4S1DD

Structure of igg1 fab fragment in complex with biotincytidinamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLSWFQQKQGKSPQLLVYSAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGTYYCQHFWSSIYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hapten-directed spontaneous disulfide shuffling: a universal technology for site-directed covalent coupling of payloads to antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords MAB M33 FAB FRAGMENT, heavy chain
total genus 44
structure length 211
sequence length 211
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2015-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1dD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1dD01
4LSDA 5E9DE 3RKDC 1Z6JT 1KPVB 3MGTA 4XI5C 4BKLA 4NP4H 1XIWB 3SCMD 2PYFB 3QQ3B 5ACZB 5C7XL 3W0WB 1YJDH 2HT3D 4JG1H 5DLMH 4HK0B 2DAVA 4LCYA 1MAMH 5I1AA 4P2RB 2NNAB 1JV5B 5C0GA 1KPUB 4M1DL 1S7RA 1BX2B 3DUSA 2OXGA 2V5SA 2VDKL 4JM2D 1HHKA 3H3PL 5D70L 5TE7H 4U33A 2HKHH 3GO1H 1RFDL 2IFGA 4DK3A 2C3HA 3HE7D 2DQHL 3JZ7A 4QHKI 3SQBA 3EGSA 3BP6A 1GC1L 1OB1B 3U30B 1L7TL 1JGDB 3ABZA 4NC2B 5JO5A 2KQMA 4OT1L 2N4IA 1RK0B 4HPYH 4F7MA 5T3XE 3OKKB 1HILA 4NZUL 4OD2B 5IMOB 1RK1A 5HI4D 3RZWA 1CK0L 3ULSB 1FP5A 3RWJA 4JY4B 4Z77A 3P9WB 3C09B 5E70A 4HUWB 3GMNB 3I6GA 2FHBA 3VD4A 4YDIH 1J12A 5A3ID 4RIRA 1VADA 4FG6D 4HBCL 4JQVA 5EU7E 1ODAA 4O02H 3VWKD 5TJWK 1REIA 2FJHB 3VXPA 1Q94B 5EDXA 3NIDE 4XZUB 1UCBL 5EBLA 2DQIL 4UOW1 4XPAL 3P2TA 4NQCE 3M8OH 2VL4A 4KMLB 3WFHA 1I1FB 4WFFD 4P2QD 5HI3C 4IRSB 3QIWA 3LN4A 3ZDYF 1J05B 1I3VA 1QZ1A 3KLHD 1FNSL 1NGPH 3ZE0E 1A1NB 1VDGA 1KLUB 5BW7A 2AV1B 3RX7A 2VR4A 2EC8A 1KELL 3MV8B 1UQSB 1G9ML 1UXSA 2ZZUT 3GRWL 4L4VE 3FOLB 1QLRB 2VXQL 3CLEH 3VH8A 2WZPD 1G7PB 1IVLA 3PWJA 5HTSA 4Y8AA 2EH7H 1QKZL 4P5TB 2D7NA 5EU4A 4M00A 1OARH 4QXUL 2ARJB 4KKAC 4RA3A 3SJVE 1AC6A 1ADQL 1UXWA 4JM2B 1D3CA 2NYYC 4JZJB 3DBXA 5DWUH 1W8OA 4I3SL 2GJ6D 4KDTA 1KB9K 4P2QA 5DZLA 1YC7A 5E5MA 4ZXBC 4PJHE 2EDKA 4P3DA 3RIFF 5JQ6H 5EIIA 4HIEB 5LWYH 4JZNB 1J9CT 3ULSA 4X6CB 4UIMA 2LTQB 1XGTB 4K3DL 3MRLA 1CLCA 1FGVL 1KIUA 4Y4KB 2VDPH 5FK9B 3K81A 1QSEB 1I9EA 4GLRI 5KSBB 3V5KB 1HH9B 1NLDH 3RKPA 3UJIL 1KG0B 1ZHBB 4JAMA 3O3UN 3HAEB 4MCZB 3ROLA 3QUYA 1YPZE 3MREB 1DBMH 2AI0H 4JM2C 5A2LH 4OCYH 2BNRB 3D2UD 4RFEB 2B39A 3BWUC 1MJUH 1XIWA 3KJ6H 1A2YB 3L3OA 2YA1A 5LQBL 5FYKD 4JAMB 4LSPL 1BVZA 4N68A 4U0QB 1UM4L 5I15H 3UTQA 2WAHA 2ZUWA 4HEPG 3A6BH 2AV7A 4EBQL 1DANU 3QHZL 1QSED 1OM3L 3TO4D 1YEEL 4JGUA 3DVFA 3ETBF 5E8OB 1TZGL 3MQIA 4GMTL 5AWNH 2XKSA 4M9OA 5JA9A 3HZMA 3SPVB 4NNYA 5SWQB 4PRHA 1YN6A 2VLKD 3RGVD 2CLVB 2BX5A 3OHXB 1AQKH 4IBLT 1T1ZA 4OF8A 4OZIF 3KPQB 4P2OA 1AGFA 1BQLL 1OVZA 1IKFL 2EYTB 2WW8A 1BZ9B 4TPRL 5GGSY 3IDMB 3VFNB 4PJAB 3UTSB 4XXDA 4XNQB 2ZUVA 2RFXA 4Z0BH 3P73A 3SY0B 5T1KA 1NL0H 3ET9F 1X5LA 3V0WH 3RWHA 4MJ2A 5GHWH 1IQDB 5EC2A 4LLMA 1TJGL 3MLYL 1JGUH 5FM5O 4F33A 5D7SH 3O2VL 4YQXH 4LSUL 3ME0A 4OUUB 25C8L 5EN2A 1IGIH 4X6EA 4JHAH 1S78D 4GKZB 3P0YH 3AROA 1INDH 1L9NA 4KUZH 1J05A 4DGVH 4ISVB 3SKNB 3GSUA 2VLJB 4HBQA 5JOEA 4LHUA 5DJXB 3WUWA 5F7HA 4D8PB 4BFIB 1XGPA 5J6HB 3EYFA 3ARDC 1ZT7A 2YKLL 3QCVL 1OW0C 2J6EL 4X9IA 1ZA6B 4HWEH 3DVNB 1OGAE 4KMTL 2VISA 1TLKA 4JPKL 5DJZB 4G43A 4DUXA 1YQVH 4LRNH 3VXTB 5BXFB 3LIZH 8CGTA 4MHHI 1K2DB 2BOBA 1Q0YH 4GRWE 3GKWH 2IGFH 2H1PL 3G6JF 4XBPB 3OB0K 5AZEL 5ITFB 4F7MB 4HG4J 4XCNA 1KPRB 5A2IH 4OCWL 4JB9H 1OAQH 5LXGH 4UINH 4GOSA 3UPRA 2G9HA 2X10A 3QXAA 1MF2H 4MYWB 3MJ8B 5CEYB 3CFEA 3LB6C 1QKZH 1ZT1A 1IFHL 1N4XL 3QUMA 4P2RD 5HDOA 1XGQB 4FHBD 4ZS7H 1KULA 4RFNB 4Z76A 1JMZA 1R24A 3CAFA 1DQMH 2BVUA 4Y16C 1J0IA 4HJGA 1UZ6F 2W91A 1CGUA 4HT1L 4JKWA 4C59B 1GH7A 4PREB 1T22B 5F97E 3BRDA 3WHXA 4ODSH 4ZD3H 5CMAB 5JR1L 1CU4H 5GIRB 4OCNC 3MLWH 2FZ3A 1F3DJ 5MEPA 4J4PD 5GGRB 3FKUS 4B50A 1PEWA 2AXJA 4C55A 1E4WH 3FB6A 1ND0A 1UZ6E 4FQQA 5BRZA 2VO5A 4MNQD 1G6RL 4N9OB 3UPAA 4WTZG 4LLUB 4D0CA 1EHXA 5EU5A 3DTXB 3GMPA 5EU6A 2CKNA 2RQ8A 1KG0A 2XNAA 3ECBB 4NKMA 2ZJSH 3MRHA 1QQDA 5GRWA 1KYOJ 1BEYL 5ADPL 1F90H 4K7PY 3L3HA 4XCNB 4HGMA 1FZOA 5C07D 2V2XA 4DVRH 2IH3A 4PP1C 2IPTL 4I77L 2XZCH 5IWLA 4JPWH 2IMMA 2GQHA 3KVQA 3SKOA 3MLYH 2P48B 1J5OL 1XGUA 2A83B 3VDCA 5J06A 1PLGH 3C2SA 4DN3L 1MAKA 1AGBA 2EEBA 4J3WA 4LLVA 4M5YL 4NT6A 3DVNA 1UCTA 4UT7L 2OMNA 5IEKB 4MQSB 1U8HA 1A6ZB 1XZ0B 3HFML 2HA1A 3BP5A 4U1NB 5JXEA 5KAQF 4GRWB 4ZPTB 2NW3B 3WNNA 3CFIC 4MD4A 2I9LA 1RJZB 2XZAH 3UJTH 3S35X 2PR4H 1AO7D 5SV4A 1OF2B 4X7DC 1WTGT 2CMRL 2IPTH 3OKOA 2H6PB 4PJIB 5F1NA 3VJ6B 1U8KA 3QSKB 4JKPH 3I6LE 2FLRT 5FKAB 2Z35A 4X7SH 5K9QI 4GO6B 4RAVB 1XGYL 4CGTA 1WK0A 1IAMA 4AEHL 4JM4H 2DQEH 4PJEE 1XR9B 5CIPB 4JB9L 3B2VL 3DRTA 4RBPH 3VA6A 2FATL 4YHML 4R3SB 5IFJA 3GMLB 4GKSB 1CDUA 1YEFL 3T0EB 3TA3C 5HHQA 2JELH 3BYYA 3Q1SH 1W72B 3HAEG 4H88L 1ETZB 3PWNB 1RIUH 5E08H 25C8H 3S5LA 4KMTH 3PXHA 3L3IA 2B1HL 2VDLH 4PRBA 1QFWH 2VLKE 5IVXB 1CI5A 4MA7L 1Q0YL 1CTOA 3REVB 2AEQH 2CDGA 5MP6H 4GRLB 1F3JB 2OL3H 4LQFL 2WMPA 1DE4A 4L4VA 4BH7A 2FH8A 2FWOB 3DMMD 1QVOA 4MDJA 5FV1L 3BGAA 2BC4A 4QRQB 5D1QA 1J1XL 3QI9A 4MJ5B 1A1OA 4MS8D 1P7QB 1HXYA 3MLRH 1KFAL 3ULVH 4Z7UF 1X5GA 4KY1H 2XG4A 3N1PC 3TN0C 3KDMA 2IGFL 2RR3A 2IBZY 4FFWC 5TFSH 3KYOA 1A2YA 1CE1L 1WC7B 4ZTPL 3VWJB 4PJGB 5DRWA 1IGTB 3QUXA 2D4FA 1BFOA 1P69B 4YPGA 1EJOH 3OPZL 5DJYA 2J8OA 2B1AH 4WW2C 4EUPG 1C1EH 4QRUB 2PTUA 3WHXB 5IFHH 3FRPA 1SJVA 2YZ1A 1A6UH 5GZOD 3KPMA 3MV7A 3H9SE 4KKBD 4Z7OF 1C7TA 4LEOB 3FN3A 5EZJB 1H8OA 1T03H 3I02A 4ZAKA 3LKQB 1FBIL 1EUTA 5GS0L 2FEEI 5EB9A 5CINL 5E9DB 4NQSB 3CFJB 5HHPB 1FVDA 2FR4A 3F7VB 1E4XI 5F9WC 2EZ0C 4NZJA 3VMPA 1QSFE 5F21B 3OPZH 3UAJD 1KEGL 2Q3AA 3U4EB 1NFIB 4WEUD 3I84A 2VDPL 4FFYH 2ERJC 2LAGB 4KRPB 2EXYD 5DR5H 4UI2A 1G9MC 1U2HA 5DK3A 1YY8B 1YEDB 1A1MA 3CCHA 1IAIM 2AJZB 2VB5A 4XPBL 4AIZA 1DBML 2FH6A 4CMHB 2EDJA 2Z4QA 1JK8B 1UB6A 4I3SH 3SGEI 4F37K 1BD2E 2QQQA 4OFIA 1BLNA 1XCQA 3CIQA 5IQ9A 5HHOB 4A6YH 2IMNA 2XKNB 4RNRA 5IHZA 4OV5A 3F12B 5LGKA 5KOVC 3IFNH 4K3DH 3BZ4B 4W68A 3S4SG 3BYTA 2Z8RA 1KC5H 4AIOA 3S96B 2HLFC 4OD3L 1MVFA 1PG7X 3FO0H 3PABA 1U3ZA 3S35H 4Q9CA 3AM8C 4ELMA 1LE9B 4JHWL 4RAUA 1JNNH 1SY6L 1WC7A 1JNJA 3ULVF 5FUOL 1J0JA 2VITA 3BE1H 4KTEL 5HGHB 4I18C 1WZLA 4LVHB 3VXQB 2PXYC 2R69L 4QCIA 4EXKA 4GAJL 3RWJB 4QF1A 2N1KA 3VWJC 1VFMA 3QUKA 2ORBH 1SBBA 4JM4L 5F9JB 3JTTA 3RWCA 3W9DA 2OI9C 3C2AL 2CDFB 2P8PA 3SE3A 5D8JL 1R3HA 3QWOB 5EIQA 4XPFL 1J0KA 5T3ZE 5B8CC 3WO3B 3VW3L 4MS8C 4CADA 3REWB 5I8OH 2A9MH 1J86A 2XACC 5HVHC 1EVTC 3L7FB 1FL5A 4Y4KC 3BZDA 5C0ND 4M6NL 1CGSH 5T5FL 1EV2E 3C6LA 2A74A 4QRPD 2UZXB 3IJHA 5F3BB 4X6CF 4NM4L 3AB0C 3MRDB 4OKVA 2F54B 2A9NH 4N8VG 4HIJA 4EZMA 4O51A 3B43A 5DJYB 2G5BB 4Y19B 2QHLA 5J6GB 4JZJC 5T3XH 3NZ8B 2YN5A 3ARDB 2BY2A 1NQBA 5D2NC 4L8BA 2VWEC 3TNMB 1MI5E 1I9IH 1JL8A 3OJDB 2ZNWA 4J1UA 3M8OL 1A6TA 3CUPB 1AGCB 3HZVB 3QULB 5D70H 2AAVA 2EDNA 4NQVB 1MY5A 4K9EC 5F6HJ 1NMCC 4Z7WF 1VFUA 2LVCA 1JYNA 1DBJL 3BH8B 4D9QE 4G42B 1O7VA 2EYRA 1H8SA 2GITA 2W59A 4BFEA 4OZGF 1NGWB 5DQDH 4BJLA 4M1GL 1FNEA 4QXWA 5LCVH 1GOFA 3TBSB 2EXWC 4M7LH 1AR1D 2NXYD 1AH1A 3ARGD 4ODXB 4K3HA 4QHUA 5I1JL 1CT8A 3GMRB 4JLRA 1K4DA 5TE7L 2ADJA 4R26H 2CDEA 2PW2A 3J8F7 4MSWA 4NC1C 4U7MA 2ZUSA 4W4NA 4IRSC 5T1LA 4MNGB 5HHMB 3FN0L 4L8SC 1BQHA 3GSNB 5DR5L 2IANE 1MELA 4ONHA 4LRIA 2OBGA 2A9NL 5CEXA 4S1DC 4G42A 2EYRB 1U91B 3P77B 1RJCA 5ALBL 4MMXC 1JGEB 1IAKA 1DCLA 5IHBA 3VFTB 5J1TC 5C2UB 4KRMB 2J4WH 3HI5H 3MRHB 1VCAA 4LCWE 2E6JA 1KCUH 2QSQA 1IM3B 1ZLVK 4J6RH 3NACL 5DJ6A 2M2DA 4JREB 1EIBA 1QR1A 2GK2A 2VQ1B 3MNWA 2G60L 4M3KB 3FFCA 3IS0X 4LLDB 4TNWF 3H2WA 1WQVT 2XY2A 2HFEA 3IETA 2G5BA 1KENL 3LEVL 1KJ2B 4KUCF 4OF5A 1B6UA 3ZDZF 4HIJB 3GMOB 4NQEE 5EOCH 4AQOA 4YE4H 2JJSA 3SDAC 3K4ZA 1WBZA 1MLBA 4Y4HD 3C6SA 5HGDA 4Z76B 3IFOB 2XI9A 4NM4H 3BVNA 1MRCL 4OLUL 1KCKA 2XQBH 4U1LA 1AO7E 4L8SA 5HPMA 1L0YA 3I6GB 1U8OA 4XPGH 4L8CA 5E95B 1FRGL 4KKCD 2OLDA 5GRUH 1LO5A 4XI5D 4PV8B 2K3TA 1FVCA 3DNKA 1L4IA 4LPCA 2DBLL 2H8PB 3B9KA 1MFEL 4JDVB 4UNVA 2IADA 1Z2KA 3NMEA 1MI5A 4NUJA 2VLJD 4G8EA 3P0GB 4X6BA 1YMHA 3GJFB 3T65A 5IVZB 1PZ5A 2AABH 1G1CA 1U8JB 3QXUA 2Y7QB 4UOJA 4BZ1L 2P8MA 1UH2A 1ZOXA 4I2XA 2IALA 4WW2B 5AG9A 5IHUH 2AXGB 3RPKA 3VFVA 4ZYKB 3T4AB 5D1ZC 4OAWA 5D5ME 2HVJA 1G9NH 1J0YA 4A2MA 2LU3A 4TPRH 5JNYB 2R0KL 3EHBD 5J11B 4ZNCD 4ZAKD 5ESQB 4GT7A 3GMOA 2CKBA 1T0PB 5IKCA 1KB9J 3NAAH 3HS0B 4LAQL 4RCAA 4APQD 5GGVH 4XMPH 2F74A 1N5YL 2M1KA 4MXQD 5KS9E 5CEZH 3TF7C 4AL8H 3VE0A 4K8RH 1OM3H 4HFUH 5CAYB 5IB1A 4QRSA 4PJBE 1G7MB 5IR1B 1IJ9A 2IPUG 5DO2C 1ZS8B 1MWAB 2NY1B 2NW2B 2DM7A 2OJEB 1GGYA 5ITFA 3D87B 4TRPL 3TO4B 4HC1H 4QHNB 2F8VA 3BMVA 3U0TB 1LDPL 1EUUA 4DKFH 4GG6F 2M26A 3TIDA 3S36H 1WIOA 5GGTL 1TQCB 5SWSB 3RFZC 3BPLC 1QO3B 1QHPA 3U1SH 2R9HD 4ODUA 3CVHB 1S7XB 3FTGB 3SHSA 3QPXL 3V6OC 4P4KA 4TTDC 4MA7H 1QRNA 3O2WH 1LEIB 5T3XD 1BD2A 1JZ2A 5ESVB 4H88H 2GT9B 1DQQB 1U8MA 4HC1L 3RAJL 1UFUA 4KH2A 1IGML 2H26B 4HMDA 2VXVL 2AJYL 1II4E 4OLUH 1QFWM 2D0GA 4HGWB 5FF6A 1PYWB 2R29L 2H2SC 3R06B 4L1HA 2NYYD 1A7BA 3T4AA 4ZYKA 4PD4J 1D9KD 3SCMC 3KDMB 1QRKA 2CK2A 2Q76B 5EO0A 2P44B 2NXZB 2HVKB 4H1LA 1EFXA 1BBDL 1DN0B 5DEGB 5KSUA 3PWVB 3T77A 4PJAA 4MJ5A 3ULUE 4IOFC 4WWKA 5CZVH 3S4SA 4WI3A 1VHPA 5D1ZB 5DMKA 1MHHB 3IAPA 3QRFM 2YRPA 2EH8H 3BI9X 5JOFA 3PF2A 2YD6A 2LVEA 1WAAA 4Z7VA 5TDNA 1G9NC 1KELH 1F4YL 1ONQB 1DEDA 1I7UA 5IV2A 1RSFA 5HPMB 5IW1B 3UC0H 1F4XH 1U2CA 5ERWB 3ARSA 5BMFL 3C08L 2X6MA 5FB8A 1JWSB 4LPWA 3MRQA 1FIGL 1SM3H 3LZFH 1KV3A 4N0UB 3H3KA 2Y23A 4FP8H 5FHAL 2DI7A 5HD8C 1TDQA 1L6ZA 4RRPG 1SBSH 1WJ3A 4WO4C 4LCIH 5GRUL 1K4CA 3I6KB 3W39B 4FQXB 5FYLE 4GG8A 4GKOA 4M8VA 4OCSH 3ZDXF 3PWPB 4OUOA 2X4OB 3RTQC 3ZKXC 2HFGH 5D93B 1AKJA 2NX5A 4FTVA 5BRZD 1C16A 3EOTH 4Y4HA 1NCWH 4JKLA 4DUVA 3P11L 1Q9WA 4CKVX 4PBXA 5IB3B 1CF8L 4ZXBB 6CGTA 3LKOB 4JDZA 2HJLA 3WD5L 4HHAA 3NABH 4NCC2 1OOAA 2BY3A 2X4NA 1U3HC 3QIWB 5DI8A 5EO9B 3FRPG 5KW9L 4UIMB 5IQ9B 4XBGA 4JANB 2IPKB 2FX9H 3IT8D 1JNHB 4OJFL 3MFFA 5AAMA 1FNGA 3KG5A 5E6IA 3HC0B 1INQB 3OB0H 4GXVL 4ZUTB 3MOQA 1ZSDB 2Q8AH 2NR6C 2R2BB 2YPVL 1WWWX 3BFOA 4CRPA 2GW5A 4JPVH 4NN5B 4GW1B 2B7DT 2PF6A 2DB8A 3GMQA 4NO2A 3UXFA 3PV7A 1GC1C 3O9WD 3PHOB 3V6ZB 4WGVB 1E6OL 1DQJA 1JGVL 5EBWB 1RVFH 2MCPH 4UDTB 5I2IB 4IDJH 1U58B 5IIEB 5KVDL 4JY6B 5D96C 5AYUH 5DA0B 4LFHG 2YK1L 4NO0A 3SN6N 4Q9QH 1AHWB 1NMAL 4UU9B 3G9AB 4Q58C 3IDUA 1VFBA 3D18B 3GMMA 1C16B 1UJTA 3IAQA 4YPJA 4OFVA 1M71B 5BZWA 5I1JH 4FQHB 4OFDA 4Z7OE 2EE3A 1MNUH 4GAFB 4CVXA 5HYSB 4FQCL 4ZUWB 3L6FB 3EDKA 5C86A 5L2KE 1UEMA 3JVGA 1AXIB 1H5BC 1RURH 1WT5A 1H3TA 3IU4L 3HNTH 3LS5H 4JFZH 1IGFH 3KNBA 3WHE1 4KVCH 4P23C 1A02N 3DX9B 5F6IC 3RUGF 3QEQA 4FABH 4L3ED 3TP4A 3VXRB 2YXFA 4KI5E 2AJXL 4TN9A 4NBYB 4HIIA 3NPSB 1I9RH 4W6WB 1D5IL 3TZVB 2GKIA 4M7KL 4NKDB 3F5WA 1A4JA 3D85A 4FFZL 4MNHA 5ANME 4NO2B 4HUWA 4YBQC 3D0LA 5IMMB 4Z77B 2QADD 4JR9H 1X6NA 2X89D 2FBOJ 1INDL 2YMXH 3N1MC 3PWPE 5KTEL 3WNOA 1MHHA 3KGRA 3BW9B 5TGBA 2JK5A 1KN2H 3VXOB 4GQ9L 2CRMA 4YHPB 2DQDL 1CXEA 5GRVK 1G7LA 4KY1L 2NY6C 4Z0XB 4ZDHB 4POZD 2C3VB 1PG7H 1MJ8H 4B7LA 4HMEA 4B53A 3RGVA 1MJJA 1UB5B 2O93L 3RGVC 4YZFE 5JPNB 5DVNA 3G08A 2WBJB 2R1WA 2QSVA 3DUHA 1DBKL 2EDBA 1IC1A 4Q0XH 3BUTA 3ARED 4UTBL 4JJ5A 4EBQH 2D7PA 4P23A 1CLYL 2BVOB 5L8LB 3RGHA 2YZ8A 3S7GA 1TVHB 2YS4A 1A47A 5E8PB 4GBXB 1C12B 1E0OB 3CMGA 3ZT6A 3CSYB 3SDCB 1RJLA 3CXDL 3VXUB 3WFBL 3HZYB 3PV6B 4ZUVA 5I15L 4KJPD 5C0RL 1AD0B 4FXGB 43CAA 1LO0L 3WLWD 43C9B 4JHAL 3ALPA 4KPHL 3RNQA 5J4MA 5FYLH 3VI4F 3QUZC 4BQ9A 1KEGH 3QHFL 3PNWB 3HC3L 3GDBA 4NRZB 4TVPE 5HHNB 3RWDA 1KCVL 1JZ8A 4P5KB 4X4ME 2VXSH 5IW1A 4GAGH 1U8NB 1YEKL 4MB4A 3FQTB 4HKBA 2NY2B 4EQ3A 4BQBA 5D7KD 4X8JA 5DRNA 4YXHH 4K07A 4ONFH 3OAUH 3HC0A 3QDJD 3RZCB 5KVDH 2X4UA 4QOKA 3BKJH 5BVJB 3GSQA 4AEEA 3WIHA 2H32A 2MPAH 1CK0H 1FFPB 4KQ3H 1W2KT 2AJSL 4CUCA 5T1DL 2OTUB 3HR6A 5IEHB 4LF3A 4DZ8B 4PS4L 4X4XA 1AQDA 5CGYD 3LCYA 1QQDB 5A16A 3AMLA 2VL5A 1T7ZA 1MHCA 4OZHE 2Y6SD 4JGJA 5FYKH 43C9A 3DXAB 3BXNA 5GRJH 3U48A 1A6TB 3IDYC 1JHKL 3ZLQC 3CLEL 4PY7B 2ZUXA 1E6OH 2VDKH 2OM5A 4KPHH 4GG8B 3U9PL 3IRPX 4Y16D 3MBEA 4U1GC 4PD4K 4FNLL 1CD8A 3NPZB 5ACLA 1J10A 4KVCL 1GGUA 1IGFL 3NTCL 4QXUH 3H7LA 5CD5C 2IJ0C 1LEIA 2QKIB 4NQDA 3MV7D 5D71L 2GY7B 1FZJB 3HI1B 1MCPL 3QNXB 4R4NC 1RZJC 4C56D 1S7XA 3CZFA 1XCTB 3O6MH 4F3FB 4JRXE 4KK9D 4X7SL 5D7JD 1T0MB 3KPTA 3BWAA 3ZYZA 4HUVB 4J7RA 4POZC 4Y2OA 5E2VH 3SGKA 1HHIB 1R5VB 3QH3A 1NGXA 1FYTE 4EUPA 2VLRB 1JZ7A 3QAZC 5CP7B 3QCTH 2PO6C 1K6QH 3W9EB 4PTTB 2P8PB 4IIQB 4JG0H 5IHLB 3RVUC 1IKNC 3V4PL 1BQUA 3EYVB 3TH3T 3ZE1F 1UENA 1J1OH 4Y4FD 4QRSB 4GRWH 1M7IA 4D94A 2C7UB 2YD1A 2F5BH 3OJVC 1EHNA 2Q6WB 4R3SA 1X5JA 3HZKB 4JY5H 3I50L 5GGQL 2F5AH 4H5SA 5IB4A 2ZOKB 1Y0LA 5CHNB 3MA7B 3GM8A 4L4TB 3IDNB 1C8PA 2F54D 2FL5B 1JMXA 4NQDB 2V7HB 5DEZA 5BMFH 1CFQB 1FAIH 2VLMD 2CJUL 5IB2A 2AGJH 3FQUB 4MD5A 1NCDH 1Y0LB 1B0RA 1R0AH 5DEFA 4CN4A 2HTLC 1OF2A 4O9HH 5E9DD 5FGSA 3EO9H 3UAJC 1LP9A 2R4SH 3CMOL 3ESVF 5E6ID 1F11A 1FNSH 5H8DA 3BO8A 5FEBA 2WQRA 5DUPH 2ZUQB 1AFVH 1JGLL 4OGYH 5FHBH 4K23L 2NZ9D 4YHIB 2BXYA 1JPTH 2HFTA 4HWZB 2BP3A 1VEOA 5C0FA 2R0WL 2HTKC 1M7DA 2XXMB 4P49A 4JFDE 2A9ML 1YEDA 4GG6E 1HQ4B 3TBSA 3CXHK 2X4RA 3EYQC 1U8OB 1QR4A 4LPVA 4OZIE 5JUEL 3EOTL 5IVNA 1AGDB 2H32B 1SM3L 3LZFL 1T0NB 4O2CA 4NCC1 3BKCL 1PQZA 1EVUA 12E8H 5ALCL 4LVNC 4PRNB 2E6QA 4YDKL 2Z92A 4HUUA 3BGMB 2R15A 2X4TB 3FCTB 3QIBA 4X6FB 1NKOA 4JKKA 1MVUB 2B8OT 4KAQL 1TVHA 5E8PA 5CGMA 3GSWA 3G5ZB 1OP5H 4CJ0A 2X9WA 1R3LA 4RSVA 4Y89A 2VLKB 2VLRE 3CVIH 3HHRB 3RNQB 1RZIA 3P9MB 1MFAL 5D1XD 5D7IB 3VFSB 2VC2H 1JWUB 3QJFA 3GHEL 1JGLH 2OL3B 5E00B 4R8WL 4JG1L 5C08B 4J23A 1A3LH 5D7JC 4G9FD 5AZEH 4ODVL 4UDTA 1UM5H 1IZJA 4K8RC 1VEPA 2B0SL 2NY1C 5LGHL 4P9HL 1WIUA 2E27L 4MA1C 1OSPL 5KSBA 4Y4KD 4H1LH 3DV4A 3RNKB 3UTTA 1HH6A 2R2EB 3G6DL 5CUSH 5HYIA 3VI3E 3MLZL 5ERWA 5L2KA 2BNQA 4QCIB 1S9VB 5F7DA 4MHHG 1ZWIA 4Y1AE 4Y19E 3FMGH 3VWKB 3JV5A 4I3RL 3QDGD 3RY6A 1ONQA 3SKMB 4WENB 3EAKA 3B5GA 2XXCB 2LV4A 4JFQA 4PJ7E 3NCYP 5ID1B 2CXGA 3MA9H 1XT5A 3LKOA 4JDZB 5GS3A 1LEGA 1S8DA 5KG9B 1YMMD 4XMLL 4L3EE 1WVZA 2DJUA 3ZDZE 2VLME 1OP9A 4TRPH 3MLVL 3RU8H 4I18B 5GGRY 5I0ZA 2AJVL 2A6DB 4GKNB 4CVUA 2HFEB 2HTLD 1RHHA 3Q6GL 1A6UL 1KN2L 4BSWB 4AMKH 5DD5H 5JPMA 5I66B 2AKRB 2J1KA 3BXNB 3U0WL 3MV8A 1JK8A 1UB6B 3ARGC 3QCVH 1C5CH 5F3BA 4HG4K 4BQ6A 5IJVB 5DHXB 5CBEA 5HHME 2C1OB 2HTKD 1A6VH 1H3GA 4LHUD 2RFXB 3BSZH 3L7FA 4JQIH 1JYVA 3RGVB 4XPTL 2BVYA 3KXFA 3MLVH 1QBLL 1NGXB 1OGTB 5DYOA 3O6LH 1KF9B 2UZIL 3NIDF 4ZO6A 4ZFOA 3L3GA 3HNTL 4JFZL 3QZWG 4M48H 2J8UB 4HKZA 1NCAH 4M02A 3D3VD 1CGXA 2VLRD 2AEWA 3F7QA 4NQSA 3I85A 4G8FB 3QP3A 1MNUL 4C56A 1IBGL 3MMEB 4XAKE 1UM6L 3AREB 2VDMH 3CD4A 5B22A 5FYLL 1L9MA 3BD5A 3O4LA 1F3RB 4POYA 1V3KA 4JRWA 3B6SB 3MUY1 1M7DB 3MV7B 1CYGA 1JWMB 5B3JF 3R06A 3L7EA 3BGFC 2WIIA 3GSNH 1AJ7L 3W82A 1BVKA 1MIMH 1CLYH 3G5VB 4NKOB 4QXGL 3G6JB 5DWUL 2W9DH 4XNYH 5D6CB 4HK3N 2VLKA 2XQYK 2WP3O 4G8GD 1OCWH 4HD9A 2CD0A 5C8JB 1IC7L 1AO7B 5IESH 3CGTA 1MVUA 3RI5K 5JORB 2HJLB 3B5TA 1MFAH 3SJVB 5ID0B 1TFHA 1VEMA 4HPOL 2E9BA 2Q86B 1FH5H 1NCNA 2IAMA 3TEUA 2ZCLH 1FDLH 4P0DA 3TYFA 2F54A 5D2LA 2FCBA 5KJRL 3G08B 3L1OL 1UWXK 3DRQB 1N5AB 1BQSA 3TYGL 3UO1H 2BSSB 3EZJB 4LLYB 5C9JA 3TIDB 1U95B 4MA8L 4NBZB 2X4RB 3KLDA 4D2NA 4NFBA 4M5YH 4O2FA 4OFYD 2CGRH 4GSDH 5K9QG 4MVBC 4WW1A 2BCKA 2FEEL 1TCMA 4AMKL 4PGEA 1UWEH 2I9TB 5KN5A 2XWTB 4PJFA 4LNVA 3QUKB 2P46B 4IM8A 1IAIH 1MCOH 5KVMC 4PJ7A 4PJAF 7FABH 1EZVX 3EJYD 4ODWA 5HHVL 4U1LB 4BUGA 1I1RA 1NGPL 3WCYA 4OCRL 2YD3A 4HHAB 3LHPL 3HS0A 3VWKC 4P23B 3PWNA 3RRQA 2V7HA 1F4XL 1RZIB 4C58B 4NWTL 2QSTA 3N9GL 5H2BA 4U05A 4XVSL 3PDDA 2FX7H 5EO1B 4GMSL 5T1LD 1I3GL 4P46C 3DGGB 1JUFB 5IBLC 4QWWD 3CSBA 4PJBA 1RU9L 1T2XA 3QXTA 4TUJB 1KJ2H 5F7MC 5F7WC 4PG2A 2ZSVA 2BFVL 3PJSB 1D5IH 3NBNA 4U49A 2A6JB 4I18A 3D39D 4G9FE 1A6ZA 1XZ0A 1TETH 1IM3A 1YMHB 3T65B 4RDQF 1MHCB 5I1EH 2Z9TA 2F5AL 4DKAA 1RUKL 3EFFB 4U6YA 5FM5M 3P9LA 2WBJD 3A67L 4DZ8A 1RURL 4TTDD 4LCUB 2AK1H 3DIFB 1XGUB 3EO1A 4FNLH 2E7LC 4HJJH 4K7FB 2AJUL 4P59L 5EU7C 1MAJA 4J3UA 1I7RA 4H0HB 3K74B 4ENED 3DARA 4P4KB 4U3CA 1WUNT 1I1YB 4L3EA 2EDLA 1VFAB 4KROD 1P1ZB 3LIZL 5IR1A 4UB0L 4XVTH 3LKNB 1NMAH 4LLUA 4JPKH 4RAHA 4D0CB 3HAEH 2J88H 4FQJL 1YEIH 5MERA 2IC2A 4F57L 4JFDA 3T1FB 1MIML 1O0VA 3RVVD 4XCFH 2DKSA 3DETD 1SYSB 3MLXL 3H6JA 4OT1H 2R2HA 3NVQA 3FQXB 1SYVA 4MLIA 1IAIL 1JZ4A 1X5KA 1MJ7L 3HE7A 4GBXA 5D1ZD 4Z7UE 3MV9A 3CFBB 1BD2B 4NOFA 3EHBC 2ZCLL 1IEAB 5C0AA 5B8CA 1TMCB 1T21A 3GI9H 2EC9T 3BEWB 5DJ2B 5T3XL 2DYPB 4JO1H 4S1RH 5JMRA 2MKLC 4FOMA 2B4CC 2PW2B 4MSWB 5IW6B 4RFNC 4R2GC 1U9KA 1VA9A 1CXHA 5IW3A 4MCYB 3Q5TA 3B9DA 3FQRB 3L3GB 5JXAL 3LHPH 2HLAB 4YWGL 4M6NH 1A7RH 1P6AB 3BWAB 1KC5L 3MUJA 2WANA 4XPBH 2GIYA 1TIUA 4OLVH 1D7FA 2NW2A 1SJHA 3QRGL 3VXNB 1JF1B 2GCYB 1HHGA 4A6YA 2CUHA 4BFBD 1RZFL 2X40A 3NCEB 4U6VL 3IVKB 2VWEE 5DJXA 4JE4B 2NXZC 43CAB 3MRIB 1CWVA 5JIPA 2DQUH 1T5WB 4PR5B 4XH2A 2DWDB 1D6VL 3EJZD 2R69H 4Z78A 4HIIB 1ZA6A 2AERT 4PJXA 2WWMD 3QWQB 3MODH 4QRPB 2X42A 3BHBB 5I76A 5I73C 2BSRB 3C5JA 2B2XH 4JHWH 4A6YB 1BF2A 3DO7A 3MCLH 2ED8A 4ODVH 1B0GB 4Y1AD 1YEJH 5EA0H 2W07A 3BISA 1YYML 3GIZH 5MEOA 2BNRD 3HN3A 2DWDA 5IP4A 2HJFA 1XGYH 4WU5B 5IMLB 1I75A 4O00A 5C71A 2C3VA 2BOCA 2HLAA 1KIQB 3LKPA 1NAMH 3BP5B 4U1NA 3MTRA 3SE4A 2JK5B 1BZQK 4KROC 2I9TA 3N0PB 3BPNC 4XNUL 4JQVC 4XCYB 1YY8A 3P77A 1Z9OA 1HHIA 5C0AB 4QHNA 4RMSA 1QFWI 1DBAH 3MRBB 3TM6A 2EYSA 2H41A 4XMKH 2F53A 1Q9KA 1HOCA 3DX6B 3TNNB 2W38A 1K5NA 2R0ZL 3IKKA 4LQFH 2EO9A 3DX9A 5I8CB 4D8PA 3TWCL 3DTXA 2BNQD 3SDAB 4HIHA 3FQWB 1A3QA 1VSCA 1R3LB 3QI9D 4DGYL 4KKLD 4LVEA 3AU1B 1OD7A 5E08L 1JTOA 3CH1B 4MCZA 2VQUA 3Q1SL 1HCFX 4JFPA 3RWGA 3ARBB 1ZXQA 3DSNA 1T1XB 3BSZL 4JQIL 5J1AA 3P3YA 3UZQA 1UKTA 2RJMA 3KPPA 1OD9A 1RZKH 1HQRA 4FTVD 5IFHL 5DMGC 2X4OA 3HC3H 5CIPH 4NN6B 3Q6FA 4WO4D 1DBJH 2X9YA 3LQZB 3P4MA 4I77H 4R0LA 1DVFA 4X6DA 1U58A 3VGHA 4YXKL 4NZTL 1B6DA 4OLVL 1CFVL 3MJ8A 1CTNA 5CEYA 1I7RB 1G7HB 1IC4H 4P2QB 4RBPK 3U4EA 3QA3A 4N5UA 4ELMF 3PQYE 4FG6C 3P11H 4NUJB 4YHMH 4Y5XC 4OSUL 2AVGA 1LE5B 4IDJL 3NIGF 1IGCL 4BZ2L 1JNHA 4NNYB 4GRLC 1V7ML 2VSDA 3QBTB 1K2DA 2BOBB 2P5EE 4PJ5E 4QRTA 3VXME 5BOPA 1E4XH 1NUNB 4YDVB 1OQOA 4G43B 5L0QC 3OGCB 5C9KA 1YEHL 2BSSA 1OAQL 4JZJA 1CDYA 1LQSR 3FOLA 3HCVB 4QHMA 1BIHA 1FFNA 2CK0L 5FUCC 1MFCL 3DVGB 3TA3B 4UT9H 3E3QC 4KXZI 3QO1A 1WWAX 2PO6B 3PWVA 4EEEA 4JY5L 4MXVE 3RA7L 1YMMB 2P49B 2L7UA 4PIRF 1A9BB 3JWOL 3VWJA 2VZTA 2V5TA 1LK2A 4MQXC 2G2RA 3MRMA 3SQOH 1KLFA 2NXYB 3LN9A 1AFVL 4JVUA 5EN2B 1NCWL 1YJDL 1BFVH 4XP1H 5EBLB 3D18A 4X99A 3S96A 4Z7UA 7CGTA 3TA3A 2FSEB 4IRZH 1SQ2N 4M8QB 4P57A 2VDLL 3CSPA 2PTTB 1T66D 5E2VL 3QIUA 5CLWA 4ZXBD 3T1WA 2GTWB 2V2TA 3BN9C 5AG8A 4OM0L 3S35L 5EOQL 4OGYL 5FHBL 1TVDA 2GY5A 1X5ZA 5F7DB 4OF7A 1QNZH 2OS7A 4YX2L 5C6TH 2FYYA 3JV6B 1NDGA 2DICA 1OAKH 2XZAL 2ED9A 4WU7A 5KVGL 5GSRB 2VZSA 3CMOH 4I9WE 2BMKA 5FA3A 5IF0A 2N56A 4QHUB 4XPHH 4HAFA 3EGSB 5H94B 5DJCB 1NAMB 1CQYA 4Y0GA 5ANMB 3CK0L 5T1MB 2PCPA 1MHEB 3D39E 4HFWB 1PGRB 2VERN 5E00A 5INCA 1R5WA 3QUMH 2NY5L 1H3VA 4P2RA 3EO0B 1Z9LA 4S0TD 4FFYL 4KDTC 1G7QA 2NY2C 4XC3L 4JFOA 2YKLH 1AIFB 3X11B 5DC9B 3B2UD 4M62L 1I1AA 3AU1A 5CJ5A 3QDGE 2E6PA 1MCDA 4Z9KB 4U7SA 4EI5D 1GCFA 4APQA 1UA6H 2NLJB 1S7TB 2VXVH 5D7KE 3CU7A 4TSBL 4P46B 1DBBL 4KUZL 4OGZA 3CVHA 5ESQA 5E2WL 5JR1H 3H9ZA 2ZG2A 4WUUB 4BFGA 5DURB 3KHOA 3L7EB 1CFVH 2AQ3A 2QR0A 5EUOF 2P5ED 4GAGL 5HVHB 3C2AH 2AXGA 3MGTB 4KU1A 4PFEA 1AGDA 5FYKL 3ZYJA 4GSDL 3RL1A 3TPUB 2C9AA 1YN7A 4KMQA 5HI5D 3WFCH 5HHNA 1ORQB 3RWDB 3IDXH 5DUBA 3VD9A 5FM8A 4QHLB 1EHAA 3P4LA 3BN3B 1ZKAA 5SWZA 4OQTA 1CFNB 2HT2D 1SY6H 2X1WL 3ZTNL 2VZVA 5CKGA 4HEME 2V5RA 3PJSA 4N5ED 3GM0A 3U7YL 4QOKD 3QEHA 3G5YB 1EEZB 3BP7B 3U9UA 2XKUA 5C08A 1KTLA 4S1QH 5HGDB 5I8OL 5KANI 2AS5M 1U36A 2YMXL 3AS2A 4HS8L 2IPUK 3UJJL 4XP4H 5H2BB 1UGNA 1OARL 5IB3A 1UXSB 3GBNL 4MAYD 1WZMA 5DD0L 3ZKQD 3GSOA 2UV3A 3TCLA 1N6UA 2VZUA 3C6LD 1RZ7H 1F3DH 3QEQE 2C3WA 1AJ7H 1PSKH 3THML 5JOPE 2P24A 1A5FL 3MNVB 3MUHL 5CGYC 4PJDF 3D9AH 4PJ8D 5GJSL 1QSEE 3MRIA 2DQGL 2Y6SC 2DL9A 3QFJA 3IF1B 1JHTB 4CNIB 1NC4A 1ZLWH 1HHHA 2J6EH 2FIKA 2NX5E 1D6VH 4RDQG 1LE5A 3ARFC 3ZE1E 3A6BL 4CL7A 1N6QL 4PGEB 3B2VH 4GRMA 1S3KH 5J89A 5I1HL 2BZDA 5KS9A 3WUWG 4GUPB 2IAND 2DS4A 4JREC 2Q76A 4OD2A 5EO0B 5IMOA 2MCG1 5IVXA 3Q48A 3DI2B 3DROA 4JKPL 4AJ0A 4NRYB 4Y5VC 3EOBA 3OKDA 3MRFA 3BUYB 1UA6L 3HI5L 4YHIA 3QUYD 3VFSA 4AT6A 3L5XH 15C8H 3T2NL 3UJIH 5JHLH 4M4RA 2Y5EA 3GJFK 5DEGA 5KSUB 5DD0H 1UACL 3UDWA 2PO6D 2Y5TB 4ZG1A 3RJQB 2R1XA 4F9PA 4OLXH 1VACB 2KPNA 3T8XB 1MOEA 5CIPA 4PJFF 3ESUF 3GNML 2ERJB 3FQXA 3KPLA 3T3PE 2FHFA 3WFEL 5E24E 4MQTB 4M7KH 2WBWB 4ONGH 3EO0A 4ELKA 3VXMB 1FE8H 2C4FU 5SX4I 5CKAA 3G5ZA 3RWIB 4NO0B 5KVFL 3ULVD 4ZSOA 2VTFA 3FN9A 3KPSE 3INUH 1BGXL 4XTRD 2Y9RT 1H0DB 1MCKA 1NUFA 4P4KC 1MCWW 3O4LB 4F8TA 3LMJL 2I60L 1CN4A 5DXWA 2GYSA 1MFDH 1N5YH 2LTQC 2H3NB 1AP2A 3BPCA 3DUUB 3IJHB 5IF0B 2YC1B 4NGHL 3SDXF 2CRZA 3ILQD 1A8JH 3CFKB 1ITCA 4R4BB 5I1KH 4OGAD 1NCBH 1X5HA 2OZ4L 1YJDC 2GFBA 3IDIA 1WITA 5EZIL 3SGEH 1G9NL 2ADIB 2OTWB 3AAZA 3FRUA 3O4OB 5I1DA 3B8YA 1A5FH 4YDIL 4S2SB 1PAMA 2QHRH 4YXLL 5C0FB 1P4IH 1BZ7A 1TXKA 2ESVE 5FYJU 2IH1A 1R5IA 1N0LA 3V6BR 3UBXB 2LABA 4NIKB 1XIWC 4HJJL 2QQKH 4PRDA 4XPAH 1XH3B 4DQOL 3AS1A 5FGBA 1QHOA 2EICA 3OJDA 3F7YB 5DMJB 4ETYA 1ZGLB 3VXUA 1FGVH 1AXSB 3HUJF 2G2RB 4UB0H 2QLVB 4LASH 2XFXB 3VFUB 1DTUA 1UJ3A 4RISL 1RIVL 1TETL 3GIVA 3PQYD 5JHDB 3MBEC 4PJCF 1RUPL 3HMWL 3WUWB 4FQPA 1GGBH 2UVFA 3HE6D 4N1HB 2DL2A 4UQ2A 3SGDI 3HCVA 4QHMB 1JWSA 4O4YL 4YDLC 1QVOB 1Z0MA 1DSFL 4RQQB 4KQ4L 2XKNA 4RMVA 4L4VD 4RNRB 5GRZA 5T5NG 1RZJL 3IJSA 4X6DE 1P2CB 1YZZA 4HIXL 5LGJB 5HJ3A 2AJYH 2A0LC 5T3ZL 2AJ3A 4S1SL 1B4JH 4XNXH 5CZVL 4ETQB 1H15A 1U8PB 4OZHA 3FFDA 5SV3A 1FV1A 2NY0D 4Y2DA 4KVNH 4JM2A 1UCBH 3JWOH 1KEML 1BBDH 2J7LA 1BEYH 5ADPH 2H32H 4YXKH 4P3CH 3RIFK 1G6RB 4JY4A 2V7NB 2ZP0T 3PGDA 4XT1C 3QT2A 1T20A 1A6WL 4LVHC 1G6VK 4EI6A 5DUPL 4NRZA 3SDYL 1P7HL 3VRIA 3T0AA 1IGJB 1NBYA 4QOKE 1EDQA 4HWBA 5F7EH 2APBA 5DJ8B 5KZCB 4OLZL 4Q6IA 3BP6B 5E7BA 3RUGE 4OZ4B 5GPRA 5TDOB 1X4YA 5GRYA 1Z5LB 1L7TH 4HS3B 2HN7A 3L6FA 3O4LD 1OT1A 2R1XB 5F71A 2BJML 4DEPB 2FD6H 4EVNA 4PJIE 4QYOB 3AB0B 2DJ4A 2LQRA 1UT9A 2CIIA 4F33B 3MRDA 3D3VA 5BVJA 2WWKT 4X9FA 1QO3A 1HWHB 4O2CB 3CCHB 1XGQA 1MFBL 3BPOC 5B39G 4KZEL 3B9AA 4QT5B 4Z8FH 5C0DA 4V2CB 1D6EB 1MH5B 4FZEH 3UMTA 1JTPA 4NWUH 1AGFB 4ONGL 4X6BB 1C5CL 1XF3A 3QXVA 2CR6A 5HYSG 3EFFA 1LO4L 3LEXA 1BD2D 1NUGA 5J11C 3O3EB 5IHUL 1CT8B 3GMRA 4JLRB 5D7IF 3VFRB 1A6AA 4N90D 3D69B 4I4WA 2HH0L 5EU6D 2VABA 5A43C 5BJTA 4EIGB 3LKQA 3WFZA 4G5ZH 1AD0A 3BIAX 3E8UL 4HLZH 3TWCH 4POUB 5BRZB 2QR0B 1ES0A 4PJBB 4H8WH 4OCSL 3VGDA 1QBAA 5IM7A 1ZAGA 3TFKD 3RAJH 3KPNA 1HSBB 5BO1L 4YK4B 3IDJB 5GS0H 1EAPA 3CU1A 4JPIA 1LGVA 4QTIH 3V8CA 1CLZL 1RJYA 3RA7H 4EVNB 4V1DD 1BOGB 3O81A 3QO0A 3WN5B 4Y4HB 2LFGA 2JJVA 1NEUA 3QULA 1LO2L 3SKNA 4X7TB 3V5HB 3PV6A 2SEBB 2R0ZH 5K9OA 2CUMA 2EDQA 4HXAL 3C08H 3TBWA 4DW2L 1QFWL 1DVFC 3HG1E 3OTTA 3O2DA 3MOBH 1P7QA 4YE4L 4ZDHA 4ENEC 4ZOBA 3QXAB 4OIIL 5EOCL 1MFEH 5IWLC 4M48L 1K3IA 2DQGH 2PETA 3L95A 3TYGH 3GIZL 4N8PA 4Y4KA 3IYLW 3QCUH 3RWCB 1EHLL 1XGTA 5GGVL 2XTJC 5F1IA 3MLTA 3U79A 4OSUH 3MLRL 1YDPB 3JTSA 4IRSA 1TZHB 1MCLA 2B2XL 3VD5A 1I1FA 2D31A 1NMBH 3BGFB 3D85B 5J3HC 1HXMB 2ZOLB 3TLRA 3ZZ1A 2ESVA 1CD1A 1YYMH 2EDEA 3CZFB 1RY7B 1FORL 3I2CL 3DV6B 4QXGH 3W2DH 3MCKB 2G60H 1S7TA 3ULUF 2NY4D 1FIEA 4D9QD 5ECJE 1MI5D 1T4KB 1OWWA 1RK1B 3CFBA 1YY9C 5C07A 3OG6B 4M4PA 2RCSL 4E0RB 4ZODA 4GW4A 5E8NA 1P9MC 3HFMH 3HE7C 3KWWB 4HGWA 12E8L 2UYLA 2AEPH 3AY4C 5E2TH 4XVJL 5FV2A 1GOGA 1XEDA 1F8TH 3AY4A 1DR9A 5CJQH 5DHVB 1UM6H 4UTBH 2UWEF 3W0WA 5FDWA 4NJ9L 2E8ZA 5IVXE 3MJ7A 2GI7A 1A9BA 1DQQA 5BVPH 2JB5L 4FFVC 4JRYB 2XZCL 4R4FL 5EOTA 4BKLB 3CDGA 5ISZB 3BEVB 4N0RA 4ONOA 1WZ1L 4LCCA 4Q6YA 3S36L 4EJ1C 2X4TA 2Z92B 5E2WH 2UUDH 3O8XA 4W81A 5D7LD 4LCYB 4ZTOH 3X13A 2ZJSL 3F7PC 1AC0A 2Y07L 1U8LA 3EW3B 4XNUH 1CFBA 4MNQE 4F2MB 2CDEB 5CP3H 1OPGL 4MX7B 1K4DB 3OKYA 4WU7B 2AJUH 1X7QB 1EGJH 5EZLA 2NY3C 4L4VB 3GSVB 3LKSA 2FDBP 4PJCB 5ENWA 1A6AB 3V4VL 5D2LE 2VC2L 3LV3B 5T3ZD 5LVEA 3TO4A 3GGWA 5EZJA 3BKCH 1MSPA 3TPKA 4NZRL 1XF3B 1KPRA 4HAGA 1K3ZA 3WDIA 4CN1A 4HX1B 5D1ZA 4DFIA 2YXMA 2AJXH 3UTQB 4U0RC 3DSFL 1ZA3B 5DQ9B 3N1GC 4LSTH 3PWPA 3WSQL 4WI6A 5D93C 2A6IA 1TQBC 3MJ7B 2BNQE 3HG1D 3TBYB 5MEPB 4K94H 1DUYB 1U8IB 4Z7VF 3WMSA 1KB5H 5HDBF 5L0QB 1YEIL 5K9JH 3SGKC 2ATKB 3KWWA 4GJTB 3JVGC 3LPFA 5C07B 5EZIH 4MJIE 3BE1L 4KTEH 3IRZA 4PB9L 3SE8L 4V1DA 3L3JB 3DVIA 4HW6A 2DLEA 1MUJB 2H9GA 1RMFL 2HJKA 1OSPH 2FJGB 4PJ7F 2NPLX 2X1OA 2GJ6A 1PZ5B 2QQLH 3RWFB 2ORBL 5C0BD 5FOBA 3DX6A 3TNNA 1PDKA 5ESAA 5EPMB 4LASL 3C5SB 5TGBB 5HY9A 3NACH 2EIZB 4DTGL 2E9IA 2OI9B 3C09C 5DS8B 1BGXH 4HUXA 1HHJB 3BDBA 2J4WL 3C9NA 4JO1L 4FQ2H 2IG2H 3ZKNC 2VR9A 3MGAA 1LP9E 2BNRE 3P40A 2HVKA 4H1LB 5DK0B 2BRRL 4FQLH 1A6PA 3D39A 3ARXA 1YNKL 3MCG1 3VXMD 4L5FH 2Y07H 1QEWB 3E2HB 3NCBB 3AC0A 3WEXB 1Q9OB 1RULH 4WUKL 3A6CL 2ITDA 4U1KA 3C6SB 4NGHH 4WGWB 2HAZA 3ZKSD 4QRRE 3SO3B 4HV8B 2NY6D 4RGNC 5D2LB 3GB7A 4U6XA 1NCBL 4Z0BL 5L88L 1DL7H 5T1DH 1G0DA 5TQ0L 3IETB 2ZUQC 5L7XH 2F74B 1T83C 1RIHH 2APVA 4LGSB 4D0DA 2CLZA 1T1YB 5ALBH 3GSNL 2PUQT 1KN4H 1SEBB 1OP5K 3TIEA 5GS0D 5IJKC 3L3KA 1I8IA 3M07A 5DZNA 4H20H 5C0IA 1AE6L 3AUVA 1K5NB 3MV7E 3FN0H 3UO1L 4UTAL 1SHMA 3L3OB 4NT6B 3MOAH 5BRZE 5TPWL 4PJ8A 3IB4A 3WJJA 5SWSA 1TZIA 4PJ5B 4UAOC 2VXSL 4PJXF 1JPGB 1KBGH 3SGDH 4PRDB 3OKLA 1JYWA 3VXRD 4Z7NE 3FO0L 4M7LL 2FO4A 3VMNA 1GRWA 2W0FB 1FL3A 1QRNB 4PJDB 3UC0L 4PGBB 3TBVA 4LLQB 3V0WL 1TVBA 4LPTA 3V6FA 5CEZE 2DIBA 5GXBB 1JZ5A 4LSRL 4I0PA 2JKXA 2X4UB 1IEHA 5KSVB 1FNLA 3DI3B 4MA3A 4ZTPH 3CFJA 4X6CA 4NQDE 4KQ3L 4PLOB 4HDIA 5CD3B 2O5ZH 3L3DA 4M3JA 2BOCB 5I73B 4EXPX 1JPGA 3L5XL 2F58H 4WU5A 3OB8A 3FB8B 4XBGB 5E5RB 4IIQC 3KXFB 3LY6A 4OZGE 4Y5YC 2ICEB 1N8ZA 1S3KL 3Q5OA 5AD0A 1A0QL 1Q1JH 2OJEA 2XN9D 2DDQH 1NGYB 2DQFB 5TE6H 3T2PA 2YSSA 4IOSD 1JV5A 3N9GH 2C26A 3TVMD 3VU2A 1UWXH 4DQOH 4QNPF 5TDPB 2VLLB 3ORJA 1CR9H 1FYTA 4X4YB 1CD9B 3D9AL 5BS0E 5JOPD 1T66C 4LEXL 3MRNA 5I1LA 4OCRH 2P5EA 1ZT1B 1RZ7L 1RHHB 2PTVA 3T3PF 3GKWL 2UZIH 1UVQA 2VAAB 4K9EL 1NGYA 3VXUD 3NH7H 1NBYB 5HDQH 1H8NA 3FHQA 4JRYD 5JHDD 3Q3GB 2ICCA 1FN4B 5DQJA 4ZFZB 1R3KA 4IOIA 3KJ4C 1YPZB 4KJQC 5F7KC 1FHGA 1S7QB 4WDIA 1JGEA 3UTSA 3GHBL 4OGXL 2VLRA 1DLHA 4AT6B 1CBVL 4NN7B 4DVBB 1FC2D 3WO4C 5DJZA 4G6KH 1UWGL 2IADB 1CLOH 1V7NH 2ADFL 4P9HH 2Z8WC 5HD8D 1WBZB 1GL4B 4MAUL 4RGND 5KS9B 1PSKL 4HCRH 2FO4B 2DLGA 2YPKB 2D9CA 4J3VA 5IB5B 4OD3H 3T3MF 3SKUD 4MNHB 5D1QD 5F3HB 5T33H 1NGWA 1ZLVH 3RDTC 4GLRH 2IH3B 1MCRA 3GNMH 3QG6A 2W60A 2R1YA 5I71C 1FFOA 4BH8A 5IESL 4DN3H 1MLBB 4J3TA 1CVRA 8FABA 2EO1A 5GISH 3OAYK 3C5ZD 3GIVB 3R0MA 4MD0B 3W11C 2EEDA 2IQ9L 2D7TH 1ORSB 3QEUA 1I9RL 1PG7L 4OZHF 1U8KB 4DVRL 1RIHL 5DK2B 1JI1A 1TPXC 1UKQA 3CFDA 4PP1D 3JV4A 3T0BA 3ARDA 3OQ3B 1UZ8B 4HKXB 5CJ8A 5DFWH 3FT3B 1GGCL 5BZWB 4ONHB 4PV9B 3V5KA 3PXJA 3WXWL 1NCCL 2EDHA 3RVWC 2ATPA 1HSBA 4KHTH 3OR7A 4KZDH 4AIZB 4DJMA 1JYXA 3QHFH 4MQXD 2AK4A 1Z9SA 2QSCL 3WV0A 3GMNA 4ESKA 2VXTL 1KLGA 4P3DB 4HUXB 3QNZB 1N7MH 5CILL 2EE2A 1KJ3L 3HPJA 2V17H 3GMQB 3PHQA 4GW1A 2G9HB 4LMQI 1HN1A 5DD1L 3X17A 1MJUL 2YC1A 1TNMA 1OT2A 1UM5L 4K3EH 2XYCA 2F53E 1A6VL 3EYUH 3W81A 5AZ2L 3HPJB 2DQTH 1KTRL 4GAYA 3V2AR 3FAXA 4PJXE 3ZHLA 3CDGB 5DVKA 3OJMB 3OAZH 1ND0B 5ISZE 3Q0HA 1LP9B 3Q6FB 3D6GA 3QIBC 4LBEA 1CE1H 1OAKL 1TNNA 2D03L 2R0LH 3H9HB 2DRUA 1GPOL 2FX9L 3SJVD 1MQKH 2J8UE 4YEFA 5GS2D 3ARBA 1XMWA 1F2XK 4JRXA 3QR2A 4WHYG 1KB5L 3O41A 3RVXC 4ZFFB 5IROC 4KHXH 3QUXB 1BREA 2EC9U 3LD8B 3TNMA 1OY3B 4LARH 3QFJE 5LKNA 1ORSA 3CXHJ 3MCKA 4MNGE 4Q9BA 1OTTD 4M6OL 4NSKB 4GG6B 4DCQB 1LK3H 5C70A 8FABB 2Z8VC 2HFGL 5KVGH 5F1OB 4K3GA 3UPRB 5C7XH 5I19H 3VXPB 1JJUA 1QNZL 2Z91B 1JNLH 1F4WH 1JRHH 4N0UA 1T2QL 2NY2D 3FAWA 5DD1H 1GHFL 4HKJA 3SY0A 4RWHA 2B1HH 1R0AL 4NZRH 5FKPA 4UQ3A 3EDJA 4PGCA 4LVNB 4K8RD 3KPSA 4PTUA 5E5UB 5SWZD 4K23H 2DMCA 5DHVH 1AHWC 2K1MA 4PJGE 5C09A 4HUVA 3C8KA 1YNTA 2XZQH 3RP1A 5GS1A 2FJFA 3IFPB 5DQDL 4DOHB 1JZ6A 4YGAB 3KPRE 1LK3L 4P9ML 1XCTA 5E9DA 4K94L 4WWKB 3OBAA 1NCDL 4PJ9B 3GUTA 4LCIL 3BZEB 1KJ3H 4M7ZC 1PX4A 4HZAA 1IGCH 2C1OA 5EOCJ 5HGHA 2X09A 4U6HB 2IQ9H 3OXRA 3S97C 4L9LC 5AYUL 3NFNB 1DQML 4P4KD 2H1PH 3LRHA 4W4OC 4XC1H 4PJEF 5ICYB 5D6CA 4LRNL 1ZVYA 1UC6A 4XX1G 2FJHA 1GAFL 2H26A 1KCLA 1MWAH 1E4JA 2CIKB 4TVPD 5E8EA 4PGDA 5T1KB 4P9MH 3N06B 4X4XB 1EEZA 4MA8H 1S9WA 3BQUB 3KYOB 4ZFFA 5ESVA 3F58L 3V0VA 3T2NH 3H9SA 4RZCA 3DXAE 4EDXA 1E4WL 3CVHL 2EDYA 3MBXL 1K6QL 1NCUA 5TQ2H 2P8LA 5E03A 3MFGB 3GO1L 3VFGH 4G8FA 4YHYB 4AEIL 1J8HE 1PD6A 1AGBB 2R0WH 5AWNL 1X44A 3KS0H 5D8JH 2V5MA 2PYEE 5IBUG 3O6FC 1DLHB 3U36A 1VGKA 4YDJB 4CVWA 3C8DA 5I74C 5GJTH 3VFMB 5I17A 3PL6A 4XMPL 1NBZA 4AK1A 3NAAL 4LAQH 3V0AC 5DI8B 3I75A 5EO9A 2P42B 2IFFL 3RVTC 3QCUL 4ODTH 3ARFD 3MBED 1M4KA 1AR2A 4QYOA 4QO1A 5L2JA 4PRPB 4XWGL 1XGRB 4LPYA 3SBWC 4YPGB 3MYJB 5I1LB 2JJSC 1MQKL 4NHCL 1GPOH 1WEJH 5SWZE 2X70B 4G9FB 1YQVL 3E0GA 4PS4H 3VGAB 5B3NA 3GBNH 2X4QB 5JDSB 5DGQA 1FO0L 5LAXA 4L8DB 1UQSA 2V9QA 3VWJD 4PLNC 3MRPB 1QSEA 4NYLA 4HS6A 3SE4C 4JO2H 4LPXA 5DD3H 5JPNA 1T7VA 5DRWB 3FCTA 3QIBB 5D9SA 3FQWA 2V7NA 3EOAB 2VJXA 3MJ9H 5H94A 5BJTB 3CFEB 3D25B 3U36B 3VCLB 4ZPTA 1LO0H 2XN9E 5E6ZA 4XXCC 1P53A 1A1OB 2BMKB 3BESR 3E2HC 3LEXB 4ORGA 5MEQB 3E6FA 4PB0H 5CWSA 1KCVH 5D6DA 1UXWB 1A9EA 1U8QB 1NC2D 3DV4B 2EKSB 5LGJA 4PRIA 1F58L 4HXAH 4Z7QF 4TTGA 5F7UA 5JQHC 2OK0H 4M93C 2N7AA 2XQYG 1LILA 3G6JE 4GKSA 4LKXA 3MO1B 2NCMA 5D96B 3M45A 4IOIB 2CQVA 4MVBD 4UDUA 4PUBH 5HBBA 5I1CH 3GSRB 1CLZH 2EZ0D 4ORGB 5E8DL 1FLTX 3QJHB 2ZSVB 5IMLA 4M6MH 4P9HC 1S7WA 2I5YL 1YA5A 4LEXH 3WNPA 5EH1A 1P84J 2BY0A 4F7EA 1KXTB 1MRCH 3CFDB 1KB5A 3FQUA 1ZVSA 5E6IC 3DO7B 4WVRA 2PYEA 3UEZA 1I7ZB 1IEBB 1AR1C 5LWYL 2NY5H 5DJ6B 2IH1B 1JN6B 2R56L 3MZTA 1FFOB 4BH8B 5HHOE 3QG6B 2F58L 2JB6B 3BRGC 3OKOB 5JXAH 3O6FD 4ONFL 3OKEB 1T0NA 4X4YA 3U46A 2VLLA 2V2WA 1AD9A 3HI6L 4CMMA 2B20A 5F7YC 1RV6X 1S7SB 3QXWA 1U8HB 1YEEH 3VGAC 1A3RL 1I85C 3MV8E 4LLQA 1Q9LB 1HKLH 1IAOA 3I75B 4ZQKB 4LLWA 5C0DB 3GJEB 4IJ3C 3IJSB 3O3AA 2NY7L 3QEQD 2BNUB 4ZAKB 1QFUH 5C0CA 1MREH 4FQQB 2P43B 4UOW0 5EC1B 1F6AA 1BWWA 4OZIA 1NAKH 2NY0C 5D2NB 1JFQH 3V7AE 5IG7B 4EI5B 1KXVC 1T7WA 2VE6A 3FT2B 1FGNL 5D1XC 5AAWA 3KPLB 4OFYA 3HMWH 4M6AA 4YNYA 2P5EB 5B38A 2W65A 3WHE0 5C0NC 1L7IH 2VXUH 4JO3H 1QFHA 5E8EB 4Y5XA 4P5TC 1ZANH 4JHBA 5C0CB 4F7EB 1CE6A 4O5LL 4PB9H 2KZ1B 3RJDA 5L2JB 1NGQL 2IANA 2VOTA 4Q6IB 3TIEB 4YIQA 1UWEL 3RHWK 1AQDB 4PREA 3EOBB 2J6EA 3FOMB 2X4PA 3MLSH 4E41D 4UILL 3MRLB 1PJ9A 2EYSB 2W9EH 4Y19D 3WD5H 4HPYL 1WV7T 3LPGA 1EFQA 4NFCA 1BAFH 1VGKB 4YDJA 1MAML 3MMEA 1DJSA 3REWA 4FN0A 3U46B 4FQ1H 1VFAA 2XG5A 3QQ9D 1GGBL 4I0PB 4AM0A 5CZXC 2H2PD 2MOVA 4PV9A 4HUMB 5HI4C 4HBCH 2YUZA 3KJ4B 3MLTB 5KBNC 3DURB 3GBMH 1G7PA 5C09E 4HKJB 3O2DH 4JFYA 4HULB 2XY1A 4NQXB 5IJVA 2O61A 4E41A 5A2FA 4U1JA 1EERB 2QTEA 4OQ1A 4FXKB 1RAMA 3BHBA 4KRNA 1D5XA 3K2MC 4LKCB 3OV6A 1EX0A 4GBXD 1BWMA 2IANB 4TULL 3MRKA 4OZFH 5ADOL 4ZD3L 4UDUB 4DGYH 2GT9A 3ISWA 3HLAA 3FB5A 2NY3D 4M7JH 5D72L 3WLBA 4OBSA 4OV6F 4YBHA 4XNMA 3FT2A 2Q7YA 3OKDB 4JFHE 1ERNA 1GJIA 1YUHA 4GAJH 2CKBL 1HNGA 1QYGH 2ESVD 1J88A 2QQNL 4A2LA 3A67H 3B3IA 5B38G 5DURD 2A73A 2C3XA 3TPUA 3IGAB 2UWEB 3LEYH 4LLAA 1JI2A 3VCLA 3QXDA 1W0VB 4K2UH 1G7LB 3LDBB 1A7OH 2NY4B 4X7EC 1U8NA 2VDQL 4FZ8H 3LSOB 4H26A 4UNUA 1SJXA 2VSCA 4Y4HC 3VDBA 3FOMA 2CO7B 2OYPA 2DYPA 1ORQA 4WUUE 3ARVA 4Z7WE 3VXUE 5C6PB 1CF8H 1J8HD 1J18A 3HA0A 1W72H 4NUGL 3HTLX 3HI6H 3NN8A 3VFPA 4D3CL 1KSRA 2H2SD 3VFGL 1NMBL 2ILLA 1X7QA 1T1WA 1D9KC 1MQ8A 2YUXA 4RFOL 5FOJA 3CDFA 3QEGL 1CVSC 3OX8B 5C3TA 3DOSA 4L8DA 4L29A 1KJVA 4LFHD 4F58H 2R39A 1S9YA 4UV7H 4JFDB 5FDYA 4BZYA 4QGTA 2AV1A 4X4ZA 3QI9C 3SDDC 5EC1A 5DJAB 1NSNH 2DWEA 1W0WB 5FECA 1DQTA 5F1SA 5FDWB 5HHMD 4ERSH 3BPOB 3WKNA 3BP4A 4X83A 2UYLB 5FYJL 4AH2B 3QRGH 4WEBH 4OLYL 3LRSB 2CRIA 3UYRH 4J3OC 3R0NA 4KTDL 3LPWA 3TJEL 4JDVA 1NH6A 4F8QA 2YD2A 5CEZD 1AQKL 3CX5K 4XCCL 1ZHNB 3QB7C 2XQBL 5HYJD 4L9LB 1KLGB 5L9DH 5H37H 4GRLA 4MB3A 3OR6B 3M1BB 4ZUTA 2GSIB 5CJOH 4LQ1A 4XHQA 1TZGH 3IFLL 3SOBH 1HXMA 4AEIH 2IPKA 5GS1C 1P7KA 2ZPKH 3K4DA 4KGJA 3FT3A 4PRAB 2K7PA 4DN4L 4EDXB 4WHCA 1F8TL 3BX7C 3NFNA 5CJQL 1FYHB 3MBXH 1LK2B 5CP3A 3M17B 3PWJB 5EO1A 5IBLD 4M43H 4JFOB 2IAMD 3LEYL 2FO1A 1Y18B 2EDWA 2MQ0A 3U82B 1TTUA 3JUYA 4L4TA 2R23A 1NMCB 1IGJA 3QUML 2D2OA 5GS1B 1J11A 3ZT7A 4NQXA 1S78C 2A6IB 3MRNB 3QWRA 4NHCH 5F9DC 2XTJB 3BD3A 2I27N 4YGVA 1C5DA 3PIQA 2LE9A 3GUTB 1XF4A 4N0CD 1E6JH 4TNVF 1WTLA 2DQCL 2NMSA 1C08A 4XZUA 4LCWD 4WWID 5EORL 1CD1B 5ALCH 1WF5A 3TN0B 4QHLA 5FAAA 2BSTB 1HINL 2ZOLA 4NKIH 2FR4B 2ENSA 3LSOA 4H26B 3RWFA 1HDMA 1R3JA 1YN6B 1MFBH 5F70A 4M62H 2L0DA 2HJKB 3S34H 3VI3F 3KPSB 2F9BT 4UV4H 3EOAA 1MLCB 4YAQA 1FG2A 4OIAA 1F42A 1T04B 2CKBH 4L1DA 4M5ZH 3TESA 3O45A 3CVIL 4KGLA 4LSSH 3P4NB 3DX8B 2CIIB 1OGAB 3TT3L 1DP0A 4G8IB 2P5WD 2QKIA 1D6EA 1MH5A 2YPLD 2NNAA 3MCLL 5E99L 2O5YH 1D5BA 3LDBC 2Q8BL 1AKJB 2NX5B 2XFXA 3LB6D 5C3LD 1SYVB 1KCUL 2R4SL 3O6FB 4LGRB 5BCAA 1MF2L 2EEAA 1UYWH 4HIHB 4NPYB 2BY1A 3X3FL 1MCHA 3MRKB 4XP9L 5F7EL 5I8CA 1ZLWK 3VFOA 4HCRA 1RZKC 1CFSA 3KS0J 4KRLB 4YC2C 1NKRA 1QLEL 3BH9B 4NC0B 4I48B 7FABL 4XWOD 5F88B 1NAMA 3PP4H 3T0ED 1W0VA 1N2RA 4NWUL 5D1QC 4YR6A 1DZBA 5M95B 4MB5A 1I7UB 5IV2B 5E5MB 5I6XC 3TT1L 2JCCE 5E2UH 5JIIA 3AMKA 1MFDL 2Q3ZA 5FXCH 3QDGA 4PG9B 1QBMH 3DROB 3IS1X 1KYOK 3W9DB 1VB9A 2XWBB 4LSVL 4PJDA 3W5NA 1N64L 5TF0A 1PBYA 3AREC 4OI8A 4L9DA 1XF4B 1I8LA 3NCYS 1FL6A 3QIUB 1WFOA 5FUOH 4WFED 1BP3B 4X5WB 3OKEA 1CIUA 3FJTA 5CBEB 2PKDA 5D4QA 1C5BH 1T2QH 1CDJA 1FZMB 5HGBA 5IUSA 1BJ1H 1F45A 3PP3H 1T3FB 2F19L 5KSBF 1WAAE 5T1KD 4N9GA 4O58H 4WJ5B 4XP9H 3OXRB 3BZFA 1UACH 4NN7C 3VJ6A 3WS3A 3INUL 2O26U 4LRIC 1T83A 4K7PH 5C2BL 1Z5LA 4PJHB 1CZ8H 1L0QA 2WSKA 3TC9A 1J5OH 4WCYH 5DZOA 4MAYC 4PP2A 1A7NH 1FFNB 4PJ9C 4FMFA 2XA8H 1CR9L 4LSSL 2DMKA 32C2A 4EQ2A 2ADIA 1Q38A 3T0WA 2FNBA 5I1KL 2FGZA 3MACL 4MZ2A 2ZCHL 5F96H 4DZBA 1WWCA 5L2KB 2XTLA 2FECL 4P23D 2VIRB 5IFAH 4Z7QE 1L6XA 1FFRA 4PJFB 2ZSWA 2I60H 3VGEA 1F5WA 3Q3GA 5DQJB 3BJ91 4KQ4H 4OZHB 5AEAA 3T04D 3C60B 2GK0A 4LSPH 4I13B 4KJQD 5I1CL 5B8CB 3S37H 1QPPA 3RL1B 1G7MA 1A4JB 1BMGA 2HJFB 4XBEL 2VZ1A 2MPAL 3U9PH 1CBVH 4HLZG 5I0DA 3K2UH 1EJ6A 2J2ZA 4EUPH 1JHKH 3MSPA 4V1DB 3FB6B 1QSFD 1CICA 3WNKA 4CBPA 5HYQB 1QPXA 1KTKE 5FO7B 3RTQB 4KJYA 4F2MA 4JZOA 3QEQB 1ULVA 3G5XA 5GISL 3GSOB 4YNYB 4UT6H 5I76B 4XX1E 4OTXH 5J1AB 1E27B 2BSED 4JFPB 3TZVC 3V6OE 1EAPB 1A21A 1WSST 2F5BL 2AXFB 3WNMA 4HH9B 4UINL 1KTLB 3RDTD 2X70A 3WYRA 3LRGA 4IRJD 4MAYB 1CS6A 4HWUA 2W92A 1P4BL 3QEHB 2W65B 2XA3A 1QA9B 4ZNEA 3DXAA 5TE4L 3T0EC 5DDHB 4Q9RH 3QCTL 2EIDA 4HF5H 3NA4A 5IGXH 1FBIH 1P1ZA 4LHJB 1PQZB 2MQCA 1JF1A 1YNLH 4PY8J 4NQEA 1R3IH 2X41A 4GMTH 4J8RB 4OGXH 2H8PA 1IT9H 3B9KB 4F15B 3NIFE 1IGYB 4HDIB 3GSQB 5C07E 4XCCH 1ZGLP 4R7NA 1Q0XL 3BUYA 4PB0L 5GGVY 1MCSA 3UBXI 32C2B 5I9QC 5E94A 4EN3C 1MCWM 5CSBA 5CCKH 4HF5L 5DJ2A 5IGXL 3D5OF 5IBTL 5EFIA 4P2CG 5FYJH 4K7PX 1I7ZA 4ODHL 4XVUC 4LCCB 4LHUB 3WL9A 1I1AD 2D4DA 4L3AA 3N1QC 3MZGB 4BZ1H 3BQUA 5BV7H 3ZSTA 3WIFA 5F89B 3VI4E 1NANH 3HNVL 2P47B 3U2SB 1QFOA 1S7WB 5A2JH 3RX5A 3S37L 3B9EA 2B5IC 2DBLH 3WFDH 5KSBE 2BHYA 5JHLL 3KYKH 1CGWA 2PCPB 3U7YH 1RUQL 3WDJA 1SMOA 2SEBA 3G5YA 3R8QA 2ITCB 4MZ3A 4YLQT 2APXA 2YBRB 3GSXB 3TCLB 1JFQL 5I30H 2AK4E 2YPVH 4XC3H 4PRAA 3CPLB 5JLZA 4HUNB 4YZFF 1UADC 4F15C 5GZND 1X5FA 4Y2DB 3O4OC 4LCWB 3WFCL 5I1IH 1PLGL 3OGOE 1LO3H 3QDGB 4PG9A 4FFZH 3QYCA 2BDNL 2KQNA 5IK3A 2YK1H 2P7TB 3LV3A 4M7LT 3AVEA 4AEHH 3DWTA 4FQLL 4OF0A 5AUMB 3QDAA 2WUCH 2DQIH 4ZFOL 1UG9A 2HWZL 1GGTA 3QQ4A 2P1YA 3BIKB 4KK5D 4P59H 4R4ND 4UTAH 2A0LD 5F9OL 1YEGL 3MXWH 4TVPH 3QDJB 4LU5L 4B41A 4NQEB 4JFFB 2I07B 4G6ML 5FOBB 4AH2A 5I1EL 4OQTH 3F6IA 1LDSA 3BDXA 5MENE 1K9TA 1ZV5A 5TQ0H 3VFUA 3TBYA 2VKWA 1DVFB 2J88L 4WHTB 1Q72L 5D9SB 3DX7B 1SBSL 1N5AA 4XAWL 1IM9A 1HNFA 1ZHKB 3PWUB 3HB3D 5A2KH 1G84A 1G7QB 1EO7A 1ZMYA 3OF6D 3VGFA 1LMKA 2AQ2A 4NYLB 4YHYC 3IDGA 5HXMA 1DQDL 3SKJH 4Y4FC 5HVGB 5JQ6L 1EMTH 3NFSL 2AJVH 3K8LA 2ADGA 3EFDH 2PR4L 3BZ4A 2CR3A 1RFDH 4OZFA 4NJ9H 5AD0B 2F15A 5DHYA 1J1XH 1P5VA 3SQOL 3ZO0A 3NABL 3O2DL 4MQ7B 2V5YA 5LBSH 1JTTA 1FC1A 1M71A 4MJ6B 2YD8A 4PJ7B 1JPFA 4DK6A 1NLBL 2OL3L 1KIRB 4HV8A 4WY7L 4PJHF 4I3RH 3IKCA 3KXFD 2Z31A 3UTPD 1Q9LA 1JWMA 2XZQL 3C60A 1Q8MA 2X4SA 2VXQH 1RULL 4GFTB 1I9JH 1FORH 3I2CH 4OM0H 4ZFOB 3EOYG 2X2YA 2D31B 9CGTA 5DTFB 3MV8D 5IMKA 1I1AC 3V0VB 5GQBA 3CX5J 3RZCC 3FFCE 3G6AA 4PGZA 5BOZG 2CH8A 4EOWH 4R0LB 4RGNB 4WNQB 1QRND 2FATH 4R7DB 5DT1H 5I19L 5C0BE 2AJ3B 4NHUB 2O5YL 3TYFB 1D5ZB 3B9KC 2FB4H 5C0BA 5SX5H 3S3PA 2A6JA 3VE0B 3QNYA 1F11B 2EKJA 3EUUA 3SDCA 2FRGP 1B2WH 1WFNA 2WNGA 1IGIL 4G6AC 3QUZA 1B0RB 1FPTH 3TFKC 3K8KA 1IC7H 4PJ8C 5GRJL 3MOBL 4G8GE 3F12A 3Q5YA 1RI8A 1J8HB 1TQCC 4CU7A 3G5VA 4FTVB 4KHTL 3OKNB 4N0YL 5GZNC 5I66A 1UJ3B 2F53D 3DX7A 1MHEA 1AXSA 3K46A 5I30L 3OGCA 2DYPD 2JJWA 3DHMA 3F7YA 3GJFH 1ZGLA 1U8JA 5JW3L 4Y4FB 5DMIL 2DF3A 1H9VA 1VFOA 1BQLH 1ZTXL 2C7UA 3EYUL 4GS7C 2Q7NA 4KK5C 3BIBX 2D7TL 3KAAA 3T3ME 3L1OH 3VG9C 1D9KB 3O3EA 4GW5A 1LEGB 2EYTA 5KVEL 4DGVL 1FDLL 3KPQA 4ZPVA 4FA8A 1G1YA 4G5ZL 5GSRA 3VH8G 1JHLH 4ZO9A 3AAZB 4NUGH 2CLVA 2FEDC 3QA3B 2X7LA 1TITA 1EXUB 3QPQC 5HJ3B 4LVOC 4NKQB 1NCAL 4QT5A 3EJJX 3TN0D 5EWIH 5D1XA 2AW2A 1H3PL 4YQXL 1OCWL 3Q2CA 4BQCA 4WDIB 5J12C 4UIKL 1QSFB 5E2JA 1KIPA 3ZL4H 4HMCA 4Y7MA 3S98A 2DJSA 4NP4L 1JE6A 2BVPB 3EO9L 5DF0A 1CGTA 3MUGA 4BA8A 2OQJA 3O8XD 2VQTA 1QFPA 2VDOH 3X12A 5C0JB 3NPSC 4BK4A 3F6LA 1MEXH 4KKBC 3MBEB 4I0KA 4QGYA 1EBPA 4RWYL 1A7QL 3B5HA 5EOTB 5JW4R 4Z78B 3B4NA 3RWIA 3V7AG 2D3VA 4YUEL 1KCSH 2VN7A 4ALAH 4CN6A 4BQ8A 4TOYH 4BM7A 4P2OC 1BM3H 4JFEB 2XICA 4K8RL 4G7VL 4IJ3B 4AL8L 3PWLB 3TCXA 4WEBL 4B5EA 4FFVD 5ANMA 3V4PH 4QTHB 4OGAC 4KK6D 3BMWA 2YD9A 4MAUH 3EJYC 3QQ4B 1B4RA 4X9GA 3B8SA 1S9VA 5EU3A 4PRNA 2RIKA 2E7CA 3CFKA 2ARJQ 4Q2ZA 1C1EL 5FA3B 3GKZA 5TF1H 1F4HA 4NQTA 2B4CL 3TN0A 4WWKC 1WBXA 4JRYE 2FLBT 3BO8B 3LEVH 3ARPA 4YHLL 2A1WH 2KUTA 1AD9B 4J8RA 3FB5B 4WEMB 4X0KB 2FIKB 1LVEA 1R3KB 4PJBF 4UQ2B 4R8WH 4MNQB 4OZGA 3S36X 4KTDH 5BQ7A 1MCBA 1KIQA 3LKPB 4J1UB 1SEBA 3E3QE 2W1NA 4KHXL 4TOYL 4JFDD 2D0FA 1EEYB 1AGEB 4ERSL 2V9RA 2FZ3B 4ZUSB 4MJ4A 2YEZB 1DFBL 1MJ7H 3V5HA 4CVZB 1ADQH 4PJ9A 2IF7A 5ITBL 4YFLF 4JZOB 4D0BB 4JO3L 2GCYA 3SDCD 5IT2L 1Q94A 4I8DA 4LK4A 2BXZA 2MWCA 3FFDB 5MENB 5ID1A 3FZUC 4P4RA 3V95A 3IXTA 2ICWA 1H3UA 2IFFH 1HE7A 2O5ZL 1U92A 2YD5A 2Y7QA 1WIPA 5AZ2H 3C5ZA 5L7XL 1A3LL 5E4EC 1CXKA 4CADB 3KXFE 3UTPE 4UUJA 1G6RA 5E7FA 3U30C 4NQDD 3EYOB 3NCFB 3D69A 3ARZA 4LCUA 5FUCE 2YA0A 4U6YB 1BVLB 2ZWLT 5IW6A 2X4PB 5EUKB 2RBLA 1OQXA 4KVNL 3SGJA 2EIBA 2MJWA 4QEGA 1GGIH 5JO5B 1HEZB 2VMFA 3FO9B 1P2CA 3ARTA 4NKDA 2P45B 2VDNL 3O4LE 4XNZB 4TNWK 5MEOB 2C3GA 3P0VL 1J1PH 4CU8A 5CZXD 4NM8H 3MRPA 1I3RA 1NANI 2DQUL 4NNXA 4WUUD 5A16B 4X5XA 1U8MB 4PJXB 5H35A 4Z7VE 3OX8A 3ARYA 3VFWA 1RIVH 4G80B 4O5LH 4E42B 5F8RC 1RZ8A 1QACA 2ZNXA 2GFBB 3CNKA 5I1GL 3K7UA 3CLFH 2DM2A 4WV1B 3GZKA 5CD3A 5ADOH 3OZ9L 3ILPB 5GRXG 3LVEA 5A3IC 1R6VA 1NDMA 1ROWA 4UILH 4H1LG 2CPCA 4MA3B 1HOCB 2H3NA 5FA4A 4PRID 4X5WA 4V1DE 1X5IA 4M1GH 5LCVL 1U3HD 4NQCB 4F7PA 3AM8A 4LSQL 5DK0A 1EMTL 1N59B 3NFSH 1UYWL 3TVMA 5HI3D 2DLFL 1DEEA 4LDEB 1UH4A 5D2LF 4ZS6D 3MXWL 3R4DA 4ODBD 4TVPL 3N1FC 5BXFA 4PUBL 1XAUA 1IL1B 1S5HA 2VDNH 1TJHH 1KEMH 4NO5B 4ZMAT 3HUJB 3IDYB 1CDGA 3I3BA 4DAGL 1RUPH 4ELKB 5ICXB 1DLFH 5HGGS 3LQAL 4EN3A 1KJMA 4R90L 4BFIA 5J6HA 1OAZL 3MR9A 4MXWH 4TUJA 3SE3C 2OZ4A 2OSLA 2XPGA 3U0PB 4RQQA 1TZIB 4PJ5A 5I6XB 5J1SC 5F9OH 4L3CA 3MXVH 2O5XL 4G7YH 2PTTA 1MPAL 1G7IB 1CFQA 5LXGL 1NBVL 4N9GB 3QIUC 4PYGA 1D5XB 1BFOB 3QQNA 3PHSA 3PQYA 4JO2L 5DD3L 3SDXB 1S9XB 5HYEA 5IEHA 5I8KH 1OAYH 4U1IA 3PGDB 4HWEL 3MJGX 4XXDB 1MCOL 4O51B 5CGTA 5DJCA 5I16B 3DETC 3NFPA 4A6YL 3BRFA 2ZG1A 3PGFL 3O6ML 1RVFL 2MCPL 5IOPB 4GRMB 1R5IB 1S8DB 5K9KB 4E9LA 1LD9B 1VESA 4NM8L 2HKFL 5DUBB 4HGKC 1YNTB 1SVCP 2GJ6B 1YQ2A 5D1XB 2FGWL 5ILTH 4RA0C 4XP6L 2NY6B 3O3DB 4OJFH 5GGTA 2P7TA 2NY0B 4EKXA 1JNNL 4KKLC 2BERA 3ARGA 2QSCH 2YWYA 4DN4H 2DI8A 1HCVA 5JW4N 3H9YA 1XR8A 5JW5B 4R2GD 3C5SA 1U6AH 4Z7UB 2IAMB 1BPVA 2D9QB 1CIDA 3GMLA 1ZT4A 4APQC 4M1DH 2EECA 4DCQA 1XF2A 1TENA 1JHLL 1Z3GL 3DGGA 1SJEA 3BKYH 3VD7A 5FF6B 2MHAA 3HPLB 1IQWL 3FO2A 4P5MA 3MYJA 4RGMB 3QUYB 2UY7A 1NGZB 4KV5E 4AZ8A 3WIIL 3IVKA 3LN5B 2R56H 2PW1A 5FKAA 5JW3H 3UTZA 4C54A 1RUML 4G3YL 4AQ1B 4X80H 1HH9A 5DO2D 4O2EA 4CW1A 3U0WH 1OGAA 2Y06L 3W11D 5FCUL 3CH1A 1BM3L 3U4AA 3NCMA 3FRUB 4YHOL 1T89A 3W2DL 5CFHA 4DKEL 4TQEH 2WWMC 3MROA 5D6DC 3FMGL 3UTSE 2NW3A 5LJYH 1DUZB 1ZK9A 3GRWA 3GSVA 1IC5L 3LKSB 5FGCB 1D5ZA 5GRVL 5EZLB 2Z4QB 1PKQE 4QHKJ 1EO5A 3HG1A 4MJIB 3V4UH 3KPSD 4R96A 2BRRH 1I1YA 2P5WE 1AP2B 1SMAA 3RNKA 2BVTA 3MRGA 5GGSB 3RUGB 1IARB 2BHZA 3V6FB 3H3BC 3SO5A 3WFBH 5B4MC 3P4OA 1KXQE 3KPOB 3KPRD 4ALAL 3CJJA 3OKLB 1EHLH 3PWLA 1ACZA 3PE9A 5GGSA 2YD7A 3IU3A 4NDMB 1AIFA 4G9DB 3VD3A 3QFDB 1A7QH 4JVPA 4NKMB 5M7QA 4DUWA 3BT2L 5I75B 2DI9A 4XHJD 1NGZA 1OAYL 5MP6L 3VXSD 4XNYL 3ELAT 3HC4H 4HFWA 1FVEB 1BQHG 4Z7WA 1IGMH 5J6GA 1TCRB 3QIBD 5C6WH