4S1DC

Structure of igg1 fab fragment in complex with biotincytidinamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
212
Chain Sequence
VQLQQSGAELVKPGASVKLSCTSSGFNNKDTFFQWVKQRPEEGLEWIGRIDPANGFTKYDPKFQGKATITVDTSSNTAYLQLNSLTSEDTALYYCTRWDTYGAAWFAYWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAB M33 FAB FRAGMENT, heavy chain
publication title Hapten-directed spontaneous disulfide shuffling: a universal technology for site-directed covalent coupling of payloads to antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 212
sequence length 219
chains with identical sequence E, H, O
ec nomenclature
pdb deposition date 2015-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1dC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1dC02
5FKAB 3KYMB 1FFNA 4GLRI 2CK2A 5DUML 1JV5A 3K3QA 1HXMA 5KN5A 1T0MB 2NZIA 4HKXA 3CVHH 2H26B 3U2SB 3AS2A 3UTQA 2JLLA 1TMCB 2FJFA 2W38A 5KSAB 2VXUH 3JVGA 3K2UH 5HVGB 3L3IA 3CIQA 2P5WE 2FZ3B 3TBVA 1KEML 5BV7H 1I9EA 1QO3B 2ZUWA 2FO1A 1TJGH 5CJOH 4YHYC 1I3GL 2XACC 1D5XB 5I1KH 1QPXA 4XAWL 5A16A 3Q0HA 2GTZB 4RX4D 5GIRB 4X6EB 1MUJA 1SMAA 3L7EA 4WV1B 5H35A 4QY8B 3RIFF 1BFVL 4YNYA 2I5YH 2OTWA 2HN7A 1BBDH 3RWFB 2CLZB 1KENL 4IOFD 3WLWD 4PJ8D 5BV7B 2HMID 3TYGH 4RFOL 2AP2A 1P9MC 1ULVA 1RJLB 4ZFZB 1ETZA 3I02B 5D8JH 2NXYD 4QTHA 2L7UA 4O2FA 3P4NB 3UTPD 3BGMA 3SE3A 3C09B 2EIEA 5DVOA 2X1QA 3GGWA 2MCPL 4PGCB 4R4FL 4MAYD 4GW1B 4R26H 3QAZB 4XNMA 5IQ7L 3T8XA 5ESVB 3U30B 4Y5VA 2DQGL 3OJVC 4NQEB 3D39E 3FOLA 4WW2F 3SDDA 3CZFB 5HHPA 1ZHNB 2W9DL 4DZBA 4WFGE 1HEZA 5I18H 5IJVB 4JLRB 1F90H 4IBLT 2YA2A 5GGSA 4C56B 3NA4A 4M6ML 4WEUD 2IFFH 2J12B 5D7SH 5ID1B 4JY5H 2JK5B 3EOBA 2EDLA 2EO1A 4ESKA 5DI8B 3MLYL 3MLZH 4QRPA 5C0IA 3AMLA 1MCNA 4XH2B 3QEGH 3WIHL 1HDMB 5KSBE 1R5IA 1QACA 2BNQA 3M8OH 1T83C 4YGVB 1ZSDB 1U95A 4OGAD 1KEGH 3O9WB 1IILE 4W4NA 4KQ3L 4I0PD 3D18A 4NQXA 3U0WL 4KV5F 4OZIB 4PJDB 2X7LA 3BKCL 3VI4E 1Q1JH 3JWOL 1W72L 3IDMA 1D6EA 3V9FA 4S2SA 3EJYC 4W6WB 5GRXG 4ZTOH 3T0AA 3S34H 3JV6B 3AB0B 1IAII 1LNUA 2ED9A 1W8OA 2A73A 4M6NL 2H6PA 1JNHA 5ITFB 1EVTC 4OCWH 3OKNB 1A7NH 1N5YH 4XB8A 1NGYB 4G8IA 3ILQD 3HE7B 4I18A 5HVHB 4UTBL 5AYUL 5EBLA 1MNUL 2BFVL 5CWSA 3QI9C 5DJ8A 2AJSH 1VFBA 2VTFA 1HHIA 2XA3A 3VE0A 3ROOA 3QUYA 1IJ9A 1NLDH 1CE6B 2XN9B 4ZAKC 1AKJD 4WCYH 1FVCB 4KXZH 3UZQA 5BVJB 5AEAA 1S9WA 4CL7A 1QFWL 4LQFH 1WFTA 1T2XA 4DGVL 4Z5RB 2LAAA 2C3GA 1N59A 1KSRA 1J11A 3KS0J 2PTUA 3LS4L 4Q74A 2KUTA 1I8KA 4FTVE 4CW1B 4DKEH 1QA9A 1SEQH 3WFEL 5CLTA 1RUKH 2BVPA 2DQFB 2GJ6A 1IL1A 3GIVA 5F96H 1P4BH 1BBJA 2Z91B 4C58B 3F65A 4LKXB 2EDJA 3DX6A 3GMQA 2XWBA 3ZSTA 1R5WA 3CX5J 1C7SA 4OZ4A 5E5MA 4D9RE 4PLKD 1MREH 2D4FA 1YN7B 3DXAB 3AM8A 1CFTA 4KK5C 4NT6B 4ORGB 4PRBB 2OJZH 1CS6A 3IS0X 3U46A 2ZCKH 3DMMD 5DD0L 1RVFH 4YZFF 1TJHL 3F8UB 1A6PA 1JZ2A 3BZEB 1G7MA 4CMMB 2XRAH 2AK1L 4X6DA 5HJ3B 3RPKA 1RK1B 4HCRH 2D7MA 1EUTA 1NMAL 5GQBA 1VGKA 2NY2B 3SDYH 2AXGB 2IADA 1KNOB 2DQIH 3UX9B 2EE3A 2QR0B 4LGSB 4U1KB 1UH4A 5C0EA 2XI9A 4O00A 4KHXL 2VDQL 1OAXH 3HFML 2DBLH 3QFJA 3O6LL 3X11B 3PIQB 1YN6B 3QHFL 4Y4KA 3WN5C 2PYED 2C1OB 4YHIB 3PF2A 4PJ7A 1Q9WB 4YBQC 2X4SA 2X4QA 5MEPA 3LKPB 1I3GH 1GC1C 5J1SC 4LNRB 2NY3C 4OUUB 2A6IB 3QWRD 1OCWH 2CDGB 4U1NA 3FOMB 4OFIA 2D9QB 1DBML 1INQB 4XHJD 1WUNT 2V2WA 5J8OA 3ARZA 2I25N 4GG6B 4PYGA 4HMCA 2VDKL 5KANI 1J0JA 2PYFB 5I1HL 1DEDA 3WJLA 2ATPA 5HY9A 1A9BA 2ESVB 4KJQC 4G3YH 3RPIA 3ULVE 4FNLH 3G08A 4NQDA 1NBYA 4R9HA 4WUUB 5GSRB 2LAGB 4PJEA 3HNVL 1N0LA 3P30L 3OGCB 3KPLB 1FZJB 3F58H 1QVOA 1UVQA 3FB8A 3UTTA 4R4FH 3OBAA 3UPAA 4R90H 1F02I 4DVBB 1TCMA 2G60L 1Q9KA 3MV8D 1RJZA 3DVNA 5TQ0L 4EN3D 3VD7A 4FXKB 3L9RA 3H9YA 2VLJB 2PW2A 4I4WB 1JHKL 4G9FE 2EIDA 1KELL 3EYFB 3H42H 5JMOC 4JPVL 5D6DA 2H41A 1ZHBA 4PRIA 3RVUD 1NDMB 1LEGA 4ODUB 4NO0B 1BLNA 3O3AA 4KJWD 4IOFC 2DAVA 3WLWC 3QI9B 3H9SD 2HMIC 3WFCL 1G7HA 3D0VA 3SKNA 5AG9A 1PX3A 3WIHH 2VXVH 5E8DH 3HG1A 5TH2B 1QYGL 3PDDA 2HJFB 4ZAKB 3PGFH 4KVCH 2XXCB 4JVWA 2HFGL 1YY8A 4RGOH 4QXTA 1ZOXA 3U0WH 5T1DL 3BKCH 1EHLL 4UILL 2V9RA 4DQOL 4JB9L 3BKJH 5E5RB 3V7MA 1W72H 1AO7D 3PDOA 4R4ND 1BX2A 2A6JA 2DL9A 4O4YL 3S96A 3GSUA 1OTSD 1IC7L 3MUHL 2VLRE 1FCGA 1N5AA 5F88B 3U1SH 3ZL4L 4M6NH 1A7PH 3QO0B 2BY0A 5GS0C 5TE7H 5IR1B 3IGAA 3PHQB 3EO0A 2FD6L 3R8QA 3BJLA 3OG4B 4UTBH 1W72B 3BEWA 1A0QH 1VGEL 1MNUH 2CMRL 1K4CB 5IVXF 3TYFA 2BFVH 3FAXA 5IHLB 4NQSB 4ONHB 3MRIB 4Q2ZB 5HDOA 5BZDB 1CVSC 1GGTA 3TIEB 4XVTL 2R56H 3MV11 2XKNB 5IHUH 3ZYIA 5J89A 1T66D 2A83A 4WHYH 2ARWA 4Y4FA 4V1DE 3QB7C 4OGAC 4ZNEA 1QFWH 4DGVH 3CLFH 3FJTA 4I0PC 4MQTB 3OAUH 5JZ7D 3CH1B 2ORBL 1J05A 2LQRA 1WBZB 1PEZA 3SDDD 1NGZB 5E9DB 4G43B 1OF2B 5GJSH 5IMMA 2PKDA 4QNPE 1GC1H 2QSCL 5DHXB 2IEPA 4ZOAA 1DBJL 3QNYB 1KLUB 2YPKA 3I2CL 4NRXA 5FGSA 3SKOA 4YDVA 2GTWB 3WN5B 4JFYA 4XVUD 1EJ6A 4Y16A 1FIGL 4QRPD 4HPYH 1FE8H 1S7QA 2BNQD 4LSPH 1Z9MA 1X5LA 3TIDA 2NY3B 3FQRB 2EIZA 4MX7A 4PJFF 4CADA 3KS0H 3DX9A 4Z7VB 3V6ZB 1SYVA 3L5XL 3EJZD 4N5UA 2NY4C 1YEFH 3F62A 4MAUH 4CNIA 5C09A 1KCUH 1G1CA 6FABH 4AG4H 3RVTD 4ZQKB 5DRZB 5SWQB 1OT2A 3ETBF 4PRPA 5DHYB 3MLTB 3TZVA 4JGUA 4KHXH 2ZOKB 5C1MB 4AT6B 4YHOL 3HFMH 5TPWL 3UEZA 3G6DH 1A5FH 2CKBL 4NJAH 4ODVL 4HZLB 4MJ6B 2O5ZH 1G1YA 1GIGH 1Q0XL 1MFCL 1FFPA 4PLKC 2B1HH 3QUYD 2G9HA 3WNKA 4G80A 4KI5E 1KCRL 2VLKA 5KSBF 3DNKA 3GM8A 1FZKA 3LS5H 1N64H 1EGJL 3DMMC 1S7SA 5SWZA 1F45A 4MCYB 1NEZG 2XFXA 1RIVL 1TCRA 25C8H 5I1AA 2EDHA 3VI4F 5D1ZA 4GAYB 3O3EB 4ZOEA 2H2SD 4G8GA 2GJ6D 5L7XL 2P8PA 3OB0H 3LN5B 5I0ZA 5J6GB 1Q94A 2X40A 3VGAC 3DGGB 3CDGB 1JHTA 1X3DA 5F7YC 4YBLC 5GS0H 5JW3L 4ZUWA 3QXDA 4LEOA 5ICXB 4E5XB 1MFEH 1CE1L 2G60H 5TQ0H 3H3KA 1RIUL 3QISA 1XR9B 4HHAA 3F5WB 1MAKA 3VG9C 1MHEA 4FHBD 4EIZC 1JHKH 1E4KA 1AP2B 2QHLA 5DVKA 2CIKA 1WC7B 4JPVH 4L4TA 3STZB 5FV2A 3Q5OA 4Z7QE 2C4FT 3J8F7 4HAGA 3RJDA 1CCZA 3L3JA 2DLIA 3TC9A 1YEDB 3QFJD 3MO1B 1JWUB 4X9BA 5ISZA 3GJFH 3BIKA 1UADC 4Y4KD 3ARGA 5TE6H 1QYGH 3WSQL 4NWUL 4Z78B 3GMPA 1DQJA 4ODBD 2HFGH 3ZKSD 1F4YL 1T03L 4PGEB 5I1LA 3T3PE 4ELKB 4F7MB 3MCKB 4I0PB 1Y6KR 5F1KC 2V2TA 4G6JL 4JB9H 3HNSH 3ARRA 4XCNA 2FBOJ 3CXHK 3BP7A 5D9SB 3GJFB 5IW6B 4XP9H 2GSIB 5KSUA 1NCCL 1FZOB 4X6BB 3SJVA 3VRLE 1FL6A 3SDAA 4D9QD 5TDNB 2DMCA 4AENA 4M6OL 2OJEB 2UUDK 3UJTL 3RVUC 5KS9A 2OR9H 5GGUA 3RWEB 3MV7D 4NPYB 1N4XL 3ZDYF 3HAEG 4JO1L 4LLVB 4M03A 3OSKA 4W4OA 3O45B 4OFPA 4XVTH 5DR5L 3QBTB 3ECBB 1U8LB 4NNYA 1KLFA 32C2B 2UZXB 2NY4B 3JVGC 2JIXD 1AKJB 1M05A 3UTTD 3EGSA 2AW2A 2E7LA 3OKKB 5IVZB 4FQJH 4XGZB 5L2JA 1NCDL 2XNAA 1YYLL 4AQ1B 3PHOB 1DQQB 2EC9T 4NQEE 1LE5B 3BH9A 4R4NC 4KDTA 1FLRL 3RX7A 3SE4A 1DBJH 3MRQA 3V0AC 2JJUA 4C56E 4KMTL 2BK8A 4PRID 3ALWA 4JG1L 4BH7B 4DUWA 1JPTH 1NBZA 3P3YA 3QNZB 4JKKA 1SY6A 5INDA 3QXAB 3HG1D 4F8TA 4JHZA 1CD0A 2AK4A 4MB3A 2V5TA 2CLVA 2R1XA 1CDGA 4XMKL 2R0LL 3HC3L 3DMMB 3ARUA 3ELAT 1DFBL 4PJDE 4Q0XH 1OGTB 2Z92B 3IDXH 5ANMA 2J4WH 3S5LG 3IJHA 4E0RA 2CDFB 3SE3C 3U4EB 4O2EB 3VXTA 4JM2F 4MZ3A 2FX9L 3QWOB 3MCG1 3E3QC 2A1WL 4U1JB 3PABA 5EU7C 2W59A 2XPGA 5J56B 5JZ7C 4Y5VC 1QQDA 2E7MA 3FONB 3K4ZA 2IANA 4BKLB 3DUUB 2HLFD 5KW9L 1IAOA 3SDDC 3VGAB 2Z8RA 4I3SH 3OAZH 3U0PB 3O3DA 3TBSA 5DUBB 3UPRB 4YBLB 5FYLE 3LEXA 4JR9H 1U0QA 2IAMA 2ZOLB 4WFEE 3V6BR 4KTYA 2VERN 1JF5A 4I48B 3OKLA 4XVUC 1DLHB 5I16A 2X9YA 3ARTA 3DVIA 1F6AB 4Y4FD 4PJIF 5C0BA 1JNLH 1XF2B 3B9AA 4WU7B 1J1OH 5CINL 3VG9B 1FGNL 4NKMB 1HWHB 2GIYA 4F37F 1MAJA 5EUOA 2C3WA 3EZ8A 2Q87A 3VFRB 1I7UA 3QCVL 5F71A 5JOPE 5HGAB 1T21B 1WIPA 2BMKA 5FO9B 3LY6A 5L7XH 1QLEL 3OX8B 4QYOB 3BKML 2IH3A 2VB5A 4PGJA 5GXBB 4DCQB 1DUZA 3BRDA 2ATKB 3QIUA 2VR9A 4LSUL 3OR7A 5TQ2H 3VU2A 3D0LB 2WW8A 1CI5A 4I18C 3VWJA 2GHWB 4XBEL 4PJHF 4M1CD 3K7UA 3RI5F 4HUUA 2SEBA 2AEQH 1ZGLM 1AHWA 1RFDL 4M5YH 3QUYC 1IC5L 1ZT1B 4JO4H 3MV8B 1RIUH 3OPZL 3JSSA 3ULUD 2UZIL 4JHWH 1B0GA 2APTA 2WINB 1QLRA 1L7IH 1UXSB 1NEZA 5C09D 2A74A 1WBYB 1LD9A 4I2XE 1JN6B 1U8MA 1K85A 5IF0A 4PRPD 5HHOE 4JO2L 3PG2A 3S3JA 1FFNB 2KQNA 1JV5B 1HXMB 5KN5B 5CBAA 4QNPF 5K9QI 4HKXB 2H2SC 5IMKB 1LWRA 4Y4HA 3UTQB 1DTUA 1QRKA 4H5SA 2FJFB 1MIML 3SGJA 1F4YH 1ACZA 1T03H 4H0HB 1J8HA 5ITBL 4XI5D 1IGIL 3IU4H 3L3IB 3UROR 1W2KT 4G6JH 2BSRA 1DQML 5IROA 4U7SA 3AM8C 4YPJA 1LK2A 3PE9A 3TBVB 2F19L 2VLKD 5IB1A 1H15A 5SWZD 3MRBA 3DI2B 2DF3A 1V5JA 2IPKA 3F7VA 4XPTL 5A16B 5M94B 3V7AG 1K4DA 1MUJB 2QTEA 3L7EB 4LOUD 5H35B 4I3RH 5D1ZD 4KKBD 4YNYB 4BH8A 1B4RA 2OTWB 2HN7B 4KHTL 2ENSA 5IHZA 5CEXB 3CU7A 1F58H 3MCLL 3UJTH 1ETZB 1IAIM 1N4XH 4U7MA 2NZ9D 2LE9A 4WUUE 3QO1A 1P6AB 2J8HA 5ACMA 1G84A 2XY2A 4Y4KC 1Z3GL 4QTHB 5L9DL 5DMYA 5C92A 2VDML 4O2FB 4N0UE 4Z0XA 3BGMB 3V5HA 4OFVA 1T6WA 3GGWB 4IRSA 1U6AH 4UV7L 4TSCH 4XNMB 3T8XB 3O4OC 5L88H 4Y5VB 2J8UA 3D3VD 3FOLB 4KI5F 3SDDB 5HHPB 1EEYA 4DZBB 3GMRA 1HEZB 1SMOA 2E6JA 2VLJE 4OIIL 5GGSB 5IT2H 2IALA 4KTEH 1DSFH 2Y9RT 4OV6F 5CEYA 1ZVYA 3RVWD 3EOBB 1S7XA 2HP4A 4XX1E 3WJLC 1CDUA 5ISZD 2VZUA 1D5MA 3K81A 5FHAL 3U7YH 3KJ4C 3ARGD 1HHKA 5C0IB 4JQIL 4JRYE 5C6PB 5B8CA 7FABH 3HAEA 3BD3A 2BNQB 2JELL 4JKPH 1U95B 2R2CA 1NUNB 1HCVA 5F3BA 3ZKXC 1A8JH 1DFBH 3D18B 4NQXB 1OAZL 1FBIH 1RZJC 5DJ0A 2DIBA 1JGUL 2X7LB 1O7VA 4DGYL 1I9RH 2FX9H 3IDMB 1D6EB 4UNTA 1YQVH 3QRGH 4S2SB 4K3HA 2WIMA 3FFCA 4MA3B 1YJDC 3CXHJ 1LNUB 4QRUA 3SJVD 2A73B 3L3HA 2OI9C 2H6PB 1JNHB 4QT5B 3N06B 4HUXB 1CDCA 4G8IB 1Q0YH 5D6DC 4FQ1L 3K2MC 4IEFB 4OM1H 4I18B 3VXNB 1DVFA 1MEXH 5EBLB 5DD1L 1B9ZA 5E2JA 5CWSB 5DJ8B 3D85A 4BQ6A 4BZ1L 1VFBB 3D87B 3VE0B 1BMGA 2OLDA 3QUYB 4MJ2A 5CINH 3S5LA 2IBZX 1S9WB 1B88A 2CUMA 3RL1A 1U41A 4YDJA 3T3PF 3T0EA 4GRWF 1N59B 3FTGA 1MJ7L 3OXSA 4WNQA 4UT7L 5CILH 3ZTJH 5E9DE 1QA9B 4NM4H 3RUGF 3BKMH 2BVPB 3LN4A 3BDBA 1IL1B 2HLFC 3GIVB 3KPRA 5BRZD 3LKNB 5MERA 1BBJB 3ULUL 4JY4A 3DX6B 3GMQB 3VRLF 2XWBB 1R5WB 5E5MB 4OZ4B 1BZ9A 1OAQL 1NFIA 4R97C 3UBXG 1CFTB 4XBEH 3L95A 3LVEA 3WMSA 3NFNA 4NHUA 3U46B 2N4IA 2OP4H 2G2RA 3SDCA 1G7MB 4CU6A 1GHFL 4JZOA 4Y4FC 3RTQA 3NIGE 4P5TA 4A6YA 3I3DA 4UAOC 3MRMA 1XZ0A 1VGKB 3C5SA 1KG0A 2IADB 4PBWD 5LJYH 4MCZA 5C0EB 1TXKA 4ENED 5F7EH 1RULL 5SV4A 2R0KL 1ITBB 2QQQA 2YD5A 1GPOL 2BOBA 4KRNA 2UY7A 4Y4KB 2IAMD 4M6AA 1AIFA 3B9KA 4PJ7B 4Y16C 4K7PX 3K4DA 3KAAA 1OM3L 3DI3B 1YEGL 4XNYH 4F3FA 2X4SB 4KK6D 2X4QB 4KKCC 1KN4H 2MSPA 1J12A 5MEPB 3O4OB 5C0BD 1GGIH 4M1CC 2VLLA 4XCEA 4XPTH 2PUQT 1MJ8L 4U1NB 2BHYA 2YUVA 5AYQA 4OZIF 2EC9U 4PJDF 3ULUC 1RZJH 2V2WB 3B6SA 1ZWIA 4ZFGL 4B41A 2EDBA 1KCVL 5CKAA 1IGFL 4KHTH 5FAAA 1J86A 3ZHLA 2ATPB 5HY9B 1A9BB 3KJ4B 4HG4K 5I6XC 2GT9A 3QHZH 3TZVC 1NAMA 1YJDH 3RPIB 4H0IA 2W91A 3QIUD 2BVYA 3G08B 2NY5L 4NQDB 1NBYB 2ZG3A 2EEBA 3ZKXB 5L9DH 1EAJA 3IJYA 3VWJD 1H3TA 4PJEB 1NAKH 4H26A 4Y8AA 3DROA 1QVOB 1UVQB 4PJ9A 3QA3B 3UTTB 4ZFFA 4UV7H 4LAQL 3O6FA 2Y5TA 3BSZL 4JZNA 4PBXA 1RJZB 3DVNB 1NFDA 3MLVL 4KUCF 1ZT4A 2A6DA 1CQYA 1T89A 2OI9B 4S0SD 3L9RB 1CN4A 4OIIH 2PW2B 3MODH 3VCLA 1AXTL 4WEMB 4LOUC 5JLZB 4CU8A 1Q38A 5J13C 1ZHBB 4M8VA 1A1OA 4KKBC 4PRIB 3V5DA 5IESL 2OTPA 5DD3H 1BLNB 3O3AB 3QZWG 4Y4HD 1G7HB 3D0VB 1DBKH 1W0YT 3B2VH 2JELH 2UZYB 3K0WA 5LGKA 3HG1B 1IAKA 4LVHC 1J8HD 3TBTA 5FOJA 1YY8B 2NZ9C 3BN9C 4QXTB 4YEEA 1PZ5A 1JGUH 3G6AA 2MQ3A 5D96C 5SV3A 1CYGA 4HS8L 3PDOB 3EW3B 1BX2B 2A6JB 4X4MA 3S96B 3F6IA 3BFOA 3GSUB 1HN1A 3NOIA 4OLVL 4RQQA 5C07A 1QSED 2NY5C 1N5AB 4OJFL 4AEEA 3C60D 2FR4A 1YA5A 4DW2H 5L2KA 1FAIH 2DWDA 1E4KC 3JXAA 4ZXBA 4WI4A 4LCCA 3IGAB 3EO0B 3LDBC 5JIHA 4R97B 3RVWC 1KN2L 3HPLA 4LAJH 3TYFB 4DFIA 3C6LD 4Q6YA 4AK1A 1FNEA 1BWWA 4BZ1H 3CC5A 4NHCH 3ARGC 2F58H 5DUPH 5EULV 2AJYH 2ICWJ 3L6FA 2A83B 4MDIA 4Y4FB 1MCIA 3K8MA 4IRSD 3P11H 4UAOB 5E7BA 1WGOA 1X4ZA 4ZO8A 1MJ7H 1I1RA 4YXKL 5IMMB 2IGFL 5MI0C 1ZMYA 4GG8A 1B0WA 5D71H 1Q9LA 5J1AA 1JFQH 4NZDA 4NRXB 3GSNA 4QOKA 3SKOB 4YDVB 3TFKD 3SDAC 1FYTD 3B9DA 4Y16B 4GG6F 1DQDL 1XIWA 4O5LL 2V9TA 1S7QB 5E24E 3V52H 1RZFL 3CDFA 4P2QA 5E6YA 3TIDB 4PP2A 2EIZB 4W4OC 4MX7B 4CADB 5FYJD 1YECL 1G9MC 1E4WL 3DX9B 3MOQA 1SYVB 5F7WC 2Z4QA 4N5ED 2CD0A 1KPUA 3H7LA 4CNIB 4I77H 5F89B 5GGRB 5C09B 2E7LC 3FFCD 3PQYA 4UV4H 1C5DA 5IBUG 1CDJA 1MCOL 4JJHA 3VDCA 2NXZD 1H3WM 1UH3A 3MRNB 2J5LC 1VFOA 1RZ7H 2A9MH 3GMLA 4PRPB 3WNMA 5I6XB 4YHMH 3TZVB 5DFTA 4OIBA 3HC4L 4KDTC 3T77B 2LU4A 5CBEA 2BSTA 1WWCA 3EOTL 3SE4C 1L0QA 3X3FH 2YXFA 5LXGH 1DANU 1GPOH 4AL8L 3RWGA 1MFDL 2IF7A 4XVSH 5JW5A 2PYEE 4RMTA 3UBXA 4MA7L 3D85D 4X4XA 1FFPB 1OM3H 4MA1B 4KRMB 4LQ1A 4HUMB 5IQ9A 3B3IA 2G9HB 4XMLL 5I1CL 2EH8H 3V2AR 2OK0L 2VLKB 1PAMA 4G9DA 5IK3A 1FZKB 1S7SB 5SWZB 3K46A 4HV8A 5I17A 2FHCA 5D7LA 4LDOB 5HDBF 2XFXB 4U05A 2KQMA 1TCRB 4ODHH 5I1AB 4XNXL 1EX0A 5HBBA 2GFBA 5J13B 1JGLL 2AERT 1IGFH 3TVMA 3PP3H 4HLZG 3H8NA 4G8GB 4L9LA 2RJMA 2P8PB 4JFEA 3DO3A 5C7XL 5JOFA 1Q9OA 5EOCJ 4TUOA 2NY5H 1Q94B 3GI8L 4LVHB 1KIPA 4ENEC 5MHSD 1A3LL 1JHTB 2X1XR 4OBRA 4PS4L 2DKSA 5HVFB 4ZUWB 3QXDB 4LEOB 5T1MA 1KIQA 2IAMC 3S3SA 5D96B 2IH1A 3BPCA 1DCLA 4LAQH 1HH6A 4GFTB 2VZ1A 1U8HA 3MRPA 4XBPA 1B0RA 2XIDA 1G7PA 4KK6C 3T2OA 5JA9A 2GYSA 3MV8E 5ERWA 3RTQD 4HT1L 4P5TD 3TV3L 4HHAB 4BFBD 2QSTA 2MCG1 1A7QH 4B5EA 5FUCC 2CIKB 4L4TB 3LDBB 4BYHA 3L3JB 2BVOA 3U4BL 1NUFA 5ISZB 3BIKB 3H9SE 1F42A 3ARGB 2DLFL 5KVFH 1ODAA 2K3TA 4PJAA 3VXPA 3GMPB 1DQJB 3QIUC 1I1CA 5I1LB 5EIQA 5KVGL 2E9BA 2FLBT 2V2TB 3VWJC 5I8OH 1UZ8A 4K7PL 3N85H 4NCDA 4XCNB 5DXWA 4Q97A 1AO7E 1X6LA 1AHWC 3BP7B 4DN3L 3QDJD 3EHBD 1S8DA 1KOAA 2X4OA 1G9MH 5KSUB 4J3OC 4Z7VF 4Y19A 3UC0H 3WXVL 3CFIC 1KTRL 1FL6B 3SDAB 1FFQA 2B2XL 2BDNH 3E6HA 4AENB 1MLBA 2E6QA 1BD2A 2NLJA 4S0TD 3QZWA 4NYLA 2EDFA 1HE7A 3O81A 5KS9B 1EXUA 2XQBH 4NN5C 4OFKA 4U6HA 5GGUB 5F7HA 1EJOL 4HG4J 2AGJH 3GB7B 4Y4HC 4G7YL 4NNYB 3SGJC 1M05B 4YXHL 4FQ2H 1ACYL 3O6FD 3EGSB 5H94A 1ZVHA 1XCQA 5IROC 1PX4A 1N0XH 1MQKL 1UACL 3E3QE 5L2JB 2DQJL 2XNAB 3FMGL 1SY6H 1XAUA 4S1SL 2J5LB 3BH9B 2IGFH 1CG9A 4NUGH 3RIFK 3W9EA 3TEUA 1X44A 1V8HA 5JW4Q 3MRQB 5F7FA 1Z0NA 1JYXA 3MJ7A 5D1XA 4YHNA 5FYJL 1SQ2N 1CLOL 1T6VN 2V2XA 4HK0A 5A2JH 1CGVA 1RAMA 3VDBA 5EWIL 1NBZB 4KKLC 2BJMH 4QRPE 3IXTA 5IBTL 1P53A 5C3LD 5INDB 1NLBH 4R8WL 5EC1A 4AEIH 2AK4B 2BNQE 2D4DA 2CLVB 2R1XB 5C08A 1D5IL 2VDNH 2CRIA 5JNYA 3O8XA 1CXEA 1LDPL 1U93B 5ANMB 3R0MA 3IJHB 1T7ZA 4E0RB 1LO0L 2R15A 2XQYK 2H32A 3VXTB 4IRSC 3MRJA 3ZSSA 1MCOH 3PABB 3RDTA 2XPGB 3HZMA 1MOEA 1QQDB 5CZXD 2IANB 1TNNA 4LLQA 1IE5A 1LO4H 1IAOB 3C08H 2X10A 5L2KD 4ZXBD 4B50A 2HTKD 4AL8H 3O3DB 1RU9L 3TBSB 5D72L 3LEXB 3MOAH 1FH5L 4OLZH 2IAMB 3TFKC 1SYSB 3V79C 5IFAH 3OKLB 4NKIL 2W0LA 1BGXH 3MREA 2OMBA 4N0RA 5CUSH 1W0WA 4XCFL 3SDXA 5I16B 5B8CC 3TT3L 2BRRL 4M48L 2J6EA 4Z7NE 5ID0A 2OK0H 4NC1C 1EEQA 3WEXA 1FVEA 5LGHL 4L1HA 1A02N 1D5ZA 5BS0A 2C1PB 4PREA 5EUOB 1ZLVK 1CICA 4ZUUA 5CGTA 4N5EC 4PJBA 1I7UB 4M4RA 1NKRA 1TQCC 2BMKB 2FBJH 1H0DA 2NXZC 4KKAD 2IH3B 1UKQA 2GJ6E 2MWCA 4QOKD 1DUZB 4XPAH 3GI8H 4HH9A 3BWUC 2EDQA 3QIUB 2AVGA 1YNKH 1XIWD 2Y4SA 4XB7A 1JRHH 3OR7B 3FO9A 4KPHL 5C71A 3HI6H 5FB8A 5HDQL 1WIUA 5IVNA 3GRWA 1DVFC 3VWJB 4P2QD 1HHHA 4OZHB 1HWGB 4HUUB 2SEBB 1NGQL 4Z7OE 1AHWB 3UAJD 1J0HA 4G6ML 4X6DE 1B0GB 3BT2L 4JPWL 1QLRB 1NEZB 4HGWA 1XGTA 1Z2KA 2P43B 3PQYD 2A74B 1KBGH 3T0EC 1ED3A 1WBXA 1LD9B 1U8MB 1G7QA 5IF0B 1ZLUK 2F15A 3RVXD 2ZUVA 5EU5A 2E27H 4K3JL 4YX2L 4NN5B 5CBAB 3LCYA 3QFJE 2AXFA 3EDDA 4Y4HB 2DLFH 2JCCF 5GRJH 4H5SB 2I24N 4GH7B 4PJ7E 1J8HB 5HYEA 5HGGS 4RRPG 1FAKT 2XA8L 1A14H 2JE8A 3TPKA 1LK2B 3F12A 5GPRA 5DD6A 5IB1B 1H15B 3MRBB 3QDGA 1NAML 2F54D 2IPKB 3F7VB 5D7LD 3SDCC 1I9JH 1K4DB 2XTJD 1OB1A 3RTQC 4BQ9A 4MQ7A 2I9LA 4P5TC 5GZOD 4YO0A 4H8WL 4BH8B 3O6ML 2Z8VC 3TVMD 2D31A 2PNDA 4D9QE 4NC0B 5IHZB 2RR3A 4JFED 2XYCA 1EJOH 4NQDE 3QO1B 5ACLA 3S7GA 4MB5A 1ZHLA 1T0NA 3SEPA 3L3OA 4NN7C 3QRFM 1BECA 4OAWA 4L8BA 4PJEE 4BSWA 5EU4A 4HIJA 2F53A 4YXHH 3B9KC 4Z0XB 4RDQG 5F7KC 3V5HB 5FOBA 4BZ2H 3UTTE 4IRSB 5F9AC 4HWEL 1EBAA 3SGEH 5I19H 1PDKA 1TITA 2J8UB 1QHPA 5GRUL 5F7LB 3HAEH 4FQIL 1AGFB 4XP4H 1N8ZA 1EEYB 4NZTH 3GMRB 3CNKA 2EKJA 3D1MC 2CO6B 4P5MA 1B2WL 4UOJA 3EHBC 4TUJA 2IALB 5CEYB 1T80A 4PRIE 1WFNA 3MJGX 2ADJA 5EWIH 4P2CG 1D5MB 2AAVA 2P48B 1BVLA 1HHKB 2AQ1A 5IHBA 5B8CB 3NZ8A 3HAEB 3A67L 3GKWH 1KFAH 3HG1E 5F3BB 3DETD 5L8KB 3NZHL 4Q9QL 4RBPK 1D5IH 3JTTA 1DQLL 5HHVL 3WE6A 2NY1D 3PDGA 5DJ0B 4K94L 3GHBL 4PJ9C 4PB0L 2DQCL 3N1MC 3QDMA 2Q7NA 2NTSP 3O6FC 1TQCB 3ZDZE 1S9KC 1MCPH 3FFCB 4MD5A 5JDJA 3GI9H 3ES6A 5I15H 1J9CT 3QEUB 2NXZB 3L5JA 4QRUB 1IQWL 1T89C 3L3HB 4KZDL 5DTFA 4P3CL 3MOBH 4OKDA 3INUH 3P0VL 1RU9H 5D72H 3CSBA 1DVFB 1X5YA 1XF4A 4NKIH 3AUVA 1HH9A 5B22A 3PWNB 2WQRA 2BRRH 5DZNA 5HXMA 1UXWA 2ZCLL 3GUTA 2X89A 5IMLA 3MUJA 4M3KB 1BZ7A 1J1XH 2ZJSL 3GSNL 3S5LB 4ZNEE 1G7IA 2QBWA 4ETYA 3RL1B 2Y6SD 2Q86A 4YDJB 3T0EB 3FQXB 4U1MA 2W0PA 5JHLH 4NCC2 1O5DT 4X9GA 3FTGB 3OXSB 4WNQB 2HT2C 5DDHA 3KLHD 1V7NL 4M5ZH 3LN4B 5D1XD 5A3ID 5CZXC 3LKSA 1BJ8A 1WAAE 4OCSL 4I5BA 4UB0L 2QSQA 3KPRB 4JFHD 5MERB 3NCCB 1E0OB 1CXLA 4ZXBC 4A6YH 4LCCC 4JY4B 5CEZD 2HTKC 3HMXL 2B1AL 5HDQH 2X6MA 3ZE1F 1BZ9B 1NFIB 1ZXQA 2IJ0C 1UB6A 5FYJU 3L95B 3H9HB 5C08D 2ICWI 2C3HA 3NFNB 4NHUB 2G5BA 3VJ6A 1X4XA 1NGQH 5DRWA 3O8XD 3SDCB 5AUMA 4G42A 4JZOB 3RTQB 3ULUE 4P5TB 3CVIH 4NOBA 1CGWA 4JQVA 4NNXA 4A6YB 1MRDH 4FP8L 5C09E 3MRMB 3NN8A 4O9HH 1XZ0B 3QG6A 3RDTD 5IW1A 5CSZA 3C5SB 1KG0B 1MF2H 4MCZB 4P3WA 4PRPE 4LFHG 4JCLA 3RWJA 4YX2H 5DGRA 1K3ZA 4PGBA 4KKAC 2BOBB 2VITA 1YPZA 2WBWB 4JHBA 4NN7B 4U0RC 35C8L 1AC6A 1HZHH 1AIFB 1UYWH 5EUKA 3FB6A 3B9KB 3W11C 4FOMA 1XIWC 1X5FA 5F9OH 5JIKA 3S35H 4F3FB 2VDLL 4EOWL 2ILLA 4Y1AA 4TULH 2VLKE 1DN0A 2VLLB 4XCEB 5SWZE 1VHPA 3FO0L 5BS0D 4OGYL 4F33A 1SJEA 1CGXA 5H37G 3B6SB 1ZWIB 4PY8J 5C0GB 4KVNL 5EPMA 5T5FL 1WT5A 3VFVA 1B4JL 3S88L 3FHAA 1NSNL 3WFBH 2IPUK 2GT9B 3KPSD 3BDYH 5EIVA 3RVXC 3LQMA 3FRPG 5DEGA 5F1NA 3TH2T 1F3DJ 2HAZA 2W9EH 1A7RH 1HNFA 3IJYB 3T4AA 4RRPA 3RA7L 3LSOA 4H26B 3X12A 2VZSA 1JF6A 3DROB 3MNZA 3WYRA 4PJ9B 5JQHC 4HAFA 4ZFFB 3O6FB 2Y5TB 2DIJA 2X70A 4JZNB 4HWEH 1NFDB 1LE9A 1CTOA 4EZMA 4LRIA 3ZTNL 4Z76A 1ZT4B 3SPVA 2DQUL 3D3VE 2A6DB 4PD4K 4GO6B 1IC4L 3R06A 2VYRE 2XTJC 1MCDA 3VCLB 5GZOC 1A1OB 3TVMC 3V5DB 2KBGA 2NY6D 4GXVL 3B9VA 1D9KA 3O2WH 5ISZE 3A67H 1Q8MA 3W81A 1IAKB 1G7JA 3TBTB 3H3BC 3KPNA 1PZ5B 2NPLX 3G6AB 4J12A 1YMMA 3OKYA 2DI8A 1LO5A 1WFOA 5L6YH 2YUZA 3QDGD 1JCKA 2C26A 3KHQA 4QF1A 5E7FA 3T0BA 4ELMF 3MJ9A 1VFMA 4XCCL 3KYKL 1UM5H 4RQQB 1I4FA 5C07B 4KZDH 4P3CH 3SJVE 2FR4B 1OAKL 5L2KB 3P0VH 5FGBA 2DWDB 3L5IA 4ZXBB 4LCCB 3UJJH 5I71C 3JTSA 1LEIA 2FH8A 3KLAA 3HPLB 4LBEA 4DOHB 5KS9E 1AR2A 2CQVA 1XFPA 2BSSA 4R2GD 1OHQA 5DJXA 4TSAL 3ARDD 1FNEB 3NAAL 3WIFA 2FECL 4WHTB 3CC5B 3ZHKA 1LEKA 3OKEA 2F53D 3EZJB 1VERA 3L6FB 1R3KA 2ZJSH 4MDIB 3GSNH 2P8MA 3DSNA 2HWZL 2CXGA 3OHXA 2O5YL 2NY1C 5CEZL 1X5HA 2VAAA 5SX4H 2NW3A 2FRGP 4HULB 3D48R 5J11C 1FL3B 1YEEL 4X9FA 3R8BB 2CR3A 3E0GA 4K23L 2ICES 5HHMD 3SGEI 1A6UH 4GG8B 1QNZL 1Q9LB 5J1AB 2WUCH 4K9EL 1HHGA 5FA4B 4UB0H 3GSNB 4QOKB 2VZTA 5I1JH 4U0RB 5BRZE 4XRCA 4CN1A 2B1AH 5FYKD 5GRWA 3L5WA 1XIWB 4EXPX 2AKRA 2VXTL 4V1DA 1CVRA 3QEQA 2Q1EA 1WJ3A 3IKKA 2YK1H 4PP2B 3WFDL 3QIBA 2AJVH 2BERA 5F21B 5ANME 5KVDL 2Z4QB 1E4XI 4BK5A 3C2AL 3QDMD 1KPUB 4PJEF 1CGUA 3BI9X 2QHRL 3UTOA 3PQYB 2DM2A 1C5DB 1T2QL 5ALBL 3MGTA 1NBVH 3QJHA 3BP4A 2J6EL 3GMLB 4RISH 3LN9A 5CBEB 2BSTB 3KLHC 3E8UH 3VA2C 4GKSA 3MLSH 3R1GH 5D1XC 3RWGB 5A3IC 2HJLA 4JM4H 3QHTC 3OAYH 1JHLL 3FHQA 4K7FA 5EIIA 2CJUL 4KK8C 5JW5B 3UBXB 4Z77A 5I1EH 4X4XB 1AQKL 4MJ5A 3RY6A 4ODXB 4JCMA 4MJ4A 5IQ9B 3B3IB 3C5JA 2X89D 1A1NA 5C0BE 4G9DB 1B3JA 5IK3B 3NVQA 2F5AH 3ARPA 4HV8B 4GMSL 3O8XC 5I17B 5D7LB 1JGVL 5EUOE 3DSFL 2XTJB 5FUCE 3D25B 1FSKC 3ZYZA 2GFBB 4WWID 4L3EA 2DJSA 3GRWL 3TVMB 2YZ1A 4X6CF 4KK9C 3RDTC 1NSNH 3H0TA 3ZDZF 2BZDA 2X09A 2AV1A 4JFEB 5JOFB 1FC2D 1IGML 2YPVL 3IETA 5IBLD 1Q9OB 4TUOB 2DTMH 4WI8A 3MBED 6CGTA 2X4RA 3BZDA 1JYVA 5HYIA 4NM8L 2FEDD 4HF5L 1XEDA 4Z7WA 5T1MB 1KIQB 2IH1B 1JZ5A 5I74C 3DRQA 3BPCB 4JJ5A 4XNZC 4YPGA 1HH6B 3LEYH 1CK0H 1KV3A 1U8HB 5IJKA 1YEIL 3MRPB 1BJ1H 1B0RB 4XBPB 1G7PB 3AROA 4JO3H 3RX8A 3SGDH 1SHMA 5ADPL 2JJWA 5ERWB 2YRPA 1S9XA 5DQ9A 1IC4H 2R2BA 4DGIL 1CICC 4GOSA 2Q6WA 2P1YA 3MACL 2R69H 2BVOB 3TM6A 5GRYA 2QQLH 3FRPA 4NWTH 3HNTL 3MYJA 4PJAB 5FGCB 1QRNA 3NTCL 3VXPB 2JB5L 4CN6A 1HXYA 1J8HE 1XGYL 1DBAH 1LP9A 3RI5K 3MPCA 3K8KA 2E9IA 2NY1B 4I1NB 4Y1AD 1J88A 1UZ8B 1EEZA 3BX7C 3IDIA 2RCSL 3GM0A 3QIWC 5EH1A 4P99A 2BY3A 2OCFD 5F9JA 3QQ4A 3BGFC 1S8DB 4NRYA 2X4OB 1TZGH 4OSUH 4Y19B 2WK2A 1O7SA 1QBML 1CIUA 4NQCA 4IRZL 3E6HB 1MLBB 5BW7A 5D2LF 3T0DA 1BD2B 2NLJB 4XCYB 4NYLB 3VI3E 2NY6C 4OF5A 1EXUB 4U6HB 5FCSH 1HK6A 1EO5A 5ILTL 2XQYG 1ZLSL 4ZD3L 2OR8A 3MUZ1 5TJWK 4LCYA 5JTWA 4OZGA 2IG2L 1R6VA 4GAFB 2HWZH 1T2JA 3QPQC 1T7VA 1X5KA 3BESR 5H94B 1XCQB 4C59B 5EBWA 1QLFA 4QEGA 2J8UE 4N0CD 1CXKA 4M61A 1X5JA 4FQQA 5JXAL 1CG9B 4LHQB 3W9EB 3OL2A 3KG5A 4PD4J 3MJ7B 5D1XB 4YHNB 1PGRB 3V0WL 1TVHA 4PB9H 2PO6D 4HK0B 1FYTE 3DHMA 1D9KD 5C0ND 5D7IE 1MHHA 2MPAH 2VXTH 3DX8A 5CZVH 3IXTB 3RWDA 5EC1B 4N68A 5JR1L 1WSST 3B8YA 1JWMA 3O6KH 4NC1E 5C08B 1AH1A 4R2GC 4YIQA 5MEND 5JNYB 1YMMD 4BELD 3O8XB 5FYJE 5KVDH 4O58L 5EORL 1FSKB 3VXSA 2D7TL 2H32B 4KQ4L 4UNUA 2F74A 2AJUH 3HUJA 3MRJB 4WHCA 3FFCE 1EERB 4L4JA 3RDTB 3HZMB 1T1ZA 4Z9KB 4LLQB 2W92A 2DMBA 1BQHG 3IYLW 2YD8A 2Y72A 5KG9A 5E03A 3ARED 3WJJA 1HYSD 3PUCA 1JHLH 5JXEA 2H2PD 5GS2D 4RA0C 1SEBA 1KJMA 5I74B 8FABA 3MREB 3PL6D 4XNZB 3OR6A 1NL0L 3SDXB 1W0WB 4PJ5D 1PKQA 5KTEH 2WBJA 5ID0B 1W8NA 3ZKMD 4ONFH 1J0ZA 3RFZC 4LCUA 3WEXB 2XZAH 5D6CA 1FVEB 4GMSH 4P48A 2BP3A 4RGND 1T4KA 3IFLH 1D5ZB 1JGVH 4MA8H 5BS0B 4PREB 3DSFH 3HA0A 1CICB 5C70A 4ZUUB 5BZWA 1MJUL 4PJBB 5JOEA 3KPPA 3GRWH 5IBUB 4CKVX 2I07B 1H0DB 1NFKA 4IOSD 2R4SL 2X9WA 5J9PA 3FB5A 1J0IA 4HH9B 5E70A 1GAFH 4DK3A 5MHSE 4NM8H 2JJSA 3JUYA 4HF5H 3FO9B 3K1KC 4NRZA 5FB8B 3S37H 5AAWA 4H88L 3QEQD 1LK3L 1KB9K 2DD8L 1J8KA 1HHHB 4HLZH 4YXLL 4NSKA 3QIBD 4P9MH 1CIDA 3FZUD 4LSTL 5KS9F 3QIWB 1PSKL 3BGFB 1T22A 3I75A 4HGWB 1XGTB 2HRPL 4YHLL 3QUZA 2MKLC 4RWYL 1ED3B 1WBXB 2MFNA 4OB5H 3PWVA 4ODTL 3O3BB 4OCYL 2Z31A 1G7QB 3WD5L 5CJXA 2X05A 3MACH 4NKDA 5EU5B 5I9QC 3DYPA 2NY6B 2AXFB 4LLDA 3NTCH 5EU3A 2AEPH 5IBLC 5K9JL 5ESAA 4NC2B 2UV3A 3CMOL 2FEDC 2J8OA 3OKOA 4J6RL 2DQDL 3F12B 5DD6B 3KPTA 3WIIH 2CK0L 3QDGB 3I3BA 5F6HI 3SKJL 3LB6C 1OB1B 5E6IB 3QDJE 4MQ7B 2I9LB 2OSLA 5T3ZD 4L3ED 4JQVC 5FUOL 2ZWLT 2F5BH 5FKPA 4XPFL 2EEAA 4OLUL 2D31B 3PWLA 5EC2A 4ZYKA 1MLCA 3JBG7 1CD1A 2DM3A 3C2SA 4XP6H 3U9PL 1YEKL 4APQA 2H8PA 1CFSA 1R0AL 1TNMA 3IJSA 3LH2H 3TJEH 4R2GB 4XAKD 1ZHLB 1HSAA 1T0NB 3L3OB 2IG2H 3NMEA 2BVUA 2CIIA 3O3UN 5T1KA 4OAWB 4L8BB 4BSWB 5EU4B 4HIJB 2F53B 1K6QL 4HIIA 5EO1A 5FOBB 4UOW0 2Y7QA 3SCMA 3WS6A 4I0CC 5FYKH 5B21A 3P0YH 1JF1A 3EOYG 3V7AE 3IDJA 3ARVA 4PY8I 1TVDA 5IW3A 5HI5D 1U8QA 1N8ZB 2D7OA 4P5MB 4YUEL 4TUJB 1QBBA 4FFYH 5IFHL 3EYVA 2ADJB 4PRNA 3WUWG 1WT5C 5KSVA 4B7LA 1S9YA 1BVLB 3MJ9L 2ED8A 1AGDA 1QRND 3EBAA 3KHOA 3VWKA 1QP1A 3NZ8B 3KWWA 4UT6L 1UJ3A 2BVTA 3CJJA 2H9GA 4GAGL 3JTTB 4WW2A 3TO4A 3CU1A 3WE6B 2R0WL 2VDPL 4GSDL 5ETUA 3BUYA 3AU1A 3QDMB 1ORSA 4KTDL 1OW0A 1MAML 4X4ME 3S36L 4OZHF 4MD5B 5CD5D 2ZSVB 3ES6B 2VRAA 4LRIC 1JVKA 1T3FA 5DTFB 1LILA 4RMVA 1QTYT 4GUPA 5L2KE 4D0BA 4NQCD 1M7IA 1CGSL 2F8OA 5EOCL 5D70L 2MHAA 1L0XA 1RZIA 1NJ9A 4LHUG 2X4TA 3NH7L 1I1AC 2VZ3A 1ND0A 2QADC 4LDEB 1HH9B 2FGWH 1OD7A 3A6CH 4GQ9H 1D9KC 4FZ8L 3A6OA 3WFHA 4YHPA 2EC8A 1UXWB 1NCTA 1EHNA 2ITDA 3GUTB 2QQKH 5IMLB 4AEHL 4Z8FL 5FO7A 4HPOH 2D03L 1G7IB 2DLGA 1SJHA 5DSCB 4U1MB 1VEMA 2DQTL 3TH3T 4PJGA 2WZPD 1HCFX 2WWMC 5AZ2H 5CCKL 5DDHB 4XC1H 5I9QB 4DKFL 1BQHA 3MFFA 1Z9LA 1KXTB 3LKSB 5FM5M 4W68A 1JPFA 2OZ4L 3GMOA 5FYKU 4QOKE 4HQQH 1FFRA 3TGXA 4I5BB 5FGBC 5B3NA 1HYSC 4H88H 1BHGA 1UB6B 2H2PC 5IGXL 2VABA 1OSPL 4YXLH 4P2QE 2G5BB 5HDLA 3VJ6B 1OQOA 3NCJL 4LSTH 3VI3F 3H2WA 3P40A 2B4CC 5E99H 3FQNA 1NCAL 1PLGH 4NZRH 3KJ6H 3BKYH 4R4BA 4G42B 5AUMB 2YA1A 3VXSD 4NNXB 2AJXH 3NCYP 2HRPH 4YHLH 2IPUG 3FT3A 3ARYA 3NN8B 4RGNC 1JGEA 3QG6B 3PQYE 4U4BA 5IW1B 5CSZB 1QHOA 1WZLA 4OCYH 1LDSA 1MPAL 3WD5H 1YDPA 1J5OH 2J8UF 4YFDB 3RWJB 5IB3A 4PGBB 4ODSH 2BC4A 3MXWH 5LBSL 2VITB 5JXED 1YPZB 1FNSL 1A2YA 5EUKB 4PLNC 3FB6B 3CMOH 1OP3H 2V17H 5T3ZL 5K9KA 2WBJD 4J6RH 3HRZA 4FFZL 2DQDH 4Y1AB 2DKMA 2CK0H 2XG4A 1DN0B 3QIBC 3FZUC 5IVOA 1WCBA 5DF0A 5D7LE 2D7NA 1VENA 1FRGL 1GZPA 2WM0A 2XTJE 3MNWA 4C4KT 4F33B 1SJEB 1CU4L 4NFCA 4NQUA 3O0RH 1I9IL 4QHNA 1YNTA 3P9MA 5EPMB 3NFSL 2B0SL 2ADFL 5JUEH 3VFVB 4ALAH 1MIEL 5LAXA 4JFEE 1VA9A 5EO9A 5IM7A 5DS8A 5KVEL 1X9QA 5DEGB 4B0MM 4KY1H 5EZLA 1JPST 2RGSA 3OXRA 4LCWA 2I60H 3BP5A 3T4AB 1EA9C 3LSOB 3V4VL 4GMTL 3X12B 3ULVH 5DMIL 3MNZB 3W39A 3U7WH 1M4KA 3RY6C 1H3XA 1MWAA 2WWKO 1OP5H 2X70B 1QSZA 1LE9B 4TNWK 1J1PL 4Z76B 3SPVB 4PRDA 3BD5A 2BNUA 4NGHL 1IVLA 4M00A 3QUZD 4U6YA 4PJ8A 4C4KO 3R06B 1L7TL 4TVPD 2Z31D 4OLYL 5IFHH 1TJIH 4QGTA 4S1DD 1G6RA 4X99B 2R29H 1I1AB 3OJDA 2QADB 1KULA 5DRNA 5IKCA 1J0KA 1D9KB 3MJ9H 4F80A 4JRWA 5EN2A 1P4IL 2XZCL 4UT6H 1GGBL 2Q3AA 4WJ5A 1NANH 4GAGH 1G7JB 2VXQL 1WZ1L 3KYOA 3NACL 3IDGA 4MAYA 3CSPA 2EICA 3GO1H 3ABZA 1YMMB 1IKFH 4NP4L 1LO5B 4P2RA 1BFSA 1DBBH 4MYWB 5GS2H 4QF1B 4FXLA 4TQEH 5IJKC 4JY6A 5DZOA 1JMXA 4LSRL 3QQ9D 5C2BH 3F7PC 2B4CH 4MVBD 4NFBA 1I4FB 4XPBL 4PJCA 3U4AA 4RFEA 1WIOA 3CFBA 4QO1A 5E4EC 2A9NH 5TF1L 4DTGL 5D70H 4N8CL 4PRAB 4HJGA 2GQHA 3JTSB 1AFVH 3WUWA 1LEIB 3KLAB 1H8OA 4LBEB 2BSSB 4HW6A 4FZ8H 3BO8A 3WIFB 4F9LA 5T1KD 1LEKB 4KZEH 4NJ9L 2VISA 4Z8FH 1R3KB 4OQ1A 2P8MB 5LWYL 3LKQA 3KR3L 1EEUA 2VIRA 3OHXB 1RZKL 3MGOA 3LHPH 4NKQB 2VAAB 2NW3B 1UQSA 4RGMC 3RBSA 5C0CA 5JA8B 4DKFH 5IVXA 2BHUA 5CD5C 4OD3H 2H1PL 2XZQH 2BNRA 4AIXA 1HHGB 3VD4A 3W5MA 4OI8A 1KTDA 4LPYA 3IDNA 5T5NF 4JFHE 3MZGB 4XRCB 5CEZE 4LHUA 4ZOBA 3L5WB 4CUCA 5BW7C 2AKRB 5IGXH 1N6QL 4V1DB 3QEQB 2HVJA 5C08E 3REWA 4FABH 1QFOA 1FG2A 1NCAH 3QIBB 2D7PA 1A6WL 3HB3C 3RIAF 5ICZA 3EYUH 4LSQL 4P5KA 4L9DA 3CCHA 3PXJA 3CX5K 3MGTB 3AAZA 1MPAH 4FMKA 3QJHB 3BP4B 3VFWA 1RURL 1NFDF 4QRQA 4HIHA 4DEPC 3MLXL 5EZJA 3Q3GA 3BPLC 4GKSB 5F8RC 4PJFA 1Z9SA 2PF6A 2HJLB 5HHXL 4BQCA 1J18A 5EO0A 4K7FB 3S8WA 1R5VA 5EIIB 3L1OH 1OTTD 3HZVA 4Z77B 4MJ5B 3B5GA 3SDXE 4NKOA 2X4NA 1IGCL 3B2UC 3C5JB 4MHHG 1F2XK 4D3CL 3Q6FA 1A1NB 5FDYA 4WI5A 3QJFA 5BS0E 1ZEAH 4LPCA 1KTKE 4PP1C 4PJBE 5C3TA 3Q6GL 4JPKL 1PG7H 4XVJL 2R8SL 3VMNA 3MV9D 1IQDA 1MIEH 3H0TB 4POYA 2VXSL 2IQ9L 1INDH 2AV1B 2PYEA 3IETB 3KPSE 3QULA 4OCRH 3EUUA 1X5XA 3I85A 3WJJC 3MC0A 3IAPA 2X4RB 4L8CA 3C5ZD 5I73C 5H37H 2J88L 3JZ7A 4Z7WB 5JXEC 3EIFA 2C7UA 4G8FA 1HI6A 2BXZA 1WEJL 3T08A 1JGDB 1S78D 4JJ5B 4YPGB 1TETL 5CGYD 2CKBA 2XKUA 1NC2A 2WBJC 3V95A 3IF1A 3GNML 2HKFL 3THML 5LG1A 4OD1L 5TE4L 5LCVL 1JZ8A 2Q8BL 1ZTXH 1S9XB 5DQ9B 2OYPA 2R2BB 2FB4H 2W65A 4M02A 5E4EB 2DKUA 2GCYA 1U3YA 2ZPKH 2Q6WB 1BQUA 5EU6A 1A3QA 4X9HA 3GJFK 3B43A 4X7TA 4I0KA 4I13B 4X7EC 5E5UB 4DN4L 3T1FA 5F6IC 1KB5L 1GGBH 3MYJB 4KDVA 1QRNB 4S11A 4BQBA 1HXYB 4LARH 3I50H 2JJSC 3V4UL 2YN5A 4XPHH 3O2VH 4HMEA 1LP9B 2FEEL 5E8EA 3QG7H 4FRWA 1HQRA 4YQXH 4EN3A 1EEZB 3LIZL 5FM4A 4RGMB 1MFBH 1T20A 1WCQA 3IDIB 1M1SA 3U9UB 3QDGE 2BOCA 1UWGL 2X9XA 2R1WA 5F9JB 3OZ9H 3QQ4B 4OTXH 4QGYA 4DKDC 1CFVL 1BZQK 4NRYB 4XPBH 2C3VA 1X7QA 1JPSH 3QUZC 3H9SA 2HKHH 4DTGH 4NQCB 5HYSG 1A6VL 2Z31C 3A6BL 5CJXC 3UZVB 2VH5L 2B20A 5C6TH 5EZOL 1IZJA 5HGHA 3C8KA 1T1XA 4LCWD 4HK3N 4NJ9H 4NIKB 2QQNL 4WFHD 4LCYB 4DZ8A 1IZKA 4OZGB 1KLGA 4XNQB 1ZVSA 1AO7A 5I75C 2F53E 4CAGA 5I0DA 1ZANL 1IT9L 2NTFA 4BSJA 2ZUQC 2Q20A 5EBWB 4HXAH 1QLFB 3MNVA 4M61B 4FQQB 5EOQL 4DUVA 4DEPB 5HHME 5ADOL 4Y5YA 3QQ9C 3BPLB 4E41A 1QFPA 3CSGA 4MVBC 5A43C 4K3DH 5B38G 3GBNH 2GSGA 1T04A 1TVHB 2XTLA 4MWFA 5J57B 3LMJH 1P7KA 5DJCA 5FYKE 5KANG 1MHHB 3DX8B 1AGBA 3LV3A 4P2OA 3RWDB 1BM3H 4APQC 1MCFA 1JWMB 4YIQB 4QHUA 1FNHA 1A6WH 1J87A 4QTIL 1DQTA 4QHMA 1NANI 2X2YA 3HZYA 5SX5H 2A77H 4L8DA 4LSQH 4RMRA 2JJVA 4P2RD 4OT1L 3VXSB 4BUGA 3QDME 2F74B 3HUJB 3SCMC 3WS6C 2EH7L 1XT5A 2D3VA 1CL7I 2VUOA 1RURH 1T1ZB 3UYPA 3ZE0E 3ARFD 2OR7A 5GJTH 5T33H 3OAZK 1OAYH 4X5XA 5KVMC 5KG9B 3MLXH 1TZHA 2WUBH 4F7CA 1VCAA 5C8JA 3TBWA 3FCTA 4XC3L 5I73B 5HHXH 3WS3B 1R24A 5K9OA 1CGTA 5DQDL 1SEBB 4G8EA 1KJMB 3PWPA 8FABB 2AEIT 2DM4A 3OR6B 1DUYA 3VFGL 1UB5A 5FYLH 1PKQB 2WBJB 4WY7L 4RA3A 2YMXH 5FV1L 1CLZL 3CFJA 3VWKC 4D3CH 1EMTH 1ZGLA 3NIFE 2IBZY 3B8SA 1UJ3C 1U2CA 5D6CB 1X5ZA 4PJAF 2FX8L 4M7KL 3TO4C 2HT3C 1T4KB 4ERSH 3FB7A 5BZWB 5C0CD 3Q6GH 1AI1H 3KPPB 1MRCL 1OW0C 4R7DA 2VKXA 2APBA 4XPGL 2BNRD 3VGFA 4ZO7A 2GJJA 43CAA 5F6IB 1U3HD 2JF1A 3TESA 1HYRC 5J9PB 3FB5B 4D8PA 1WWBX 4LHUD 5TFSL 3IFNH 4NRZB 1KIUA 2AABH 4POZC 5EA0L 2IBGA 4MJIA 1OGAA 5BOZG 4TVPH 3W0WD 4LPVA 2D0HA 4ZS7L 4UDTA 1UA6L 4NSKB 4TPRL 1GGCL 2Z0BA 3BEVA 4Q9RL 2NY0D 3UTZA 1UJTA 4FN0A 3H3PL 4JVPA 2HKFH 2NYYD 1XH3A 1T22B 3KXFD 5LCVH 3WFZA 1P4LA 3ZKNC 3QUZB 4QRSA 3QP3A 3PWVB 3UJIL 2Z31B 2HH0H 1JNNL 3T0WA 3D5OF 4C83A 4NKDB 2DI7A 4OQTA 4LP4A 4BK4A 1T1WA 2I27N 4OFDA 3JWOC 1MSPA 2CRMA 4LLDB 2AEWA 4Y89A 3P4MA 1YPZE 1E6JL 2GITA 5EU3B 4YHYB 1F8TH 1CQKA 2NY7L 4K7PY 3QCUL 5ESAB 5I75B 3V4UH 3MV01 3HMWL 2YD4A 5GGTA 2ZUQB 4PV9A 3OKOB 1P7HL 4NFDA 4YDIL 4Y1AE 4GRLA 1F6FB 3EAKA 2WP3O 1UWGH 5CGYC 4X98A 5TGBA 4I2XB 3GEWB 2YR3A 5HHOB 4P59L 4K2UL 1FJ1A 5DUMH 2OSLB 2LV4A 1RUAL 5FKPB 5C0AD 3TPUA 1NKOA 3PWLB 4Y2DA 5EC2B 4ZYKB 4EVNA 1MLCB 1MWAL 1OTUD 4K8RD 1CD1B 3A6BH 3STLA 1GJIA 4APQB 3MLUL 3CPLA 2H8PB 1CFSB 4X9IA 2DDQL 3IJSB 1YC8A 1KEMH 2XZZA 3EDFA 3FQTA 1HSAB 3MBXL 5T1KB 2CIIB 5BMFL 3RZCA 4XAWH 5EO1B 1G6RL 5GGVL 2Y07L 2Y7QB 1NC2D 2R4RL 2HT4C 3SCMB 1BFVH 3BISA 3J7HA 4OF0A 5EOQH 1JF1B 1D6VL 3IDJB 1KENH 2P24A 4MQXD 4ZPVB 4LSVL 1U8QB 5ADOH 2Y06L 1R3LA 4RFOH 1REIA 3RGHA 3L5HA 3L3KA 4LASL 4I8DA 5EU6D 1Z6JT 3EYVB 5HYSA 5GGQL 3F7RA 4PRNB 3MV7A 5DRXA 2X41A 4Z6AT 5KSVB 4KJYA 4K3EL 1S9YB 4N0UB 1AGDB 3VWKB 1CLCA 3KWWB 2JIXA 2MCPH 4ZSOA 2A38A 1UJ3B 2E7BA 3BWAA 5IQ7H 3TO4B 4QXUL 5MENE 4O2CA 4YDLC 2DQGH 4TTDD 1YMME 5F44A 4K55A 4OT1H 1W0VA 5ETUB 1XGRA 2W9DH 3AU1B 1ORSB 5HVWA 4LDLB 2O61B 1H3GA 4M6MH 4BZYA 2VJXA 1X5GA 1RUQL 2IMNA 1T3FB 5DD5L 5E2TL 3ESVF 4U3HA 4PJ8C 4GUPB 3MLYH 5B38A 1CZ8L 3RWIA 3RVVD 4D0BB 4XC3H 3ARXA 4JRYB 4U2ZA 1UENA 2MHAB 2YUXA 4YFLF 3W9DA 1RZIB 5DQDH 1NJ9B 2EDDA 2X4TB 3BVNA 4KQ3H 4Z0BL 1ND0B 1IFHL 2NXYC 4M8QA 4J3SA 2DQHL 3WFHB 1A7BA 4YHPB 4PJ5E 4Z7UE 1TLKA 5E94A 3JWOH 2COQA 2ITDB 4W6XB 2FX8H 5FO7B 4MAYC 3WKMH 4F9PA 1NCUA 2P5EA 4RGNE 3GJEA 4OGZA 4K07A 1CDIA 3VRIA 4PJGB 3ROLA 2CPCA 1QKZL 4XPGH 1P5UA 3DECA 2PN5A 2P8LA 1BQHB 2YUWA 4E41D 1VDGA 3MFFB 4LF3A 5AYUH 4HFWA 1JPFB 3GMOB 2LU3A 3TA3A 5TFSH 3QXVA 4YE4L 1PBYA 2VR4A 5DLML 4YR6A 3VXMA 4P2OD 5EA0H 4PG2A 1I7ZA 2VABB 3VG0L 3QEQE 1OQXA 1OAUL 4F9LC 4AJ0A 3FQNB 5GRVK 3LS4H 1RY7B 4R4BB 1CGYA 1EZVX 3I6KA 2N7BA 3PV6A 3RUGA 4JKMA 3N1FC 4JFDA 3CVHA 3WFEH 3FT3B 1RUML 1JGEB 1S3KL 4LPUA 1RJYA 3O2DL 1WAAA 2PR4L 3UJIH 1BQLL 1QUNA 4BQ8A 1DDHA 1YDPB 5HYJA 5EDXA 5IB3B 4PV8A 3ILQC 4TSBL 2BC4B 2ZNXA 2V5RA 2XICA 1A2YB 5DD0H 1CLYL 1TJHH 4AMKL 3PWPD 2HYMA 2EKSA 1R3IL 3SE8L 2GAZA 2AK1H 4FQLL 3HRZB 4YDIH 2C4XA 4PRHA 1NMAH 5E8NA 4G6FD 4K8RL 4JANA 5E08L 5HI4D 5ESVA 3BE1L 1GRWA 1RHHA 1KJ3L 1WCBB 1S5IL 5E1AA 1GZPB 4K2UH 3L7FA 3MNWB 4JAMB 2NYYC 3V6FA 4TUKL 2EDXA 5T3ZE 2VDQH 4L3EE 4OLXL 4QHNB 4WRLA 1YNTB 3P9MB 2M2DA 1C1EL 3O6LH 3V6OA 1MWAH 3MSPA 3QHFH 3TLRA 5C0FA 2JK5A 2BX5A 5E56A 5LAXB 3MLUH 5EO9B 3BAEL 5IM7B 5DS8B 5DI8A 5CJ5A 3HR6A 1C8PA 1VEPA 2HLAA 3IDUA 5EZLB 3OXRB 1ZSDA 3MBXH 4LCWB 4XAKE 4N0FA 4Z7WE 5DZLA 4YDLB 4MJID 1OGAD 2RB8A 2DLHA 4M9PA 1XF5B 3AVEA 3HRPA 3UPCA 1G6RH 3W39B 3ESUF 1EH9A 2Y07H 4YDKL 1DBMH 1MWAB 1ORQA 4KXZI 1MHPL 4JFXA 4ZO6A 4X80L 1D6VH 1IARB 4PRDB 2VDKH 2BNUB 4LMQE 5I1HH 4LSVH 1S7RA 4U6YB 2VSDA 4PJ8B 4MXWL 4LASH 1MFAL 1G6RB 2ZCHL 4QRRA 3CFKA 5ESQA 3OJDB 5I8CB 3MUY1 5DRNB 5IKCB 2NXYB 3HNVH 3P30H 1OTUC 4K8RC 5EN2B 1WFUA 1BP3B 2YKLL 1QRNE 2MQ0A 4LVNC 4NZUL 3KYOB 3IDGB 4MAYB 3DVFA 4JKWA 1DEEA 1LP9E 1FN4B 2YS4A 3HTLX 4GRLD 3D3VA 2EO9A 3NIDE 4P2RB 3MQIA 4OCXL 1I85A 1KELH 4YHKL 4MLSA 5D5ME 1GSMA 4XHJC 1CDHA 4JY6B 4NNPL 2CGRL 1RUQH 3LD8C 1XCTB 2HFEA 5DD5H 4N0YL 4PJCB 4MQXC 4RFEB 2GY5A 1CZ8H 3WFCH 4Y2DD 1NUDA 4H20L 3RQ3A 3TWCL 3CFBB 1QEWA 5D7KD 1M7DA 4NQCE 3CX2A 2V7HA 1T0PB 4HJGB 4LIQL 4LKXA 3WUWB 4Z0BH 1WV7T 4JDVA 5T1DH 1V3JA 1G0DA 3MJ8A 1EHLH 4TVSa 4UILH 1FDLL 4CVUA 4DQOH 5K9QG 4OZGE 3RZCD 2VISB 1VESA 4O4YH 1K2DA 1YPZF 4QRTA 2QEJA 3PJSA 1IC7H 3LKQB 2ZSWA 1A22B 4LNVA 2NX5A 2VIRB 2R2HA 3ZL4H 3MGOB 4EN3C 3TN0A 2D7QA 4FQCL 1UQSB 4LEXL 1A7OL 5C0CB 3W2DL 2FD6H 1L6ZA 5IVXB 4JFOA 2Y5EA 1VGEH 5E2WL 5DFVD 3LKRA 2CMRH 2BNRB 5J4MA 4WVRA 3VW3L 3VA6A 3F7QA 1KTDB 4HFUL 4BFGA 3IDNB 4KJWC 3ZDXE 2MJWA 5HPOA 4HCRA 4LHUB 5I1GL 1N7ML 1FNFA 2WLYA 3UO1L 3VG0H 1EDQA 3MRFA 1VPOL 1OP9A 3BPOC 3DOSA 2HVJB 3REWB 5AZEL 5CZKA 4F7TA 1FG2B 3LKPA 2ORBH 1FZMA 2FSEA 2A6IA 2ZKHL 3CXDL 5ICZB 5FM8A 2QSCH 1INEL 4P5KB 3VXSE 4U2YA 3CCHB 4P4RA 2GUOA 1OTSC 3PP4L 3HUJE 1KJ2L 3I2CH 5JIIA 4QHLA 3AAZB 2VDRL 3VMOA 1NUGA 3VFWB 4QRQB 4UQ3A 5BRZA 3MA9L 2ZG1A 4HIHB 1FIGH 5TDPA 4TSBH 4AIZA 5EZJB 4Y5YC 3DYOA 3Q3GB 1RZGA 3FFDA 4PJFB 1XGQA 1P2CA 4HUNB 5EO0B 1UKSA 3ULVF 1R5VB 4PY7A 4WI9A 2DB8A 5I8KL 3HZVB 3EO9L 3RKDD 3L5XH 4HSQA 4NKOB 2X4NB 4P2OC 1PKQE 1T66C 1AGCA 2RFXA 3Q6FB 4K8RH 2BVQA 3OTTA 1U92A 2P5ED 3GSQA 3VXRD 1KJ3H 4J8RA 3STBA 3ZLQC 3QJFB 5IWLA 2RIKA 4TUKH 3O4LA 3PP3K 5FHBL 4RDQF 3CDYA 1DL7L 4YHOH 5TPWH 4L29A 3GSWA 4OGXL 4PGDA 3ZE2E 1IQDB 2CKBH 3WUZA 2Y1VA 1NDMA 4ODVH 2DOCA 4OCNC 2WV3A 1Q0XH 2PYEB 1MFCH 3TA3D 3IVKA 3NA9L 3QULB 4P9HL 4LVNB 5HD8D 5KSAD 5A2FA 4L8CB 1C5CL 2E6PA 5TH2A 2GW5A 3VXMD 1KCRH 4ORZC 5DQJA 1EGJH 4AIOA 4G8FB 4JFQB 1HI6B 3AGVA 4LVEA 5DJ6A 1RIVH 2CKBB 1YYML 4OQTL 1NC2B 3BGAA 1QFWI 3EJZC 3IF1B 2Z8WC 4JFDD 4XP1L 5ACZA 1IAIL 3I6GA 3LD8B 1HIML 4N9OB 3UYRL 4YFEA 2M1KA 3RVTC 2W65B 2GCYB 3GFUA 4AH2A 4TVPE 2L4OA 1MFAH 5GGTL 5HYJD 4EBQL 5EU6B 2VUYA 1BAFL 4X7TB 3ZT7A 5JW3H 5CMAA 2YWZA 3T1FB 3GK8L 5JPNA 4JDTL 5B4MD 1CE1H 3DARA 2ZUYA 4GKNA 3EFDL 4TN9A 3VFTA 1UCBL 5E8EB 1UFUA 4PRHD 1EAPB 1VACA 1HQRB 4EN3B 1I8LA 1C7TA 1KIRA 4OCXH 4HKZA 1T20B 1NMBL 1CF8L 3V5KA 2BOCB 4XMPL 3MJ6A 2R1WB 1JYNA 4P9HC 4JN1L 4HWBA 2C3VB 1A1MA 1X7QB 2A6KA 4FZEL 1ROWA 4H20H 3HI5L 3TWCH 3MRHA 2EYSA 3H9SB 3VD5A 3MLWL 3WSQH 4NWUH 4LIQH 3G6JA 2VN4A 5BVPL 1CFNA 5DGQA 1FDLH 3BPOB 5HGHB 3C8KB 1F4HA 1JI2A 4JFZL 3UP1A 5E2UL 3O9WD 4DZ8B 1FPTL 1KLGB 1UZ6E 1CR9L 4OCMC 3T09A 1AO7B 1R3JA 3EYOA 4URTB 4BM7A 4Z7VA 3MR9A 2NTFB 2ADIA 1IGJA 3GSXA 1NCCH 2WLZA 1QSEA 4GRLC 3T4YA 4JHAL 4UZGA 3MNVB 4GLRH 3C60A 3W2DH 4XWGL 4S1QL 4M6OH 1DANT 1KCLA 4Y5YB 2VWEC 4E41B 4TOYL 4GJTB 4QRRD 2GSGB 5BO1L 4IJ3C 1T04B 3HE7D 4XWOD 4JO1H 5DR5H 3C6LA 4Y2DC 4XXDA 4MWFB 3S4SG 5I1GH 1N7MH 1P7KB 5DJCB 1I7RA 1N3NA 1AGBB 3UO1H 3LV3B 4P2OB 1NGPL 1FIEA 4TNVK 2YN3A 5IIEA 1AE6L 4QHUB 2XN9D 1NCDH 1YYLH 2R0ZL 1IBGL 4QHMB 4W81A 4RNRA 3HZYB 1CD9B 4L8DB 3RZCC 2ZUSA 1FLRH 2DL2A 3M45A 4KMTH 1NCWL 1YC7A 1WVZA 1LQSR 4JG1H 5CKGA 1I3VA 4KMQA 3RJQB 3MA9H 3X3GL 2M26A 4X5XB 1FYTA 5D7IA 1TZHB 4ZFOA 4F7CB 4KUZL 3TBWB 3FCTB 4QRPB 4Z95L 2GK0A 5DFVC 1R5IB 3DGGA 4XMKH 5ECJE 2LU7A 1R24B 3CFCL 2R0LH 1ADQL 3HC3H 3GIZL 5K9OB 3OKDA 5ICYA 4G8EB 3DXAD 3PWPB 3IFPA 4O51A 1DUYB 4FS0A 1UB5B 4TTGA 5F1IA 3CFJB 1ZGLB 2VOTA 4TRPL 1PZUB 2ZP0T 1F4XL 2A1WH 3BUTA 4XZUA 4O02L 2NX5D 1AD9A 1C12A 1PEWA 5KW9H 5CP7A 1FCCA 3TN0D 3FB7B 3HZKA 5FHBH 2NY2D 4PJGE 4AM0A 1JJUA 4R7DB 2OMNA 3NIDF 4OGXH 4DUXA 3UMTA 1NQBA 3U6RA 3VRJA 3WKML 3NCYS 3MV9E 4LLYA 43CAB 4YAQA 4HKBA 5C6WH 3NA9H 1C08A 4Z7QF 1FC1A 4P9HH 4D8PB 3MRKA 5DJDA 3CVHL 2ZUXA 4QXGL 1IGYA 4IHOA 1HHIB 4X5LA 3ROOB 4PTTA 3RY5A 2VXUL 4NZJA 4MJIB 1OGAB 4N1EA 3MRGA 1FGNH 4UDTB 3CFDA 3RKDC 5BV7L 3BEVB 2EDOA 2OBGA 3UTZB 4P57A 3QCVH 5CJOL 1XH3B 5I1KL 1I8KB 1JNJA 5FIEA 1BIIA 3ALPA 1QLEH 4F9PC 3LOWA 1P4LB 4HX1A 4QRSB 2GJ6B 2I5YL 1BBDL 1BAFH 4WI2A 2ESVD 3PWUA 4LSUH 4C83B 3SKUD 3TYGL 1T1WB 1M71A 3GK8H 5HSFA 1P1ZA 4YZFE 4PUBL 3P4MB 1BEYL 1C16A 3TA3C 1U8KA 1RFDH 2PXYA 4BSVA 1IC5H 3OPZH 3ZDXF 2UZIH 4PG2C 3WO3B 4X6DB 3WL9A 4U3XA 4GRLB 1CF8H 3IDYC 3VFOA 4XMPH 2NW2A 2NMSA 4X98B 5DVNA 5TGBB 4JO2H 3O4LD 1FJ1B 2JCCA 5I18L 4IJ3B 2ARJQ 3PWJA 3TPUB 3QFJB 3MLWH 4Y2DB 1F4AA 1EO7A 2IFFL 4BH7A 4EVNB 3HUJF 1MIMH 4JY5L 4OUOA 3STLB 3QDHA 2VR5A 1S7VA 5ITBH 3QI9D 5BV7C 1IGIH 3CPLB 3VD3A 1DQMH 3MLZL 1S7TA 3QEGL 2F19H 1ZT7A 1OPGL 5DMKA 4LCWE 3M8OL 5E2UH 4CJ0A 3P4OA 1FPTH 5B4MC 4UIKL 4WFHE 2I26N 3RGVA 3RZCB 5I1DA 1AD0A 3QDJA 3SOBL 1D3CA 1Q1JL 4HS3A 5BCAA 5KOVC 4U1JA 3JWNC 4XWGH 2P24B 3QUMA 1R3LB 5KAQF 3MCLH 5DURD 3SE9L 5CGMA 3OQ3B 3L3KB 3U0PA 2B5IC 1A7NL 5HYSB 3UTSA 5F97E 3T65A 3MV7B 4UMGA 5DRXB 3V6OC 1Z3GH 4KK5D 2VQTA 4KJYB 2VDMH 3ZE2F 4P49A 3UTPE 2JIXB 3FB8B 4XI5C 4ZSOB 2IPTL 4MXVE 2AJSL 1Q9KB 1J10A 1NLDL 4O2CB 3MLRL 1F11A 4WCYL 1E28A 5HGBA 1W0VB 1XGRB 4LQFL 4P2RE 1AGEA 3QSKB 1NEUA 1E27A 2HVKA 5B39G 5D1ZC 4DKEL 1LEGB 1FP5A 1HINL 4PJCE 3S6CA 1RUKL 5I1IL 2YRLA 5FHAH 4JPIA 4KUZH 3CD4A 4XXCA 3RWIB 5B38B 4JQIH 3SKNB 4Z95H 2VSCA 4LRNL 3ARQA 4EDXA 2UY6A 1P4BL 3CFCH 3W9DB 3S4SA 3N1QC 4RMUA 4XWOC 3BVNB 1OAZH 4J2XA 1MREL 4M8QB 2OJZL 3N50A 4TRPH 5E94B 4DGYH 5DMGD 8CGTA 1RVFL 3FN9A 1T1YA 1IGTA 4O02H 4FFVD 3GJEB 4HCRL 2NR6D 4DK6A 4WGWB 3VRIB 3ROLB 1I85C 5E8PA 5C0CE 4GRWH 4ZS6D 3SDYL 2W0FA 1JN6A 2YRZA 5IVXE 2DQIL 4UOW1 2P8LB 4FQ1H 4PR5A 3BEWB 2BNRE 4LF3B 5DD1H 4HFWB 1DLFL 5IMKA 1DJSA 1OAXL 2DBLL 3TA3B 4QXGH 3BP6A 4J1UA 3DTXA 5HGDA 4YR6B 3VXMB 4HBQA 3RHWF 1I7ZB 1PVHA 4GRWB 3W0WE 4YJZL 3IDYB 3EYQD 2DQEL 1J05B 4JREC 4UT7H 1OARL 3I6KB 3PV6B 3RUGB 2NNAA 4JFDB 5K33A 3CVHB 3KXFE 1OCWL 1UZ6F 4P3DA 5EB9A 4HGMA 3MUGA 5D4QA 1RJYB 2QJDA 2YPKB 3TN0C 1DR9A 5CS7A 3SN6N 1DDHB 2NY2C 5IUSA 4JFYB 3ULUH 5HYJB 1UH2A 2HTLD 4HH8A 3GSRA 3WHE0 3EDJA 1D5BA 5CEXA 2DLTA 1OAQH 4PV8B 4G3YL 4PUBH 4K3GA 5CJQL 4PJFE 4U6TA 1BEYH 4FNLL 3FQUA 2VNCA 3ALXA 4OCLC 3S97C 2EKSB 4EXKA 1GHFH 2GAZB 1EFQA 3F58L 2H3NA 4PRHB 4NO2A 5E8NB 3HMXA 4R90L 1JZ3A 4JANB 3RIAK 1RHHB 3NFPA 4YHZL 3GMNA 4LKCA 5E1AB 3L7FB 3V6FB 5GS0D 5EFIA 1RULH 3KPQA 2R0KH 4X0KA 4E42A 2B5IB 3H42L 5EBMA 5C0AE 5C0FB 4LSSL 1FG9C 2QV2A 1CBVL 2JB6A 3G9VA 4MHHI 3SGKA 1QFUL 4LP5A 1T5XA 4U49A 4U3CA 1YEGH 2VXVL 2HLAB 3T1WA 1OPGH 5E8DL 3NCBB 4UIKH 4N0FB 4G80B 4F57L 3PGFL 1URLA 4KVCL 2P7TA 1OSZA 4RGOL 1TPXC 4TNWF 1MJ8H 2J3SA 4OBSA 2F54A 4R6UA 3SOBH 1FV1A 1WWAX 1ORQB 4X7FC 3BKJL 2P42B 4QLRA 4ZFGH 4JFXB 1UG9A 5D1ZB 1SVCP 1KCVH 4MA3A 1S7RB 3X14A 4FG6D 5IWLC 3SE9H 3U1SL 1A7PL 3T0VA 4QT5A 1A21A 5F7NC 1JBJA 4HUXA 4GXUM 4M62L 5I2IA 4QRRB 3CFKB 5EU6E 5TE7L 5ESQB 1VADA 4PJGF 3VXNA 5MEOA 1A0QL 2X4UA 3G5VA 2IPTH 1Y6NR 2PXYD 4WUKL 4HWBL 3BSZH 2R56L 3MLVH 3MLRH 2NY4D 4MNQA 3VXOA 5I30L 5IHUL 5F7UA 4GKOA 1DEEB 4DAGL 3BZFA 1V7ML 4WI6A 3D3VB 2AXJA 4IDLA 5E00A 1MHEB 3CLFL 4RAUA 3OAUL 3MRDA 1AXTH 2XWTA 1LVEA 5BJTA 2EDRA 3DHJA 5GJSL 1EIBA 5IESH 1HINH 2HFEB 1GC1L 3Q2CA 2X42A 5I1IH 1UWXH 1TENA 3C8DA 1JZ4A 4MSWA 1QEWB 2GI7A 4LRNH 4Y2OA 1M7DB 2VQ1A 5JQ6L 2V7HB 3LKNA 2P44B 2YBRA 4JDVB 5JW4M 4IMKA 3MJ8B 4ZPTA 2BCKA 3VXQA 2ICEA 4HPYL 1FE8L 2BHZA 4LSPL 4ELMA 4HS8H 1YQ2A 3REVA 3RGVD 4JREB 1K2DB 2YOCA 4JZJA 2FGZA 3BXNA 4QRTB 1PD6A 5MI0B 3PJSB 4OLVH 2ZSWB 1IMHC 3P73A 2NX5B 4LIQE 2R2HB 3PNWA 4ODWA 1YEFL 3CMGA 4MAUL 3TN0B 4OJFH 1I8LC 3SJVB 1KCUL 2IQAA 3NIGF 4EJ1C 6FABL 5B39A 4AG4L 4WENB 3IS1X 3OB8A 1A4JA 4QCIA 4CU7A 5FFLA 4JFOB 3ZDYE 3LKRB 4E41E 1KN2H 1DLFH 1F6LL 3I3EA 1CD8A 5JDSA 3UTSD 3G6DL 3BPNC 4DKAA 1RQ5A 1A5FL 4A2MA 4NJAL 1KGCD 2O5ZL 4HDIA 1GIGL 3MRFB 1HHJA 3RNKA 1ZLWH 2B1HL 2R23A 4F7TB 2LVEA 4JEGB 4LLAA 2DQEH 1NBQA 1V3LA 4B7IA 1OARH 4ZFOL 4YXKH 1FZMB 2FSEB 5AD0A 3LS5L 5DMGC 1N64L 2G75A 2APVA 5F8QC 5IEHA 1I1FA 1GOFA 4P4RB 2GUOB 1JTOA 4FFVC 25C8L 4R3SA 3M17A 4QHLB 2NR6C 4RCAA 1JZ6A 1S9VA 3C60C 1QFWM 4UQ3B 5BRZB 1DQDH 3KYNA 4O5LH 5TDPB 4ZS6C 4AIZB 3WCYA 3OAYK 1RZGB 5CJQH 3FFDB 1RZFH 5D7JA 1XGQB 3U48A 1SM3L 2IWGA 1P2CB 3BQUA 3C6LC 1TPXB 1YECH 4PY7B 3PWPE 1E4WH 5GS0L 1S7UA 1YZZA 2CXKA 3QA3A 1MFEL 1AGCB 2RFXB 3ARBA 2BVQB 4FA8A 2Q7YA 4YEFA 1U92B 4L3CA 3GSQB 4J8RB 4MXVF 3EYQC 4YHZH 2UWEA 2F9BT 3O4LB 4R7NA 3HC4H 3BHBA 1WF5A 3EOTH 1BFOA 2DICA 4C55A 4L29B 3BZ4A 3GSWB 1MQ8A 5JLZA 4PGDB 1MFDH 4HUVA 4LSSH 5I66A 3FO1A 1CBVH 4MA7H 2HTLC 1QFUH 3IVKB 5D1QA 1L4IA 1U8IA 4PJIE 4MS8D 4PJCF 5TE6L 4XMLH 5I1CH 4F57H 5DQJB 5C0BB 3CLEL 1RI8A 4MJIE 1OGAE 4D0DA 2HFFA 3TNMA 1FORL 5BQ7A 5DJ6B 2YEZA 4N1HB 4H25A 3U82B 3HNSL 4XNXH 2DS4A 4X6CA 4UINL 1JGLH 4QWWD 5ACZB 3I6GB 3MMEA 1ZA3A 4XP9L 2K1MA 5C7XH 2CR6A 5DURB 4AH2B 4AZ8A 4M62H 5CAYB 3KPSA 2X1PA 1LO3L 1A3LH 3BW9A 4PS4H 4JFPA 2E7HA 5ENWA 5CMAB 4PJHE 1F13A 3GMMA 5JPNB 1SBSL 3X13A 4L3AA 2OR9L 3BIAX 5DJ2A 2DN7A 4WUKH 1NC4A 4HWBH 4GKNB 5DA4A 3VFTB 1L9NA 5I30H 5F1SA 4DAGH 4IRJA 5B3JE 1V7MH 3CDCA 4HT1H 3I84A 2Y36L 3IXAA 3KDMA 3TV3H 3VH8G 5SWSA 2FLRT 1VACB 4OLEA 4Y5XA 4ZDHA 1KIRB 4HKZB 4FQJL 1DE4A 3V5KB 1MRFL 4C54A 2AV7A 2DYPA 5CJBA 4HD9A 1TQBC 2VQUA 2VWEE 1U9KA 2VE6A 3CFEA 1A1MB 1C5BL 3U4BH 2A6KB 3MRHB 4FG6C 2EYSB 4N9GA 3BPNB 5JQ6H 1IEAA 5D7KE 3G6JB 1IAMA 4ZG1A 1I7TA 1JPTL 4MD0A 3FQWA 5KVGH 1CFNB 4ZUSA 4HMDA 2BSRB 4KRLB 3KLSA 3QUML 4K7PH 3Q48A 2CLRA 4MGXA 5KJRL 5FECA 3IAQA 1CDBA 3QXWA 2EXWD 2MMXA 3NPZB 3BRFA 1R3JB 2PXYC 4HJ0D 3EYOB 4DN3H 4FXGA 3MR9B 4Q0XL 1PJ9A 3IDXL 2ADIB 2J4WL 1IGJB 3GSXB 5F89A 2OM5A 5GGRA 1QSEB 1N6UA 3T4YB 3WXVH 4NO3A 4ZOCA 5D2LA 2B2XH 2IMMA 3C60B 3LRHA 3C6SA 3MRNA 4U7KA 1HKLL 3TCLA 1F3RB 3PGCA 4HWZA 2YZ8A 3LRGA 3T77A 3H9ZA 3OJ2C