4S1FA

Fructose-6-phosphate aldolase a from e.coli soaked in acetylacetone
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
220
structure length
220
Chain Sequence
b'HELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-6-phosphate aldolase 1
molecule tags Lyase
source organism Escherichia coli
publication title Acid Base Catalyst Discriminates between a Fructose 6-Phosphate Aldolase and a Transaldolase
doi rcsb
total genus 81
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 4.1.2.-:
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4s1fA00
4LW7A 4QITA 2E6FA 1X7FA 5D2VA 2Y85A 4AHQA 1EIXA 4A2RA 1FWWA 4Z0JA 5L6UA 4ORIA 2ZZ1A 1T0OA 4TR9A 1QCWA 5K3VA 3KRUA 2QAFA 3W75A 3ATZA 3O6CA 4LVDA 3W2KA 3W23A 3T44A 5EYWA 4UTLA 5K9CA 4KKXA 3NL5A 1V5XA 1JUEA 4Z1CA 2QCDB 1FCUA 2VFFA 1I45A 3QM3A 3PY2A 3PUEA 2W79A 1L2UA 1X8FA 1OHLA 3QMRA 4DQWA 2V2CA 5G1TA 2DJLA 2ZBTA 3DKLA 4YCOA 3BW4A 3VCRA 4RKAA 3NG3A 1TQXA 2PRMA 5F4SA 1W54A 4HN4A 1JVNA 3B4UA 2QCEA 2VFIA 3CC1A 3G1YA 1EP2A 2ZQ0A 4B5NA 1DHPA 3NQFA 4UTIA 3TFCA 4NNAA 3W76A 6TIMA 1IXQA 3E02A 5AC6A 5LKYA 3L0GA 5BOOA 3MWAA 3LCHA 3W1XA 3GKAA 4M6PA 3TW7A 1RD5A 4AWUA 5HMSA 2GOUA 6ALDA 2FQIA 1JCYA 2G5WA 2C18A 3L5AA 3R13A 3P62A 3RF9A 2C0AA 3TSBA 1F6PA 2JKPA 2ZZ2A 3C61A 5TIMA 4K36A 3LHZA 3QF0A 2Y7DA 3M1ZA 2E1DA 3DHDA 1UJPA 2C6QA 1ICQA 2Y88A 3NA8A 3SIZA 2A6NA 3DENA 5HUOA 2V2HA 1U83A 4I7WA 4G1KA 3TFXA 2F84A 3LTYA 4UIOA 4MIMA 3GYEA 3HPZA 3F4NA 3EX6A 1RZMA 4DF1A 3GXNA 4TX9A 1O95A 4ADSA 3FIGA 5I3HA 2E5DA 5LNWA 1BTMA 1H50A 4PL2A 3W1RA 5D30A 4E0CA 1AL7A 3W73A 3W7IA 1OFDA 4O57A 3GXTA 2Y70A 5LSMA 2ZTJA 1TSIA 4NXKA 1G4PA 1CW2A 4PC8A 5CZTA 3BK0A 5U7SA 4R33A 2V8ZA 1EPXA 1R2TA 2ZYFA 4JTHA 1ONRA 3CQ0A 2TMDA 4IGHA 2A7NA 1OX4B 4OU1A 1DQWA 3LXCA 2X2GA 4JGDA 1R46A 2OT0A 2JKEA 4YCPA 3PC0A 3ZWTA 2ZA2A 1OFAA 2TRSA 4X22A 5CPLA 1J2WA 3NQEA 1X1ZA 4XUGA 1EUAA 3Q37A 4JICA 1WOAA 1QO5A 1Z44A 3WJSA 3L66A 5AHIA 1XM3A 3S5YA 1OX4A 4AWTA 2E5BA 3G18A 3C2OA 3KVJA 3B06A 4HSNA 1D3GA 5A8GA 4NJHA 1RQEA 1FY6A 1MSSA 5HR6A 3LXAA 1WBHA 1VC4A 3SR7A 5D03A 2CLIA 1YPFA 5AYZA 3IIPA 2GQ8A 2PURA 3IEBA 3ANYA 5F1UA 3W3OA 2E5CA 3MUXA 2FIQA 3W72A 1OX5A 1YXCA 1S3HA 3U2OA 4HNVA 4QQ3A 3FYOA 1G7VA 4HT3A 3GDMA 3N9RA 1VYSX 3S5OA 3MI2A 3G8RA 5HUPA 4HKPA 1LBMA 3W88A 4UMBA 3PBYA 5FESA 4NNBA 5ABTA 2DZUA 3DFNA 4NXSA 3B0PA 3JR2A 2I1OA 1SO3A 2V5BA 1W31A 1PV8A 3STGA 2HSAA 2V5LA 4JXCA 4JTIA 3W86A 1L6YA 1O5XA 3LV5A 1OJXA 4O28A 3DFPA 1UUOA 3EX3A 4L4MA 1B9BA 4MFDA 1AW2A 1VYPX 3A23A 1L9WA 4LC6A 1SW0A 1TRDA 1F6KA 3MI3A 3UY7A 2YW3A 3I65A 4DF0A 4PFMA 2EHHA 4FF7A 5HULA 2C3ZA 4GC4A 3S5ZA 2CW6A 4HHPA 2ATMA 3L9CA 1SO4A 3LRKA 3M47A 1ICSA 4GNJA 1OFOA 3R12A 1NEYA 4PTNA 5D38A 3LLDA 2AAMA 2R94A 1O94A 3PS7A 4DO4A 4UNLA 3W7DA 1EEPA 1IXNA 3A21A 4KFOA 1LM1A 4IWWA 4N02A 5G2IA 4JS3A 5FF2A 4N2YA 1SSDA 2ZZ6A 3PG8A 2Z2UA 3KRZA 5F2MA 3M5ZA 4O0KA 3IGUA 1PHWA 1LTDA 1R30A 3EWZA 5G4WA 3INPA 1E51A 4Z0SA 3S5NA 2VFGA 4RR4A 1XCFA 3BW2A 3G1VA 4OQVA 1VGAA 1S5TA 5C2XA 1F5ZA 3B05A 3LI1A 4XTIA 2VEMA 1ZAJA 4KWVA 5G1YA 1TB3A 1OF6A 8TIMA 1A50A 1PS9A 2H90A 4M7SA 1DKWA 3CWNA 1W3TA 3TAKA 4MY8A 4HNNA 3EB2A 3U8GA 4PL1A 3L5LA 3CU2A 4IXHA 3GK0A 2VC6A 5L9FA 4AAJA 4LS1A 1B3OA 1FCVA 3G0XA 4D2JA 1VYRA 2CU0A 2CLKA 1DVJA 4CNNA 4BR1A 4Z08A 1KW1A 4UFKA 1XI3A 3LHTA 4PCFA 1WBJA 4Y96A 5AC8A 4YL2A 3I68A 3WJZA 1SSGA 4JTTA 4MJMA 2GUUA 1XBVA 3ATYA 1QDSA 1OYCA 3W6YA 2Q8ZA 3O06A 2YCEA 3MP5A 1GTHA 2A21A 4WX2A 3JS3A 4K7YA 1KA9F 3G1HA 4YLWA 5E0KA 3W84A 1KLYA 3BG3A 3GZ3A 2Y62A 5TQLA 3HO8A 3QQ0A 4UR8A 1GTEA 1ME8A 2YW4A 3HMJG 4LU0A 4FNQA 4O1DA 1KFBA 3M5YA 4TMBA 4QAIA 1Z41A 1KTCA 3SGUA 4AMAA 1EA0A 2V2DA 3EXRA 3W22A 4WJEA 2X1RA 1ZCOA 4I7UA 2BTMA 1Y0EA 3SSJA 3EWXA 2E09A 4O8RA 4R34A 3TIMA 4P61A 4ORMA 3NQ7A 4AWSA 1TJRA 2DZVA 3NQMA 3W7PA 4YXGA 2R14A 1QPNA 2ISSA 2FTPA 3SFKA 3SI9A 3MYPA 2YZRA 3SGZA 4DBDA 2BXVA 3C8FA 3MJYA 4MPQA 3W7MA 1KFJA 1MO0A 5HWJA 1FWTA 2QF7A 3FJLA 5DY3A 3W7CA 2YFNA 3C6CA 4AHPA 2C16A 2Y7GA 1NF7A 3LX9A 3MI6A 3P67A 5KTLA 3TV8A 5I3KA 3TAOA 4GUGA 3NVTA 1JCMP 3NR0A 5I3GA 3A5FA 3HG3A 2EKCA 5LNSA 1H61A 4HNUA 4ZQCA 2OX1A 1H7OA 3UNDA 1JRBA 3LCFA 4DF2A 1QAPA 3SJ3A 1M5WA 4GUIA 3G3MA 3GDRA 1BWLA 2Y7FA 3L67A 2BSLA 3STFA 1SZFA 1K7EA 2ZFAA 3UD6A 5HINA 1TPC1 2XN2A 2RFGA 3I7QA 5CSRA 3MHGA 1LRTA 3UWVA 1GYNA 3KAOA 3M41A 1OG0A 1T96A 3S42A 3LDVA 3NPWA 3KVMA 3O07A 3SY5A 4IQLA 1AMKA 4U28A 4NJJA 4E38A 5D2WA 3DFOA 1KFKA 3W70A 2C13A 2OT1A 3HQ1A 2UV8G 3NQGA 3S1UA 4CNOA 3MBFA 4ZL1A 3QH2A 2WSYA 3W7OA 3E0IA 1XC4A 2WSQA 2NZLA 3T55A 4IPJA 3E96A 3ZFHA 2FJKA 3UPWA 1JUKA 2GPTA 1Q3NA 1IGSA 4LRSA 3RK8A 1YXDA 4NQ1A 1KLZA 3M7WA 3KVKA 2NXIA 4DEFA 1F2JA 4JDBA 3H54A 1VLIA 5K2ZA 4GXMA 3V75A 3PSVA 3I7RA 2YDAA 1HO1A 3PM6A 5EBUA 2QCNA 1DQXA 3R2GA 1XBYA 1UASA 4LS2A 3T4CA 2ZRUA 5CKSA 2E6AA 5MHBA 2VOMA 3NQVA 3OBKA 3TC6A 2LLEA 3G0SA 3NQ2A 3FA5A 1I8JA 1SPQA 1EWEA 3LTSA 2XFWA 4WXZA 5J5DA 3F4WA 2OMAA 3P81A 4POCA 5BMWA 1G69A 2GVGA 3W7EA 4DPPA 3HGOA 4OGZA 2C19A 1NFBA 1ZNNA 3HB9A 2GJLA 3B0VC 3A5VA 3TUUA 1HFBA 4JY9A 3C2RA 3RLVA 3EX2A 2QEZA 2J24A 3TSDA 3TJLA 3O16A 1JCLA 3HOJA 4WD0A 5BRBA 1GEQA 1K02A 1LLWA 3LB0A 4ONVA 4WXYA 3USBA 5E93A 1CI1A 1SO5A 2O7QA 5CZJA 4A3UA 4LC8A 3BVJA 4LWWA 2NV2A 4A29A 5LGXA 3HGJA 1GVSA 2ZTKA 4LY8A 3T78A 1QPRA 3QW4B 3W85A 1XFBA 2ZRZA 3TSMA 5BW6A 2WNQA 4S2CA 3NPUA 3GVGA 4M6QA 1JQXA 3P8JA 2P0OA 4TIMA 2PRLA 2ZRVA 3A9IA 1FDYA 5SWUA 1LP6A 5F1VA 5AHFA 2ZRYA 4JIQA 3PUOA 4JTJA 5AFDA 4WZHA 4FXRA 4JX5A 4TU1A 4IJBA 3DI1A 3D0CA 3ZS4A 1VLWA 2WO5A 3YPIA 1FDJA 1H5YA 3CHVA 2YSWA 3FOKA 4ML9A 4QSHA 4CNPA 3CLMA 4HPXA 1OFQA 4QNEA 4UTMA 4DO6A 4Q32A 1LYXA 1FUYA 1SZEA 1VR6A 1WXJA 5CPMA 1KV5A 1J4EA 4FNUA 2QUTA 4A21A 3GAYA 2WOQA 3IVTA 4RV8A 4ALDA 3LHYA 1G6CA 3GDKA 2WV8A 3UXDA 1K8ZA 1ZAHA 1AW1A 4UTTA 4IMCA 4R53A 1TV8A 3QJAA 2J6XA 3NXFA 4O16A 1F73A 4JTFA 1SZGA 5G2WA 3GXPA 4DXVA 5FF0A 3NQCA 3P8IA 1LBFA 2ZA1A 3TX9A 3OEXA 2YX0A 3KOFA 2VFEA 1BKSA 1FBAA 4NX0A 1W5PA 1N8FA 3SW6A 5K9DA 3Q58A 1B4EA 4O4VA 4XKYB 1O60A 4CLMA 3GR7A 2FPTA 5CPNA 5EY5A 4E2BA 5AHNA 1GZGA 1HTIA 3P7YA 2A0NA 2E6DA 2PE4A 3NEVA 4NX5A 4EF8A 1ZJIA 4HSOA 2A4AA 2YR1A 4NZJA 3L0NA 3NL6A 3ABOA 2I14A 4RCXA 1EWDA 1T99A 4MOZA 5E1QA 3PG9A 2EAWA 2JGYA 3OIXA 4H4IA 2Y63A 4O18A 4MY9A 1KBIA 2WKJA 4UR7A 1DL3A 4DO5A 3O63A 5K4XA 3QSTA 1C9DA 2ABAA 1OF8A 2X30A 2HTMA 2QJGA 3W1AA 4MY1A 4M5PA 3TNOA 1MXSA 3NM3A 3N14A 5AC7A 4Z1AA 1ME9A 2WPBA 4UTHA 3L68A 3GDTA 1KM1A 2DZSA 3A24A 1O4UA 2DZWA 1GVRA 1K7FA 3PAJA 1W5NA 3E12A 4AEOA 1RPXA 3W1NA 4U4MA 4O11A 4CCCA 3VKJA 1XDMA 1ZALA 4UTJA 1GVFA 3M5XA 3OVRA 3LV6A 4O0ZA 1YDVA 1MEWA 4OV4A 3DH7A 3HBLA 4IMGA 4NNCA 3BLIA 3VFLA 1K8XA 2DJXA 2H6RA 4UUIA 1QPOA 3B0UX 5HQEA 5J5RA 3W9ZA 3GLCA 3QPZA 4WOQA 4L4LA 2KZHA 3FEMA 5LGZA 1GQNA 3GKFA 3U6WA 3P84A 1LBLA 4ZMGA 3QW3A 4MZ1A 3UYCA 4DELA 1X1OA 1A5BA 1H7NA 5DCBA 1TPH1 2X1TA 4S1FA 3BO9A 3QMSA 4JX4A 3L2IA 3WJXA 4O12A 3W1TA 1DORA 4C1KA 1FWNA 3W07A 4QISA 4QM1A 5F2IA 3NL2A 1XUZA 1SU5A 3QPYA 5FF4A 5D05A 3LCIA 3C2FA 3W87A 1VZWA 1Z42A 2NWSA 3W74A 1VCFA 1UCWA 4XBSA 4QJ1A 1GVQA 1SUXA 3C52A 1P0KA 3N9SA 4IX0A 5TBOA 3W2UA 1GJPA 2V0TA 2H8XA 1PIIA 3LTPA 4I9AA 1FCQA 3QSRA 4IMFA 4NVTA 3THAA 1A5CA 4JD4A 2V81A 2QKFA 1OFBA 5K7JA 2YPIA 4JDYA 2QDHA 1W5QA 1NVMA 2E6YA 1VCGA 4K8EA 1I2NA 2TPSA 1WA3A 1AG1O 4UTTC 1DOSA 1IF2A 3P5YA 1OYBA 2C1HA 2VELA 4BI6A 3TKFA 1LRNA 3ZWSA 4UNKA 1MEHA 5LZLA 2ZZ4A 3DKJA 3NO5A 4K8HA 3IGXA 4WUIA 3C2EA 1BEUA 3IVSA 1W5MA 4NZFA 5DBTA 3W7LA 2VXNA 3LBCA 5F2LA 2NX9A 1K3UA 1ICPA 2J9YA 3P80A 3UWUA 2B0MA 4XWUA 1FWSA 1FWRA 3C3NA 2Z1BA 3BPWA 4Q33A 5G2HA 4K7VA 3IVUA 1NAL1 1RQBA 3NNTA 1OX6A 1TMHA 1ZY9A 4NT0A 5BNKA 4ZQRA 2GQ9A 1FXQA 3KX6A 3DI0A 3L5MA 2OCZA 3HG4A 1FQ0A 1H7XA 4JNMA 1SO6A 2P10A 3NQ8A 1HO4A 2QCCA 4JYFA 3LCXA 3W2JA 1KFEA 2BWGA 2FDSA 3CEPA 1YTEA 4N6EA 3EWBX 4ZQOA 2WSRA 4UTWC 5D2XA 4LVBA 3OHIA 1GVOA 3EX1A 1XUUA 4QIUA 1JUBA 3N2XA 1GG1A 3PVFA 3MO7A 4MZYA 1YLVA 3W2MA 5CPOA 1P1XA 2TYSA 4WY0B 1PCWA 1UBSA 5K9XA 5LHEA 5AYYA 3N19B 1ME7A 1R47A 1H60A 4JTSA 5AOUA 5FEWA 4N6FA 3CIXA 3LLFA 2CZDA 1H62A 3NPVA 3QRHA 4IPIA 1QO2A 1AW5A 3FYPA 3R89A 2YYTA 4GUFA 4GBUA 3LCWA 5DLCA 4GUHA 4YMZA 2GVJA 1SFJA 4M19A 3LCLA 4RX0A 2D73A 4NU7A 5HNRA 4AVFA 3TQKA 2NXHA 1HUVA 3QQ1A 5F4WA 2J88A 5DCEA 5BMXA 1A5SA 1KFCA 1TPB1 2E77A 3FKKA 4O10A 3NM1A 4GUJA 4XBKA 3G24A 3G8EA 4LS0A 3VI2A 3IIZA 3T7VA 4HPJA 2NWRA 2XN1A 5DN1A 2Y61A 3E9AA 2RDTA 2V30A 3DFQA 1JULA 4ICNA 4DBEA 2FB3A 3P60A 3NYZA 5EL1A 2NX1A 4MYXA 4BF9A 1L6WA 4ZQNA 5CGQA 2ZZ5A 2NLIA 2OJPA 1N7KA 3BGJA 4AF0A 1TTJA 4FIRA 4Y9AA 5F2GA 1VPXA 4IX2A 5KZMA 1OFRA 1OFEA 4N9BA 2CZFA 2ZA3A 3FLUA 3N34A 5CZSA 3RNDA 1VQTA 4ZVJA 1IXOA 1TO3A 1DV7A 2JGQA 2VEIA 1XBZA 3BW3A 5GVJA 3LM7A 1G7UA 4LOCA 2WJZA 2Y6ZA 4FX7A 1JCJA 4MVAA 1BWKA 1Q6OA 2HS6A 1GOXA 1W3NA 1TTPA 3GR8A 2VKZG 2W6RA 2F7FA 1K7XA 4XZ9A 3BARA 1QOQA 4O19A 5D2TA 1LOLA 3P61A 7TIMA 4RZ6A 3TW6A 2J27A 3IIVA 1KM4A 4R7JA 1KTNA 3WK2A 2QJHA 4Z1BA 1DJQA 1SW7A 4O54A 1THFD 4OT7A 2C15A 1AL8A 1W56A 3EWWA 4O1AA 5KZDA 2TSYA 3MP3A 2JK2A 4WOZA 4O52A 3FJ6A 4NJIA 2C14A 4LVGA 1EX5A 3LBMA 4IXXA 4LVAA 1VJIA 4P2VA 3TE9A 3HIJA 2DU2A 2ZZ7A 2Z0IA 3PR2A 3NL3A 1G4EA 4UFMA 4GJ1A 1Q6LA 3O05A 5CG7A 1XXXA 4MKNA 3A22A 2CLMA 1G4TA 4EWND 1ADOA 1CX9A 3KRSA 4J9JA 4UCGA 2ZZ3A 3QYQA 3W7RA 4WQ6A 5AYXA 2ABBA 5EA9A 3VE7A 1OK6A 3WK0A 3LRLA 2Z6IA 1PL9A 3NQAA 1Q45A 3N2MA 4JY8A 3VNDA 4S2BA 4KFPA 4O1BA 4FNPA 1W1ZA 4HNTA 4BI5A 4O4WA 3UXAA 3G3DA 3EKLA 4N9DA 4JEQA 4NJKA 4EIVA 4IMEA 4MFEA 1WX0A 4KWWA 1TTQA 1FCBA 3UZJA 3FS2A 3BG5A 2PCQA 3T40A 1VCVA 3FKRA 5FI8A 3BGGA 3TQVA 3LOTA 3NQDA 4UMCA 3G1SA 2G96A 4AHOA 4AXKA 3MBDA 3W7JA 5D2YA 3HG5A 1FX6A 1QWGA 3N73A 1JR1A 3HPXA 5DY2A 2Z6JA 1M6JA 1TRIA 4OBTA 1TPDA 1X6UA 2HS8A 3NPXA 5HWNA 4LUIA 3NGJA 3C2VA 1KM3A 3LGEA 1LDCA 3W7QA 3M0ZA 3S6DA 1VHNA 2B7PA 2ALDA 1N55A 1LCOA 3QFEA 4QNWA 5HR7A 2XN0A 3BV4A 3TK7A 1F76A 2HMCA 5LNVA 1XBXA 4YWIA 4LV4A 1TTIA 2BX7A 3R5EA 2ZCGA 2GJNA 3EWUA 2CLOA 1TPFA 1UUMA 3UWYA 3BLEA 4NJGA 3S1VA 1TIMA 4JYDA 1H7WA 4PEKA 4A2SA 1LZOA 2CLHA 1RR2A 2I9EA 1ML1A 4BI7A 3SZ8A 4O13A 5D02A 2YGYA 5AB3A 2CZ5A 1YADA 3HG2A 3I6RA 3MP4A 3MMTA 2B7OA 4NUWA 3IGSA 2PC4A 1OK4A 4CCDA 2A85A 2CLLA 1NF0A 3DFTA 3HGRA 5IBXC 1Z48A 3P74A 4XQ6A 1I2QA 3TDFA 2EGZA 1H51A 3P5ZA 1SZNA 1KM5A 4IMDA 2YXGA 5FF3A 1JRCA 5C54A 3QC3A 1LOQA 1TPUA 3IIXA 4CQAA 3OVPA 3N3MA 2X1SA 4JTGA 4ADTA 2G95A 2QCDA 4Y90A 3NAVA 2A7PA 3L65A 3PF3A 2FB2A 3UWZA 4BK9A 3MYOA 4FEZA 3JRKA 3CIWA 4W9TA 3G1DA 2WQPA 2R8WA 1G4SA 1RQHA 2JBMA 5FF7A 4ADUA 4UFLA 3LHVA 4LTSA 3RU6A 3K30A 1KM2A 5LNUA 2ZDRA 3Q94A 3PB0A 4JN6A 3M5VA 2EF9A 1K03A 2AQWA 3P82A 4FX8A 4JTEA 2DP3A 5AHLA 1NSJA 4M7TA 3TC7A 2PRHA 5C55A 1M7OA 2YYUA 1OABA 4GWEA 1WAUA 4EOUA 1L6SA 1W0MA 4MYAA 4WY0A 4GRSA 5FEXA 1TQJA 1JCXA 1G67A 3ABSA 4MLJA 3Q2DA 2O7SA 4FX6M 4RJEA 3ZR4A 1YTDA 3TA6A 1SW3A 2P1FA 1C29A 4JTKA 2X16A 2DZPA 3TXZA 1W3IA 5EPDA 3EXTA 1TJPA 3CTLA 4LV9A 3UY8A 4BWLA 3GB6A 5D32A 3MW7A 4O53A 2WNNA 4IUOA 4MLRA 1UB3A 4X9SA 2NUXA 1S5WA 3LCGA 2B7NA 1GWJA 2RHGA 3TCEA 3ABQA 1IIGA 3G1FA 2Q8LA 1C8VA 4LVFA 3W1QA 3LHUA 1YXYA 4K38A 2A6LA 3HJZA 3PSWA 2H3DA 1J5TA 3B04A 3AJXA 4Z1DA 2NXGA 2QR6A 2VENA 4RK8A 3TXVA 3TMQA 2CLFA 3EX4A 3RMJA 2FLIA 3LXBA 3UQNA 5HWMA 4JR5A 1O5KA 5DXYA 3F03K 1QPQA 3LRMA 4OE7A 3STCA 3FFSA 1I2PA 1KM0A 3CWOX 4CQ9A 2FFCA 4PODA 3KHJA 5CZ0A 3S9YA 3S0CA 4K39A 3B8DA 3W1PA 5C6MA 2GQAA 1QMLA 3W1MA 5KINA 1LROA 2IQTA 4UTUA 5K4ZA 3L21A 3KXQA 3STEA 1P4CA 1GT8A 1Q6QA 1TYGA 4K6AA 1PHQA 4TO8A 2V82A 3OA3A 3S8HA 3HPSA 5I3FA 1PE1A 3M16A 1IXPA 4FO4A 1XDLA 4TMCA 3W1LA 2CZEA 1WQ5A 4N9EA 5C5YA 3S1WA 1TCDA 3PULA 2A2IA 5A5WA 3H53A 2H8ZA 2RDWA 1M7PA 3F1QA 3W2NA 4RZ4A 1KFLA 3MHFA 5AHMA 5DXXA 2VFHA 3BLFA 1WYIA 4O17A 1F7BA 1P5BA 4LT9A 4UC5A 3NDOA 4OWGA 3RLUA 2ATSA 3DFSA 3WFAA 3TH6A 2BZNA 1TPEA 2W0UA 4FXSA 3O1NA 3WK3A 4JYEA 3GIYA 2NV1A 1I2OA 2QDGA 4UFHA 4JIPA 3QMTA 2QAPA 1IIHA 4N4PA 1QOPA 1ZENA 1LOSA 1GYLA 4BWLC 4IOTA 2QUVA 5D33A 1RVGA 3KVLA 1XL9A 5DELA 3DGRA 1P0NA 5FEPA 1MZHA 4O15A 4FHAA 1TPVA 5LHFA 3TMLA 2CFFA 1TV5A 2AGKA 4JTLA 4O14A 2QJIA 3UPBA 1YPIA 3OG3A 3QEZA 4MUZA 3AO0A 3ELFA 1A53A 4UFIA 3DAQA 3CT7A 4X3ZA 1YDNA 3LI0A 1I2RA 3PB2A 5KZEA 2ISVA 1SFLA 1TREA 4OHQA 5DCDA 3G0UA 3NQ6A 3KFTA 3WJYA 5G5IA 1AK5A 1EP1A 1I4NA 1D9EA 1H7RA 4OV9A 4Y8FA 3C4UA 4AF0B 3IRDA 1B57A 1XKYA 3I7SA 2DORA 1EUNA 1VHCA 5D04C 3W83A 3GDLA 4K37A 2DZTA 2QCFA 4RLIA 1F05A 5AHEA 3PBVA 3CEUA 3CPRA 4ZQMA 1GPWA 4CQ8A 4O1CA 5H91A 3RFAA 3CB8A 2CLEA 3WJWA 1W37A 2YFOA 1OFPA 1W8SA 2FPYA 5FEZA 2ZRWA 3EKZA 4XKYA 4MJZA 1RV8A 2A5HA 1TPWA 1VRDA 1A5AA 5F4XA 2VEPA 3DU0A 4Q4KA 3TROA 3E49A 5KMYA 5LNRA 2RKXA 2A7RA 4WY0F 2J9XA 2BLEA 4CCEA 3W7HA 4RXGA 4UFJA 4GFSA 2GVLA 3TJXA 3W7GA 3W7KA 3L0KA 4Y6GA 1FXPA 3PUDA 1SR9A 4E2DA 3LHWA 1KV8A 1R2SA 4X2RA 3H55A 2H3BA 2VFDA 3TQ0A 1OYAA 1VH7A 3OVQA 1U5JA 3PBWA 1D3HA 1DJNA 5CSSA 3EXSA 4EVZA 3GAKA 1OVDA 2Y7EA 3THQA 2QCGA 4RXFA 1H63A 2JKAA 1QNVA 2Q3OA 1S5VA 4O50A 4RZ5A 1ZAIA 4C1LA 4ZQPA 5EMUA 3TR2A 4LRTA 2RH9A 4FNRA 1ZHAA 5IBXA 3UZ5A 4BFAA 2G97A 3MHUA 2NUYA 4DPQA 3G1AA 1EP3A 2FPVA 3O8AA 2ZRXA 3QZEA 1V7YA 3WK1A 1JCNA 1WOBA 4HIBA 2NUWA 1WDWA 2R91A 4FIQA 1FDZA 3G1XA 2E68A 3DBPA 4FB7A 3UWWA 4H6KA 4I7VA 4JTUA 3C0JA 3O6YX 1ALDA 4MZ8A 3W7NA 1YDOA 4JX6A 4N4QA 1SQ7A 3DZ1A 5KSWA 1F74A 3GNDA 4UTWA 4ZZ9A 1TV7A 4PA8A 2X1UA 4KFNA 1H7PA 1PCKA 1QFEA 2B4GA 1EB3A 2Y89A 3EEGA 2V9DA 3R8RA 3S1XA 3SECA 5DBUA 2J9ZA 4FNTA 3VE9A 4A22A 1LRQA 2QCMA 1H1YA 4UTKA 4EF9A 1R2RA 1PVNA 5T26A 3NZ1A 3IV3A 2DZXA 1MEIA 1HL2A 1YTKA 1YYAA 5I3IA 1DBTA 2QUUA 4LUJA 1JQVA 3ABRA 4FNSA 1KM6A 3TU9A 2VEKA 2NX3A 3HGSA 3W71A 3O6DA 5D09A 1LLZA 3UWQA 2QCLA 3M9YA 3B03A 5D37A 1Q6RA 4H3DA 3PWAA 4N9CA 3DHFA 3M43A 1WV2A 3GNNA 2OZ0A 3LERA 2QCHA 1H1ZA 5IM51 5KITA 2EPHA 5H2ZA 3NZRA 5EKYA 5AN7A 3BG9A 3HF3A 1VS1A 5HJLA 3C56A 4LNYA 2Q3RA 1HG3A 3CM4A 4AB4A 4AH7A 2WNZA 4UXDA 4UMAA 5I3JA 1W5OA 5U4NA 3M44A 2RDUA 1B4KA 2B7QA 4M6VA 3V1PA 1GG0A 1K8YA 1QR7A 1LORA 3GX9A 1KBJA 3DXIA 1JJKA 3IIOA 3EWYA 2CWNA 2A1YA 3G22A 4GE8A 3M6YA 3PBUA 5G4EA 2ISWA 3NOEA 3W1UA 1KTBA 1ZFJA 4XTDA 3O15A 4PH6A 3W2LA 1T8XA
chains in the Genus database with same CATH superfamily
2E6FA 3VGHA 4JZ5A 1EIXA 1IWBA 3GO2A 3ATZA 3ARZA 1W8GA 3W23A 2RGLA 5C2GA 4HYRA 3WQ8A 4FOKA 3T08A 1UR9A 3PUEA 2AOSA 2W79A 3QMRA 4E3VA 1Y5WA 2V2CA 3IJDA 1TQXA 5F4SA 1W54A 3R10A 2QCEA 2CETA 4RW3A 8A3HA 4DBWA 4Q4PA 1DHPA 3NQFA 1HKVA 1R38A 1UKPA 3TFCA 2XFRA 4GGBA 4ASTA 5LKYA 3M7SA 4WKFA 1QBBA 3GKAA 1E56A 1RD5A 1GNXA 6ALDA 1YBQA 4V15A 2FQIA 4XSMA 2DSZA 1EHAA 3EPOA 3VABA 3RF9A 3H70A 4C65A 2IQDA 3RLHA 5TIMA 2GWNA 3LHZA 3TYCA 2BY0A 4YTRA 4XZLX 3N2BA 1UP2A 3A4XA 3TYDA 4QCEA 3SIZA 1HL9A 5HUOA 3SN1A 4G1KA 3LTYA 4GK8A 4CNTA 3GYEA 2E67A 1X97A 1WXZA 1DJIA 4EANA 1TVNA 4DYKA 4W8AA 1Q4NX 3H22A 1O95A 1POJA 3BUVA 4WRHA 1BTMA 1H50A 1P0EA 1V3MA 3W1RA 2FH8A 3W73A 4O57A 4IISA 4BY3A 5LSMA 2ZTJA 1TSIA 1G4PA 3BK0A 4I8DA 1AA1B 1NWRA 2VUNA 3N2CA 3JZEA 2A7NA 4C6NA 1CGWA 4JGDA 4FLRA 3WD1A 4LCSA 3PC0A 1BYAA 4MMWA 4IQDA 1J2WA 3MSRA 3MCNA 3OBEA 4JICA 1WOAA 1QO5A 4JIHA 1GW9A 2DH3A 1OX4A 3G18A 1QI5A 3LY0A 1D3GA 3MA8A 2Y8UA 2ZUNA 2ZVRA 1WBHA 3SR7A 3K1DA 3VVGA 4DM2A 2PURA 4LUTA 3IEBA 3ANYA 2E5CA 1PO9A 1UKTA 2FIQA 2GGIA 1S3HA 4HNVA 5H8PA 4GJIA 2PDXA 1E3XA 3TC3A 3ITXA 3GDMA 3S5OA 1XGEA 3MI2A 3Q67A 5CBJA 1JZ4A 3RDKA 3MUZ1 1LBMA 2J4GA 4UMBA 3VIMA 1J2BA 5ABTA 2DZUA 3DFNA 2X1IA 2REQB 3B0PA 3JR2A 2V5BA 4IF2A 2PDLA 5T8GA 3W4RA 2DGAA 1RY8A 1MQRA 2WNWA 3FJNA 2FZDA 3DFPA 3NWRA 3ZR5A 1EYEA 4L4MA 4FK9A 5A69A 1GK8A 4MFDA 1AW2A 1OIMA 3OIHA 1TRDA 5KZ6A 1F6KA 1LQ2A 3H7VA 2YW3A 4PFMA 5ABHA 1R86A 4HHLA 2Y8VA 1O1HA 3S5ZA 4S3CA 4KEUA 2CW6A 3WBXA 3WMLA 1SO4A 4ZTYA 3PP7A 4V27A 4GNJA 3V7PA 1OFOA 4PTNA 4KWSA 5D38A 3LLDA 3H2EA 9RUBA 1QU4A 4N02A 2HE5A 1EHNA 5FF2A 3AHYA 2D20A 3KBWA 4WSJA 3VNIA 5F2MA 3DG6A 3SUTA 4O0KA 2IPWA 3MUIA 4P7LA 1IQ8A 3INPA 1E6ZA 5FJTA 1BXBA 2VCBA 4Z0SA 3S5NA 4PUWA 4PMXA 3T6CA 1XCFA 3G1VA 4OQVA 4TX8A 2VMFA 4GCXA 4YTSA 3AQUA 1CZ1A 1ADDA 3LI1A 4XTIA 1ZAJA 4C6IA 4QLLA 1TB3A 3SCVA 1FWFC 1JPDX 4M7SA 2J6VA 3K8MA 2JALA 4JQ2A 3UCCA 1W3TA 3BQ6A 1QRQA 2WKLA 4LBRA 4HTBA 3CZLA 5E70A 5BWAA 1V6YA 1Z3NA 3UYIA 2R6OA 1FCVA 3G0XA 3O9NA 4D2JA 3MB9A 2CLKA 4BR1A 4UFKA 4GYFA 1XI3A 3VOFA 5AZ0A 2YXXA 2I5IA 5CAKA 1WBJA 4Y96A 5AC8A 1V51A 5AVNA 3KHDA 4GVIA 6PTDA 2YA0A 4PUEA 2C79A 4QCFA 2GUUA 4AISA 4DAIA 1KXVA 2VZVA 3ATYA 3WQFA 1MW1A 2CZVA 2W27A 2VNCA 3PZNA 1WKYA 2OSXA 5DEZA 4F0KA 1CENA 1UC5A 4F2BA 1Z32X 4B4FA 3SCPA 4GQQA 1J6PA 2WCAA 3OA5A 3QKEA 4K7YA 4Q4RA 1KA9F 3GZ3A 3COTA 2F9RA 4EPKA 3NXLA 1GPFA 4QX4A 2X8RA 4QAIA 3DC0A 1KTCA 2I9UA 3SGUA 4AMAA 3LPGA 3W26A 3N12A 1ZCOA 4Q8PA 3WLNA 3G5EA 4PCPA 5GJPA 3V5OA 3EWXA 4P61A 3NQ7A 1TFVA 4NILA 1B2YA 4AWSA 1UZ1A 3W7PA 1RCXB 4QJ3B 1XLDA 4JNYA 4LCRA 2X0YA 1X39A 4MPQA 3BZGA 1TKKA 2E25A 4M0XA 3W7MA 4XD5A 2WBGA 3C6CA 2Y7GA 3M0VA 3HQPA 4GGHA 3WF1A 2QDEA 1J6OA 3PZ9A 2WVUA 2WC7A 2C7FA 3SQLA 2OTDA 3OZYA 3NVTA 4HMEA 5HMEA 1M53A 3HG3A 4LEQA 5C9RA 1RJRA 1H61A 4GH1A 1JRBA 4DF2A 2NLYA 1M5WA 2O9TA 4GUIA 3VAVA 4DBSA 4AD3A 5BOEA 3GH7A 3UD6A 3EWCA 3I7QA 2PDYA 1AVAA 4RNJA 1OG0A 1S5NA 2WKGA 1W1TA 3S42A 1UR8A 3VXGA 3KVMA 3O07A 4S3GA 1AMKA 4NJJA 1HJQA 3HQ1A 2VYOA 3NQGA 4RDWA 3MBFA 3SFWA 4R3UA 3ZO9A 1RALA 1X98A 5BXSA 2WSQA 3T55A 3QBUA 1JDAA 4JFTA 4AW7A 2FJKA 1RLDA 2G3IA 4FXFA 1IGSA 1T5AA 4NQ1A 3WQGA 3KVKA 3SO7A 4K2SA 4DEFA 1D2KA 3TJ4A 4H01A 2EPKX 4GXMA 3PSVA 1UKSA 3WD0A 3PM6A 2NQ9A 4B5XA 2Z27A 2RDXA 4C1NB 1KC7A 1NH6A 4EK7A 3GH4A 2DSKA 3G0SA 4DZIA 3CPGA 3WBYA 2E9LA 2D3LA 2Q8XA 4YS1A 3GFZA 3APTA 2GJXB 4B4HA 4UTFA 1IE7C 2PLJA 2GVGA 3NVDA 3N11A 3W7EA 4OGZA 2C19A 1NFBA 1ZNNA 1X38A 2GJLA 4B3LA 3A5VA 3TUUA 1HFBA 3AHZA 2WZMA 3ZR6A 2QW5A 3RLVA 3R79A 3TEVA 2J24A 3TSDA 1KCXA 3TJLA 3VA8A 1GHSA 1UZ4A 4WD0A 4JTAA 1K02A 4GKTA 2GUBA 3VIOA 4PGLA 4KGLA 1Q7MA 1VD6A 2WM0A 2WHLA 3BVJA 5LGXA 3DESA 4LY8A 2ZXBA 1QPRA 3W85A 1UWSA 4L6HA 3CIVA 2XM2A 1QATA 3UCDA 1AQHA 4FLSA 4HPGA 2AMXA 1JQXA 1KD0A 4TIMA 3WUGA 3BAYA 3SN4A 3N4AA 1L6FA 2ZRVA 1RAKA 3TN6A 1LP6A 3KLKA 5F1VA 1OCNA 4IJBA 3D0CA 4JKLA 1D8CA 1EJXC 2WO5A 4S3EA 3CHVA 4QSHA 5E9AA 4CNPA 4QNEA 4DO6A 1FUYA 1SZEA 4PMJA 1U1HA 4PTWA 1XLLA 5FCZA 2CXGA 2VRQA 2OYMA 4KETA 1DWHM 4C6LA 4XKMA 3UJRA 3UA3A 3TTEA 4NZCA 3ZLHA 3IUIA 4O16A 1F73A 2EPMX 5G2WA 5FJRA 1SZRA 3NQCA 4KEZA 4XAYA 3TX9A 4L64A 3KTXA 1XGZA 2VFEA 1BKSA 1FBAA 1B3WA 5K9DA 1OD0A 5CC7A 4Q8UA 2FPTA 3MC5A 1UR2A 4E2BA 5DANA 4ZO6A 2GDQA 4HSOA 2D0FA 1TMQA 2A4AA 2YR1A 2XSBA 3NL6A 2D2HA 4E4UA 4RCXA 1EWDA 4MOZA 3PG9A 1NP2A 2EAWA 4H4IA 4K1WA 2IPFA 5LIKX 3NIYA 3MV01 3O63A 5K4XA 3ARQA 1C9DA 2OFJA 1J01A 2QJGA 1LF1A 3W1AA 4N7QA 4PMUA 1MXSA 1F3EA 3L68A 1S46A 3UZWA 1O4UA 4IPLA 3QVQA 2GK1A 3E12A 3W1NA 4CCCA 3VKJA 5CLWA 4LB4A 1ZALA 3M5XA 5I03A 1MEWA 3AWOA 1E1CA 3HBLA 1CECA 1YNYA 2I56A 3VFLA 4GY0A 3WNLA 1MUCA 3HV8A 1XHGA 3ITVA 1IYXA 5J5RA 3V5CA 3QPZA 5FACA 5AKQA 1GYMA 4F0SA 2VGGA 3DCPA 4MZ1A 4DELA 1J0JA 4L61A 1W9VA 3WH6A 1A4MA 1NDWA 4C1KA 1XLJA 2ESCA 4YJ5A 1XUZA 5D05A 1D8WA 3W87A 1Z42A 3V16A 3W74A 4JOMA 2VDIA 5B80A 4V1XA 2XG9A 3W2UA 1MW3A 2FGZA 2WC3A 4GLEA 3B40A 3WQDA 1FCQA 4NVTA 3THAA 1M3UA 2VWTA 2V81A 2YPIA 2D0HA 3NOYA 2E6YA 1FWHC 3UW6A 5I06A 1IF2A 2OPJA 4GZJA 2NVDA 1BTCA 1BQGA 1LL4A 1LRNA 4UNKA 3IAQA 3DKJA 4K8HA 3IGXA 5G4HC 5F2LA 3AHVA 4BEQA 2DW6A 1ICPA 3P80A 4XWUA 2XVPA 2OQHA 5JUVA 1FWRA 4LCQA 2Z1BA 3APGA 3WQWA 4Q33A 3MUAA 1RQBA 4K1GA 3FNDA 2D2JA 2R1MA 2WWDA 3KX6A 2OKTA 3TYZA 3MZNA 3S1GA 1A49A 3HA1A 1O5QA 5I0DA 1FQ0A 4XG1A 1R7AA 4YVPA 2PTWA 3PZQA 1HO4A 4JYFA 3LZ3A 2PA6A 3NO1A 4YHGA 4D6FA 4ZQOA 3AMKA 3CMJA 5D2XA 3OHIA 5C9WA 3EX1A 1MUMA 1XUUA 4QTGA 1V3LA 4HOWA 1JUBA 1GG1A 3MO7A 3CH0A 5CPOA 2XWDA 3WL0A 4WY0B 3VDGA 1UBSA 3QV6A 3M0LA 2HVNA 1R47A 4JQ4A 4JTSA 2ALRA 4N6FA 2CZDA 4HMDA 4IIGA 4GI9A 3WBAA 4W5ZA 3OTRA 3FYPA 3R89A 4QLJA 1JAKA 4GUFA 3DYOA 4GUHA 2GVJA 4QR6A 3AS1A 1X8CA 4JEJA 3RHGA 4YU1A 2XFFA 5CC6A 5BMXA 3ZQ9A 2J7EA 3L4VA 1KGXA 1BVZA 1L8PA 3NM1A 5HATA 3G8EA 2ZXAA 2QQ6A 1DE5A 1BRLB 1XCXA 3ZM8A 1JULA 1YPXA 4YWSA 4DBEA 3P60A 5EL1A 4ZQNA 2YDSA 5JBDA 3T0DA 2F8QA 2YZ5A 2NLIA 2FJUB 4AF0A 1TTJA 4FIRA 1XICA 5F2GA 4PZVA 2DIJA 1KGWA 1OFRA 4LUTB 2VVSA 4N9BA 3CWHA 4HNLA 2CZFA 2W66A 3W6LA 5I5RA 2MUCA 3E1F1 1DV7A 4W4QA 1PEZA 3RRXA 1UQYA 1TWIA 3K4WA 2Y6ZA 2W92A 3PTDA 4MVAA 2HS6A 4YYCA 3WLPA 1W3NA 4MADA 2ZUMA 3VPLA 1K7XA 3BARA 2HV5A 4O19A 3KBVA 3P61A 2VGIA 3GHRA 1AQ0A 4RZ6A 2EKGA 3KTCA 3VZXA 3OZOA 1KM4A 2A79A 4QG9A 2JEQA 2C15A 3FGCA 1PX4A 3S2JA 4EPBC 1CPUA 3CNYA 6REQA 1Q7QA 1IEXA 2BOFX 3VIKA 2FDMA 1CB2A 1PZ0A 3OB8A 1UUQA 3E74A 1ZP3A 1HVQA 4KRZA 4P2VA 2DU2A 3UA4A 4PTVA 3BAWA 2Z0IA 1NOUA 1FP9A 3PR2A 3CYJA 3NL3A 4DYJA 1VFUA 4G2DA 1RBAA 1XXXA 1F4HA 1GW1A 6REQB 1B3XA 3FN9A 4REQB 1G4TA 3KRSA 1G01A 4BZYA 3EZ4A 2OLAA 3W7RA 5AYXA 2ABBA 3SRFA 1VP5A 4ICMA 2YL6A 2E9BA 3WK0A 2NVCA 3BSGA 3N6JA 3BL3A 3AICA 4JY8A 3POHA 4O1BA 3ZT7A 1RJQA 4FNPA 2WMHA 4HNTA 4G1NA 3UXAA 4KH2A 2VX5A 4UCFA 3UXIA 3IANA 4B90A 3EKLA 4N9DA 1RXOB 4JEQA 2ZC1A 4KCWA 4QQUA 1S2WA 1WX0A 1BXNA 1TTQA 3ZLGA 3FS2A 3E0VA 3VD5A 2PCQA 2DVXA 5CXPA 3BLLA 4QAWA 4B3ZA 3G1SA 4CD7A 1E6XM 4LUYA 3KZPA 4W84A 2XINA 1ZJAA 1FX6A 3HG5A 1UHVA 3RUBL 1XKJA 5T9BG 5XINA 1TRIA 4AZ7A 4OBTA 1XLGA 1X6UA 3SQSA 2NT0A 3QY6A 3PNUA 3M0ZA 3JUGA 1M65A 3EA1A 3B9AA 3U2ZA 4FP1A 2WJDA 1XIEA 2HK0A 1TWWA 2HMCA 4HOXA 4LV4A 9XIAA 3W24A 5XIMA 2Y4SA 3ARRA 3EWUA 1XPGA 1TPFA 4ATWA 4NJGA 1TIMA 2CWXA 4G56A 4PEKA 4A2SA 2J77A 4BI7A 2XU2A 5DMYA 4QE1A 4J5NA 1YADA 3MMTA 4M3PA 3IGSA 1E0UA 2PC4A 4Q22A 1OK4A 4CCDA 4GA8A 2A85A 3DFTA 1YHTA 5IBXC 3AHTA 3KCJA 1Z48A 2Q01A 4QJ5B 1OBAA 1WDRA 3A4AA 1A47A 4N0RA 2E0PA 3AMDA 4H7VA 4CQAA 1NY1A 3N3MA 1UC4A 2VRJA 1G94A 2G95A 2BV9A 2QCDA 1IGWA 2QYGA 4H7CA 4JHZA 3PF3A 4L9XA 3MYOA 5CJNA 3JRKA 3A13A 2PWVA 3JZUA 4QDPA 1J0HA 3A3WA 3PANA 2ODOA 2R8WA 3LHVA 3WBWA 2VGBA 1TZ9A 3BOXA 2ZDRA 5GJMA 2QPXA 3M5VA 1EO7A 1I9CB 3P82A 3VD3A 2DP3A 3MY9A 4AD1A 3U2EA 1WZMA 3TC7A 4IL2A 5C55A 5TF0A 4YVXA 1NU5A 3POCA 1F61A 2BFGA 4X60A 4JKMA 1L6SA 8CGTA 4WY0A 4L1GA 4GRSA 5FEXA 2PDPA 3SRDA 1WE5A 1L8NA 1JCXA 4NIRA 1KRCC 4URIA 1XSKA 2VC5A 3FVDA 3K46A 3WCZA 4FX6M 3GHUA 3IGHX 4RJEA 4G5DA 3GHTA 1MZRA 4XSLA 4P8VA 3CTLA 3UY8A 1XC6A 3AISA 2VP8A 1WXYA 4IUOA 2CERA 3E0LA 3ES7A 2IXVA 2B7NA 2BGSA 3H12A 1UPPA 4JIRA 1T6MA 3BC9A 1GWJA 4I3GA 4GYKA 1C8VA 1XX1A 1WUFA 1BRLA 2GWGA 4AD2A 3M07A 2A6LA 1TCMA 2H3DA 1J5TA 2H9AA 3O7UA 1PIGA 1SJBA 3CV7A 3TMQA 3EX4A 3UQNA 3LXBA 1HGWA 3G2GA 1MUWA 4XD3A 5DXYA 4KIEA 3FX4A 1I2PA 4WKHA 2O4MA 4PMQA 1DTNA 1Z7AA 4L56A 4CQ9A 4DJFD 1W9DM 3S0CA 4K39A 2GQAA 3FYYA 2Z1SA 3RGTA 2OZ3A 4M81A 3W1MA 4AVOA 3O2LA 3ME3A 2F6XA 3WLQA 3W37A 3U4AA 2VEFA 2HISA 1TYGA 4LGXA 1FH7A 4OUIA 1PHQA 4TO8A 2V82A 2TODA 2FVMA 3M16A 4FO4A 1XDLA 4DX3A 4TMCA 2CZEA 3MMDA 1WQ5A 5DO8A 3S9ZA 3WMCA 1Z8AA 3KL3A 2A2IA 5A5WA 1ZGDA 3H53A 4PFHA 3WH5A 2RDWA 1M7PA 4H9UA 1ZZMA 1P43A 2XGBA 2XIMA 3MHFA 5AHMA 3BLFA 3PZTA 1P5BA 3FGCB 1CGYA 4OWGA 4IGNA 1VBUA 1S39A 3M0KA 3WFAA 1S38A 3TH6A 4EXAA 4AY7A 1TPEA 2W0UA 4FXSA 3O1NA 1J12A 4XO6A 3CHDA 1MYRA 3QHOA 1HQTA 1W1PA 4N4PA 2EEXA 4ZE5A 1ZENA 1RUSA 4FZIA 3ZYZA 1JYXA 4MWAD 3LK6A 3ONCA 4HU0A 1N82A 3OG2A 4BWLC 2QUVA 1P0NA 2ZUVA 4AZGA 1MZHA 1CLXA 4O15A 1TPVA 5CSUA 2EJAA 4I9MA 2CFFA 2AGKA 1HVXA 3OJGA 1CXHA 3VK5A 1YE4A 3QEZA 1AZ1A 3VMOA 3ELFA 4UFIA 1CBGA 2GQ3A 1W9BM 2D69A 1HJWA 2NQ5A 1EGVA 3PB2A 1E71M 2ISVA 2VQUA 4GNKB 4OHQA 7A3HA 1XSJA 3KFTA 2UZ9A 2V5KA 5G5IA 3CASA 4IIHA 3SM0A 3C4UA 1GQLA 2QPUA 3PPHA 1EUNA 2V3FA 5ABFB 5H8MA 3SAZA 1A80A 2DVUA 1E15A 2QCFA 4RLIA 1W1VA 4I5RA 1KQYA 2GSHA 4ZQMA 4CQ8A 3HU7A 4FLQA 1KWKA 5H91A 5LYRA 4CKQA 4CGTA 1W8SA 3CV6A 4JBRA 1OINA 2VEPA 2PD9A 2VR5A 4Q4KA 5KMYA 3QXBA 4H9TA 3C8NA 1JZ7A 2CIPA 4RXGA 3DHUA 3L0KA 1X6LA 3PBMA 1EBGA 4XO7A 1UD2A 4E2DA 3BURA 2RGMA 3QOKA 2HBXA 3APYA 4X2RA 3IJ8A 1WCGA 4JCLA 4L9ZA 1OYAA 3QPEA 3TYUA 1OVDA 2EPOA 2Y7EA 2QCGA 1H63A 2QPSA 3DECA 4BS0A 5DRIA 5FSDC 4X0VA 4WGXA 2X05A 4DAFA 3LENA 1ZAIA 2WM1A 4DWDA 5EMUA 1TR1A 3UZ5A 5IBXA 5HPCA 4R9OA 1CT5A 4PRTA 2NUYA 4ES4A 2ZRXA 2VZOA 1JCNA 3A9BA 4LYRA 2NUWA 1WDWA 3VD4A 4FIQA 3G1XA 4JQAA 4RDZA 4AZCA 3GDBA 4H6KA 5REQA 3C0JA 3O6YX 5CH9A 1YDOA 4JTDA 1SQ7A 1UWAA 1OCQA 3H7UA 2F2HA 3GNDA 4MPKA 2X41A 3TJIA 2UWFA 3A3HA 4U2YA 4KFNA 3KWSA 1QFEA 4QXIA 2B4GA 2IKIA 4D8ZA 1EB3A 1E6NA 2Y89A 5DFAA 4ZFCA 3PZGA 2I57A 3KL0A 3S1XA 3SECA 5DBUA 3S4TA 2QCMA 3GQYA 1IWAA 1YTKA 5I3IA 3NGFA 1HW6A 5HPOA 3MMWA 2Q09A 3NSXA 4CD5A 1GJWA 2VEKA 3LNPA 3VIFA 4DRSA 1BF2A 2NQLA 3GD6A 5HMFA 3AXKA 2WQDA 4H3DA 3FCPA 3M43A 3THCA 5D9NA 1XH0A 1S2AA 4US5D 5IM51 3I3EA 4JL1A 3RXZA 4FI4A 5H2ZA 4UQBA 3N1AA 3CL6A 1AFSA 3HF3A 3UG5A 2PDNA 1A3WA 3G6LA 2YCJA 2J8FA 1H0IA 1OT2A 5BRPA 2Q3RA 4Y9MA 1C8YA 3CM4A 3LUTA 2WNZA 4UMAA 1ITUA 3M44A 3V1PA 1RA5A 2H9AB 3C0LA 3G22A 2O9RA 1AJ2A 1R6WA 5HNUA 3KP0A 5G4EA 2ISWA 3W1UA 3F5KA 4IIDA 4A8IA 5DMMA 4M82A 5JVLA 4E4PA 2Y85A 4AHQA 2NQZA 4A2RA 2ZKMX 5J04A 1FWWA 4TR9A 4LAZA 4B91A 3AZTA 3W00A 1J0KA 1S1PA 1DIDA 4KKXA 3PJTA 4YN5A 3PY2A 1L2UA 3L23A 4H9XA 4XD4A 5G1TA 2DJLA 2PRMA 3GM8A 2RUSA 4L6DA 1JNDA 1QW8A 2VFIA 3V0UA 1UWTA 3CUGA 1MNZA 1XYAA 3IJLA 4U5KA 1IXQA 5A6SA 5AC6A 5BOOA 1UJQA 3CLWA 4V28A 4M6PA 2VI0A 1DWAM 4AWUA 1JCYA 3W6MA 1ZBKA 2C18A 1NP0A 4NL1A 4TTUA 5C7HA 2J79A 1ZB5A 1P48A 4E2VA 4K36A 2OKOA 3PZMA 3QF0A 3LGDA 3M1ZA 2X7VA 1BHGA 3DHDA 1Q6GA 2WHJA 3CBWA 1MNSA 2V2HA 3WNOA 1K6AA 2C8NA 2F84A 4L1XA 4MIMA 1HKWA 1E6QM 2DV0A 3MKCA 3GSMA 1RZMA 2ZIDA 4DF1A 4PMRA 2PWDA 3WLJA 3FIGA 1DJWA 1EFZA 2E5DA 2QZRA 3GVVA 5LNWA 3VU2A 4F48A 3BDKA 1NDZA 2BVTA 3W7IA 3IS4A 3GXTA 2VX6A 1KRMA 2Y70A 3LQGA 1BAGA 2V8ZA 4YYFA 3RJXA 1XP3A 2X0SA 1ONRA 2YCLB 4IGHA 1DQWA 3QLLA 2X2GA 2DSVA 4AD4A 3UG4A 4PTDA 2JKEA 4J27A 4L4OA 4YCPA 3ZWTA 1OFAA 4X22A 2WSPA 2CNCA 4C90A 1RD6A 3HURA 5DRCA 1XM3A 3S5YA 5CAHA 4AWTA 3P0WA 3MANA 2P53A 4HSNA 1RQEA 1MSSA 5HR6A 1G9HA 1IT0A 3EB3A 3IIPA 4ZXLA 2E40A 2DPEA 3W72A 1RK6A 7REQA 1XD0A 3U2OA 2HVOA 4QQ3A 3FYOA 2OWWA 1G7VA 4H1ZA 4XIMA 4HYVA 4HT3A 1HN1A 1JDDA 2QUMA 5HA7A 4AX6A 5EMMA 1TZ7A 3W88A 4PMYA 5LIYX 4FR6A 1CGXA 4Q8WA 3VMNA 2CC0A 1PV8A 3STGA 4J3VA 4RV3A 3NURA 3FA3A 4S3KA 3KEHA 1O5XA 3LV5A 1KCKA 4QDMA 3ZJKA 3TOYA 3EX3A 1B9BA 2GGJA 2WCSA 3A23A 1L9WA 4AIOA 3TOPA 3MDUA 3KP1A 4GZ7A 1Z9AA 1QNPA 3UY7A 3I65A 5E9XA 3MQTA 4GC4A 2A3BA 5FL1A 1WZLA 4EE9A 1EJWC 1BVNP 4JL2A 3LRKA 4ICCX 3M47A 3R12A 2Z24A 2FVLA 5HBFA 3UXKA 1IXNA 4KFOA 1LM1A 4IWWA 3SUWA 4MB4A 1P6CA 1E9LA 1QBAA 4IT1A 1GOOA 3M5ZA 3IGUA 4WJXA 3EDEA 1AMYA 3EWZA 1V6UA 1J11A 1E51A 2PMQA 4YHEA 3WDPP 1ZPTA 1VGAA 1S5TA 4J2PA 4ATDA 1VFOA 3R43A 3LNMA 4C6PA 1OF6A 1A50A 2H90A 3U9IA 5A8NA 3I10A 2PP1A 2D23A 4HCHA 1KRBC 1E73M 3CWNA 3TAKA 4HNNA 3GVQA 3L5LA 4AIUA 4HTYA 3WNNA 3WNMA 2QGYA 4IXHA 2VC6A 2CBIA 4AAJA 3EAUA 3HQOA 1B3OA 4PMZA 4PBEA 3NZQA 4HN8A 1XJBA 4CNNA 4A8LA 3LHTA 3P3BA 1AH0A 3WQ4A 3ISIX 3IV8A 4ROQA 3TTOA 1UD5A 2YBVA 2FTYA 3HPFA 2C1GA 2J78A 3CYVA 5AYBA 3ZSSA 3GC2A 1XBVA 1H5VA 3IJ9A 1NOWA 1F8MA 3OZPA 1QDSA 1MDRA 1DJZA 3NSMA 2YCEA 3MP5A 2DQWA 1GTHA 2XGZA 1J10A 2VJXA 3G1HA 3NUKA 4GI8A 4PRRA 2Y62A 1KRAC 5TQLA 4GQRA 4TTGA 4IP5A 1GTEA 1EF3A 4MWAB 2BNJA 1OC5A 4D6HA 2I17A 3HMJG 4FNQA 2J13A 1KFBA 2EQDA 4ZGYA 4DUWA 4TMBA 1XCWA 2A3CA 3WH7A 2GGEA 4MNJA 3ZJ8A 4I7UA 2BTMA 3U3HA 4CNUA 3WLKX 4R34A 5GNXA 2Z29A 4H19A 1F4AA 3WN6A 1GOMA 4MWAA 3H4GA 1E6SM 4F79A 3URNA 2BXVA 4BF5A 3MJYA 3GTHA 1MO0A 4RE2A 1FWTA 1SM9A 5EBAA 1XYLA 2G50A 5DY3A 3W7CA 2YFNA 3LM3A 2C16A 4H7ZA 2BP1A 4QP0A 3EBVA 4BQ3A 3MI6A 1QNQA 5KTLA 4H41A 4OJYA 2QGHA 2QLYA 4KWUA 4ACYA 4M51A 4B9YA 3TR9A 4D1JA 4HNUA 1DYSA 4TX6A 4Z2HA 4H00A 4J7RA 3STFA 1SZFA 3AAMA 3CUJA 1K7EA 3TZNA 3TYEA 1TPC1 2XN2A 3AMLA 4LAUA 5CSRA 2XZ7A 1LRTA 2WB5A 1EX1A 3OLDA 1QI2A 4B5TA 3BGAA 1CGTA 3SY5A 3KZSA 4W88A 5D2WA 4H9MA 2CHRA 2C13A 4CNOA 3NQBA 3ONBA 3QH2A 3OP2A 3E0IA 2EPLX 3VDAA 1XC4A 3ALGA 2QXWA 4IPJA 3E96A 1JUKA 2GPTA 3BMWA 4W7WA 5C2CA 3PTKA 3GG0A 4KT2A 2Q71A 3M7WA 1QOXA 2FVKA 3UR7A 1F2JA 3R25A 3P2VA 2GGGA 3LPFA 4BKNA 4DIAA 1VLIA 4Z2GA 3EEZA 1EQCA 4AVNA 2YDAA 1HO1A 1LWHA 4X2PA 1OB0A 1UASA 2W5FA 4LS2A 1E40A 4U5IA 4PE8A 4C6JA 1Z69A 2ZRUA 3MDWA 1AD4A 2VOMA 3NQVA 2EG6A 3TC6A 1WUEA 3NQ2A 3FA5A 2FMNA 1FHLA 4LF2A 2BDQA 1EWEA 3QR0A 1JAEA 2XFWA 3WG6A 1EOMA 2Z25A 3F4WA 3P81A 1LLOA 4U3AA 4O0QA 1BSIA 1G69A 4DPPA 3HGOA 2WJEA 1W1IE 4UQAA 3UNTA 4NSBA 1QW9A 2VCAA 3B8SA 1DXFA 1QJWA 3C2RA 3EX2A 3L4UA 1F07A 1JCLA 4AYGA 1LLWA 1HJUA 3LB0A 1CI1A 4A3UA 4LC8A 4LWWA 4A29A 1UPMB 3WKZA 3OLGA 2ZTKA 1GVYA 1XLIA 1XFBA 1DIOA 1HGYA 3TSMA 4I5UA 4S2CA 3TA9A 4BCEA 4M6QA 1P7TB 2IS7A 2XH0A 4UZUA 2PRLA 2EXOA 2G41A 2YIHA 3DG7A 3E5BA 3IUHA 1FDYA 4I9TA 4KPLA 5AHFA 5AFDA 1UIOA 4FXRA 4JX5A 3IJ7A 1ZSXA 1MFVA 4L5ZA 1H5YA 4M24A 2YSWA 3AFBA 3R1ZA 4UTMA 3OYXA 4Q32A 4ZOAA 1P7TA 3GYCA 5JBEA 1VR6A 2QIWA 3WLLA 5CPMA 3M0XA 1UIPA 1KV5A 3BZJA 3GNXA 4UZSA 3UG8A 1ISZA 4IJCA 3VIJA 2WOQA 4CU8A 3LHYA 1ZAHA 4QS5A 2ZOXA 3U5YA 1E1EA 4UTTA 1D7KA 2QNEA 3NDZA 1BQCA 3FHAA 2O0TA 4JTFA 1SZGA 3K8KA 3AHXA 1EC7A 1IR1A 2Z1WA 2WPGA 2QF8A 1LBFA 2HRWA 1XG4A 3WDHA 3CL7A 2HXUA 1W5PA 2CXEA 1B4EA 2P76A 1V6TA 4XKYB 1V0LA 4EAMA 3FW6A 5EY5A 1EKOA 4MF4A 1GZGA 2VQTA 1DWFM 1ZJIA 1V3IA 1H2JA 3RIKA 4NZJA 2V5DA 3ABOA 3HN3A 5BU9A 2I14A 7ODCA 3IARA 3LSBA 5BZAA 1RP9A 4GIYA 2XISA 1K6WA 2ABAA 3RX3A 1E6RA 2QIIA 1JZ3A 4Z42C 4GH3A 4QRNA 3N14A 4Z1AA 3BTNA 3GDTA 1A5KC 1UA7A 3A24A 3VNZA 2DZWA 8XIMA 1K7FA 1W5NA 4AEOA 3UVAA 3BMXA 2PZNA 1XDMA 3SUSA 5A8QA 1B90A 4O0ZA 4OV4A 4IMGA 3BLIA 3AZSA 4UOQA 1K8XA 3FHQA 2H6RA 3T0TA 1JPMA 5CZKA 4DXKA 3GLCA 1MMFA 4WOQA 4L4LA 4AZIA 3FEMA 1GQNA 3ARTA 3U6WA 3L2LA 4L9YA 1LBLA 4GBDA 4Y9OA 3QW3A 5C7VA 1XPYA 3UYCA 3LPPA 3BANA 2FZNA 4MGGA 1EOKA 4S1FA 3BO9A 3AXIA 3L2IA 1T7LA 2FKPA 4O12A 3W1TA 1DORA 5M3WA 1DXIA 4QE5A 7XIMA 3V18A 1FWNA 2DT1A 3W07A 4QISA 4IIBA 3QPYA 4IIFA 5FF4A 3C2FA 3THDA 2Z00A 2OLSA 4GY1A 4MJ2A 4XZWA 4A05A 2A3LA 5HANA 1SUXA 4YTUA 5CLTA 1BYDA 5HOSA 2GSEA 4PYSA 2V0TA 4PCTA 1UBPC 3A47A 3QSRA 4JD4A 1PWLA 4AEFA 2QKFA 5K7JA 5HXMA 3EKGA 1TV2A 3BWWA 1NVMA 1C92A 5JIWA 4K8EA 2O92A 2FZ9A 1XIMA 4UTTC 7PTDA 1LT7A 4KBXA 1JDCA 4P7OA 2TAAA 3TKFA 4ERIA 2C1IA 3BOLA 4GYJA 3BLKA 4M1RA 1QT1A 3W7LA 2FGBA 1TA3B 1UOKA 3UWUA 2B0MA 2F2KA 1HZYA 3BAKA 1EGZA 3UGVA 4C7GA 3AWNA 3KDNA 1NTHA 4FOUA 2VWSA 5G2HA 1UG6A 1NAL1 3I6EA 1TMHA 3EOEA 1LQ0A 1ZY9A 3DI0A 2VVNA 3SY1A 1PYFA 3ANUA 3M46A 3HG4A 1PDYA 1XLBA 3D6NA 1CXEA 4E8CA 3W28A 4C5YA 3NQ8A 3CZJA 1V03A 2QCCA 3W2JA 4DXXA 4WDXA 2FDSA 3SGGA 1YTEA 3WNKA 3EWBX 2L5HA 2WSRA 3N04A 1J0YA 1GVOA 2INZA 3UF9A 1A0DA 3PVFA 4JNZA 1EZWA 4E8GA 4KW2A 1K9DA 3TN4A 1P1XA 1ECEA 4UQCA 3PPGA 2CCRA 3VUPA 5LHEA 1WO2A 2VX4A 5D4YA 1H62A 1SYTA 4IPIA 1QO2A 1GOIA 2YYTA 1L2QA 1SFJA 3LCLA 4NU7A 1GHRA 4O1FA 4AVFA 3TQKA 3W29A 2J88A 4LB3A 5DCEA 4EACA 1A5SA 1UW9A 3GW3A 4B5SA 4BHYA 3FKKA 1EPVA 4O10A 9XIMA 3SCRA 2WVVB 3G24A 2R1LA 4LS0A 3DC8A 3T7VA 4HPJA 2XN1A 5DN1A 4FS9A 3A4WA 3E9AA 2RDTA 4RNHA 1EC8A 4PN2A 3BAJA 4ICNA 1GCYA 2FB3A 3NYZA 4IPNB 5CGQA 5DT5A 2J7BA 2ZUWA 3W53A 3BGJA 1M7JA 4Y9AA 1VPXA 5KZMA 4W86A 2DY3A 2G37A 1BWVA 3HFTA 1OFEA 3WUFA 4P8XA 1U1UA 3RNDA 4C6CA 1IXOA 3ENLA 1TUXA 3I3BA 2P5NA 1KB3A 3G77A 3AU6A 1S2VA 4HPNA 2PDWA 4JQ3A 1OADA 1G7UA 3LM7A 3PWIA 4C6OA 2WJZA 2POTA 4FX7A 1K9FA 1E0WA 1N8WA 4F3HA 3U5UA 1GOXA 3GR8A 2J8TA 3VKAA 3WZ0E 2W6RA 3N2OA 3UJEA 2W61A 2VD8A 1QOQA 3ID7A 5D2TA 7TIMA 2J27A 1ONWA 3EOUA 3IIVA 3VOJA 4TVUA 4O54A 1THFD 1UYQA 4OT7A 3MZ2A 5D9PA 3EWWA 1W56A 3VILA 5I24A 2TSYA 3H23A 2JK2A 1GZ1A 1O66A 2BBFA 4ZOBA 3UJFA 2PD5A 3MCMA 4LFYA 2VD9A 3EA3A 4FPSA 3B9EA 1VJIA 1DWGM 2WMIB 3TE9A 4ERAA 4NZ3A 2BMBA 4CCZA 3SUVA 1G4EA 3AIQA 3A6OA 5A2CA 4UFMA 3ZJ7A 2PGRA 4GJ1A 3O05A 3WQPA 1TV4A 1W3HA 4DO7A 2CLMA 5FAJA 4DNMA 1WDPA 4LQ1A 1ITXA 5EA9A 1HP5A 2PLCA 3VE7A 1OK6A 1KBKA 4GACA 2Z6IA 4MAZA 4Q8MA 1PL9A 4TVDA 1Q45A 3N2MA 4KFPA 2VR4A 1GQJA 2OLHA 1W1ZA 1I0BA 4O4WA 2BVDA 1ZLPA 4NJKA 3DOPA 4EIVA 4IMEA 2OWCA 1FRBA 3RO6A 3PFMA 4XK2A 1UWRA 4NP7A 1FCBA 3UZJA 5A6BD 4GHRA 5HQLA 3BG5A 3IACA 4HBKA 1FFQA 3T40A 4AYSA 1RA0A 3F7JA 3BGGA 4Z2LA 3LOTA 4UR9A 3LQLA 5I79A 3MBDA 3W7JA 5D2YA 4HPHA 1QWGA 3R4IA 1JR1A 1M6JA 3K5XA 2MANA 5JXQA 3GBDA 3WH8A 3VNKA 4FA3A 4BA0A 4PRWA 4H04A 4CVWA 3EDDA 3NGJA 3C2VA 1J18A 4DWSC 3WLOA 1VHNA 2BXYA 2GFTA 3KOWA 4RNFA 2AL2B 1S2TA 2ALDA 1N55A 4HCLA 3KW3A 2Z4GA 2ACUA 3W01A 4YNGA 3GVRA 1XBXA 1JF5A 1RJPA 4YWIA 7CGTA 1R9ZA 2ZCGA 2OU4A 4ZA0A 3DX5A 4PMVA 3VNJA 4QROA 4JYDA 1QNSA 2HEJA 1RR2A 1KXQA 1K77A 1VFSA 2WYSA 3AOFA 3QC0A 3SZ8A 5GNZA 5D02A 5AB3A 3EOOA 3H2MA 3I6RA 4HU3A 1GGOA 1XS2A 1TX0A 2CLLA 1JPKA 4HK6A 4X63A 1S5MA 4Q8VA 5HK4A 4D6DA 3TDFA 2EGZA 3P5ZA 3ARVA 1ZJBA 1SZNA 2OR2A 4IMDA 2VC9A 3A4JA 1JRCA 1RCQA 1TPUA 3FAWA 3VX1A 3IIXA 3OVPA 3QN3A 2DH2A 4H9ZA 2JIEA 4S39A 5TNVA 1XLCA 2WXDM 1YE6A 2FGLA 1Q65A 1PKYA 1R3RA 1A0EA 3QTPA 5I6SA 3L2MA 2FB2A 5E5CA 3UWZA 4BK9A 7TAAA 3IJQA 4DJDC 1WDQA 4ZO7A 4W9TA 4Y8EA 3G1DA 2C0HA 2I7GA 1YNPA 1RQHA 3RRAA 3K1GA 4ADUA 4UFLA 2PP3A 1KR0A 2D1ZA 1B0IA 3Q94A 1J96A 2CBUA 2E7FA 3TLQA 3QR3A 2D24A 3EWDA 3WD2A 1NSJA 3GY1A 1YBQB 2PRHA 1WZKA 2YJQA 1OABA 2AL1A 2PODA 4EOUA 3MUY1 4X9YA 5JBFA 2PDQA 4OBSA 4GZIA 4Q8TA 2Y24A 4AX7A 4ZENA 3ABSA 2BY1A 6XIMA 1V7AA 3GFYA 4QS6A 1YTDA 1VBRA 1SW3A 2X16A 2DIKA 4PUNA 4HQVA 2C71A 3EXTA 2PDFA 4JIEA 1V3HA 4BWLA 3GB6A 4R85A 3I3DA 3ITTA 1UB3A 4X9SA 1AJ0A 2NUXA 1S5WA 3I4EA 2XFYA 3XIMA 1Y5XA 2RHGA 1VEPA 1ZBCA 3G1FA 1IIGA 4TUFA 3RO8A 3HJZA 3PSWA 1KO0A 4Z1DA 3ZSTA 2VENA 3UGRA 3H2CA 5E6YA 3NYDA 4KMQA 3TXVA 5HWMA 4JR5A 4NYUA 4FALA 3TP4A 1QHPA 4FR1A 3F03K 5BYWA 2F6UA 7ENLA 4OE7A 1GOQA 2BGQA 3GTXA 3CWOX 1EH9A 4PODA 4ZB5A 3KHJA 3SCSA 2AGTA 3B8DA 4I6KA 4LAKA 2CITA 3EMZA 1QMLA 3M64A 1I0DA 4UTUA 5FD0A 3CQIA 2WWCA 3GW0A 4F4RA 3TVAA 4F40A 2QJMA 2IXUA 1P4CA 1GT8A 1MW2A 1Q6QA 4K6AA 2ASHA 2GJXA 1IXPA 4F0MA 2PDCA 2DSWA 4XVEA 5C5YA 1R3WA 1DTUA 1E72M 1UD6A 3ARWA 1YKWA 4IFKA 3RM8A 4ZB0A 1R3QA 5EMJA 2H8ZA 1W1B1 3PJWA 3W2NA 4RZ4A 2EBNA 2V69A 2VFHA 5A6TC 4LY4A 2PDUA 4GY7A 1XLKA 4PUJA 1F7BA 2ZE3A 4LT9A 4CD6A 3RLUA 1CXFA 1IHIA 2BZNA 3T9PA 3UERA 1REQB 4IG2A 3WK3A 4DY1A 3TWAA 4NAEB 3BJSA 1BG4A 1V02A 2QUNA 2PUZA 2QAPA 1P0DA 3OGVA 5FA5A 1BGGA 3VIIA 2P8CA 1GYLA 2WHKA 1A5NC 1NDVA 3KVLA 3UBPC 2V3GA 3TMLA 1TV5A 3MSGA 1V3JA 4NAEA 4KIRA 1JPHA 4ZR8A 3CZ8A 3DAQA 4CN1A 1FHVA 2GOKA 1LL7A 2CYGA 5KZEA 1Q2SA 2PTYA 1TREA 1OC7A 3R8HA 3KBSA 1J8VA 3NQ6A 4W5UA 1A5UA 4ACZB 2ACQA 4MJ4A 3WQCA 4J4KA 2YCKX 4D6IA 4AF0B 1U33A 3TYAA 5D04C 4L7ZA 4AY8A 4IQEA 3F5JA 2DZTA 4JKKA 1PWMA 1IWPA 3CEUA 3CPRA 3FV9A 3SJNA 1V8EA 1GPWA 1LL6A 1CXLA 4DJEC 5CBBA 3CB8A 2RAGA 2CLEA 4GZEA 1F8IA 1OFPA 4PUUA 5IFPA 2FPYA 1RV8A 3II1A 4IFOA 1TPWA 1A5AA 5ABFA 3SEPA 1M9HA 5I00A 4Z2KA 4HNOA 3E49A 1VFFA 3LD5A 3R0DA 2RKXA 2O9OA 2J9XA 3NZGA 5JH2A 4E4FA 4CCEA 1B31A 4GFSA 3TJXA 3W7GA 1BSLA 1SR0A 2BODX 3URBA 3B8IA 3PUDA 1AQFA 3LHWA 1V0KA 1KV8A 3QV7A 3GG7A 3RPMA 1YEYA 3CZKA 1D3HA 2WANA 3WDIA 3THQA 2ZE0A 3WO8A 3T09A 4O50A 4EAYA 3PZIA 4RZ5A 4LRTA 3MT1A 3WF2A 4U2ZA 2FPVA 3O8AA 1QI0A 1ONXA 1VJZA 2BHUA 3WDJA 2R91A 3CV1A 2E68A 3KL5A 3DBPA 4I7VA 4JTUA 4MB5A 3EOSA 2BG5A 1KQZA 4MZ8A 4JX6A 4N4QA 3DZ1A 4IQJA 2QJNA 4CQCA 3U0HA 5KSWA 1F74A 4ZZ9A 3T0BA 1Y65A 1UMYA 3UR2A 3T07A 3SSZA 3GU2A 4D71A 3CHFA 1H11A 2WW5A 1VKFA 4IFRA 3AS2A 4IGSA 3KCLA 5I07A 1B3ZA 2J9ZA 2E9MA 2I5QA 1LRQA 1E3ZA 1BYCA 1H1YA 4EF9A 1PVNA 5T26A 2DZXA 1MEIA 3PJUA 5CQ1A 1U30A 1KM6A 3NO3A 3LMZA 3TU9A 2NX3A 3LZ5A 3O6DA 1O68A 5D09A 4J3ZA 2SFPA 3AYTA 1EJVC 1Q6RA 3ABXA 3TYBA 3DHFA 2IPGA 2QCHA 1QI4A 2YBUA 3UT0A 2PWUA 5KITA 1NWSA 5XIAA 3NZRA 1J5SA 5AN7A 3ZXWA 5CPTA 3BG9A 2Q6ZA 2J8GA 4GCAA 4LNYA 3OU8A 4AH7A 1ESWA 3QTGA 5U4NA 4M6VA 1GG0A 2OZ8A 1LORA 4FAMA 1KBJA 4R27A 1TA3A 1JJKA 2GDVA 3EWYA 4GE8A 3PBUA 4GC3A 4NF7A 1EDGA 3B9OA 1IR2A 1ZFJA 4LEFA 4JFVA 3SUUA 2DZAA 3W2LA 1T8XA 3RYSA 1X7FA 3U48A 5C9ZA 1KCZA 4OBRA 1QNOA 4Z0JA 1QCWA 1V4YA 1XIFA 3KRUA 1DIKA 1C8QA 1FWEC 1Q13A 3W2KA 1QK2A 5EYWA 4UTLA 2OWXA 5K9CA 1V5XA 4Z1CA 2QCDB 1FCUA 1I45A 2ON3A 2KAUC 4DQWA 4RPPA 3GXFA 2ZBTA 1Q6FA 4YCOA 3BW4A 1RY0A 3B9DA 3VCRA 4RKAA 1NIUA 3NG3A 1JYVA 4HN4A 4WVXA 4GJJA 2ZQ0A 3CUXA 4B5NA 4C1NA 3WLHA 1QW7A 4NNAA 1W3KA 1JZ2A 3MWAA 2HPIA 3W1XA 4C6EA 2D22A 3TW7A 4HB7A 5M17A 2GL5A 2GOUA 5AZ1A 3L5AA 3R13A 1T8QA 2VGFA 1AZ2A 4UB9A 2C0AA 2JKPA 1DQUA 2MNRA 2Y7DA 2DT0A 3DUGA 4C7FA 3WQ6A 4EWJA 3GFXA 2A6NA 3DENA 1H3GA 4Y9NA 4I7WA 2Q02A 1S2CA 3TFXA 1VAHA 3F4CA 1O5RA 1W2PA 5DQPA 1PBGA 3AXMA 3VNMA 2VT0A 3VNLA 1HKIA 3LMYA 4F9JA 3FVMA 4QG8A 5IDIA 2BXZA 4TX9A 4DLFA 4JHOA 3VYLA 1VBHA 2A3EA 5A2AA 4AZHA 1M03A 3MS8A 1ZU8A 1AL7A 4E0CA 1QVBA 3C3UA 3FSUA 1RK5A 5I78A 3KOYA 2HE8A 3C0QA 3E2QA 1H09A 4NXKA 1CW2A 4PC8A 5U7SA 4NZ5A 4R33A 2YBTA 5A6MA 3TCSA 1QHZA 4CEUC 3CH9A 4C5ZA 3T2OA 1FKXA 3NSNA 1R46A 2HROA 2OT0A 3RG6A 2ZA2A 3TTQA 4XISA 2TRSA 3CK5A 3NQEA 1X1ZA 4XUGA 4QE4A 5FJJA 1V0NA 3WJSA 3VX0A 3WQEA 5AHIA 3CGTA 3AIEA 1XLMA 1ZTVA 4A3YA 3WQOA 3LU2A 3KOXA 3KVJA 3KE0A 2VZSA 1FY6A 5ABEA 1CWYA 3LXAA 5IRPA 3U57A 1UROA 4KESA 5D03A 5AYZA 2GQ8A 1XH2A 4MNLA 3W3OA 4G9PA 4GPNA 2ISDA 5H6HA 2ZUUA 4UOJA 2QMKA 5AVHA 1UKOA 3S5SA 1JIBA 3UJ2A 3N9RA 2WLYA 3PUGA 1MQQA 6XIAA 3G8RA 5HUPA 4B2DA 4Z17A 4HKPA 4AC1X 2W9MA 1C91A 5FESA 4REQA 3UP8A 4NXSA 1SO3A 3R94A 2EG7A 2HSAA 1QXLA 4JXCA 5BCAA 2Y5SA 3W86A 3VO0A 1L6YA 5C0QA 3QR1A 2WZTA 1V79A 4GYPA 1UUOA 2OSWA 1UQZA 3N2TA 4LC6A 2HVMA 1SW0A 2FZBA 2E1WA 1HJVA 2XSAA 2D2GA 1XFCA 2XPKA 4ZXOA 3BCDA 1WKDA 1JEZA 2XIIA 3BCFA 4H8HA 2EHHA 2YDRA 3ZZ1A 2P88A 4NYYA 3SB0A 1IEIA 3WUEA 4B5VA 4O8AA 3L12A 5A2BA 4MDPA 2WMFA 2R94A 3RM4A 1O94A 3PS7A 4DO4A 1IEVA 1EEPA 2BVYA 2OEMA 3A21A 1XYFA 1R3VA 1C8XA 4N2YA 2QJJA 2ZZ6A 3PG8A 2Z2UA 3KRZA 4BQ5A 5T9CE 1LTDA 1R30A 2R1PA 3CJPA 5EMYA 3LEPA 5G4WA 4Q7NA 2OSYA 3UPMA 3H4WA 4RR4A 5C2XA 3RCMA 3GS6A 3VD7A 3B05A 4PULA 2VEMA 3XINA 4KWVA 4UQEA 8TIMA 3OQEA 3KBNA 1IEWA 1PAMA 1PS9A 5T91A 4NAFB 4ERGA 5MKGB 2YA1A 4PL1A 1Y8BA 1EXBA 2Y8KA 3CU2A 3CAKA 1RHCA 3ES8A 1TE6A 1VYRA 1DVJA 3FA4A 1KW1A 5ENLA 3VOCA 4PCFA 4ZE4A 2A3HA 2IW0A 1GOWA 2YCIX 4C6QA 4Z2IA 1HNYA 3WJZA 3VKKA 4IUGA 5LA1A 5FSEC 4JTTA 3WMBA 3BAIA 4AZ6A 3ANVA 1ZBVA 2PGEA 2GVEA 3D3FA 3W6YA 2Q8ZA 3CAWA 3O06A 4C6MA 1OD8A 4Q8NA 1KWGA 2A21A 3JS3A 3AROA 5E0KA 2CPUA 3ZMRA 2XH4A 1KLYA 5H1WA 2ZUSA 1S3TC 2J66A 3DYMA 4JTQA 1FVPA 5REQB 3QFWA 4UR8A 1ME8A 5DX7A 4GQBA 2YW4A 1ISVA 3R8GA 4O1DA 4WHBA 3EPMA 4MKSA 2V3DA 3EXRA 2XVKA 4WJEA 2X1RA 2OYKA 1CNVA 2ZWZA 2E09A 5CG0A 4O8RA 4WDUA 3E2SA 1TJRA 4XBJA 1GUVA 3NQMA 2R14A 2ADAA 2FTPA 3SFKA 3QHMA 3SGZA 2PLKA 5DMLA 4DBDA 3OLEA 2EO7A 3C8FA 5KETA 4ML4A 1KXHA 3ITYA 5HWJA 1AUSL 1NM9A 2J7CA 2VEGA 2DFAA 4W89A 3PZVA 1NF7A 3K4AA 2Y1HA 1K4HA 3BLOA 4Q4SA 3P67A 1UWIA 3TV8A 4DBUA 1A0CA 1JCMP 3NR0A 5I3GA 1FWJC 2YOCA 3HV9A 2Z28A 5LNSA 3H2NA 1E5NA 4ZQCA 3HFYA 2OX1A 1H7OA 3UNDA 3LCFA 3VIGA 1MXDA 3ZVHA 1AD1A 2IKHA 1BWLA 4JIIX 2YDQA 1X7IA 3DG3A 5HINA 1P6BA 2V6AA 3MHGA 4ILSA 1UD3A 1RSCA 3UWVA 1GYNA 3KAOA 3M41A 1T96A 1KNWA 5HDRA 3L4ZA 3DFOA 3HQNA 1KFKA 4FSAA 3W70A 2OT1A 4LUSA 4HYWA 2WSYA 1XYBA 4QHRA 3E6EA 3LN3A 4JPGA 3ZFHA 3ERPA 1E1FA 4LBSA 1Q3NA 3PBGA 1MDLA 4LRSA 1YXDA 3S3GA 2NXIA 4W87A 4JDBA 3VIPA 3H54A 5A6JA 3V75A 1E0TA 1R3YA 5A6KA 2XIJA 5KEZA 3FJ4A 2BOEX 2QCNA 4JCMA 3WQ5A 4IG2B 1OY0A 1E4MM 4IL0A 3AS0A 4V33A 1OEPA 2QHAA 1TJ0A 2E6AA 5GPRA 4XZNX 1W9PA 1TX2A 2LLEA 1LWJA 5EB8A 3TWBA 1HP4A 1XV8A 1C9WA 1SPQA 2QT3A 3GXMA 3LTSA 3OYZA 3GE7A 5HNNA 4A35A 1OGSA 4WXZA 4Z2JA 1JD7A 2WMJA 1E9ZB 4UWMA 1TELA 5D8WA 3HB9A 5C70A 3QZAA 3CV2A 5HJYA 2XIQA 2ZADA 3MKKA 3O16A 1RBOB 4RDYA 2E8YA 1OG6A 1GEQA 3WBEA 4ONVA 3USBA 5E93A 3I4KA 2O7QA 5CZJA 2OEKA 2NV2A 3HGJA 2E4TA 1GVSA 4WCJA 1LJYA 2GJRA 2VC7A 2OX4A 2PTDA 2ZRZA 3AXHA 3N4FA 3GC5A 1RLCL 5BW6A 2WNQA 3P14A 4HZ7A 4INFA 3G6MA 3PUOA 2PTXA 4JTJA 1BXCA 4WZHA 1BF6A 4JTRA 4TU1A 3DI1A 2HQAA 3ZS4A 1VLWA 3DHPA 3ITOA 4PBFA 1FDJA 3FOKA 1JGIA 3F2CA 3CLMA 2I16A 4KERA 1LYXA 1EJSC 1UP3A 4EXQA 1HIZA 4W8BA 1YIXA 1JFXA 2QUTA 4A21A 3GAYA 4ALDA 4WSHA 1G6CA 3GDKA 3UXDA 4IP7A 1Q63A 4N42A 3L4TA 5LXEA 2CLPA 2WHMA 3QJAA 4L6OA 2J6XA 3NXFA 4NAFA 5AC4A 4DXVA 3P8IA 4J35A 2ZA1A 2WZEA 3OEXA 1YDYA 3B8UA 1F6YA 2YX0A 1ENUA 4NX0A 1N8FA 2VX7A 3BE7A 4LX4A 3Q58A 4AIBA 1O60A 4CLMA 3LSCA 4YTTA 3GR7A 3CAQA 2CHOA 3WELA 2RJHA 5CPNA 1BVWA 4B5WA 1FWBC 3ZJ6A 5AHNA 4LYPA 1HTIA 4HHHA 2A0NA 1EO5A 2PE4A 3NEVA 4EF8A 3H21A 5A3HA 2EPNA 3L0NA 2IPJA 1GKRA 5JQ9A 4B3KA 3ECQA 4O18A 1XIDA 4JQ1A 3RILA 4AZ5A 1DL3A 3UEQA 3GH5A 4GISA 4MY1A 1DXEA 4M5PA 3TNBA 3TNOA 3NM3A 2PF8A 4UQDA 2WPBA 3ITGA 1KM1A 2DZSA 4PSPA 3I6TA 1RPXA 5JH1A 2WSKA 4O11A 4H8UA 3BLPX 3GC4A 4D9PA 4WGHA 3TN5A 4UTJA 5BXTA 1YDVA 5EMLA 3AMGA 2DJXA 4UUIA 1QPOA 3CHCA 3S9IA 4DWSA 5HQEA 3BH4A 3CUFA 2X2YA 3A64A 2DT3A 3ARYA 2KZHA 5LGZA 3H26A 1T41A 3P84A 1I1WA 2DQXA 1X1OA 1H7NA 1UH2A 2JF6A 3QV9A 4M6UA 3P0XA 2X1TA 1IEQA 3QMSA 3F4DA 3W02A 3WJXA 4ENLA 5IDZA 3KS5A 3AUOA 5F2IA 4ZOCA 3BSHA 1SU5A 1XIHA 1PKMA 4FF5A 4UOZA 3LCIA 2BVWA 1U5HA 2HDJA 5F7UA 1JYWA 3R58A 3GXDA 1UCWA 4XBSA 4GINA 4P7QA 1P0KA 4U31A 2H8XA 1PIIA 4MDOA 2Z1XA 2J7GA 4IMFA 1A5CA 1M7XA 4BQ4A 2CEQA 4MB3A 4RZBA