IK3A 3TV3L 4W70A 4UT7H 1YUHB 4GMSL 3QIUB 3MRFA 4HH9B 5T5FL 4D3CL 1FZKB 4RGNB 1C5DB 3HZMA 2C4FT 1AC6A 1ZHBA 1FIEA 5EU6A 4C57C 2LTQC 1DSFL 2Q76B 2AV7B 3DV4B 3CH1A 5DJCA 4EBQH 4NCC2 3RVTD 4J12A 4PD4J 3QUXA 4URTB 3ARUA 3V6OC 4PY7B 3LIZH 3REVA 4QRRB 1KLUB 5C0AB 5ESVB 3BPOC 5E5MB 2XKNB 3MV11 5D2LA 1HEZA 2VLRD 3HMXH 5T1MB 4RA0C 5C9KA 1P2CA 4XHQA 2OP4L 1EIBA 3V0WH 4HLZH 1NL0L 5DRWA 3QWOA 4UU9A 1NC2B 1PD6A 3NABL 4MLIA 1G7JB 1S9VA 5J1AA 4WI8A 3IAGC 4JFPB 5DC9B 3CMOH 4HPOL 5HYSA 1DBMH 3GMPA 3V6OE 2PKDA 1AC0A 2BOBB 2G75B 4P2YA 5GGUA 3B2UD 4NWTH 3T2NL 4E5XA 1KIRA 4FABL 1WAAE 1GZQB 5HVFB 1VEPA 2DMBA 4RWYL 5K9JH 3T0WA 2P8MA 4ONHB 1T22A 1QFWM 3SE3C 1J0KA 5HHQA 3WDIA 3VD9A 5DYOA 5SWSD 4ZUWA 4G8GE 2JJSA 4L9LC 3VFMB 2VLJA 5I19L 4LBEA 3BXNA 1MRDH 4Y16B 3KR3L 4X98B 5FCUH 1WWCA 5T3XL 2E7MA 1TTUA 1ZT7A 3RU8L 5FF6A 3VFVB 1TLKA 1PZ5A 5TQ0L 2PETA 4YXHH 5EWIH 3W5MA 1I1AD 3JTSB 4O9HL 4UIMB 1H3PH 3BQUB 1QLRB 1RULL 3D9AH 2E7HA 4X99A 4XNXH 1MY5A 4JFYA 1CD8A 1G7LB 3HFML 4NHUB 5KSBE 5F8RC 5C0AD 3ARRA 1JGEB 4Y19B 2A1WH 4PB9H 2P45B 1FHGA 4HFUH 3LPFA 2QTEA 4H1LG 4XRCB 3RIAK 3L5WB 1GC1C 4N68A 1HHIB 1TJGL 3IFNL 4PJ5A 4HUUA 4X7TA 1UXSA 1ZTXH 1Z6JT 4NO5A 2AEPL 5DD1H 4DZ8B 4OCSH 5EORH 3RWEA 3HRZA 5DJZA 4NT6A 4X5WA 3BO8A 4D0DB 3KJ4C 2V2TA 1XGQB 3QO0B 2VTFA 4LOUD 4J7RA 3O6MH 4PJHF 2P24B 2VIRA 1CDYA 3DNKA 4WENB 1VESA 3CXHK 1NJ9A 3HI5H 1G9MH 2VXTH 5L0QC 4RISH 2H8PB 3KLAA 5CHNA 1UM6H 1HINH 3SKOB 4JN2B 2DTML 3MOAH 1I7UB 3UC0H 3X13B 5IP4A 1IFHH 2WM0A 2A9MH 4WI6A 5JORB 3OKNA 2R2HB 3CFJB 3KHOA 4XP5L 3JXAA 2ICWJ 4Y16D 2X41A 1KCSH 1R3KA 5B22A 32C2B 3ZYZA 1QYGL 1WEJL 1N6UA 4XCYB 3NPZB 3OTTA 2AGJL 3MR9B 3MXWL 1JNLL 4IHOA 3WNMA 1PY9A 2J8HA 1FDLL 1QSFE 4NOBA 3BISA 4AK1A 4Q2ZB 1LP9B 4ODSL 4RSVA 2DQGL 2XXCB 2BVUA 1S8DB 2X4UB 3KLDA 1R3HB 3H3PL 1BLNB 2AI0H 2H32A 2C3GA 1A64A 1XCQA 1ZGLP 4ODHL 5KSVA 3IS0X 4X9FA 3BX7C 2Q87A 2VC2L 2R69L 2VDKL 4TNVF 1H3UA 5FV1L 4MXVE 2ARJQ 5HJ3B 3I6GA 4F57L 4OLXL 5I8EA 5KVEL 4YDIH 1OTUD 3LQAC 5IVOA 1E28B 3O6LH 5HHMB 2OTUA 5DTFA 5C0RH 1CK0H 1T6VN 1LE5B 1BVLA 5IW1A 1H9VA 3RL2B 4UT9L 4DW2H 3FQWB 5FOJA 3QDAA 4ZO6A 3IDIA 3IU4H 3TBVB 2HTKC 4DKEL 1T7XA 3FT2A 4FQQA 4XP9H 4XVJL 2VDPL 3OV6A 5DS8A 1A3RH 1C12A 5LJYH 1SM3H 1FNSH 2CLZA 3T0EC 5KW9L 4F9LA 3F12B 4CNIA 5T5NF 5IF0B 2DLFL 1FGNL 2E6JA 5IOPA 2C1PB 4NUGL 1YC8A 2J5LC 2VR9A 4Y8AA 1NSNL 4QRUB 5DJ6A 1KEGL 1P4BL 4YHNA 3V7AG 1UKTA 1S5HA 3B5TA 4DK6A 1T1YB 3MGTA 1ZSDA 4G8IB 3VI3E 3LKPB 2HAZA 1FCGA 1WICA 3J8F7 2R4RH 3PHOA 3V4PL 5TE4L 3VFPB 4Y1AE 3T0EE 4HMCA 4PJCF 4KDWA 1GGIH 1EJ6A 1KCUH 3C5ZB 2BSED 4NKOA 2GQHA 4LPCA 3IFLH 3RVTC 1NC4B 4ZFZB 1RUKL 2X4OA 3EZJB 1NH6A 4XZUB 4FG6D 1MHPL 1RUQL 5D6DA 3V6OA 3CXHJ 1NGYB 3QA3B 1IBGL 3QQ4A 1SQ2N 5DLML 1NUNB 5CILH 5HHMD 4PPTA 4WW2C 3MGOB 3T2QA 5DHYB 4FFVD 4NHCH 1A6UH 3L3OA 3GB7A 2ATKB 3ZT6A 3CSYB 2X40A 3GKZA 4NNPL 1CGSL 4UDTA 4DZBB 3HUJB 3FN0L 1ZVSA 5EUKB 5CS7A 5J12C 5TFSH 2O5YH 5FUZH 3FQUB 1U95A 1BQHB 2EE2A 4ERSH 3CD4A 2R2EA 1IAIM 3B2UC 4HX1A 3SDXB 4BM7A 1JYNA 1HKLH 2ICEA 4ZODA 5TDPB 5B39A 5C0IA 2XPGA 2VLRE 3B8SA 5C07A 2DIJA 1PG7X 2EE6A 4POUB 3G5YB 1YEDB 3OKOB 1RK0B 3SO3B 3D0LB 1IKFL 1KJ3H 1Z9SA 2KQMA 2MJWA 1QSEE 1LEKB 3WLWD 3GSUB 4I5BA 3C5JB 4KZEH 2Q7YA 5KSBA 5KVFH 2A2QT 3EDJA 3ARYA 1D5IH 3GNML 4TRPL 3GSOB 3QIUC 2F8XC 1EHAA 5HGBA 4L4VB 5HYJB 1XF4B 3NCFB 4RGNC 1DCLA 2EH7L 3N1MC 5C0BD 5D7SH 1ZV5A 5SWSE 1X44A 4I0CC 3PWPB 2XV6B 3GMMA 4O5LL 1MJ7H 1UZ8A 1FZOB 4R96B 2DLEA 5I2IA 5EO0B 4EVNA 1Q94B 1U8HA 3I85A 3FRUA 1WFOA 4ONOA 2OZ4L 3T04D 4WU5A 5C0ND 5K9QI 1MLBA 2IJ0C 4Z0BL 3BJLA 3BW9A 3RFZC 3FRPA 5DEGA 5ETUB 4BZ2H 2EDBA 4KTDH 5C6TH 1N2RB 5C0CB 4LOUC 1ZLSL 5C0AE 3SDAB 1OPGL 4FXLA 1QSFA 1SEQH 1A6AA 4G7VH 1FL5A 4OGXH 1U8PA 3D18B 1YQ2A 3OPZL 4Y4KB 1MRFL 1HXYA 3VXTA 4Y16C 1X5JA 1S7WA 3KPLA 4R8WH 4JFDA 4AIOA 5F7WC 3S9DB 3EUUA 4TTDC 2HJKB 4XMLL 3MRHB 4XPHL 2Y7QB 5F6IB 3RGVB 3NCMA 2NY6D 2MPAL 5F1NB 1AQKH 2VL4A 5D71L 4RFEB 4C83A 4R7DB 3BQUC 2OX5A 3G08B 4HHAA 3MRPB 3LKQB 3PWPD 4PS4H 4FZEH 2A77H 2CKBL 4M7LL 3SDYH 1RUAL 3GSQA 1D3CA 2AERT 1NDGA 3IDJA 1FRGL 4KHTH 1X9QA 1GGBH 4JHWH 3HC3H 2XZQH 1F3JA 3SE8H 4OF7A 1OTUC 2BY3A 3D3VD 1KEML 4MDIA 3WFEH 3P4NB 2I07A 2OL3H 4PRBB 3OJDA 2BDNH 1UFUA 1IGIH 1BM3L 3MV9E 2DIBA 2R2CA 1KCKA 4L8SA 1KJVB 3SDAD 1F3RB 1M4KA 3M1BB 1UEMA 3ARFB 4LIQL 5HYSG 4GKOA 3QXUA 4KKAD 3U46B 5L88L 4PGCB 3IDYC 3MXVL 3O3AB 1UWEH 4P59L 4Y1AA 4XBGA 1JPGB 4U6HA 4OB5H 4U6XA 2XWTA 3O45B 3HZKB 1KLFA 1ZT1A 3CXDH 1ZLVH 4LLUA 4PRDB 3NZ8B 3CFEB 3O4LD 4MXWH 5E94B 3GMLA 4YPJA 1HHKB 4G5ZH 4QXGL 3ULUH 2R1YB 4PJAB 5EC1B 5DXWA 3OZ9H 3MV8D 3QDMD 3BRFA 1VKXA 7FABH 3OX8A 3ZE2F 4JGMA 1ZK9A 4NRYB 2P49B 5T1LB 3MLSH 5T1KB 1T0NA 3DX7A 2V9RA 1A9EA 2QL1A 2HN7B 1DEEB 2K3TA 2RFXB 1HIML 1OOAA 1LEGA 4PJBB 5I1DA 3A0OA 5FKAA 1DQJA 2LVCA 1QVOA 4JVPA 4EKXA 2W9DH 5EOCH 2VLRA 1YMHB 4FXGB 4FFVC 4JPVL 4AEIH 5JW3L 2FB4H 1CBVH 1K5NA 1U92B 2QHLA 2YXFA 4IIQB 3VFGL 4GSDH 4NZJA 4Q6IA 1PQZB 5F97E 3EZ8A 4YFLI 5C0DB 4FQ1H 1MWAA 1QSEA 1JHLL 4WFFD 1LILA 5F7DB 3T4YB 3L3DA 1BD2E 3TEUA 2YRLA 1CIUA 4QNPE 1FV1A 1WT5A 3ARFD 2UY6A 5DUPH 2WBWB 1CYGA 1Z9LA 5HHME 5TQ2H 4JVUA 2GSGB 3TIDB 1SBSL 3D0VB 1S9XB 3ZTJG 3EYQC 5DC4B 4LLVA 1JGUL 1ZHLA 3WLWC 3E3QE 4PYHA 3UZQA 4KMQA 4D8PB 3GBLA 4QO1A 3RNQB 3SDCB 3WN5A 3NCCB 4ISVA 1R0AL 2V5TA 1FFQA 2CMRL 3RWFB 4ONFL 5DR5L 3SKMB 2F74A 2Y5TB 1FZKA 1N64L 1I1AA 1BJ8A 2DQTL 2ZCHL 2R56H 5T1KD 4NN5B 2YRZA 3S36H 3C5ZC 5LXGL 2AV7A 2QR0B 4X8JA 3HZVA 2BSRA 2W9LA 3MA7B 1N6QH 3LAFA 1UCBH 5FM4A 3GBMH 1RJZA 1QHPA 5LG1A 5C0AA 5ESVA 4YE4H 2VNCA 1X5KA 3NACL 3RWIA 5JXAH 3I6KA 3ARDD 4XNYL 2VQ1B 3S3SA 1U8LB 1FORL 3CLFL 3MPCA 4GAYB 5C0BE 4IM8A 1HQ4B 1MF2L 4X7FC 2WNGA 3RZWA 3W0WB 4UV4L 1U8QA 4JO2L 4GXUN 5BQ7B 1IC7H 5D7JB 2BVOB 4JO4H 1LDPL 1S9KC 4LSPL 3K4AA 1WC7B 5IB2B 2YPKA 2YN5A 4UNTA 3CZFA 3HG1B 5IJVB 1A4JB 2JCCE 2Y23A 3SO3C 2DJSA 4K8RC 2EKJA 5T3ZL 5ICXA 4R4BA 4X7DC 3HUJE 3GUTB 1IM3A 3PHSA 15C8H 3O3BA 3S4SB 2EIZA 1DANT 4KI5C 5IROA 3SDXE 1LO5B 3KPQA 3VFVA 2OXGA 4HJGB 2NY6C 2Z92B 3CJJA 5EN2B 4OCMC 1QLRA 2CLRB 4L1HA 1CXLA 2DL9A 3BIAX 4CMHB 3NCEB 4MA7L 5J9PA 1G7LA 5INDA 3MV9A 4MZ2A 4U1HB 4PTTA 4NKMB 1BREA 1I9JL 4JZJB 3VXUB 5FHBH 1KPRA 2ADFL 4YHPB 3L5WA 1NGZB 5JLZA 4U1LA 3EOYG 3JWDL 2IGFL 4WNQA 1UWGH 4JM2B 2F8OA 2GIYA 3PWPE 3W0WD 2QQLL 1CU4L 2VO5A 3E8UH 4C4KT 1MCIA 5HYFA 4QGYA 1MELA 3NN8B 3SDAC 1CQKA 1K6QH 2DWDB 3H9ZA 2CO7B 3MRLB 2CKNA 2JF1A 2NY7L 4LVNB 2DQHH 3HG1D 4LU5H 4OT1H 4KKAC 1GGTA 4YIQA 3FMGH 3D3VE 1FVEB 1B6UA 5JMOC 3WIHA 3STLB 4F58H 4OCNC 3CFJA 4YHYB 5EO9B 1V05A 4NBYB 3EJJX 3EDEA 1FFNB 4NWUH 2R8SH 3D39B 4I0PB 3P0YH 1FPTL 3OR6B 4I2XE 3WJJA 4PJ9B 3K80A 1OGTA 5F6IC 3RGVC 4JHZA 1AXTH 3O8XB 5FO8A 2BHZA 4KJQC 3ZL4H 3QUZB 2A9NH 2X4UA 1VADB 5GZND 1MPAL 2Y4SA 2AV1B 1KTLA 4Z6AT 1FNFA 3P40A 3VA2C 5H37H 4P4KB 1QSVA 1CLOH 5LBSH 1BD2A 3MRJB 3PHQA 2C3WA 3O4LE 5F7YC 4PY8J 5KSUA 3ES6B 5D96B 4PGJA 4X6FA 1VACB 3QDME 3MV8E 5GGTL 1BX2B 1S7SB 1IGTB 4TOYL 3QO1B 4KWUA 4PJEF 3L3IA 2VAAA 1Y0LB 3IKCB 2Z93B 4G6ML 4JRWA 1GOFA 3VXMB 4ALAH 3QJFA 1TCRB 3ULUD 2AJYL 1ZLUK 4EUPH 3ARFC 4G8EB 1HSBB 3CPLB 1Z2KA 2B4CL 3VXRD 1W0VB 1J5OL 2DWEA 1OSPH 3AY4A 1EJOH 1KJMA 2YN3A 4W6XB 4YHOL 4YAQA 2ED9A 1MFBL 4WFFE 3K1DA 4HC1L 5J4MA 5AZ2L 4YHLL 1OB1A 1FLTX 4JDTH 1X5XA 3QXAA 4PG9A 3V5DA 5BS0E 2FD6H 1U2HA 5ICYB 1U36A 2VXSL 3HMXA 4RRPA 2KUTA 1DUZA 4IRJA 1ZWIB 3X3GL 5C0BA 2R0LH 3U9PH 5E99H 2Q8AL 3WS6A 4M7KH 2YD7A 1EAPA 3L6FB 5KVDH 3O3EB 2VWEE 3DBXA 3WL9A 2ZSVB 3FB6B 4PJAE 1I3RB 4LNRB 3VWKD 5BZWA 1MJUL 4QHNA 1C7TA 3ILQC 4N8PA 3ARDC 2B7DT 5KSAB 5FECB 2F58L 2JCCA 2YA0A 1I3VA 5HY9A 4JGJA 1OSZB 4QRPB 5INCB 1OAYH 2ZCKL 4UQ2B 1N26A 4G9DA 2VUYA 4PJBE 3LDBC 1A6TB 5MEQA 1AIFA 1BQHA 2HRLA 1FAIH 1ITCA 1P7QB 3SDXA 4F7PA 3QHFL 2EDQA 1VCAA 4OKVB 2BJML 1NCBH 2OYPA 1JF1A 1JHTB 4BH8B 3P11L 3WFBL 3OGOE 2AXGA 5GSVB 1TNNA 3IYLW 4IRSB 2BC4B 4UUJB 3A6BL 3TO4B 1FZJA 4E0RB 3QRGL 3C5JA 1QFUL 5L6YL 1BZQK 3S37X 1JCKA 2FO4A 3V52L 3SDCC 1JIBA 3CSPA 4NDMA 5KVGL 5EB9A 3FO1A 1C1EH 1NANI 3WFHB 5IM7A 4UI2A 2WIIA 3OG4B 2XTLA 1J8HD 3FAWA 4NN5C 3GJFK 2VLKB 3LQZB 2NR6D 3IKKA 2L0DA 1GOGA 3KXFB 3PWPA 5F88B 3QB7C 4GS7B 5HVHC 4NQEB 4FQ2L 4X7CC 2DLIA 5KSAD 4CL7A 1MHEB 4S1RH 3D3VA 5E4EB 5C09A 4YDVA 1CWVA 2J2ZA 4HQQH 1VERA 1T5XA 2N7AA 2PTTA 5EG6C 3EO9L 3QQNA 2Z31B 1JF6A 2B0SL 4M9PA 5C0GA 5IFHL 1P7QD 1KG0B 5D7JC 3WLBB 3QUYB 4I2XA 1PKQB 2Y36H 2AJSH 1A7QL 1QKZH 2VXUL 4POYA 2E9BA 4KROB 4RMRA 3DGGA 3KPRD 1VFBA 5H8DA 2XG5A 1S5IH 4PJHB 1JRHH 1YY9D 1OP3K 5C2UB 3TO4D 1YNKL 1NBYA 4M3KB 1JWMA 4MQXC 4X4XA 4MCYA 1QNZH 1ZANH 3LN5B 2OZ4A 3GBNL 2VE6B 3O4LA 3SKJL 5ISZB 2RJMA 2YK1L 1KC5H 4D9QD 2QQNL 3BRDA 4O51A 1CGTA 1NGWB 3CFKA 4N0FA 3HG1E 3T1FA 1R3JB 3QDMA 3MV8A 2VLKD 4LKCB 4TSBH 5GZNC 4HT1L 1RUML 4CMHC 5FK9B 1XGUA 4U4BA 2A74B 4KQ4H 4XPFH 2WMPA 3UTTE 5FGSA 3VMPA 4KK8D 5ICZA 4YX2L 5GJTL 2EDWA 2HH0H 3LMJL 3X3FH 1JI2A 2RR3A 4JZJC 4EUPB 2GJ6B 4L4TB 1A1OB 2R23A 4LHQB 1WBYA 4G8FB 5I0DA 3PWJA 4DUWA 3KAAA 1U8JA 1DQLL 2O61A 4JM2C 3C08L 3ALPA 5A43C 5HDQH 3N50A 5B38A 5IEKB 1B0GA 5DJYA 3X14B 1DE4B 3MO1B 4HFWB 1CXFA 4LASL 5I1EL 4WW1A 5F7KC 3TJEH 4MD4A 3OAYK 1KTRL 1INDL 2F5BH 2ADJB 3OGCB 1INQA 4NRXA 3I9GH 1FVDA 1G7HB 3IFPA 3ARFA 4LCIH 3ULUC 4LVNC 2YMXL 1GCFA 5BS0A 4LCYB 2H9GA 2X09A 1XH3A 1S7VA 1DEDA 3VE0A 1JPGA 4YHYC 2D7TH 3MROA 4L1DA 1CCZA 1M7IB 4JPWL 3U2SA 3O45A 3BZ4B 1I9RL 4AL8H 4I0PC 5ISZD 4PJ9C 1MHCB 3ULUE 3U0PA 3O8XC 4YJZL 3QUZC 3QUKA 3RA7L 4LGPB 3ZDYF 5ALCH 3VXRE 2AXFA 1DLFL 2YD1A 3SCMD 3WE6B 1T89A 4XI5C 5FFLA 1TFHA 5ADOH 4ZDHA 2ZUYA 2XRAL 3QEQB 4P4KC 3D5OF 2FGWH 2R15A 3LEVH 2GJ6D 4PJCB 1U8KA 5D96C 3EFFB 3TIEA 2BSTA 5DK0A 4U2YA 1MAJA 3EHBC 3VWKC 4X9BA 2EDEA 1HE7A 2A83A 5CAYB 1CR9H 4ODXA 1IEHA 3ARDA 3MRGB 3OKDA 3C8KA 3EYUL 4XP4L 2O26U 3ZHDA 2WV3A 4AH2B 4N0YH 3G6JE 1E6OL 1KN4L 3V6ZA 4WWKB 3MBEB 4MNQB 1UVQB 1FLRL 4YDJB 5F7DA 1N0XH 2YUVA 3H3BC 1E4XH 3NIFF 1U91B 1KCVH 1IQWL 3PV6A 1OTSD 4KK5C 4HS8H 3L3GB 1JGVL 5BVJB 1L9MA 3U4EB 3MFGB 4PUBH 1S9XA 3E6FA 2E7BA 4NN6B 4G80B 4PGDA 1RUPL 3HS0A 4OM0L 3QWRD 2F53B 3G6DL 2RB8A 3AFLA 4HS6B 1YN6B 4PJGE 2UV3A 3KYNA 3GIZH 4P9HC 3WSQH 2YPVL 2DKUA 4PLNC 5IBTL 2WLZA 1H3XA 4M02A 2HFGL 4YFEA 1JPFA 4LRIC 4AIXA 1EBAA 2Y5TA 4R90L 2V7NA 2OK0L 1WFUA 8CGTA 5IT2H 3QXDB 1UACL 4AEHH 2QR0A 3K2MC 3RBGA 3QEQD 1LEIA 2ARJA 1IT9L 5AYQA 5MI0B 3DUSB 5DVKA 1S7RA 1E6JH 3C87A 4FFYH 1B9ZA 4Z7WE 5GRWA 4L8CB 1BZ9A 5F9OH 1X7QB 2FIKA 5D1XD 5KSAC 1U8LA 1SMAA 2FBJL 5H94A 1J8HE 5SWZD 1JYWA 4BSWA 2NY5H 4WWKD 1P9MA 3MBED 4MNQD 4Y8DC 3UO1L 4AMKH 3TZVA 5DRXA 3V5HB 1H8SA 4WDIB 1K8DB 4JG1L 1MVUB 3BP5A 1WCBB 2XZCL 3MBXL 3HE6B 5TE7H 3LS5L 4F9PC 3L1OH 5IFJA 1YY9C 5CBEA 2YC1A 1HCFX 2BVQB 3TO4C 4FRWA 3JVGA 1DN0B 3UTTA 4TPRL 5EOQH 2EDTA 3MLRL 3FKUS 5E9DD 5JO5A 2BVYA 1CFSA 3BWUC 3GI9L 1UM4L 4HCRL 2WUBH 3QFDA 3V0AC 5FKPB 4M7JL 2HWZL 2GTZA 2Z9TA 3RY6C 3KPRE 1F4WH 4IMKC 2W65A 4WFHD 2OL3A 4ZO8A 1CDGA 5E5RB 1B0RA 3BD5A 4JJ5A 4RRPG 4TNWK 3TH3T 4HLZG 3INUL 2J88L 3NH7L 5M95B 2AEIT 1HZHH 1S7TB 2CK0L 4J3OC 5CBAA 1D6EB 3DSFL 4X80H 4F37K 25C8H 3NFSL 5K59F 1L0YA 4QT5A 4D9QE 2IG2H 5JXED 1UH3A 4CRPA 5E4EC 1U42A 4ZXBD 1T04B 2VLKE 4AG4L 2AKRB 5JQ6H 1NGQH 2DM4A 5F96H 4QRTA 4Y2OA 3LB6D 1NBVL 4MMXC 4OLUL 4XWGL 3WDHA 3QUYC 5KOVC 1Z9OA 3MRLA 5MP6H 4QYOB 2APBA 1RMFL 4QXTA 4GRLA 4KROC 4DCQA 3LKNA 1BQHG 3U1SL 2VZUA 5EZOH 5IQ7L 3VXRA 3EFDL 3MLUH 2HG5B 2P8PA 1R5WA 4QY8B 4XH2B 4PJIF 1MCPL 5ENWA 3TWCH 2KH2B 4NNXA 2VDLH 5GRUL 5CWSA 4AQ1B 4M6OL 1CGSH 3DGCR 1AI1H 1PKQE 2IFFL 4MNGE 3RDTB 4YDKH 5DT1L 1K4CB 5C9JB 1A6ZB 4OFPA 4KK9D 5K9QG 4FQJH 3T3PE 2EYRB 1H3VA 1NBZA 3PWUA 1YZZA 3VGGA 4TTGA 5LQBL 1D9KB 4UNVA 3BWAB 4XB8A 2IH3A 2O5ZL 3EYVB 3G6JA 1CT8A 3TN0B 1IKFH 3O6FD 1N8ZA 5LGKA 4NJAH 4PRPB 2JB6B 4JN1L 5D7KD 5ISZE 1JPSL 5BV7L 3L5JA 4YNYB 1JZ2A 1ZA3A 3ES6A 4HWBL 2OJEB 2ADGA 1UB6A 5EU3A 3VWKA 1MAKA 1F3DJ 1ZE3C 2H2PD 5SWQB 5JHDB 4HW6A 4KVCH 1OAUL 3QZWA 4D9RD 4LSSH 1P1ZB 3MZGB 4GMTH 2DI7A 4JDVB 3WHE0 2R1WA 4HUWB 1G0YR 4PJGA 4EDWH 3KPMB 5DMIL 2GJ6E 2EH8L 4HWEL 3ZTNL 2ATPA 1MCQA 2Q86B 4NC1C 1TZHA 5DK2B 5F7LB 2P8LB 4HIIB 1E4XI 1CFNA 2CDEA 1RZJH 3D48R 4ZFFA 3EBAA 4WGVB 4DVBA 4L9DA 3S35H 4ORZC 4X4YA 3DXAD 4MWFA 4ZUVA 4M6MH 4ZUUB 2X10A 5T3XD 3RDTD 5HHNA 5GGTA 1RD6A 4Z7WA 3MNZB 2YSSA 2PTUA 4YFDB 4Z7NF 3ULVH 3CC5A 2J8UF 1IQDB 4JKMA 5E8NA 1TQCB 2ZSWB 1I1CA 5D6CB 1ZT4B 4KQ3L 1J8HA 4JZNA 5GZOC 2IQ9L 5GS3A 4ZPTB 4H8WH 3TN0D 3ARQA 4HUVA 3S97C 3RPIA 5C0EA 2HFEA 1T3FA 1L7IH 3RUGF 2NW3A 3L6FA 3O3EA 4N9OB 3VFRB 4MA3B 2A6KA 1BJMA 4LP5A 5JHDD 5IR1B 3OB0K 4RGOH 5KSAA 1RIHL 1B2WH 4ZS7L 1KTDB 4LLMA 5J6HB 4JY6B 4WWKC 3MBEC 3QEQE 4JFQA 5J06A 4L5FH 1IGYA 4PJDE 4RIRB 4WY7H 1A6TA 1BAFL 5H2BB 4PJCE 4GKNB 5BW7C 3G5XA 1FRGH 3SGEH 2VLMD 1KPUB 3TNNB 3KPRA 4JPIA 4KRPD 4MXQD 4F9PA 4BFIB 4OZGE 4QRQB 4NN6C 1Z3GH 2E9WA 5SWZE 3P4MA 1CLZL 5EFIB 4MNQE 5I18H 1UT9A 5EBWB 1N5YH 4RAVB 1MCOH 1BQSA 4ZD3H 1RVFH 4XVTH 3FO0L 1XF5A 3I50H 1JK8A 1HILB 4BKLA 1BIIA 3RY6A 5IB5A 4P2RA 2FH8A 1C5BL 4KV5E 5GRJH 1G6RH 5IVNA 3LQZA 1I75A 5JOFB 1Q9LA 3RWDA 5HHXH 5MI0C 1PLGL 3MREB 4ZYKB 2QV2A 2NQCA 1JP5A 1BWMA 4HZLA 2FLBT 4FQHA 2FECL 1EHNA 5E9DE 1ADQH 4JY5L 5ITBL 4OZ4B 1M71B 2WWMD 1CGYA 4YWGH 3L9RA 5JXEC 1CXIA 1NMAL 4G7YH 5IHZA 4O58L 3K8LA 4X9GA 4ETQB 1S9YA 5E8DH 2PXYD 4WFHE 5H35B 3WUWA 4ZPVB 1KFAL 3IDMA 5F44A 4J8RB 3X12B 3D85B 3K2UL 5FHAH 3LB6C 1IM9B 3UPAA 3PWVB 4MNGA 4K94L 4D9LH 1B3JA 3H0TB 2XQBL 3HE6C 3RAJH 3CDCA 5KBNC 3QHZH 2FYYA 1RIVH 1I8MB 5CSGA 2Z35B 2I25N 2EXYD 4XXCC 4HF5H 3NIDF 2VZ1A 1I3GH 1HQRA 2XTJB 4ZAKB 1HYRC 1ZLUH 4K23L 4RMVA 1E4JA 3DX6B 2E9JA 3OWEA 4Y5XB 4L3CA 1WZ1H 5F9JA 5I16A 5F9AC 3MRNB 4OGAD 4Z7VE 1I7ZB 2HLAA 4OD1L 2DDQL 3G04B 3VW3H 1G9EA 4XPGL 1NAKH 3ECBB 5IJKC 2AK4B 4Z78B 1I8KA 5I0ZA 3SCMA 4WV1B 1V5JA 4CMMB 2XY1A 4WO4B 3DVNB 2OI9B 4DTGH 4RX4D 5EBMA 4UNUA 3QSKB 1P4LB 2R2BB 3UJJH 3T8XA 1T0PB 5DQDH 4PIRF 5J0BA 3VGFA 4G8FA 3MCKB 1AO7D 2R4SL 1TETL 5DHVB 1UCTA 1KPVA 5IVXF 4DGYL 3GMOB 4CKVX 3F6LA 4APQD 2EDRA 4L3EB 2AVGA 3MJ8A 4OF0A 4UDUA 1DE4A 3BP6B 5GPRA 3LS4H 1IC4L 2NXZB 4LSVL 5MEOA 3U36B 3H42H 2ZCLL 5LCVL 4LNVA 2YWYA 3FCTB 5D7KE 3S5LA 4KGLA 1IAKB 4ODBD 4PJEB 4BZYA 4YXLH 1BFOA 5CJBA 5EOTA 5LGJA 3PIQB 4RNRB 1PG7W 5GJSL 1F00I 2BNUB 2VJXA 3WO3B 1LO3H 3AU1B 3O81A 4D9RE 2Y72A 4ZAKD 43CAB 5CUSL 3DURB 1RZ8B 2XYCA 3RDTC 1SJEB 3S4SG 1KIPA 4JPKH 3HNVH 3BVNA 4LDEB 1D9KC 3EO1A 4LSPH 2JJUA 4WO4D 1R5IA 2XWJB 3D2UD 3MLWL 4QTIL 3S34H 3TN0C 4U1IA 3O11A 2CKBB 2IPKA 3DXAE 4X6EB 4PJDA 4JANB 2VDQH 4PJCA 3GSWA 1MCLA 4AEFA 2Y07L 4NCC1 4G3YH 3TNMB 4RQQB 4YHKH 2IF7A 3GJFH 2GK0A 5B3JE 1KIQA 3I2CL 2OJZH 5D1XA 3ARBB 4OZGA 1EXUA 2A0LD 4L3ED 5SWZA 2F5AL 3FB5A 2V6HA 3MBEA 2NXZD 4MNQA 3HAEH 4C58B 1KLGB 2E27H 2D9CA 3I02B 4JCLA 4RMQA 4UTAL 3WD5H 1YYLL 3I75A 4G6KL 3MRRA 5C0JB 1JHKH 3ULVD 3ZDZF 2X4NA 1FFOA 4HXAL 4R4FH 1U3JA 4GOSA 2VAJA 5JHDE 4MXQC 2ADFH 5GRVL 2YHGA 3VFOA 5DUML 2P7TB 4N9GB 3SGEI 2DBLL 5EU4A 4NFBA 1YN6A 3EO0B 5F7FA 3QIWB 2JELL 3CVHH 4POZD 4RZCA 3CUPA 5E9DA 1CDCA 4P23B 1UJ3A 1GZPB 4I3SL 1F8TH 3BIKA 5D8JL 3WS3A 1L0XA 2VLME 3W2DL 5IHBA 5ELIA 3AUVA 1TQCC 1A47A 3LV3A 3LRHA 4M1DH 3PGDA 4HIXH 4J6RH 4NPYB 4OZHF 3VXNB 4X6BA 4ZFOL 4WTXA 1NDMB 3QXVA 1ETZB 1NCWH 1AGBB 4ZUTA 3GMRA 1AP2B 4RFOH 4LSUL 4AIZB 1AGCA 5EUOF 4MA8L 1RJCA 3N0PB 4KK6D 1UXWA 2WWMC 3T0BA 5CD3A 2X9XA 3ARBD 5JXEA 1ZVYA 2X4QB 2EYSA 4ZXBA 2PXYC 5I17B 1YJDL 4UT6L 5EBLB 3THMH 3MACH 3JWNC 3MOQA 5HGAA 4N8VB 1XFPA 3AROA 4MJ6B 3V5HA 1YA5A 3ARSA 5I1AB 1A3QA 1RZFH 4HIJA 3S3JA 4Z7VA 4ELME 4G43A 5IB1B 3UTSB 1ED3B 2D03L 3G6AA 1AHWC 4XCEA 4JO3L 1QRNB 3C60B 2NY1B 1J1PL 2LU7A 4J3WA 2EDOA 3O2DL 2DQCL 1EEYA 2ZJSH 2EXYC 4ODTH 1RJLA 4XPBL 4E42A 1O0VA 5IVZA 2EIDA 4UINH 4M7LT 4NFCA 1OGAB 4P23D 2CPCA 3KGRA 3QDJD 1Y18B 4MMZC 3TBTA 3KPNB 2X9YA 2PYEB 2J6EL 3VRJA 3PJSB 4OGAC 3QEUB 2NY3D 3M8OL 4XC3H 4C54A 5CZVL 5D72L 5KJRH 1X5YA 4PB0H 4NKDA 2WBJD 5IJKA 1RHHB 1G7PB 3EYFB 1IGJB 3V4UL 3CFDB 2BRRH 4P46D 2BFVL 2DICA 3FQXB 4K2UH 1QBAA 4YO0A 3ZKSD 4NGHH 4WI4A 3O6FA 3RHWF 4F7TA 3DRTB 3IXAB 3BP4B 3RWJA 4WIQA 4NP4H 4UILH 4WHYG 2Y6SD 2GCYA 5F89B 4MZ3A 3QDGB 4BK4A 3NA9H 2R0ZH 1DUYB 1VGEL 4KY1L 1A7PH 1JF5A 5A3IC 2PCPB 1OM3L 4P9ML 2YZ1A 4HCRA 4FQXB 4YR6A 4MHHI 1KELH 2P5WB 4F33A 2ITCA 4ZOEA 1QRND 1YEEL 1TVBB 3C60D 3RVXC 1DFBH 3ARGB 3IDNB 1AO7E 1F11B 5I8KL 2X4RA 4U7KA 2F58H 1T7YA 2E7LC 4MX7B 3GK8L 5EZLA 2XTJC 4ZAKC 5EU7E 3DXAA 2AJVH 4Y5XC 1ZHKA 1BGXL 1KCRL 5A2IH 1F5WA 1IL1B 1CE6B 1E0OB 5JUEH 1XMWA 3S36X 2HVKB 5FDWB 2I5YL 1U0QA 4WV1C 3CFBA 5DRZB 4S1SL 5L2KB 2AJUH 4WO4C 2OI9C 4Z0XB 3BWAA 3QWQB 5J89A 2UZIL 3WKNA 3TN0A 3HAEB 3SE4A 3A6BH 5DEZA 2V2XB 4JAMA 1K4DB 4OV5A 5DMKA 3ZDXE 1P5VA 1MQKH 2NY4D 3QDGD 5J6GA 3GHEL 4U1NA 4H1LH 3LH2L 2PO6B 2X4TA 1V7MH 3RX5A 1M7XA 1RZJC 4Y4HD 2F8VA 1NFDF 4U0QB 2NXZC 3WUWG 1MEXL 4D0BA 4MCZA 3BYTA 5EZJB 4GRWF 3KPMA 2ITDA 4TQEH 2P5WD 3VH8B 4YLQT 3L7FA 3DSNA 3AXLB 3RX8A 4CW1A 3WJLC 3HKFA 5MERA 1F6AA 3ARGD 5DK2A 3MLYL 4NQCB 4HIIA 3RWGA 1G9NH 4M5ZL 5DJDB 2OR8A 2EEAA 4O2CA 4L3EE 2V17H 5T3ZD 1JYVA 4TUOA 5J57B 1H8NA 2VDNH 3V4VH 1D5XA 5E2VL 5FA4B 4ZSOE 1LE9B 5EIVA 2BVPB 5J1TC 3P9MB 5H37G 4XNUL 4LPYA 5A16B 2AJZA 2C1OA 3ULVE 1JBJA 3F58H 4MQSB 1F3DH 1TNMA 3BKCH 1OAXL 4PYGA 4HKZA 5CGYD 4XCFH 4B5EA 5HHOB 1QBMH 1YY8A 3UJIH 5E08L 1JVKA 1FG2A 4JG0L 1ITBB 3SBWC 1NCAL 4P48A 4ELMA 3HMWL 4X6DF 4KK6C 5DUBA 1U3HB 4EUPG 4X6CE 3ARBC 4PREB 1G1YA 4L29A 1T1WA 5J6HA 2PXYA 5D2NB 1FP5A 2ZUQB 4OD3L 2M2DA 2QSCH 4HBCL 3EGSB 4XT1C 3GI8H 4RIRA 2IQAA 4N0UA 4Q9QH 1T4KA 3LMJH 2FEEL 2EDNA 4KJYB 4GLRH 2I26N 1AHWA 1IEBA 5DC0A 2FJGB 5BMFL 1N3NA 5TE6H 1X4ZA 3EAKA 4OLYL 4Q97A 4KMTH 2I60L 1RZIB 4NO2A 3QIWC 5CP3H 1SEBB 1F58L 4P23C 2AABH 4OZFH 5ABDE 5GHWL 5IB3B 4MAYB 3WHXA 3TBWA 1MFDH 1ZS8A 4HSQA 3RIFK 2NY3C 5T5NG 1A7RH 2UYLA 5DJAA 2NY2B 5D70H 5DFWH 1A7NL 3VWJA 3AC0A 5HHOD 2AQ1A 2NNAB 4PJ7E 4KKNA 1WBXB 4Y7MA 4HWZA 3QDJE 2G2RA 1D5ZA 1OF2B 4AT6A 2DOCA 2CK2A 1I8LC 5F8QC 1NMBL 2Y6SC 3GKWL 1AO7A 3QR2A 2B2XH 3LY6A 3DWTA 5CEYB 4P4RB 4APQA 5ITFB 1CFVL 1TMCB 1MRCL 3V5KB 3GO1L 5F1SA 3NAAL 1CL7H 4HGWB 1ZGLA 2A6DB 3N06B 3HE7D 3HPJB 3DMMB 2H45A 3C60C 2DQIL 2Z35A 3VXPA 4OF5A 2YBRA 1RY7B 4CDHA 2AAVA 1VFOA 2E7LA 4N1EA 4MAYD 4PJIB 2D7MA 3MRNA 4GAGL 5ADPH 3HI6H 3GRWH 1H15A 4QHMA 4FZ8H 2C3HA 1UC6A 2O5XH 1QRNE 4JR9H 2UWEF 1FL3A 4HS3A 1CFBA 1RJYB 3OXSA 1IKNC 1IC1A 2W1NA 2EDHA 4RAUB 4HWUA 1PW3A 1CFTB 3D2UA 3T1WA 4MDJB 3KYOB 4BH7B 3MRQB 4P57A 2B39A 1L9NA 2XWBB 3JTTA 4XC1H 1PZUB 3JWOH 2HKHH 4S0TD 4EI5D 5DD3H 1G0XA 1YPZF 1BOGB 4UB0H 5KZCD 3RY5A 1IC5H 3H7BA 3LRSA 4Z9KB 1CXEA 4F2MB 4DWHA 2RBLA 2B1AH 4L3EA 1FN4A 4YHML 4AYFA 1F6FB 4Y89A 5FYLL 1IGCL 4BFBD 1B4JH 4ZSOA 4LQFL 4FQXC 5GGQH 1T83C 4ZO7A 2CGRL 2IAND 3MRMA 5CJQL 3HC0B 4GW5A 4NM4L 3ARGC 1PG7L 1E4KC 4RNRA 2CDGB 3QDGE 2BNUA 4F7CB 1KB5L 1Q9KA 2XN9D 4FQCL 3CX2A 1AR1C 3QJHB 2DIAA 3U7WL 3VCLB 2WQ8A 3FJTA 5IGXH 2CQVA 2FX7H 3DURA 1BFVL 4TUJB 2P5WE 2H6PA 5JDSA 3WHE1 1KN2L 5E2JA 1DQQB 3BZEB 1QLFA 5DURD 4X6CA 4IMLA 5JR1L 3W9EB 1JPTH 4IOIB 4JFZH 2GFBB 1FE8L 1FIGL 3L3KB 2J8UB 3NZHL 4HGMA 4X6EA 2XA8L 4NQVA 4JB9H 3U0WH 4LLWB 4PFEA 1J10A 1QUNA 2XNAA 3MYZA 2DLTA 2LE9A 3FOMA 2HFFB 3WFCH 1UYWL 1RPQA 4H20L 3RUGB 4YDLB 1K8IA 4JRYB 5TPWH 2PO6C 1TZGH 5DEFB 2HWZH 1EUUA 2JIXA 4W4NA 3O3DB 3BKYH 4HD9A 5DVOA 4GBXB 2W9EH 3ZDYE 5C08B 5I75B 3O4OB 1ZGLM 4OAWA 4TSCH 4OLWH 5FOBB 4OTXL 4LCWB 4O02H 4JQVA 5JW4N 4YZFF 1QG3A 1U8NA 4PR5A 1G6RA 4Y5YA 3UJTL 5DK3A 2BOCB 2G9HB 3MUY1 3VJ6B 3M45A 4N9GA 5C2BH 3BDBA 4U33A 1F90L 1TXKA 3SKNA 2DM7A 4PJ7A 4LAQL 5CINL 1DVFD 1ADQA 4P23A 2P42B 3QDJA 1GZPA 2DQDH 1Q0XH 5I8CA 2L7UA 5E8PA 1QLEH 1YYML 3DUHA 4G6AD 2CRZA 4ZNCD 4F3FB 1QFWL 2PW1A 4EDXA 3DI3B 4WU7A 4N1HB 1BFSA 1NLDL 2WBJA 5DFVD 1DQDL 3QI9B 4HKBB 4M48H 1S3KL 4P46A 3FTGA 3QH3A 4P49A 5GISL 3DROA 4PP1D 2CXKA 1I9IH 1EO5A 5L2JB 2RAMA 4M6AA 1NLBH 2XT1B 4XXDB 3B6SB 3QG7L 1U3HC 4JRYD 4KRMB 5CZXD 4O2FA 2LQRA 4YXKH 3UCRA 1LO4H 5D2NC 3ESUF 4GBXD 1R3IH 3P4OA 3DX8A 2ZUQC 2EKSA 1Q9WA 1HHHA 5C08D 1P4IL 5HHOE 2WBKA 3VFNA 1XR8B 4QCIB 1TPXB 1U2CA 1M7DB 3EYSH 5CD5D 5HYQA 4ONGH 3EOTL 3LSOB 4JN1H 4KMLB 2C4FU 3SGKA 1QRNA 3C60A 3LKOA 2B4CC 2V2WA 3C9NA 1ND0B 1YEJH 1CL7I 1MREL 4EI6A 1CD0A 1I3UA 4FFWD 3WNNA 4X5XA 1A7OL 2HRPH 4ZS6D 4QGTA 3P73B 4Z7OF 2YD4A 4NN7B 1SBBA 4MAYC 4UZGA 1MNUH 3NIGE 3QEUA 3VFWA 5HGGS 2A6IB 5JW4R 3STZB 4P2OB 4K7PH 2NY2C 5IHLB 3D1MC 2HJFB 1RHHA 3TPUA 5HVWA 1IAOB 3QI9D 4JFEB 4KZDL 3VFSA 4EN3B 4R7NA 1G7MA 1OLZA 1KOAA 1N59A 1YMME 3K8MA 4TULH 5HI5C 1CS6A 3DRTA 2GITA 4PRHE 3VA6A 3H9SD 5F9DC 2X9WA 4RDQG 3TGXA 4HPYH 6CGTA 1XZ0A 2F9BT 4ZQKA 4GUPA 5E8EB 3L3HB 4QXUH 1U8OA 1D5BB 2MQ0A 3MA9H 3IETA 4LHUD 4A2MA 1I7TA 4LSTL 3ELAT 3QDGA 2VL5B 1BQUA 3S88H 4HWNA 2CUIA 1HH9B 2CIIA 5CCKL 4Y4HA 2AS5M 3DTXA 5E6IB 5IB4A 4E41A 3ULSB 3ISWA 1ULVA 5CMAB 2O93L 4XB7A 5T33H 5IVXB 2K9UA 1T83A 4GKSA 4HAFA 2P5WA 3BP7B 5ESAA 1A9BB 3Q1SH 3DMMC 2IPTH 1MIEL 3L3JB 5D1ZB 3RL1B 3QQ9D 4K3JL 5AD0A 2VITA 3WFDH 5EA0L 1XIWD 3BKJH 4R0LB 3GMNB 3GHBH 4PGEA 2DYPD 1DBJL 2X1PA 5DJ0A 3C6SA 5A40E 3IU3A 4LRNL 3UTQA 3MX0A 1BVKB 3LN4B 4I3RH 1MAML 3PWNB 4NZTH 5GSRB 4WCYH 1INEH 2AEQH 3JV5A 4S2SA 5JOEA 4UV7H 4K9EL 2IANE 4OLVH 2BVTA 4WRLA 4P2CG 3BEVA 1KTKE 3NFPB 3GJFA 4LPUA 1A6WL 1RURH 2BVEA 3VXOA 3GSXB 4EN3D 1S9WB 4I1NB 2EXWD 4JLRA 5DD6A 2VXQH 2XN9E 1BFTA 3HAEA 1CLZH 3MYJB 3FQRB 4JKPH 4PTUA 1FYTE 4PJIE 1YEGL 5TDNB 3UXFA 4KRLB 3GDBA 4HKJB 5CSZA 3U0TB 5T1DH 4LSRH 3SOBH 1T5WA 4W6WB 2EYTB 2IMMA 4NNYB 3OKMB 5E6ID 1C5BH 2GY7B 1EMTL 3VGAC 1OQOA 2BP3A 4UIKH 4QF1B 4OFDA 1GYAA 1PGRB 1OCWH 1Q0YL 4GT7A 1UGNA 5DDHA 3TT3L 2WAHA 3CVHA 1YEHL 1JZ8A 1F4YH 3HZYB 3Q3GB 3VDCA 2YPLA 3OHXB 4JY4B 3FN9A 1CN4A 3IDXH 2BHUA 1XF3B 3N1PC 4AM0A 1N0LA 3UAJD 5DJDA 1A1MB 3PL6D 3Q5TA 2VUOA 5JHLL 4YHIB 3CK0H 1W8OA 1YNTA 4XBPB 5I8OH 3DARA 2NW2A 1SY6H 4I4WB 5FCSH 2JB5H 1F6LL 1OTTD 3C09B 3DOSA 5FA4A 3TJHD 5C7XL 2BVPA 4QWWD 4M61A 1Q9OA 2HJLA 1FFPB 1IAIL 5DA4A 3VXQB 3FN3A 1G7IA 2R29H 4KAQH 3UDWC 4JDZB 3KYAA 4QTHB 3RKDC 1CQYA 1EEZB 2VZVA 5DFVC 4JFFB 5GRYA 1U8IB 5KG9B 5HHOA 3PWLB 3SJVB 2OQJB 2GW5A 1SYVA 3KLHD 1I8IA 4PP1C 3LHPH 2Q6WA 3VMNA 1OT1A 4OZHB 1GGCL 1CDIA 4Y5VB 4YDLC 1CICB 5EIIA 3BH8B 4K3DH 5E2TH 2LAGB 3JV6B 3BE1L 5CZXC 2DDQH 4YGVA 4GG6E 4LARL 5EUOB 4GBXC 3EOBA 5F7EL 2UZXB 2VISB 5I75C 1AJ7H 3EGSA 3O4OC 5DQ9B 1Q72H 4FXKB 4ZFGH 1GC1H 1W72H 3NMEA 2HKFL 4PGBB 4ZTOL 1JWUA 5FA3B 3RI5F 3JV0A 5ACLA 5CD5C 3PQYB 1VGKB 3QULB 4KVNL 4MNHB 3DRQB 3ZT5A 1A5FL 4Y2DD 2Z91B 4CN1A 3REWA 4DGIL 4M43L 1MLCB 5IKCA 2AP2A 3HE7A 3FOLB 1HH6B 5EO1B 5CIPB 3BMVA 1WV7T 1J0YA 1HNGA 1XT5A 2GJZB 3U4BH 1MFCL 4LCCA 4WFED 5L8JB 2X1OA 4JO1L 3GFUA 4NRZA 1YMMA 3MRBA 1A4KB 1N7MH 4PRHA 1C5CH 4MAYA 3F7PC 3T0VA 3ZT7A 1DP0A 4AEEA 4OCYL 1YEIL 4G42A 4L8BB 4Z76B 2E8ZA 4JFFD 3W11D 1U93A 3QI9C 5GJSH 5SV3A 2D7NA 2ZUUA 3C2AL 3ZKND 4P3CL 1FL6A 1WBXA 4NM8L 2YEZA 5JNYB 4OLZH 1UM5H 3VGEA 1MCBA 1U58B 5F6HJ 3L7EB 4OFVA 5AG8A 4P3DA 1CICD 3FFCD 5FB8A 1DQML 4EI5A 3TO2A 4HAGA 4U1MB 3WXVL 5I15L 2GT9A 1KJ2H 2GAZA 4HJJH 2ADIA 4JHAL 1FBIH 3HPLB 3MLVH 3IJHA 3LQAH 5CP7A 1TPXC 1LO0L 2X89D 3K1KC 4GKZB 4PJFE 4U1KA 3PQYD 5I76B 3AM8A 3PNWB 2Y06H 1EA9C 3H9SE 1NGPL 1S7QA 2IANA 2FATH 3E0GA 1EHLL 1PFCA 3HPJA 5E8OB 1I1YA 2MFNA 3FQTB 4H0HB 4DN3H 5HYIA 5J13B 1IJ9A 3ZKQD 1KXTB 3S35X 4M5YL 3AB0B 5GS1B 5DO2C 4CAGA 2XOTA 3P30L 2XN9A 4S1QL 4ELKB 4YEEA 3IGAB 4PG2C 4MD5B 5ERWA 4U6YB 3QIBB 4X8XA 3MLXH 3B9KB 2UY7A 1EBPA 3DETD 4NN7C 4OSUL 1FYTA 3JWOC 4PJIA 4F7EA 1SJHA 4XPTL 3U48A 4G6KH 1JPST 3C6LA 3NCYS 5HPMB 2D0GA 4NSKB 2FHBA 4H1LA 1FJ1B 4Y4FD 1OWWA 1RJYA 2G5RA 3NBNA 2AJ3B 4OF6A 1KENH 4EN3C 2Y9RT 3CZJA 4RFNB 5DD5H 4MDJA 2IBBA 1NCNA 3QCUH 1E4WH 1EDQA 3RP1A 3NFNB 2JELH 4M1GH 3NIDE 1A6PA 4EOWH 2FX8L 3WKML 1AD0B 4HIHB 1RK1A 1BOGA 2VDMH 1L6ZA 4GW4A 1H0DB 4XMPL 1I1FA 5E00A 4OUUB 1FNLA 2XI9A 4JFXB 3B9AA 5E6IC 1PYWA 5DWUL 1VFAB 5KN5A 1Z5LB 2QBWA 2FZ3A 2MOVA 3ZSSA 1P7KB 5AWNL 4DVRH 4KUZL 1L6XA 3MNVA 5BCAA 4BQ8A 2IH1B 1NFDB 5D1ZC 5E7FA 1MCRA 4GRWB 4R0LC 4MA8H 3D25A 2K7PA 4KUCF 4CADA 1YNLH 3KDMB 3LPGA 1A1NB 5I1CL 1NCDH 2FSEB 4BJLA 1T2JA 4F7MB 3B9KD 3S37L 3TJHC 1CFQB 2EIEA 3VRIA 3V9FA 1UZ6F 4CU8A 4QWWC 4TUJA 5BO1H 1DVFA 1HYSD 3AS1A 2D0FA 3TYGL 3AAZA 3WEXA 4Z8FL 3E6HA 3I3EA 1OAZH 5ACZB 1CXHA 4CJ1A 4PJXA 1T03L 4GG6A 4P5TB 5HHPB 4PV9A 4J4PA 4JO3H 5IEHA 3BMWA 2JE8A 3L3KA 2R0WL 4XCCL 5E2WL 3RZCA 1JMZA 2GUOA 4MHHG 5BJTB 5AZEL 4YQXH 1HSAB 1YDPB 2ESVB 3V6FB 5E1AA 3KLHC 1XEDA 3D69A 1D5MB 4NQDB 1CG9A 1JWSA 5I1LA 5BRZD 4QHLB 3DO7B 5I1HH 5TGBB 1FNAA 4JZOA 1C16B 2D31A 2AQ2A 3MRCB 2IMNA 1RU9L 2F54D 4HV8A 4WUUD 5IIEA 4HIEB 4QLRA 1J1OH 1JNNL 1TVHA 5LAXB 3VG0H 3UBXI 2QHRH 4GBXA 4QHUB 1F4XH 4X7SL 5D2LF 1V3KA 4KKCD 3HNTH 5FGBC 4WHTB 5CP3A 3I3DA 4OZFA 4N8CH 1DDHA 1LO2H 4PLKD 1V3LA 2QSTA 1H5BB 1JGDB 4H25B 3FONA 2PUQT 1FNEA 3GJEA 5L9DH 1AXSB 4MQ7B 1X6LA 2X7LA 2EE3A 4K3HA 4XNZB 1YQVL 5ALBL 4ORGA 3VJ6A 5ILTH 4Z5RA 2A6JA 4H88H 3OQ3B 3C09C 2RCSL 2BX5A 4OZIF 1AY1L 5GGRY 5IESL 1QQDB 3HR6A 1IGMH 4DUXA 1HWHB 2VQUA 5C0FA 3KNBA 2NX5A 4XTRC 1NEZB 4XAWL 5JPMB 5D7LA 3T3MF 4AENB 4P5TD 4DKDC 1MCEA 4FS0A 3V0VA 3W11C 2CDFB 5M7QA 3VG9B 4DGVL 3B3IA 3O6KH 4WFEE 3ZKNC 4KPHH 3F7YA 1R24B 4PJFA 3BGMA 3HAEG 3BDYL 1PAMA 5IWLC 5GXBB 3U7YL 1FGVL 3H9SA 4Y5VC 4UOW0 1CICC 3OKKA 5F3BA 5HI3C 3Q6FA 3VDAA 4X0KA 2ZOLA 5AAWA 2J1KA 2CR6A 4LHUA 5DGRA 2CSPA 2CIKA 4NKIL 4OCWH 3WXWH 2DD8L 1DQTA 5EOCJ 1OW0A 2AK1L 3TBSA 4KKBC 2W0KA 4OCRH 1J0HA 6FABH 1CD1A 1AGDB 3GRWA 5ANMB 3MOBL 4ZOBA 3FFCE 3PABA 3DUUB 1FNHA 1FVCB 1MWAL 2DL2A 1XIWA 3TT1L 4NJ9L 1HOCB 5EUOE 3O2VL 1CLYL 1RZ7H 1LD9A 2DYPA 4BZ1L 5K9KB 2J4WL 4MSWB 4Z18A 5KTEL 3RNKB 2IAMB 5GRZA 2BNQA 2FL5A 3BAEH 1OARL 3RWHB 4OIBA 1AKJD 1ZA6A 2K7QA 3BT2L 5MENB 3R1GL 1DBAL 4L8DB 3WIIH 3STZA 2C3VA 3GSVB 1HXMA 4Y88A 2FJHA 1DBBH 2JJTC 4CVZA 4EXKA 4EN3A 2FR4A 1GHFL 4BSVB 1HN1A 1Y6MR 1NCCH 2OXHA 2UWEB 2EO9A 5KS9E 3P9LA 4ODUB 4TVSa 1HHGB 4ZFOB 4JFOA 2EC8A 4XX1E 4P2QB 5D9SA 5I71B 1WITA 3FT4A 2MWCA 4YHZH 2HTKD 3MLTA 4AJ0A 2BSSA 4I18A 4IDJH 2AXHA 4RAHA 4XNMB 5EZIH 1IEAB 1HH9A 1YPZB 5IMKA 5JIKA 4DUVA 1PEWA 1XF2B 1A0QL 3N85H 4HH8A 1DANU 4YBLB 3RKPA 3MNWB 3BP7A 4OJFH 3OKLB 4FTVB 1YEKL 1ACYH 3BKML 5J13C 3LKRA 1GIGL 3AB0C 5GS1C 2W38A 1KBGL 3PL6A 5I1KH 5CEXA 5GGRB 3HLAB 1QACA 1T20A 2OBGA 3QIBC 5EU5B 4DKAA 3QUMH 3B9KC 2OTWA 4J1UA 1G84A 3HN3A 2XACC 3ESVF 4PV8A 1HYSC 1UA6H 4MD0A 3SQOL 2ORBL 3T0XA 5J1SC 3HC4H 2BCKA 3GSXA 3WNLA 4U6VH 2WUCL 4G6JH 1JV5B 3F6IA 4S10A 4RFNC 5JW4Q 5DD0L 5BMFH 3QCTH 3FZUC 2DB8A 1BMGA 2DM2A 4FQIH 4QRSB 1JFQL 2BMKA 5FM5O 2NLJB 4TNVK 1AQDA 1QA9A 2MTPA 1HWGB 3QEGL 2YKLH 1QO3B 1WBZA 2BY2A 2X05A 3FFDB 5JTWA 4JQXC 1JN6B 4PBXA 5DJ2A 5IW6A 4MB4A 4P5MA 1RZKL 2EYTA 1CE1L 3IRPX 4OIIL 3GIVB 3O9WB 5F93C 2V5RA 2BRQA 1A2YA 1ZEAL 3UTOA 1GXEA 3BUYB 4Z77B 4NQXA 3KPSD 4KKCC 3VXSD 3X11B 3T65A 5HGHB 4XPAH 3ROOA 4PLKC 3OHXA 1CTOA 4JY4A 5DHXB 3QEHB 5BRZE 3KYMA 4K94C 4XMKH 2CUHA 4Y2DA 2VDOL 2WINB 3W9DB 4JREB 5JW5B 1A6VL 2ZWLT 2F19H 2F54E 4P5KB 4WUUE 3QIUD 4TVPH 2Y1VA 1T7WA 1C08A 8FABA 4RGND 4U1JA 1HCVA 4WJ5B 2L4OA 1LGVA 4TN9A 3KPPB 4P3WA 5JPNB 4K8RH 1CFVH 4ZUSB 1DLHB 1Y6NR 3QISA 1DL7L 1XGPA 3WIHL 1BEYH 4MS8C 4FP8H 4QRRD 4PRAA 3SO5A 2FWOA 3IT8D 3PXHA 3TVMB 4R4NC 4X4ZA 5KSBF 4P5TC 4OGYL 4GXVH 43C9B 5KANI 3A67H 1XGRB 5CJOH 1P5UA 2OQJA 35C8L 1FG9C 3UPRB 1NC2D 4QOKA 3G5VB 2AJXH 3OJMB 5E95B 1AE6L 5I66B 4ODWA 3JZ7A 4NZRH 4NQSA 4BQ6A 3AGVA 2VKWA 5BVPL 3FFCA 2VLLA 3CU1A 5K9OB 3O9WD 5JA9A 5ID0B 5E70A 2KL6A 1GRWA 3A6CL 4XVUD 2FH6A 2VISA 2DQUL 1VPOH 4FXKA 1OAKH 1ONQA 4V1DB 3I84A 2X4SB 3NTCH 2X89A 5FXCH 3FO9B 1H5BC 2Z4QB 3IVKA 1HDMB 3GMQB 1K2DA 4FMKA 3BPCB 5GGSY 5FUOH 2YRPA 1BQLH 5J7CC 2Z8WC 2APVA 5I1GH 5CKAA 4TTDD 4XNZC 1GPOH 2ID5A 1MFAL 5EO1A 4NZUH 3SPVB 1VFUA 3MCLL 4XNQB 4X6DE 1FNGA 1JMXA 2ENYA 2OMBA 4PJ8A 3BQUD 2XXMB 4UT7L 2FRGP 3TFKC 3U9UA 5FYLH 1A4KA 3ZHKA 5KS9A 1ZHNB 3C8HA 1QFPA 1T7VA 3FT3A 4Y19D 4EBQL 1YECH 5C70A 3VI4E 4MXVF 4B50A 3MRIB 1M6OB 4Y4FA 3VG9C 1WQVT 3BI9X 3LIZL 1KB5H 3CFCH 3MODH 4HKXA 3QXTA 5FYJH 2MMXA 3RRQA 3M07A 4LSQH 3CAFA 3HMXL 2KKQA 3V0WL 1NQBA 3SGDH 5CJXC 2G60H 5ESQB 5D1QB 5DSCB 3CMOL 1DBML 5FO9A 3IXTA 4Z95H 4NWTL 1MCWM 4WTZA 1RIUH 3QUMB 2E7CA 4LF3B 4XGZA 3P2TA 5K9JL 3RVUC 5IMLB 2BERA 1QOKA 4OZFG 1ZAGA 4PGZA 2QQKH 4HK3N 1MI5B 2ZKHH 1MRDL 1D7FA 3SE9H 5FCUL 3F7QA 1NFIB 1MCHA 4ELKA 4MD5A 2IAMC 3I3BA 5LKNA 4YXHL 2J7LA 5EWIL 5F1IA 3B9KA 3GGWB 1CTNA 1H3PL 4OTXH 1R3LB 5HI4D 3MV7B 1OAQH 1SYSB 1TZIA 3D9AL 5HGDB 3V6BR 3DVGB 4XNXL 2DAVA 5DI8A 3DECA 2CLVB 1FO0H 4C55A 5EIQA 1WAAA 3PGCB 4OD2A 3OR7B 2EDFA 2A1WL 3EOAB 3SY0B 3UTZA 4PB9L 2C7UA 4HFUL 1D6VH 2BXZA 3O0RH 4BQCA 1E27B 5HHVH 4G8GA 4LAQH 2CJUH 1ZTXL 5I71C 5BRZA 4K7FA 3MRDA 3FB8A 4OCSL 5DZNA 1Q1JH 4LGRB 5EORL 4OI8A 2VXVH 4AY0A 3QG6A 1JGLH 4HXBH 2F54A 1M05B 4TUKH 5D5ME 4FA8A 4WUUA 1A14H 1SY6A 4UBDC 3O6ML 4YC2B 1YJDC 4LHUG 2MKWA 5JA8B 5GGSB 3HI5L 4YBLC 1G9ML 4NUJB 5IG7B 3SE3A 1MJJA 4OFYA 2VXTL 4RISL 3T77A 3BZDA 1T2QH 1UM6L 2NZ9C 1HINL 5CLWA 3Q2CA 3KPOA 3EYQD 4L9LA 3MOAL 3QPXH 3UC0L 1IFHL 1KNOB 3WNOA 5MEPA 3R8QA 1KCSL 2L7JA 1J11A 3PDOB 2H3NB 2NTSP 1S7UB 2ICES 2W0FA 5CGMA 3KPSE 3VXSE 5HSFA 3WIFA 3C5ZD 3MV01 4G9FB 5I30H 3UBXA 4BK5A 3MV7D 3BZFA 1NC4D 2AI0L 3MUHL 3ZKMC 3LOWA 3W5NA 1CGWA 1ES0A 4FHBD 1U6AH 2HT3D 2IC2A 2G5BB 1TCMA 1I7RA 2GSIB 4RGNE 1W72A 1EO8L 4YDIL 5IHUH 2HYMA 4GFTB 3ZE0F 4W6YB 3IJYB 3O6LL 3FO2B 3VFUB 2EECA 2YUZA 3P3YA 1LK2A 4WHCA 3DO7A 5C0RL 1CK0L 4Q0XH 3R06A 2P5EB 3HCVA 3LRGA 3QNYB 4QRRE 4C4KO 2XFXA 4WWID 2DQJH 4DW2L 1I1RA 3O9WC 1VEMA 4FNLH 4TVPD 1BBJA 4XVUC 1AD9B 3IU4L 4X6DA 4WHTA 1S7XA 4GAJH 4KZDH 3C8DA 3GSRB 3DIFA 4K8RD 4XP9L 3BH9B 1A3RL 3U6RB 1LK3H 1SM3L 1FNSL 3QNXB 5BXFA 1KXQE 4NOFA 5DJ8B 4JREC 4KI5D 3ARTA 2H26B 2MHAA 2AQ3A 1AGEB 1A3LH 4D0CB 5GIRB 5IV2A 1MQ8A 2UZYB 1MFEH 4L4VD 5HYJD 1CLCA 3B2VH 1KB5B 4ZG1A 4I9WD 1T1ZB 3IJSA 2MKLC 2EICA 2R4RL 1AKJA 2N4IA 4QEGA 1WZLA 1FH5H 1GGIL 3TVMC 2YOCA 1KCUL 4W81A 5JPMA 3PP4H 3MTRA 2FJFA 4OFIA 1KJ2A 1MIEH 2W60B 3IFLL 3W39A 1QHOA 3OXRA 4K3JH 4YZFE 2X70B 3ARVA 3LKSA 4WEBH 2HT4C 3DYMA 1BZ7B 4LLDB 4ODVH 5CILL 1WISA 2R1XB 1A6UL 3OKEB 4NHCL 2P5ED 3ZZ1A 4MVBC 4HZAA 5C0CD 4Y19E 5DJXB 5F3HB 5GS0H 3DV6B 1AGFB 3CCHA 5TFSL 1JUFA 4GQ9H 2O5YL 1MCKA 5FUZL 1ORSB 1CDBA 5TF1H 4H0IA 4ERSL 4XVSH 4WHDA 1HKLL 5FYLD 3SGDI 4Y4KD 3T0EA 4OF3A 3CX5K 4UTBH 4K3EH 4U3HA 1QBLL 2VH5H 4HK0B 4NO0B 1KJ3L 4NO3B 1FVCA 3RGVD 4DQOH 4H5SA 5TDOA 1FO0B 1XGTB 4AQOA 4KZEL 4KJQD 3VGBA 3DX9B 3ZO0A 5KVFL 2AXJA 1MUJA 3FB7A 5FYJD 3RNKA 1NGXA 1T1XA 1X5FA 3L95B 4TSAH 4HDIB 5E1HB 1XGYH 4LKXA 1NAMH 3MFFB 2D7QA 5AYUH 4IRZH 5HI4C 5D7SL 1HI6A 1T21A 3MRKB 3ROLB 4OM1H 2H1PH 1CZ8H 5LWYH 3RTQB 1MJ7L 3MJ9H 3TA3B 5F6HI 5D5MA 3TP4A 1LP9E 3RWCA 3ALXA 4WW2A 2WP3T 5C8JB 3MMEB 5DRNA 1QEWA 4R3SB 1J87A 2B20A 5ID1B 2X4PA 1VFMA 2J12B 5FGCB 4BZ2L 4Z7OE 5D1QC 4KTDL 3UYRH 4QNPF 5C6TL 3MJ7B 2ZUSA 1N5AA 4LCUB 1EO7A 1M1SA 3O41A 4R97B 5DZOA 5C6WH 4DOHB 1XR9B 2PYFA 3KPSA 4R26H 3VXSA 5CEZH 3ZE1F 4C59B 4GRMB 1SEQL 5SWSA 1FZMA 3M17A 3OKLA 4G7VL 4OGXL 3CDGA 2PW2A 5EPMB 1W0WB 4MAUH 1X3DA 5FIEA 3KWWB 5B8CB 3VFTB 4NYLB 1UKQA 2D4FA 4OV6F 4R8WL 1TJIH 1MCNA 1EGJH 1YUHA 3QIUA 2B8OT 2XIDA 4HH9A 3BEWB 4YPGB 5T1LD 4A6YH 1C5DA 1AQKL 1KT2B 3G5ZB 1AFVH 3L5XH 3GSNH 2Q76A 3DV4A 2IADB 2D0HA 3F7VB 1TVDA 4PS4L 4FZEL 2A77L 4PY7A 4P9HH 1WVZA 4QRRA 1MJ8H 1KLUA 4XX1G 5E5MA 2XKNA 2HT3C 4KHTL 3N9GH 1GGBL 4JHWL 4I77H 3FQNB 5T1MA 3ILQD 2XZQL 2NLJA 4C56B 3SE8L 3CX5J 1NC2A 1QP1A 5IK3B 2C3XA 1QO3A 3WFEL 1G7JA 3IF1B 3MV7E 2OL3L 4PRNB 4JFPA 1JN6A 3MRFB 3NGBB 2YD8A 3QT2A 2BOBA 2G75A 1IGIL 1ZHBB 3HZMB 5EU6B 4CBPA 4WHYH 1R6VA 5IFAH 3CH1B 4YC2C 1YEFH 1GZQA 4Z77A 4ONHA 3QUXB 3D87B 3REVB 3WFZA 3VFMA 2VN7A 1UWEL 4WTZG 1NANH 5D2LB 3QCVH 1HEZB 4Y16A 4X98A 1P2CB 3BSZH 3SDCD 2B5IB 4OB5L 4DK3A 4S1DC 5DRWB 3QWOB 4UU9B 4JQIH 4TVPE 2XY2A 1S9VB 4KJWD 5J1AB 4MXWL 3JTSA 5FYKU 4WJ5A 4UIMA 5HYSB 4G5ZL 3ULUL 3FL7A 3BQUA 4E5XB 3OZ9L 5GGUB 4U31A 1KIRB 7FABL 4XP1H 4K7PX 2D3VA 1I85C 1WCQA 3MLSL 2P8MB 4NHUA 1T22B 4OZIB 2R39A 5HHQB 1JGEA 4Y19A 1CF8H 4KI5E 5LGHH 5DYOB 4QHKJ 2VLJB 4LBEB 3BXNB 4XRCA 4L4VE 3KJ6H 5JOPD 5HYJE 4C56D 1HHIA 4I9WE 1ZT7B 4CVUA 5FF6B 2W9DL 4DZ8A 5EOCL 1PZ5B 4YK4B 2DI8A 2QSVA 4V2CB 1J1XH 4AEIL 1PSKH 2FB4L 1CBVL 4D0DA 4GSDL 4KTEH 1XGQA 3QO0A 5D7JD 4FQ1L 2P24A 1EEQA 1DR9A 2H8PA 4X99B 2WZPD 1LWRA 4JFYB 2R0KH 3SKOA 5DUPL 4JN2A 1I7UA 4R6UA 3X13A 4LEXH 5JORA 1R5VB 3FO9A 4Y4KC 2Z4QA 1NAMB 2R2HA 5TQ2L 32C2A 4MQXD 4XCYA 1RAMA 3MR9A 4PJ5B 5C0CE 1CVRA 4NO5B 4UOW1 3RWEB 2WQRA 5DJZB 4Q2ZA 1LP9A 2X44D 4NT6B 4X5WB 1S8DA 3BO8B 2N1KA 4DAGH 2KZWA 1R3HA 1BLNA 5FYLE 2VIRB 1UH4A 1X5LA 5EDXA 1NJ9B 2R56L 3KLAB 5CHNB 3S36L 3UBXG 5GS0D 2D7OA 3CVIH 5HJ3A 1N6QL 1M6OA 2VLJD 3VXUD 3OKNB 1XCTB 1UCBL 2NYYD 1R3KB 3GBML 1DBKH 5I1IH 4KJPD 1E28A 3Q0HA 4EZMA 1G6VK 3ORJA 4YE4L 1QRKA 4YBHA 5FYJE 4IHOB 4JM2D 1AXIB 3MSPA 1LE5A 5JXAL 4NIKB 5F71A 3RL2A 3BGAA 3FQWA 3TBVA 2H32B 1XCQB 4NFDA 2MCPH 5J56B 5KSVB 1IVLA 4ZTPH 2OR7A 3DPBA 2NXYB 1IC7L 3Q6GH 4A6YB 4JO4L 3QUMA 5L7XH 3B8YA 3CDFA 1NBQA 3F12A 3GSNB 1MIMH 1X5HA 3DVFA 3I6GB 3QYCA 5IF0A 2X5PA 5I8EB 2C1PA 4X9HA 3D39D 4I0PD 4HBQA 3PE9A 4PJ9D 5DTFB 4QRUA 2LU4A 3O8XD 15C8L 1BVLB 1T1YA 3QUZD 4G8IA 3LKPA 1KV3A 5CZKA 3SGJC 3VFPA 3IDIB 2D2OA 4XI5D 3P0GB 3C5ZA 4FQQB 1R3LA 4P4KD 3U30B 1NC4A 4ZFZA 1J0ZA 5DS8B 2QLVB 5E5UB 4XBEH 4XZUA 2CLZB 3QA3A 1NGYA 3RTQC 3TA3C 4NBZB 4CNIB 4YFLF 3EHBD 3PGCA 4JKKA 5IOPB 4MJIB 3MGOA 5F7NC 4DKFH 5DHYA 3LEYH 5CEZD 4HUMB 1L7TH 2ATKA 4IIQC 5DJ6B 5FHBL 3CSYA 5I74B 4YHNB 1S5HB 4DZBA 3BD4A 3H3KA 1MCFA 3HUJA 1JZ3A 3MGTB 1ZSDB 5EUKA 1UWGL 3VXMD 3PHOB 3FQUA 2YUWA 1QZ1A 4KK5D 3E8UL 5E2UH 4NKOB 1JTTA 5TDPA 2RHEA 1CVSC 3ET9F 4R97C 4WI7A 2OR9H 1K6QL 2X4OB 2DQEH 3G5YA 1YEDA 3OKOA 1RK0A 2DQHL 4LU5L 3D0LA 4OT1L 3OAZK 1LEKA 4EEEA 3EJZC 3GSUA 3WBDA 4B7IA 1UENA 4F58L 3L3OB 5B8CC 4ETYA 3GB7B 2H3NA 4NWUL 5HVGB 3MUGB 3NVQA 4UDTB 3U83A 3GSOA 4KJWC 4L4VA 5HYJA 1XF4A 4DOHE 1ZVSB 2YD5A 1AXTL 4IOSD 4KDTC 12E8H 2R2EB 2DKSA 2A9NL 5B39B 5C0IB 4MB3A 2XPGB 1FZOA 3O2WH 4R96A 5C07B 2VSDA 5EO0A 1Q94A 4MJID 1CLOL 5LBSL 5HDOA 1P84K 4I5BB 5I1JH 4PP2B 3EYOB 2XZAH 4RMTA 2Q7YB 2J4WH 5KSBB 4QRPD 4U1SB 5ETUA 4Y0GA 4Q74A 3NGBC 5HGBB 4Q9RH 1N2RA 1UZ6E 2IBGA 3S3PA 5C0CA 1CIDA 3SDAA 1VENA 1B0WA 4O4YH 3VD7A 4NKQB 2FX9H 2ZPKH 4ALAL 3GMMB 3QUXC 5JOPE 1UZ8B 2IBZY 4C56E 4U6TA 4LL9A 3D18A 4IRSD 3BH9A 4EVNB 2APWA 4JJHA 4HGKC 1U8HB 4Y4KA 3R4DA 3FRUB 4XP6H 1T0MB 2QKIB 3W0WE 1RFDL 1OSPL 2APXA 5FYKH 2B5IC 1EJOL 2VZSA 5IMOB 2HJKA 4BQBA 4WU5B 1B90A 3MRHA 2Y7QA 3OAUH 1MLBB 4JM4H 2Q8BH 3RGVA 4KHXH 4LLYB 3PV7A 3BW9B 4CN6A 4OQTH 5DEGB 5F1NA 3LN9A 4JDTL 4RFEA 2YD9A 4R7DA 3MLZH 4ZOCA 1IE5A 3G08A 2FD6L 3MRPA 3KXFD 3LKQA 4FFZH 3TM6A 3BJ91 1IAMA 4YUEH 1QSFB 3U79A 2B1HH 5C07D 3L5HA 4XHJC 4M6NH 1A6AB 2R0LL 3U9PL 4NQED 4WUKH 1U8PB 5GS0C 5E99L 2JJSC 3LZFH 1HXYB 4M7KL 2WIMA 4JFHD 3VXTB 2NYYC 5KVDL 1S7WB 3TV3H 3KPLB 4KJPC 4JFDB 3P4NA 4PRBA 4GMSH 4U3CA 5T5FH 4YK4C 5C3LD 4D3CH 1EV2E 2Z31D 1DSFH 1GGUA 4OZIE 1RSFA 3QUYD 4LLQB 4C83B 1OAYL 5DJXA 1KJVA 2VOTA 2CXGA 3DV6A 5A2JH 3M1BA 4HHAB 4KROD 3VXUE 2VLJE 3U46A 3GSQB 1NDGB 1FAIL 3IDJB 3O3AA 4PGCA 3T3ME 1NCBL 1G0DA 2OP4H 1F3JB 3HZKA 1NL0H 2X1WL 1LMKA 4U1GB 4PRDA 5JIHA 4HK0A 3NABH 2JK5B 3NZ8A 4HJ0D 4MDIB 3CFEA 5KANG 1WTLA 2I07B 5E94A 3OJDB 4HPOH 3CLEL 1HHKA 3ILPB 2R1YA 1P84J 4PJAA 3WNPA 5EC1A 3T2NH 4FABH 3L5IA 3V79C 4L8SB 4NRYA 5T1LA 1C1EL 4RWYH 5T1KA 1F4HA 2Y5EA 2HP4A 3T08A 2HN7A 1DEEA 3D39E 2RFXA 5I19H 4PJBA 4FQLL 4Y1AB 3KR3H 4L4TD 5T3XH 3OF6D 4EQ2A 4U6XB 1OHQA 2XWTB 3RU8H 1ZT1B 4JFDD 4LLUB 5TQ0H 1N6VA 1YMHA 4FXGA 1CXKA 2ZG1A 1U92A 9CGTA 4IIQA 4O9HH 2VMFA 4HUKB 1PQZA 4S1RL 3GMLB 5C0DA 4UQ3B 3G6JF 1RULH 3R8BB 1VKXB 3GZKA 3W81A 4JE4B 3OX8B 4HQQL 3T4YA 3WIHH 3HFMH 1T0NB 3DX7B 1A9EB 1MCDA 2NXYC 3MQIA 2ZUXA 2Y36L 2AJSL 1QKZL 5CEZE 1LEGB 2GSGA 3TIDA 2Q3AA 3D0VA 5I1DB 5FKAB 1TJGH 3IFNH 1DQJB 3SEPA 1QVOB 3U82B 1S5IL 1JRHL 2AEPH 1AE6H 2KPNA 3VXME 4PJGF 4D8PA 1GAFL 3RNQA 3SDCA 1K5NB 1LNUB 1C7SA 4Q6IB 3RWFA 1QNZL 1ZANL 1QSEB 2NMSA 3SKMA 2H2SD 5J12B 3L3DB 1KC5L 1ORQB 5GZOD 4KDTA 1FV1B 2SEBB 2IEPA 2DTMH 3MA7A 3U30C 1ZXQA 4TSBL 2DMCA 3KG5A 4ZNEE 1QSZA 4XP5H 3ZYOA 4KQ4L 1QYGH 4F9LC 1WEJH 1QD0A 2AGJH 3MXWH 1X5GA 1JNLH 4Z7WF 3X3FL 2HH0L 1W8NA 4LLVB 1ZHLB 1FDLH 2VQ1A 4C56A 5I74C 3BPLB 4GAYA 4ODSH 2DQGH 4M00A 1HQ4A 3WN5B 4ISVB 2EDLA 3IF1A 3H3PH 4PRNA 3W0WA 5L8LB 4HMEA 1PX4A 2F74B 4ODHH 1I1AB 1P7HL 5HDQL 2DJUA 2XZZA 1QPPA 5BQ7A 4A2LA 2VC2H 2R69H 5D7JA 2VDKH 2BVOA 2EC9U 4X8JB 3HZVB 2BSRB 3ETBF 3TJEL 3V8CA 3DHMA 4MJIE 2F5BL 2V9QA 2DN7A 1WC7A 4Z7QF 4F57H 5IB2A 4OLXH 3HG1A 3I9GL 5D6DC 5IJVA 4LCIL 5KVEH 1A4JA 4IRSC 1RJZB 3AREB 4QRPE 2F53D 2BHYA 3TESA 3GUTA 4MJ4A 3HRPA 1MH5B 2D7TL 3I6KB 3RWIB 3S4SA 4UT9H 1LO5A 4Z7UF 4AL8L 4HJGA 1QSED 2AW2A 2Z92A 3RVWC 2YXMA 4DKEH 1WJ3A 1U8QB 4WGWB 4I3GA 4XVJH 2VDPH 5EN2A 3U4AA 3RX7A 2CLRA 5ALCL 2P1YA 5KW9H 4PRIB 2YPKB 5ADOL 2Q3ZA 3CZFB 4OZIA 2DLFH 1FGNH 4U1HA 4GS7C 4NUGH 4NKMA 4JZJA 5ICXB 4R4BB 1NSNH 3SKUD 2FGWL 3VXUA 1IM3B 3LEVL 1KEGH 4YHPA 1P4BH 1NGZA 2EDYA 3O3BB 2EIZB 4P99A 3KPQB 3DHJA 4JM2A 1IZJA 3KXFE 1CR9L 3V4PH 5TE4H 5FYKD 2Z31C 4W4OC 5C07E 5EULV 1V7NL 4N0YL 1SHMA 3NN8A 5K93A 5HPOA 4NQEE 2DWDA 1RUKH 1N0XL 4N1CA 2PNDA 3AS3A 3HE6D 1MHPH 1RUQH 1E4XL 3IS1X 1KCVL 4JFHE 1IBGH 5J9PB 4GH7B 5DLMH 1FVEA 3MV9B 4HS8L 4HEP