4S1QH

Crystal structure of a vrc01-lineage antibody, 45-vrc01.h03+06.d-001739, in complex with clade a/e hiv-1 gp120 core
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
232
structure length
228
Chain Sequence
EVRLIQSGAVMRKPGSSVKISCRASGYNFREYSIHWVRLIPGRGLEWIGWIKGMWGAVSYARQLQGRVSMTRQLSQDPDDPDWGIAYLEFSGLTSGDTAEYFCVRKGPSCPHCGDFHWQHWGQGTAVVVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 gp120 core
publication title Maturation and Diversity of the VRC01-Antibody Lineage over 15 Years of Chronic HIV-1 Infection.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 35
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2015-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1qH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1qH01
4B5EA 3VWKC 4JR9L 3MUZ1 1NANI 4KKCD 5J13C 1L7IH 2NNAA 2NY3B 4ETYA 4IDLA 1U8HB 4LOUD 4QCIB 3VXUE 2CRZA 1UCBH 4R90H 1LP9B 3LKNB 2VSCA 32C2A 3KXFB 4XC1H 3BZDA 5F9DC 5FXCH 2YD9A 4M48L 3AGVA 4OZFG 3KYNA 4JRYA 2ZKHH 1KV3A 4S1SL 1R5VB 4R4NC 5IQ7H 1CXIA 3PQYD 4JANA 4KAQL 2FZ3A 3D3VB 1GGYA 3P40A 3ZKSD 2WWKT 2JJTC 1NCWH 4UB0L 5ELIA 3VFVB 3GHBH 4PJGE 4KQ4L 1UVQA 1CLYH 1IQDA 1ZLUK 4NKIL 1UZ6F 4GRLD 4LVOC 1SM3L 3S3PA 2VDLH 3TBWA 4NJAL 4OIIH 4YR6A 3C5ZD 3U1SL 5I8CB 1AKJA 5EU4A 4D8PA 2VDOH 3PWPA 2PO6B 2X4SB 4HC1L 4PYHA 3CC5B 1TVHB 4Z7QF 1CGTA 2W9EH 3O6FC 1QRND 1J8HD 4K71C 1S5HB 2N7BA 4OF6A 4V1DD 2V2WB 1G0XA 2XYCA 4ZUUB 1UM5H 2CGRL 2DM3A 2FEEL 4KK9C 4OLEA 1MJJB 4ZO6A 1IM3A 1A6TB 4F37F 4HF5H 2NNAB 4WTWA 3DX8A 3BO8A 5BVPL 2D7MA 4YK4B 4ONGL 5CJXA 4KPHL 3I3DA 4L8SB 1NBVH 32C2B 2XFXB 5HI4D 3TO4B 4JHWH 3SGJC 5DTFA 4R2GB 4BZ1H 1R3LA 3HAEH 4JRYB 4X98B 1KENL 1RI8A 3HE7D 3EOTH 5D7LA 2VE6A 4JANB 5IGXL 2FZ3B 3W0WA 1Z9MA 1DL7H 3MNVA 4L8BA 3OKLA 4POYA 2Y1VA 4NYLA 3ARED 5JMRA 5IHUL 1UVQB 4KHTL 1IQDB 4IRJD 1FNHA 5DF0A 4XBPA 5EC1A 5HVWA 1CFSB 1NUNB 2OS7A 3MO1B 5LG1A 1AQKL 1P5VA 1E4XH 4QF1B 5EU4B 5IEHA 3PWPB 1WUNT 2ID5A 5MHSE 1OHQA 3DV4A 2NY4C 5E5MB 3D25B 1JHTA 1QFUH 3UXFA 3ILQC 3TBYA 3MSPA 1RJLA 1NQBA 2X42A 2O61B 4MMXC 1P5UA 4XMKL 4P57A 3RL2A 3HAEB 2DOCA 1I1CA 4JLRB 1IM3B 4OM0L 2B39A 4K3HA 2OYPA 1HNFA 2ZUWA 4MJ6A 3BO8B 1JZ4A 1W0WB 1RK0A 5LXGH 1XGQA 3ARBD 4N9GB 4KUZL 4UILL 1B6DA 5C3TA 1FNGA 4PRHA 1NC2B 3LN4B 2DQCL 4G5ZH 3TV3H 1S3KH 4TTGA 3N1GC 2AJSL 2VE6B 1G9MH 4RFOL 4OZFA 3W0WB 3ZL4L 2FH6A 4UT7L 3MNVB 4DKEH 1YQ2A 1T1WA 2DTSA 4AEHH 3WHE1 1V7NH 3ESVF 1BQHG 4ZXBC 4NN7C 5LCVL 1H5BB 2ATPA 5LVEA 5JZ7D 1D3CA 4Q9RH 4U3HA 3CPLA 3NFNA 3U0TA 3RZCA 2YC1A 1N6QH 1MHPL 2Y36L 1MH5A 3OF6A 4DN3L 4Q6YA 2RCSL 3OKMB 1NGWB 3ZKND 4Z0BL 1IGCL 1RZGA 1YNKH 3TBYB 2IMNA 4U05A 2EE3A 4OZIE 1RJLB 1DBJL 1WIPA 2XTLA 4IRZL 4KK5C 5HYJE 2O5XH 4NHUA 1JTOA 1WLHA 2J2ZA 3RL2B 4ZS7H 2Q7YA 4YE4L 3S97C 4YUEL 5HI5C 2R29H 2YZ8A 2JELH 4KMTH 4MJ6B 3PGDA 3FQRA 3KPRE 5DZLA 4Y5XB 2VO5A 1RK0B 5J8OA 3O6KH 1UB6A 4M6NH 3MNWB 3PL6C 1O7VA 5T1MB 1L6ZA 5JHDA 1MWAA 4O51B 4CW1B 1X5HA 1WFOA 1RFDL 4CADB 2YUVA 4NZDA 2HTLD 4NFDA 5C6TL 1FG9C 4ZFOL 4U1SB 3TT3L 3DVGA 4CU8A 4LEOA 3B5GA 4JG1H 4NZUL 3I2CL 4UV7L 3QDGA 2ATPB 3NFNB 3RZCB 3U0TB 2YC1B 1XGYL 3WEXB 3ZTNH 2DM4A 4PJDA 3GMRA 3GJFA 4NC2B 3GBML 5DJCA 1IC5L 3FFCA 5BVJA 4W6WB 2O5ZL 1F3JA 3BN9C 4I3RL 1CG9B 3UDWC 2XACC 3GDBA 3BT2H 1T0MA 1LILA 2WUCL 4JN2A 1LDPL 1J86A 1MFCH 4KKCC 3TZVB 5IJKA 3PJSA 1IGTB 4L3ED 3FT2A 1V3LA 1DR9A 4KVCH 4LOUC 3PNWA 1UB6B 3N0PB 3VI4F 5EDXA 5JHDB 1H0DA 1T4KB 4I3SH 2APTA 3SO5A 4PBXA 2X4PB 1Z9OA 3HG1D 3MV7A 5D5MF 2X4NA 3IF1A 4O5LH 3SOBL 3V52L 2YPLE 4EVNA 3MMEA 4PJFA 3MRRB 3WIFB 1YECH 1JGDA 2EYTB 1CU4L 3EDKA 4OCSH 4F9LA 4KTDH 5EBLB 3OKNA 4LEOB 1FBIH 3QULA 1VGEL 4GRLC 1RIHL 3KPNB 3QDGB 3G08A 4DVBA 3C5ZC 4R4BB 1BQHA 1DUYA 2CQVA 5D8JH 4G8GD 4QHLA 3BKJH 1HEZA 1JPGB 3U2SB 5CIPH 4RZCA 5GGQH 3VG0H 3B5HA 4OAWA 4R97B 5IP4A 3X3GL 5BVJB 3O11A 1F3JB 4NO0A 3DTXB 3GKWL 1AR2A 4NQCD 5EH1A 3F12A 5T3ZL 5ALBL 1DSFL 4FXKA 3VDAA 1FNSL 3AFLA 3A0OA 1NLBL 1Y18A 3S7GA 1CFBA 3VI3F 3LN5B 3PJSB 5JHLH 3BRDA 3FT2B 2W07A 4DOHE 1KJVB 3D18A 3PNWB 4AQ1B 2IFFL 3D2UA 1P6AB 4GO6B 4M9OA 1EHLL 1U2CA 2R4SH 5HI4C 1MCWM 3V4VH 3LD8C 1H0DB 5GRUH 3ZYIA 3IDMB 1F4XL 1UGNA 1QFWM 3HE7C 3T0WA 2BVTA 3W9DA 3QNZB 5I66A 4EVNB 1CL7I 3MMEB 1J5OH 1JGDB 2PUQT 3QXAB 3AREC 1FFPB 1IE5A 3FB7A 3QQ9D 4G7VL 4IRJC 1B2WL 1K4DA 2N56A 3G9VA 5LKNA 3OJDB 3T0XA 2R0ZH 4J2XA 4HIHA 1YEFL 5IBUG 3BVNB 2H6PA 5EN2A 1N59A 1DUYB 4QHLB 4NNXA 4XH2A 5T5FH 4P5TD 1IAII 4ODSH 4M4PA 5DRZA 4FABH 4RGNE 3MOAL 1DLHA 4OAWB 1QVOB 2AK4D 5E00A 2ZOKA 3W2DL 3O11B 4NO0B 1XIWD 2X89D 1N4XL 4F7TA 4XP9L 3P9MA 4FXKB 3IAGC 3TYGH 5C0CA 1SBBA 1H8NA 1ZEAL 1I7RA 4JGJA 3RNKA 4GW5A 3KNBA 5CHNA 1I9RL 1HHHA 3D2UB 5L6YH 4P5KA 1AC0A 3ARBC 5CFHA 1BF8A 4LLMA 3IDUA 5BO1L 4YIQA 4X9BA 1NDMA 3UTSE 3NIGF 4DUVA 1UXWA 4IJ3B 2H1PL 2QQQA 4HKXB 1G7LA 1R0AH 4OI7A 3QJHA 2R1XA 3U6RA 2OR9H 4J3XA 5F7LB 3QQNA 1F6LL 5J7CC 3TA3B 1RU9H 2IFGA 4HGKC 1EO7A 4OLZL 1U6AH 2R2HB 3EKCA 4C54A 5GGSB 5JZ7C 3ES6A 2AJVL 2B1AL 4OGYL 4NHCH 1TNMA 3G6AB 3ZKXC 1VFBA 3ZKNC 5AWNH 5IWLC 3UBXG 3CSYB 3VXMB 2FBJL 1PKOA 5E00B 3UYPA 1S7QA 1X3DA 4TQEL 4M7LH 5K9QI 4WI7A 3Q5OA 2GSIA 1NPUA 4F7TB 1T20A 3P9MB 1ZKAA 1OCWL 5C0CB 3N1QC 3KYKL 4C83A 1S9YB 3P4LA 2HVKA 2EC8A 3KNBB 3X11A 1QQDA 3LY6A 5CHNB 4Z7VF 3NVQA 1HHHB 4P5KB 1ORSA 5KSBE 1EJOL 3JSSA 1BJ8A 3HMWL 4C56D 3L95B 3HMXL 2Y72A 2X4OA 3CDFA 1CQYA 4XAKE 4YHKH 3RDTB 3O0RH 2EH8L 1FHGA 1LK2B 1ZGLB 3O9WD 4CL7A 3MGTB 5BMFL 4U1IA 1FE8H 5JPMA 3O2WH 2HTLC 5D72L 2ADFL 4NO2B 5D71L 5TFSL 3UO1L 1XF4A 3P30H 4GXUN 4QXTA 5IVXE 3QUXD 1IAOA 5I1JH 3O3UN 5FCUL 3E6HA 1LO3L 2DI7A 3UJTH 3ZE2F 3NZ8B 1HILB 1PZ5A 2Q8BH 2WBJD 4D9QE 2BXYA 4MXQC 1FCGA 1VFBB 5FHAL 4U6XA 3RKDD 3GMNA 4X8XA 4F37K 3O41B 2GSIB 5D7SH 3G5XB 3K74B 1J8KA 1T20B 1N2RB 5C08E 1CR9L 4C83B 1G1CA 3FT4B 3ZHLA 4K3DH 3T0DA 1QBLH 3S5LG 4YPJA 4NCDA 4L3CA 4XVTH 4DVRH 5L8KB 4S11A 1XGUA 5F96L 3V4PL 2VDQL 4DKAA 5SX5H 5F7EL 2ITDA 4IOIA 5JPMB 3MXWH 1OVZA 4HIEB 4EN3B 3UTTB 1E27A 4WTZG 1XF4B 5AYUH 3DX6A 2JCCF 4AIZA 5MP6L 5GS2D 2LVEA 2GKIA 1CTOA 1IAOB 2VXQH 2WQ8A 1C5DB 4POUB 1V3JA 3LKRA 1KJMA 3QG6A 3E6HB 4QXWA 2GSGA 3UYOD 5DA0B 4DW2L 3ARSA 1K5NB 5HD8D 1PZ5B 2VDRL 1ZLSL 2W65A 4PJBE 2SEBA 4G6JH 4U6XB 3D39E 2QV2A 5IROC 4M6MH 1XCTA 1MQ8A 5EO0A 5HBBA 3C09C 3NOIA 3U9PH 3UBXA 3O3DB 2CDEA 4CVXB 1MLBA 2P46B 4PRPB 4RFEA 3MJ8A 3FJTA 2MHAA 3CZFA 1RUML 1AQDA 1J12A 2BRRL 2PXYD 5GS1A 1I3RA 4L3CB 5T33L 1XGUB 4LK4A 2DN7A 1M1SA 2CJUL 4OZHF 3WUWA 2ITDB 1UH3A 4IOIB 1HDMA 2ZSVA 1RZ7H 4GOSA 5JUEH 2XV6B 1E27B 3RVVD 3QEQB 3DX6B 4QRSB 5I1AA 5GRWA 1CK0H 3QQ9C 1W2KT 4XCYA 1YDPA 1LE5A 2F58L 5DXWA 3V0AC 3STBA 3D0VA 3LS4H 3LZFL 1KJMB 2F19L 1IAKA 1QYGL 4TRPL 1RMFL 1UJTA 5DSCA 2G5RA 4ZUSA 1OB1A 1IM9A 3SE3A 4P5TC 5AZEH 4OSUL 3MV9E 4OB5L 4D3CH 1A6VL 1DUZA 2SEBB 3MLSL 5FGRA 2XN9A 4Z18A 4P23B 3ZYOA 1CICD 2C3HA 4P3CH 3AUVA 1XCTB 1RAMA 1ZT7A 4RQQA 3OX8A 5T3XD 35C8L 1U8MA 3UBXB 3SDYL 1J18A 1PLGH 4QRPD 2Z31A 3SCMD 1I1FA 1NFDF 3EJJX 2G2RB 4RFEB 1JV5A 3GIZH 5F9AC 2X4UB 3T65B 3CZFB 3SKJH 1AQDB 5F1OB 1BZ9A 1I3RB 4A6YA 4F15C 2VIRB 3L3JA 3TO2A 4OD3H 1NCTA 1NJ9B 3V8CA 3S5LA 3EBAA 3PV7A 4X8JA 1WAAE 3EOAB 1AI1L 2HJLA 4ZFGL 4XVJH 4AG4L 2DQHL 5E2JA 3FKUS 4L9DA 2ZSVB 4MB4A 4PRPE 2I25N 2PW2A 3WIHL 1GRWA 5I1AB 3LRSB 4XCYB 5HVGB 1YDPB 4NN6C 1LE5B 2Z9TA 1FO0L 1SY6L 3D0VB 2YRPA 4WTZA 2QL1A 3GIVA 3RL1A 1IAKB 5IF0A 1RIVL 1CVSC 3AROA 3FQWA 4PRIE 1E6JH 4UDTB 1L0QA 1H3VA 5DSCB 5ETUA 5FO8A 4ZUSB 1IM9B 3KS0H 3LIZL 3V6OE 1HIML 1DUZB 3DARA 3ARDD 4F7PA 4LFHD 4XNMA 5CD3A 1DBAL 2XN9B 3ZE1F 1OAYL 5FUZH 4XPTH 4FQXD 4RGMB 1ZT7B 3WFEL 4AQOA 2BHUA 3OX8B 4RQQB 4Q2ZB 3DUSA 5CEXA 2XOTA 1E4XI 3MJ7A 1JIBA 1MIEH 5ESAA 5I1EL 5F6IC 3QDMD 1JYXA 2Z31B 1I1FB 1RZIA 2ZG2A 4JCLA 1ZS8B 2DQDH 1QA9A 5AUMB 4LNRB 1BZ9B 4A6YB 3V5DB 3L3JB 1CGSL 2D4FA 2DQTH 3TO2B 5EBMB 2NPLX 3S5LB 2EDJA 2RJMA 4JDTH 3Q3GB 3K7UA 2ZUTA 1LO4L 4MJIA 2DRUA 3PXHA 3MRDA 4N8PA 1T66D 5B3JE 3TF7C 3O9WC 5E1HB 2M2DA 2CH8A 1N5AB 2R1YA 2PW2B 3QRFM 1E0OB 3FN3A 4I18C 5J56B 4KY1H 2VLJE 3DGGA 5JW4Q 4LLYA 3QUXC 4JRXE 1DQML 1IGJA 4NIKB 3MLRL 5GZND 1PEZA 4TVPD 2BVEA 5FO8B 4NGHH 3QT2A 5EC2B 1Z9SA 2WBJC 4HWUA 4F7PB 5CD3B 5A16B 4OUUB 1FLTX 3RKDC 1Q9LA 2I9TB 4MA7L 3GB7A 2XXMB 4JFEE 3EW3B 3DUSB 2PYEB 2YD6A 2A0LD 5EO1A 3MJ7B 3ME0A 5FV2A 1IFHH 3VGAB 2M1KA 43C9A 2B5IC 3Q0HA 4U49A 1ZLUH 1X7QB 4JFHE 1RZIB 1MCCA 1JK8A 4YHPA 3GHEL 1JFQL 1MJ8H 1QA9B 1I8MA 1EERB 2YD4A 3SY0A 2YWYA 4N0FA 3BDYL 5D9SB 4PTUA 2VN4A 5EIQA 4M8QA 1TZIA 4MJIB 5HHOD 4KHXH 3MRDB 5J3HC 3HZVA 4R7NA 1TNNA 4RIRA 1N6VA 4I5BA 1YJDC 3FO0H 3QIBD 4XNZB 5DJAB 4LLYB 5HDQH 3MV11 4XWGH 1X44A 2Q7NA 3SEPA 1C8PA 3PXJA 5ANMB 1G6RH 2YN3A 3KJ6H 1L9NA 5I30H 1CTNA 4NRYA 1RZJC 2E8ZA 1E4WH 5HD8C 1W72L 1NDGA 3L5WA 5BV7B 3VGBA 3INUL 3UJJL 1DN2A 4YFLI 7FABH 1L4IA 5C0DA 3EHBD 3N06B 2E7CA 3DYOA 2Q20A 3I02A 2Y25A 1AD9B 1A9BB 3WNOA 5HSFA 4AT6B 1CDIA 5F70A 1QP1A 5TF0A 1D5MA 4HXBH 4N0UA 3E3QC 3MC0A 1ED3B 4GRWB 5GS0H 1JK8B 2Y6SD 3AMKA 2GW5A 1WC7A 1UKTA 2XG4A 5HPMA 1KN2L 3WS6C 2PXYC 5IHLB 3SKUD 4P4RA 2X6MA 4N0FB 4X9IA 1QLEH 4OBRA 3QDJE 4KRNA 4HC1A 3MLYL 1URLA 4IHOB 3HZVB 3DPBA 4EKXA 1MRCH 4GUPB 3HR6A 2ICES 4BFIB 1R3HB 4RIRB 3RVVC 5CZVL 2F5AH 3B3IA 1T2QL 3AM8C 2YMXH 1ADQH 1QSEB 3WN5A 3BGFB 3M8OH 2EDXA 1FL6A 3S4SB 2NXZB 1BP3B 4YXHH 3L5WB 2VL5A 4PJAE 4LLUA 5DJYA 1CICC 5D2NA 1NGYA 5IMOA 3GBNL 1RZJL 4ONFL 3BRFA 2Z8RA 3RNQA 2D7TH 1D5MB 5FF6B 4N0UB 5AD0B 4U1KA 2IALA 3SCMC 1BM3L 4JM2F 1P69B 3NTCL 1WC7B 4P4RB 1BEYH 1C12B 3T0ED 2JJTA 2ZUUA 4JM2D 4JKKA 2W38A 2MJWA 5F1NB 4MA3B 1QNZL 2GJ6A 4X6DE 5JA8B 3BPNC 5IKCA 5I19L 4JY5H 1YY8B 3Q1SH 3KLDA 1BIIA 4OI9A 5DWUL 2YK1L 2Q3ZA 5E8OB 5E9DE 2XQBH 3BIKA 5FOBA 4M03A 4XXDA 4JFFD 3WN5B 3B8SA 5AZ2L 3CIQA 3BIBX 3KPPA 4DUXA 4BQ6A 2DKMA 4LRNL 3EZJB 3ARDC 4ZQKA 6CGTA 5ACLA 1P1ZA 4MCYB 2ADJB 2JF1A 3VWKB 3P4MA 1D6VL 5T1LA 1A3RL 1NGYB 4FQXC 2C1OA 3VXRA 2CLRA 2P7TA 4OI8A 4MB5A 4H5SA 1YPZA 5DQJA 2P44B 25C8L 5JXAL 2GITA 1Z5LA 2NY5C 3SGJA 3F7VA 1OAUL 3S34L 3K4DA 2COQA 4LLDA 5T3XL 1EAPB 2VDPH 2VN7A 1C5CL 5EB9A 4JO2L 1RVFL 2VXVL 4RA0C 3EGSA 5E94A 4MLIA 2A83A 2H2PD 4FQHA 4PRNB 4NKDA 2P42B 1T66C 2R2BA 4LVOB 3C8KB 5IKCB 1FP5A 4HIJA 3QCVL 1UJ3C 1XZ0A 1V3MA 1BIIB 1J87A 1AGFB 3PGFL 4CVUA 2BNRA 3VGDA 3TCLB 1GGCL 3BIKB 3IFOB 2GAZB 5FOBB 3T3ME 3IJSA 3TH4T 3T77B 5J12C 3O6FB 5GZNC 4K71B 3KPPB 1NAML 1MCBA 3BOVA 1RHHA 4Y19A 5EU6B 1ZHLA 4LLQA 1FV1A 4ZQKB 5KJRH 3V7MA 1S9XA 3GI8H 1HE7A 1WBYB 3C8HA 1UWXK 4OLYL 4M1GL 3O3EA 4W6YB 2C1OB 2CLRB 1NC4B 4LSQL 4Z76A 5KVGH 4OTXL 5DMIH 2A0LC 3FN9A 1TJHL 5DRNB 4X7TB 4H5SB 1G7HB 4YHOH 2UWEF 1KACB 8FABA 1Z5LB 3QG7L 1BFSA 3B83A 2X05A 4ZFOA 1B0GA 2EDQA 4ENED 5J1SC 1LO5A 2HTKD 3EAKA 2JKXA 2DQGL 5E94B 2P5WA 4NOBA 2NY5L 2A83B 4ZNCD 4WEMB 4UINL 4ODWA 2CRYA 4CMMB 1QUNA 4X4XB 4YWGH 2R2BB 4ZXBA 4DKFL 3MRLA 2NY6D 3TFKD 2BNRB 3QIBC 1N7ML 2IH3A 1J7VR 4FNLH 3O81A 2NY4B 3DXAE 1AXIB 4P59L 4ODXA 2R56H 1BF2A 1DE4B 1P84J 2R8SL 3ULUL 5I6XC 3KYOA 5EWIH 1DFBL 2GEEA 5KTEH 4RGOL 4Y19B 5GJSH 4HD9A 3CCHA 1FV1B 1JGUL 1MFDH 1AO7E 1NCUA 4RISH 3EYSH 3V95A 4PJ7E 4OGXH 4ORGA 2NX5D 4D0CB 3NPSB 4JM4L 3VWJA 4TVPL 4I0CC 4Z76B 2Q8AH 4QXUH 3ETBF 4YC2C 3P4NA 1VERA 1UYWL 2R4RL 3MLWL 5E99H 3PL6A 4KZEH 4BUGA 5TE7H 3QHZH 1KFAL 2Y6SC 1B0GB 3SJVE 4PJIF 4DAGL 4DCQA 4LPCA 4YDIH 5KVMC 1LO5B 2F8VA 1PKQA 3E8UL 5C92A 3BMWA 2AS5M 4ZO8A 1JE6A 2P5WB 3NIDF 5I15L 2VKWA 1Z0NA 3ET9F 3C5SA 3ZYJA 5C3LD 4HUUA 1P4BL 3A67L 1UACH 4ZXBB 3BQUD 2O5YH 3MRLB 4CMHC 5KSAB 2JIXD 5IG7A 2I60H 3KHOA 5HGHA 2I07A 4M7KL 4ODXB 4XB8A 4QTHB 2CLVA 3B8YA 3R0MA 1J1XH 1Q1JH 2P5EB 3P77B 3RY5A 5FB8B 2F54E 4XBGA 5INDA 3UDWA 1MOEA 1U8PB 4JZOB 1RSFA 1X5AA 1MI5A 4LDLB 3UROR 3BUYA 2QSVA 1OAZH 1Q72H 2MKWA 3HFMH 3TNNB 3RUGB 4K7FA 2D9CA 3VGFA 4K23H 1ZGLM 3PL6B 1D9KD 2AI0L 4UV4H 2APFA 1MAJA 3QSKB 1B90A 4XMLL 5JOEA 2J3SA 3IJYA 1PKQB 2AJUL 4CAGA 5KN5A 1IBGL 2ERJC 3DX9A 5IM7A 3PQYA 3LQZB 5I0DA 3HTLX 4NQSA 3QR2A 3T0EC 4XT1C 4JM2C 4N8VG 1YN7A 4BQ8A 3TPUA 5ADPH 5C0AE 4U1NB 4HUUB 1DBKL 1DDHA 4M02A 3OXSA 4ODTL 4WCYH 4FQLH 3C5ZA 1MCWW 1IC4L 5HGHB 2I07B 2H45A 1K3IA 5F7WC 5A2FA 3RWFA 4G8IA 2AJXL 3CLEL 1A7NH 1J8HA 1GVIA 1JPFA 3SKMA 3U30B 3SDXF 4V1DA 5CEZH 4GAYA 4NSKA 4ZTPH 1TLKA 4IS6B 5INDB 3TWCL 4P2YA 3RWHA 4S1RL 1Q94A 5IB2A 2KQMA 3OKDA 4MQSB 4RMSA 1HYRC 1RURL 3BUTA 5GHWL 5T1KD 3MXVH 5IUSA 3SN6N 5JO5A 2N7AA 3FMGH 4K7FB 3SDCD 4I48A 3DURA 4X80L 4PJ5D 3GEWB 1OQXA 5C0JA 4AY0A 4HMCA 3RTQD 2H8PA 3IJYB 1U41A 1OSPH 5IM7B 15C8H 3PQYB 2ZCLH 3QPXL 3NIFE 5FYKD 3ZLQC 3WFCH 4PLJD 3G04B 3Q48A 4FFZH 2UZIL 3AREA 3DWTA 4UBDD 1YN7B 3CDYA 4OLUH 3TPUB 2V17L 1VPOH 2H2PC 3IDNB 4PJXA 6FABL 1C1EL 4I0PD 1IEBA 4GRLB 3RAJL 3OXSB 5JW3H 2QSQA 3N1PC 3QCTL 3W9EB 2GYSA 3C5ZB 4WW1A 2BNUA 3C9NA 4JFDD 3S88L 2F53B 1N8ZA 2Z0BA 3RWFB 2DD8L 2FB4H 1QRNB 1JPFB 1JCKA 5IMKB 4V1DB 4GAYB 3IT8D 4MQTB 1PDKA 3MGOB 3IJHA 4FQ2H 4JKWA 5L2KA 3GKZA 1OSZB 1YMHB 5D93C 3RWHB 3TEUA 1EX0A 1Q94B 2CIKB 4IM8A 5IB2B 4YNYA 2W59A 3IU4L 3HMXA 3BD4A 4G7YL 3O3AA 4XPBL 2NR6D 1A64A 5JO5B 3U7AA 5ALCH 1DTUA 3DURB 5IESH 4PBWD 3AY4A 1GGBL 4LU5L 2OJZL 4NZRL 5BW7C 4ENEC 2H8PB 3HE7B 3HI6L 4IMKC 1KB5L 1FSKC 1WK0A 2HTKC 1NFKA 2X1WL 3BKMH 3ZDYF 3W39B 4NWTL 2DLFH 1RIUL 4XX1E 4PJCA 1N0XL 4IRJB 4U6VL 4DZ8A 4WJ5A 2YSSA 2APVA 4XGZA 1IEBB 3DRQA 3G9AB 5CGTA 5I1CH 1CZ8L 5D7LE 2NY6C 4MZ2A 4N8VA 3TFKC 4NPYA 3WHXA 1YYML 1AH1A 1RJZB 3LQAH 4WW1B 2BNUB 3C9NB 3QI9D 1U3JA 1N8ZB 5IFAL 2VISB 3VFSA 2MSPA 5DHXB 1WWAX 1SMOA 1A7RL 2X1XR 4QRTB 4L29A 5H37G 3D87B 4OUOA 5E8NB 3KPSA 3IJHB 1EEYA 4MDJA 2AXFA 2E6QA 5EU7C 2I9LA 3BWAA 3KS0J 3MUY1 3GJFH 1OGAD 3QFDA 4WDIA 3O3AB 4F8QA 4FQCL 2E9JA 2MKLC 2F53E 1KCVH 2QSTA 3B9KD 3ARBB 5KG9B 2QADB 3DOSA 2UZYB 3FOMB 4MA8L 4J6RH 4U7MA 3I6LD 5EZJA 1KB9K 1CF8H 1U42A 2VRAA 4XNUL 5GZOD 4MNHA 2A1WH 4PJCB 4QNPE 4DKDC 3QHFL 2BSSA 4G6ML 4DZ8B 1JHLL 3DUHA 5E2WL 3TVMD 2H9GA 3BQUC 3T2NL 1GH7A 5MEND 4GKNA 4YFDB 4NQED 4LHUD 1XEDA 3MLZH 1FFRA 4PJEF 4JFQA 3ZKXB 1IZKA 4U1HA 2IAMD 5GGVL 2V2TB 1JNHA 5GISH 5IMLB 5KAQG 2ZCKL 2C26A 4L29B 1TMCB 2XXCB 3Q6GL 3WD5L 1EEYB 3P0GB 1C5BH 1UB5A 2X40A 5CZKA 2AXFB 3ARGD 1T1ZB 2M26A 2I9LB 3BWAB 3I75B 3ILPA 3I3BA 3SGEH 4LCWD 4P0DA 4CUCA 3ARPA 4OM1L 2C4FU 4S1DD 4P3DB 4WDIB 2YA2A 1R3IL 1T0NA 4PS4L 4X6CF 4L3EA 5EOCJ 4ZYKB 1HN1A 4DWHA 3LKPA 1FYTE 3CSPA 5KVDH 3KR3L 1MRFH 4KFZC 1D9KC 2WV3A 3S37L 2FSEA 1FVDA 3H2WA 5C6PB 1BVLA 1BBJA 2IH1A 4GLRI 1QFHA 2ZZUT 3IRZA 1T0PB 1N5YL 3VXOA 4YEFA 4WUUB 4FP8H 4L8CA 3IKCA 2BSSB 3BHBA 4ODVH 3VXUD 3WKML 5DEGA 3TJEL 2H9GB 2AV1A 1H9VA 5D5MA 5C0ND 5TQ0H 2F5BH 2VH5H 4PJGF 5DC0A 3GSUA 1LO0H 4D9LH 4OGZA 5C2BL 3BEVA 4PJ8D 2GTWA 1R3KB 4O2CB 4U1HB 4HG4J 2XKNA 2HG5B 3L5IA 1D7FA 2DB8A 5IROA 1CE1L 3VFUA 5DYOA 1HOCA 2DKSA 4NQCA 4PJDE 2WBKA 1F97A 3LDBC 4M61A 2YEZA 2LABA 1FL3A 3BZ4A 1T0NB 3O45A 3FFCE 2X4QA 4L3EB 3LKPB 4JAMA 1H15A 3AB0C 3SDCC 3WFZA 1K8IB 2NY1D 1AFVL 3VXTA 3SE8H 3TYFA 3WIHA 1BWMA 2WINA 3FB5B 3OZ9L 4NWUH 1FVDB 5SWSD 5SX4I 3RTQC 1BVLB 4K94C 3LN9A 3HG1B 1FO0A 1SY6A 1T3FA 3VXOB 1MJ7L 3QUYD 4XNYL 4NOFA 4PLJC 4L8CB 2B0SH 3IKCB 4IDJH 4UBDC 4HX1A 1KYOJ 1YYLH 3BHBB 1LEGA 3Q5TA 1CDCA 3UC0H 1E28A 1BZ7A 2XTJC 3CX2A 4I0PC 3QA3A 1BVKA 5D5MB 2D0GA 3MV7E 5JIPA 5DGQA 1QFWL 3GSUB 4PJFE 1HZHL 4X5WA 5I73C 1AY1L 4G8GB 4FQIH 1NFIA 3V2AR 5IR1A 1MEXH 3MLVL 5F1IA 2XKNB 4IOFD 1S8DA 4WUUE 1NLDL 3D85A 5BZDA 2AK4A 3VFUB 1H3WM 3C09B 1XIWA 4NQCB 2X89A 1GHFH 4E42B 2F8XC 4M61B 5CJQH 2YEZB 4I8DA 2XZQL 5HHQA 1FL3B 1F11B 3R1GH 2H26A 3WNPA 1KTDA 3O45B 3MBXL 2NR6C 1EBPA 2VLKB 2X4QB 3S35H 5MHSD 1A02N 5MEPB 4H20H 1H15B 5DRXB 3H42L 1K9TA 4UT6L 4AIOA 2VITB 3VXTB 5HI3D 4M43L 4X4YB 4LSRH 3IFLH 1FNEA 1KN4H 5FA3A 2EDTA 4UNTA 5DDHA 4BK4A 1Y0LA 2X5PA 3RVTD 3V6ZA 3K4AA 4I2XA 1EXUB 4FFYL 5I1IL 2OTUB 4AEFA 4HX1B 5FUOH 1KLUB 4CKVX 2ZSWA 4F7CA 1BZ7B 5C2UB 1P6FA 3TC9A 1JGEA 1IVLA 3QA3B 1BVKB 1UEYA 4PREB 3GMPA 5FYKL 3TNMB 3ZSTA 4ZSOA 2B20A 3X14B 1NCBL 4MAUH 4LSSH 3QI9C 5IR1B 4P5TB 5KS9A 3VI4E 5F1IB 3BP6A 4RDQG 4AEIL 4J8RB 3CMOL 4O2FA 2HJFA 1UADC 1IGFH 2AK4B 2DLEA 2BJMH 1HHKB 1MF2L 5DD0H 2JLLA 5JW4M 4LVNC 4N8CH 2IQAA 3NACH 4R2GD 5T5NG 5HHQB 4OZIF 2H26B 1GOFA 2NYYD 5IBTL 4OCRL 1KTDB 3NFSL 1FGVL 1ZV5A 1T83C 3B9KC 5CSZB 1K3ZA 3DSFL 4C56A 3THML 2JJUA 5IB5B 1FNEB 5FA3B 5HYJD 3GBLA 4XP1L 3E6FB 3LKSA 3DGCR 3QQ3A 5T1DL 1IKNC 1A9EA 4OGAD 3T09A 3O9WA 5IB4A 4WI8A 5GZOC 4M6OH 4L4TE 3X12A 1ES0A 4G43A 3KPRD 1GZQA 4I18A 4F7CB 1W72A 4NN6B 3U4BL 1BIHA 3TVMC 1CGVA 1HXYA 3QUXA 4XCNA 5DR5H 3X3FH 3GMPB 1QKZH 3ULVE 1B3JA 3VI3E 1U36A 2CMRH 4ZSOB 3GSVA 1N64H 2FECL 3TJHD 2WBJA 4S1QL 4RMTA 3BP6B 2IAMC 2XIDA 3HRZA 2QHLA 4O2FB 4CVZB 3K80A 2HJFB 4PP1D 1NMAH 1WZ1L 2BCKB 3UJIH 4EDWH 3NA4A 2R15A 1KJ2H 1DN0A 1H8SA 3ARGC 3VD3A 2IQAB 3B2UD 5DK0A 4MDIB 5F6IB 1J1PH 4OJFL 1NC2D 1O7SA 4S1DC 2ICWB 3A6CL 1EVUA 1MCPL 1H3PH 3W11D 3QUZD 1RJCA 1IARB 5ACZA 2UYLB 2AKRA 4C56B 5KANI 2MPAL 4K07A 4Z7VB 4DQOH 4TUJA 4WWKD 3O9WB 4GG8A 1S7RA 3WMSA 2IC2A 1CIUA 3AAZB 1JZ8A 3X12B 1ES0B 4G43B 1GZQB 3O6LL 1W72B 1DEDA 5ILTH 5LQBH 1XF2B 1HXYB 2V9QA 1KJ2B 3QUXB 5DUML 3U4EB 4QHKI 3EO9H 5C0NC 1RY7B 4LSVH 5JDSA 3EJZD 4XXCC 1T80A 2D7OA 2X9WA 3GSVB 2OK0L 1YEIL 3L3GA 4PJ8C 2JCCA 5JXED 5L9DL 4IRSD 2J8HA 4MJ4A 2ESVA 2YPLD 1WEJH 1CD1B 4XZUA 1YJDH 4ELKB 5BOZG 4LCIL 4MD0A 3RKPA 2H2SD 1XGPA 5BQ7A 1CD8A 1F90H 1DN0B 4PGBB 3K8LA 2DLTA 4UOJA 3QJFA 2X9XA 2B5IB 3LEVH 5CZXD 5DK0B 3ZYZA 4R0LC 1DANT 4UIMB 5C0RH 4L3AA 5EBGA 1CDYA 1JF1A 4HKBA 4UTBH 3MQIA 4YXKL 3WS6A 2BFVH 2NY1C 3LQMA 4GXVL 2PXYA 4KZDH 5A3ID 4P2QE 4ZNEA 3ARUA 4G9FE 5D70H 4JPWL 2NXYD 3U7YL 1T04A 3H0TA 12E8H 1LQSR 3SBWC 4HUKB 3QUYC 2BP3A 4QHKJ 4RMVA 1FDLH 1C7SA 3B9DA 4D9RE 3AM8A 3FB8A 1UWXH 3FAWA 2P8LB 2VR5A 4JKMA 3CVHL 2OX5A 3MODH 4EOWL 4YFLF 1EA9C 3O4LE 4XPHL 2JCCB 5IVOA 1UKSA 4Z7VE 3P11L 3QEGL 2V5YA 1ULVA 4JFPA 4IOFC 3TZVD 4WTXA 4LDEB 4Y5VA 1ETZA 1CYGA 1TFHA 1CICA 2FX7H 3VRLE 2Y5TA 4HS6A 3RWDA 1JN6A 4O02L 3FHAA 1JRHH 5BRZB 2GJZA 3SCMA 3CDCA 1WF5A 4HKBB 3U7WL 3AXLA 4NJ9H 1JZ3A 1INEL 3T0AA 2DBLH 1NCCL 4BK5A 1S5IH 4RGND 3QUMH 5HI3C 1KLGA 1V3KA 4HPOH 1TCRB 4G9DB 4GBXA 3PHQA 4Q6IC 1KJ3H 5CP3H 2UVFA 3BAEL 3B6SA 3A6BL 5JPNA 3REVA 2CRIA 1T04B 4RAHA 4RX4D 2IWGA 3H0TB 2AEWA 3RVTC 3WXWL 3BKYL 2XRAH 3RY6A 3TIDB 3FO2A 4NP4H 4YDKH 3FB8B 3KVQA 4YHLH 4TVSa 4O9HL 2QHRH 4OZHB 1FAKT 4Z9KB 4HT1H 1P7KB 3UTSD 5SWQB 1MJUH 2YKLL 3GGWA 1XR8B 4JPVL 1CLOH 1DVFD 1KCSL 2KH2B 5CUSL 4G6FB 1DQQA 1TVBA 1XT5A 2Y7QA 4JFPB 3ARDA 3EDJA 1A7OH 1ETZB 1LEIA 2EE9A 3WFBL 1AGDA 2ENYA 1GPOH 1CICB 2QQNH 4FQXA 3MLTB 4WU5B 1NCNA 4L8SC 2FR4B 1RD6A 2D31A 3T8XA 2Y5TB 4HS6B 4RBPK 3RWDB 1DQDH 1JN6B 4EDXB 4R2GC 1VFUA 4QRPB 3R8QA 3QDMA 2GJZB 1LDSA 1MCOH 4ZPVB 3SCMB 2NYYC 4OCWH 5F93C 2NW2A 3AXLB 1SHMA 2V2XB 1GOHA 4YO0A 1NGQL 5GGRA 3EYUL 4PB9H 3EUUA 1KLGB 4G80A 1BX2A 1NFDB 1TJIL 3GRWL 3QDHA 5JPNB 4HFUL 3REVB 3OMZA 1U8NA 2H32A 3QP3A 4BM7A 4AH2A 4MQ7A 5KSBF 4OGAC 1ZVSA 1DZBA 2FGWL 4F9PA 2UUDK 3JZ7A 1F58L 4XCEB 3SGKC 3EDFA 3LVEA 1NAMB 5FCSH 3JWDL 3FO2B 1CT8A 4WO4D 1YEJL 4MCZA 5CILL 1AJ7H 1JGLH 4LPXA 4XNXL 5FKAA 3LCYA 2PYFA 1OARL 5E8DH 3JUYA 4MX7A 4HK0A 1L7IL 1VEOA 4HJGB 3GGWB 1AGCA 4FOMA 1TVBB 3NAAL 3TJHC 2Y7QB 4Q7DA 4QT5A 1UCBL 4R90L 3ARDB 3KLAB 3FONA 1I9EA 1TPXC 4PP1C 1LEIB 1GCFA 4XC1L 2AV7B 2W91A 4HV8B 5FK9A 3VRJA 3OSKA 3CUPA 1VFOA 2AEPH 2D31B 3B2VH 3T8XB 2DQEH 3B2UC 3W81A 5IQ7L 4QY8A 1CFQB 1QG3A 4LLVA 1NCWL 3GHBL 5IFJB 1AE6H 4X7FC 4M48H 2NW2B 1PG7W 3G5VA 4YBLC 3GSRA 3GMMA 3W11C 4D9QD 1CLYL 3OR6A 3QUZC 1JHKH 3WE6A 1IZJA 5DZOA 2PCPB 4OLWH 1A2YA 2VDLL 4I13B 4OIIL 5DVOA 3HUJA 4G80B 1KULA 3KJ4C 1IGMH 2VDOL 3F5WA 5FGCE 2PW1A 4MQ7B 4RWYH 5HHOA 4WWKC 5BOPA 1ZHNA 5ID1A 3HC4H 3RY4A 3QO1B 5C08D 1SM3H 1Z0MA 2FWOA 4QXGH 2W9EL 5BS0A 1UJ3B 3S3JA 4PRDB 1CT8B 2RBLA 4HUVA 3QIBA 5MEQA 4MCZB 2IEPA 5FKAB 1UM5L 2PYFB 5J12B 3C6LB 4P2OD 4MX7B 3ARFD 2FX8H 3EJZC 3MRNA 4PB0H 4HF5L 5C8JA 1AGCB 5JXEC 1W0VB 2BVPB 1YMME 4IRSC 1CBVH 1NBVL 4MAYA 2VLLA 3RVUD 1G9MC 4JHWL 5FK9B 3VRJB 3CUPB 5B8CB 2H2SC 5E4EC 1FPTL 4BZ1L 3EOTL 1QR1A 3QIUA 2EICA 3FOLA 3DV6A 5CZXC 5FDYA 1YQVH 3S35X 1QSZA 4GW4A 1DL7L 1MCSA 2EH7H 3MRMB 3GSRB 1YNTA 3MRCA 3OR6B 4W4OC 3WE6B 1WTLA 3LMJH 3IDXH 4O2EB 3D39D 1A2YB 5A3IC 3HUJB 2ARJQ 1WBZA 4HJJH 2HMID 3S96A 2ADIA 3MRBA 1E4XL 4OV6F 5IQ9A 4JO1H 4X5XA 2NXYC 5HHOB 3RZWA 5ID1B 1ZHNB 3IAQA 3B9AA 4ZFZB 2FWOB 3NFPA 3CNKA 1QFUL 2G75A 5EA0H 3WDIA 4M5ZH 3QIBB 1TVDA 2BY1A 3ARTA 3P9LA 4GKOA 3KPOA 2CK0H 1VB9A 4WEUD 1BHGA 3MOBH 5C8JB 5I18H 2CIIA 1WWBX 4P46D 5L8JB 5LXGL 2W0LA 4XMKH 1XR9B 5I8EA 3TZVC 2VLLB 1VADA 2JJSA 4MA1C 3TV3L 1S3KL 5DS8A 3FOLB 5JIIA 1G9ML 1INDH 1A3LH 1YEDA 4GW4B 4YHZH 5JW4N 2R0WH 3EOBA 4DKEL 1EFXB 4XMPH 1AR1D 5EOQH 3N9GH 2Q86A 1YNTB 4AEHL 3MV9D 1T89A 3BGAA 1V7NL 1QOKA 4C59B 3GM8A 3FB6A 4RGNC 3UTTD 1R5IB 2J8UA 1NCAH 2DIJA 2WIIA 4Q9RL 3T0EA 2ADIB 3MRBB 1TITA 4JM2A 1N6QL 2RGSA 3U0PA 4GG6F 4PLKD 1YNKL 2G75B 5KSVA 4U1MA 4YAQB 4CMHB 3O2DH 3M1BB 2O5XL 3P9LB 4X83A 3HNVH 3KPOB 2PTTB 2Y36H 4QOKE 2CKNA 2RCSH 2WUBH 4ZS7L 3SKOA 3TT1H 4JFFA 3LB6D 5F89B 4Z0BH 2R29L 3RIFF 2JELL 2CDGA 4KMTL 2CIIB 4WW2C 1DVFC 4LGPB 3VFMA 1LWRA 4WIQA 4M6NL 2B4CH 4PRPD 1KTRL 1Q0YH 3PHOA 2XA8L 3PDGA 3CSBA 1UFUA 4OF5A 43CAA 5JOPE 5LJYH 1FNLA 1KB5A 2KL6A 2IBBA 5D1XA 4UU9A 2HFTA 4U1JA 2DICA 3TLRA 4Q0XH 1YEDB 4PRID 3EOBB 4R4FH 3ARRA 2YZ1A 5D2NE 3BE1H 3JVGC 5E5RB 5GRVK 4UZGA 3RWIB 3UTPE 5SV3A 4JG1L 3TIEA 3FB6B 3BEWA 4XPGH 4WU7B 2ERJB 2X9YA 2BHZA 4H26A 2WIIB 3WNLA 3T0EB 4JM2B 5DHYA 1NANH 3VFTA 3DI3B 3ZTNL 3U0PB 1NGXA 3I2CH 2BNQA 1I1AD 5KSVB 4U1MB 1BFVH 1UWGH 4WO4C 3N85H 1XFPA 1TQCC 1CFNA 2FJGA 2IPUG 5IBLD 1HINH 3SKOB 3B9EA 4JFFB 3BT2L 4ZFFA 2GJ6E 1UQSA 5ESVA 1K6QH 1MFCL 2CDGB 4XAWH 1RULH 1MVUB 3ZKMD 3OAUH 3WFHB 4KVCL 1A5FH 1T6WA 5E6ZA 3K46A 2ARJB 3HC0A 4NKMA 3DETD 3PHOB 4Y5YC 4LPWA 4I3SL 43CAB 1KB5B 2VDNH 4JRXD 4UU9B 1MCNA 2JJWA 3K2UH 3MLUL 4O5LL 3DHMA 4X6BA 1OAQH 1V7MH 4MNGA 1YECL 5CGYD 2WP3T 1CQKA 4OCSL 4KTDL 5BW7A 3VXRE 1OTSD 1L7TH 4IMKA 4TPRH 3BEWB 1H3GA 1M6OA 3MUGA 1QHOA 4H26B 3P73B 5C6WH 1UM6L 3VFTB 5D8JL 3PUCA 4NZTH 3BKJL 4Q9CA 1RIHH 4C55A 5GGQL 3X13A 5I1LA 1F02I 3GMLA 4JFHD 3ZT5A 1CFNB 2FJGB 2X1OA 2HH0H 2BC4A 2R1WA 2JB5H 5MI0C 4OCYH 1UQSB 4P2OC 5HGDB 3ARFC 3P0YH 5IT2H 5DEFA 5JHLL 2HWZH 4XCFH 2EEDA 1ZA3B 4NDMA 3QFJB 1R5WA 4NQVA 1EVTC 5D93B 3RVUC 2R4SL 1ORQA 3H9HA 3HC0B 4NKMB 3V4VL 2PKDA 2NX5A 2OMNA 3NN8A 5GRUL 1GC1H 2C4FT 1GZPB 5TDNA 1J5OL 5FGBC 1OTTD 1KSRA 3BDBA 4BQCA 2CUMA 4JDZA 3U48A 2QKIA 1FSKB 2YD7A 1MCHA 3MUGB 1WCBB 4Y4FD 2HMIC 1V5JA 1TXKA 2Q87A 2BDNH 3NPZB 4G7VH 5T5FL 3V0VB 5EUOE 5INCA 1PY4A 4ODSL 3PDOA 4NM4H 1OF2A 1WT5C 3BQUA 2AJ3B 4FMFA 3GMLB 4FABL 2NY6B 3UBXI 3PWUA 5FOJA 5E08H 4QRUB 4J12A 1F8TL 5J6GA 1DQJB 3GUTA 2CSPA 2X10A 1OY3B 1RZFH 1EEZB 4Q58C 4H0HB 4P46C 3QDJD 4P2RB 3OKYA 3ZE0E 2A9NL 1B4RA 2D3VA 2QJDA 4MD5A 1R5WB 4NQVB 3WL9A 1FG2A 1ORQB 4HGWB 1VESA 2NX5B 2ZG3A 3NN8B 3D1MC 4NUJA 2PR4H 2EKSA 5ENWA 3MRHA 1R0AL 2CKBH 2OR9L 4YDVB 5K59E 4HUXB 5AG8A 1AR1C 1S9VB 4Y2OA 2VR9A 3DO7A 2QKIB 4M4RA 1RU9L 3MCLH 5DD5H 1U6AL 2MFNA 3WFDH 1T7WA 1KIQA 1T22A 4JJ5A 2Y4SA 1GAFH 1G7QA 4UTAH 3HI5H 3SE4C 2AERT 1A6ZA 4PJIB 5EIIA 4NHCL 1OF2B 1U93A 3BQUB 1I8LC 5AWNL 2MTPA 4PLKC 4HUNB 2EYRB 1J05A 2ICCA 2JIXB 4X7EC 4M7LL 1INQA 3VMOA 4X6DF 2UWEE 1NEZG 3LB6C 2CPCA 4TNWF 4OKDA 1Q9WA 3EYVA 2X4TA 4LKXB 1QFPA 2J6EL 3DX7B 4RAVB 3BW9B 5FDWB 3VD7A 2P45B 4MD5B 4JFXA 1G9EA 2PTVA 2P43B 3WL9B 4HS3B 3EFDH 1NGPH 5D7IF 4NUJB 4N0CD 4MWFB 4WNQA 1A21A 5E9DD 4YHKL 3O0RL 2EKSB 5ENWB 3SDCA 2HFFA 3MRHB 3VCLA 2C7UA 1EJOH 4PJ5A 1FE8L 3C87A 5DVKA 3O2WL 2A6JA 4M1CD 1D9KB 1MI5E 4D0DB 1A4JA 3P30L 4P2RE 3DO7B 3V6OC 3WIIH 4KH2A 2JK5A 5I1JL 3HLAA 5D2LA 2VXTL 4JREC 5D71H 1LNUA 3VDCA 5JOFA 3UJTL 1JRHI 1QSED 3B4NA 2Q8BL 5EORH 5C09A 4I0PA 1U93B 5HVFB 1I1AC 4AJ0A 1XMWA 4K94H 5GS0D 1FZMA 2YXFA 1INQB 1TENA 4JFDA 5DJ2B 4JPIA 5D7SL 5IBLC 1P84K 2RHEA 2ATKB 1J0YA 4PV8A 1Q9WB 4BZYA 4K3DL 1QBLL 5TDOB 2J88H 3ZKMC 2DWDB 4YHNB 5K9QG 5EBWB 3T3MF 5I1GH 1CIDA 4JFXB 4NQUA 3NIDE 3SPVA 3STLA 3LDBB 4H1LG 4XVTL 4DVRL 3OG6B 3DETC 3ZO0A 4QRRE 5T1KB 3SDXB 4WNQB 1X5FA 4LPYA 3SDCB 3VCLB 4EBQH 4G8EA 5ISZE 4PJ5B 1YEEH 2WLYA 3MXWL 3BGMA 4QRQA 3SGDH 5CGYC 2ZCHH 5AYUL 1IEAA 3RTQB 2JK5B 1OTSC 4CVWA 5HDBE 2VXQL 2Q76B 2X7LB 5E6IA 2QSCH 1UXSB 1LNUB 4QGTA 5JOFB 4BYHA 4ISVA 4FTVE 1XF3B 5MP6H 2XTJB 2CK2A 4I0PB 4MJ5A 1MNUH 1MQKH 4G6JL 1PFCA 1A6WH 3QXDA 1KPUA 5I73B 4P4KD 1FZMB 3LV3A 1TZHA 3TP4A 4JFDB 4JPIB 4PJXE 2GY7B 3MBED 1VCAA 3IB4A 1U58B 1OWRM 2MOVA 1CL7H 2NTFA 4TSAH 3MV8B 3ROOB 1NEZA 3RVXC 2J4WH 5I0ZA 1UA6H 5HY9B 4WUKH 3SPVB 2W0FA 3STLB 3BKCH 3FFDA 5JORA 1OGAA 2D7QA 4ZPTA 1J0IA 1U91A 4ZTOH 5TGBB 5EZOH 4LSPH 3DXAD 3IETA 5C07B 2E7LC 1MFAH 5L2KE 3B9KA 5FA4A 3JV4A 3MCG1 4PJ7F 1JNLH 1IAIH 1I1YB 5JUEL 1RZ7L 5FECA 2VQUA 1OTTC 5IB1A 5F7NC 2MQ0A 1IEAB 1CK0L 4NQDE 4JVWA 1AO7D 3R4DA 1IKNA 1UC6A 3LS4L 4Y4FC 5FYKU 2HRLA 5IOPB 2E7HA 4ONHB 4ISVB 3WCYA 4HULB 5HTSA 2YUWA 3HZYB 1CFVH 4E0RB 5AZEL 4MJ5B 5SX5K 3TVMA 2FJHA 3BDXA 3C8DA 1QBMH 1JPTH 3QXDB 4X7SH 5EOTB 4P3CL 3O2VH 1LMKA 3SJVD 3RIFK 3LV3B 1TZHB 1YN6A 3VXPA 3QI9B 3VJ6A 1I75A 4U6HA 3VFGH 2IAMA 1PLGL 4GAFB 4OZGF 3G6DH 5DFTA 4DFHA 1P4LA 1NC4D 2NTFB 2HT3D 5E2UH 5AG9A 3GIZL 5ID0A 2E27H 1ZWIA 3VGAC 2RFXA 4EI5D 3SKJL 1DP0A 1VGKB 3ARGA 2A6IA 2W0FB 4LCWA 5B21A 3CH1A 1AD0B 5IVZA 4Z78A 2FRGP 4OD3L 4LGRB 3WO4B 1NKRA 4HEME 2K7QA 5DUBA 3KPSE 4H1LA 4XVJL 3B9KB 5FA4B 1F4HA 3QCUH 5F9JB 3DVFA 1ITBB 2FEEI 1VA9A 5IB1B 2F54D 1FVCA 1OAKH 1QLRB 4PJ9A 3CVHA 1MFBH 4DEPC 3WIHH 4M00A 3H7BA 4APQD 3RWCA 4WI5A 2ZJSH 3GSNH 3MRQA 3CFBA 5HVHC 5E1AB 3TVMB 2FJHB 3NCYP 1FO0H 3CVIH 1SJEB 4J3UA 1ZK9A 1ZANH 5MENB 4RBPH 4XPTL 1RIVH 4NQEB 4XXCA 2EZ0C 3F8UB 4LHUB 4PJ8A 1YN6B 1I9JH 5BXFA 3VJ6B 2V5MA 4PG9A 4U6HB 3MYJA 2OSLA 2IAMB 1MIEL 5ITFB 1X5LA 1OGTA 1P4LB 5SWZE 1I3VA 3QWQB 4DGIH 5ID0B 4B41A 5C0AD 3DMMA 2DQDL 3ARGB 4PJEB 1JZ6A 2FYYA 4ZUVA 4LCWB 3CH1B 1CLZH 4R0LA 2DQTL 5IVZB 1KIPB 3FQXB 3T08A 1EDQA 1T5XA 4N0CC 3VFRA 4JDTL 4M62H 1DBBH 3FZUD 4F7MB 4H1LB 2Y07H 2K3TA 2N1KA 1CD0A 4M1CC 1KNOA 4UQ3A 5SWSA 4KY1L 2VAAA 5EU5A 2EECA 2D0FA 3SBWA 1JI1A 3PP3K 5KSAD 4A2MA 3QUYA 3CVHB 2B8OT 4NC1E 2IQ9L 5EPMB 3MRQB 3LS5H 4NGHL 5FYLH 3VXUB 3DROB 2XZZA 4R7DA 3UTZA 4P2CG 3HAEG 5JQ6H 1U3ZA 3PHSA 5FO9A 2VC2H 2P5ED 4OFPA 5MEOA 3W5NA 3CFJA 4EUPH 5GS0C 5CBAB 4PJ8B 3TBSB 1RUQH 4MNQE 4PG9B 1IFHL 3UP1A 2NY7H 1OGTB 4PG2C 4PJGB 1SVZA 1ERNA 5BV7L 4QCIA 1JWUB 3MJ9L 4G42B 1LP9A 3LKNA 1MJ8L 5J4MA 5CWSA 3RX5A 4ZUVB 4R0LB 5DD3H 1T5XB 4BH8A 1BPVA 3VFRB 3GRWA 3N1MC 4KHXL 2NY1B 2OZ4H 3DVNB 1A1NA 4QWWD 3FO0L 4Q6IA 2VAAB 1QFOA 3RJDA 4PJEE 5HDQL 5JIHA 3STZB 4EUPB 3IFPB 4XWGL 2DM7A 4K3EH 2VZ3A 3V0WH 3QXTA 3U4AA 3KJ6L 5I8CA 5I30L 2IANE 2X4SA 5TE6H 1E4WL 4TSBH 2GHWB 3O3BB 1TVHA 4R7DB 4MJ2A 3UTZB 7FABL 4LSDA 4F80A 3OAZH 2V2WA 1I4FB 4X6CE 3F7PC 3ZMRA 4OLVH 5MEOB 3CFJB 4P4KC 1J9CT 1N26A 3MBEC 1A6TA 1LE9B 3BIAX 4HXBL 4NQTA 4JGUA 1OLZA 1GXEA 2ZPKL 5I75C 1C16A 4PPTA 5GS0L 1S7XA 2HN7A 4Q9QH 4L8SA 5CWSB 2D03H 2CDFB 2XFXA 5D7LD 3TO4A 4LEXH 1VACA 2NZIA 2FL5B 3SDAD 4JY6B 4GAGH 4X98A 4BH8B 3QWRD 3QQ4B 4BSWA 1KB9J 1CDGA 1QLEL 1MRCL 2A6KA 1A1NB 4YZFE 4XPFH 4Q6IB 2F5AL 5CEZD 1CFSA 3VFNB 4ZD3H 2YMXL 3MO1A 1ADQL 5E7BA 4OCMC 1LEKA 5IHZA 3M8OL 4OCXH 4OLXH 4QF1A 1NAKH 4TSCH 1A1OB 2AGJH 3GSWA 2F53D 4N9OB 4YXHL 2FD6L 4NRZB 3MRFB 5FYLE 1CGYA 5E5MA 5C0IA 3D25A 1WFNA 3PABA 3T3PF 4BA8A 4QNPF 4HWBH 2O61A 3FQUB 4TNWK 3HAEA 2HKFH 3UZEA 4HG4K 4JHZA 4JLRA 2D7TL 3CXDH 4CNIB 3HC3H 3D0LB 4CU7A 1W0WA 4PGZA 4I77L 4QO1A 2HT3C 1F45A 1C16B 1S7XB 2HN7B 4N9GA 4EI5C 5EG6C 1MRDH 2Z91B 5KS9E 4F8TA 2AJYH 1BEYL 1OWWA 1VACB 5F7YC 3NH7H 1NC2A 9CGTA 1FFQA 3LN4A 4BSWB 4G6KH 4MXVE 2FJFA 3QUZA 2A6KB 1PGRB 3GNML 4JY5L 3G5YB 3IFNH 3HNTH 4X7CC 4OZIB 3RPKA 3Q1SL 5HYJB 2G60H 4GJTB 3F58H 3OF6D 2ZNWA 4PJHE 2WMPA 2XQBL 5FM5M 4BKLA 4WWKA 1LEKB 1H5BA 5IHZB 4GH7B 1KYOK 1QPXA 4APQC 3GSWB 3KPRB 3EIFA 3OKMA 1FYTD 5C0IB 1NGWA 4GQ9H 1Q9KA 1KCUH 3PABB 5LWYH 1IC7H 3H8NA 1AHWB 4KI1A 4OCLC 2DAVA 4IRSA 4LRNH 4LAQH 1I3GH 5DMYA 2YPLA 1TPXB 2DL2A 3NPSC 5IMMB 2ORBH 1KBGH 5I74C 2FCBA 4Y5XA 2VDPL 3MNWA 2QADD 5T1MA 4JQXC 4LHJB 4O51A 4CW1A 4Y1AE 2K7PA 5I1HH 2EDFA 4BFEA 4YBLB 3FZUC 4CADA 2FJFB 1KXTB 1C5CH 2UZXB 3QUZB 4PJDF 4W4OA 3OB0K 5J1TC 5B39G 4HWEH 2XQYK 1FZOA 3VFPA 4U1SA 2EDEA 3KJ4B 2HRPH 4BKLB 4HUWB 4WWKB 5GRJH 5KSAC 5GGUA 3FFCD 1ZTXH 3WEXA 4WI6A 3KGRA 1Q9KB 2AXGA 1EGJH 5F7MC 1E4JA 4DN4H 3K2MC 2D7NA 5KJRL 3GI8L 1FQ9C 2DKUA 1DBMH 3QBTB 5F7HA 4JO4H 1CE6B 1CG9A 5KVGL 1QBAA 5DMIL 4HS8H 4IRSB 3LKQB 2ZG1A 5FHBH 2IG2H 2YPLB 4YHOL 3TZVA 4PJFF 2DI9A 1IGTA 4UUJA 2DTMH 4PGEA 5E4EB 5L7XH 2CO6B 2V5TA 3BP7B 2VKXA 5GSRB 2CO7B 1EBAA 2ESVE 1NCDH 2FO4A 5GGTL 1T4KA 2EKJA 3IVKA 1TQBC 2X4PA 4FQQA 3W82A 4YWGL 3WIFA 3MRRA 5IIEB 1QSFE 1FRGH 2EYTA 4WUUD 1FZOB 3VFPB 5I1KH 2X1PA 4QWWC 1HQ4A 5EBLA 4UINH 4FNLL 3KPQA 4MGXA 2NXYB 3KPNA 4NKQB 4RX4A 4DKFH 2R56L 3EO1A 4R4BA 5GGUB 4ZNEE 3G6JE 3RWGB 5EWIL 1F4WH 1JPGA 3U2SA 4DOHB 5KTEL 4MXQD 3U9UB 3RFZC 2RAMA 5GJSL 3SDDD 2AXGB 4JE4B 1JP5A 4RISL 3EYSL 2WWKO 3U30C 2OJEB 3UTSA 4OGXL 4ZOCA 1JNJA 3DTXA 4LQFL 4WW2A 3CH8A 2Q8AL 2WK2A 4QXUL 4XPAL 1BVZA 5JTWA 3CD4A 5E99L 3LN5A 4KZEL 4UUJB 5FM8A 4MA1B 5TE7L 4PGEB 1KJVA 3QHZL 3JV6A 4X7DC 3HNSH 3QNYB 4YDIL 4K8RH 4X0KB 1T1XB 3BZFB 3UMTA 2FO4B 1JYWA 3L3OA 1RQ5A 3SDAC 3IDMA 3IVKB 1UEMA 3QNZA 4FQQB 3JVGA 1ZVYA 1UACL 2A6DA 5CIPA 3E8UH 4RGNB 2O5YL 3OL2A 3QXAA 3SO3C 1FFPA 3M45A 1HQ4B 2YUXA 4DTGH 3E2HC 2I60L 3KPQB 5C70A 2AVGA 2VZ1A 3OJDA 4Z7OF 5B39A 2DMBA 4D0BA 4ODHL 3VD5A 3TH3T 3BVNA 5I17B 3EO1B 3UAJD 4HEPG 3FTGA 4WO4A 3MFFB 5DT1H 1J1XL 1Q1JL 3SGDI 2AP2A 4MHHG 4N90E 4MMZC 1QVOA 4HXAH 4KROD 3UTSB 1ND0B 2FIKA 5CJOH 2JJVA 2OTWB 4WW2B 1OAZL 1Q72L 1DVFB 3HFML 1XCQA 4HWZA 2KPNA 1FZKA 4K23L 3ULVF 4L4TD 2VLKD 1YC8A 4UV4L 3JV6B 4LBEA 2NW3B 4L9LC 1A47A 3MA9H 5IVXA 2UV3A 5C86A 1T7YA 1YUHA 1NL0H 3IYLW 5FO7A 3ULVD 4XHJD 1A4KB 1SEBA 3L3OB 4HKXA 1ZSDB 2OM5A 4LIQH 3S8WA 2A9MH 2P8PA 5ADPL 4K7PH 2A6DB 5CIPB 2JB6A 5L2JA 3QDME 4FQLL 5HXMA 2EE6A 3TA3A 1UM4H 4M7JH 4HBCL 5B39B 2R2HA 2K1MA 1MCIA 4D0BB 5GGSA 5C08A 4C58B 1A7NL 2XG5A 3FTGB 4WO4B 5CEZL 2BRQA 3G6AA 2YRZA 1TQCB 5J9PA 2QTEA 5KSBB 2DDQH 4NNPH 3CSYA 4HK3N 3VXMA 4EI6A 3EYOB 4P2OA 2FIKB 3OKKA 1FIGL 1QO3B 1J1OH 3ARFA 4PV9B 1MCRA 3V4UH 3ULUE 3MXVL 3RA7H 1XCQB 4GMSH 3FMGL 4HWZB 4PD4K 4F2MA 1KCLA 1FZKB 4LLAA 3U0WH 2DQIH 3I50H 1S9YA 2A2QT 2VUYA 3QPQD 4LBEB 4Y5YB 4TUKH 1S7VB 5IVXB 4TVPE 3S3SA 2QADC 1MCDA 1YUHB 3BP4B 1OSPL 5FO7B 3L95A 15C8L 1X4YA 4XCCH 2ZCLL 1SEBB 1X9QA 3WFCL 1DQLH 3RDTA 5FGBA 2DIAA 3LQAC 1LK2A 5DJ8B 3MRIA 1ZGLA 4OLUL 2P8PB 1QZ1A 3L3IA 2DBJA 3MGTA 4YHYC 4PJBA 3KPMB 3V5HA 5HHVH 2PETA 4NO2A 2JB6B 2ZUVA 3D39A 5JW3L 5L2JB 4Z7WE 1BLNA 1E4KC 1P7QD 1D5BA 4OFDA 3MPCA 1P9MA 4KRLB 4GAJH 4Z7UE 3OV6A 2OP4H 5C08B 4PFEA 1WT5A 2FB4L 3VMPA 5DVLA 5JW5B 4M5YH 3NZ8A 1HILA 2J6EA 1TZGH 2NLJA 5J9PB 4FQ2L 3S88H 4WFGE 5GS3A 3BJLA 2KDGA 3T2OA 1EO8H 4EI6B 4P2QD 4P2OB 5MI0B 3U36A 3OKKB 5JLZB 3ARFB 5BS0E 4PRAA 1A0QH 3O41A 4G9FD 4NO3A 3G5XA 4P46A 5ALCL 4F2MB 1N2RA 3K1KC 5IESL 1E6OH 1P7HL 3FT4A 5H94A 5C0GA 2Z8WC 3P4OB 1VFMA 4GT7A 4XPBH 4D9RD 4FA8A 1U8LB 5L0QC 4PBVC 1S7WA 2WWMD 5KVFH 3BKML 1MCJA 1GGBH 1HCFX 3O4LD 5F9WC 2DLFL 3MRIB 3VRLF 4LIQE 3O8XB 3L3IB 3MV9A 1DEEB 4PJBB 3V5HB 5I1CL 4HIEA 3S98A 3D39B 3UTTA 4EN3A 1JJUA 4NZJA 3DBXB 5E2VH 3IGAB 1BLNB 2P8MA 3LQAL 1D5BB 4M1DH 3ABZA 1HQRA 1C5DA 1U8KA 1ZHBA 4H25B 4C4KT 3H9SE 3IDJB 3BPOC 1I8LA 1K5NA 1MHEA 4XNQB 2I27N 4KMQA 2NLJB 1IAIM 1KGCE 2W60A 3I85A 3SDDC 1A3QA 1SJVA 3ZHDA 3WSQH 5K9KA 1A14H 1CLCA 3U36B 2EDLA 4PRAB 1WAAA 4NO3B 1KELH 4P46B 3O3DA 1GIGH 3MREB 1KCVL 4CVXA 3PDDA 4OIBA 2AAVA 4PGDA 4X6EB 5H94B 3I6KB 5C0GB 4PRPA 1YEHH 4J6RL 2DJUA 2R39A 2AK1H 1K2DB 5IK3B 4UT9H 1S7WB 1CF8L 1Z3GH 3REWA 1YA5A 4PRIA 1XF5A 3VXSE 1EH9A 5LGKA 4NBYB 5J3HD 3MRPB 3V6OA 3MV9B 5E2TL 5L88L 1OM3H 3QEQA 4QRSA 1NMCC 4XNUH 2DLGA 2P8MB 3MLZL 1HK6A 3ESUF 1NBQA 1HQRB 5GIRB 1U8KB 1ZHBB 3BD5A 3MCKB 3QEUB 5FAAA 2X70B 1VHPA 2AEIT 4J1UA 5GISL 5M94B 3UAJC 2YPVH 2J8UE 1MHEB 1MVFA 3FO9B 5DHVH 2W60B 2DIBA 1C5BL 2VDMH 5K9KB 4P23A 2QQLH 1WV7T 2VB5A 4KROC 1KPRA 1JNNH 2YR3A 5C1MB 3RBGA 4HCRH 4PGDB 5BRZD 3Q6FB 3MA7A 4BSVA 1JPST 2G2RA 1MRFL 3MZGB 4U7KA 2X4UA 1HSBA 1AP2B 4LKCB 4OD1L 3T65A 4ALAH 4LVHC 4F3FA 1SEQH 4JRXA 2VIRA 1PVHA 3ULVC 1NJ9A 4XHJC 5H2BB 3T1FB 3REWB 5EZIL 4PRIB 1XF5B 2HFGH 3EOAA 5J06A 1UKQA 4FP8L 3GJFK 5D6DA 4KKAD 4ODVL 4NFBA 2CXGA 3ZZ1A 1UWEH 4HIIA 1G7PA 3FQNA 4PRBB 5TQ0L 2F5BL 2VH5L 4D9LL 3LEXB 1LO0L 5F3BB 3LRSA 3PWLB 4JREB 3D9AH 2VZVA 4KV5E 4ZO7A 3W5MA 3TJEH 4L4VE 3L1OH 5EZLA 4J1UB 1L6XA 1I1AB 4UDTA 4G6FD 3QAZC 3JTSA 4NNYB 2W1NA 1EHNA 4L5FH 4MB3A 5K9OB 2BNQE 1KPRB 4Q2ZA 4KDTC 3WS3B 2DMKA 5ICYB 1T1YA 3MA7B 2GUOA 4LMQE 4BSVB 2YN5A 5BCAA 3GK8H 4HKJB 3QPQC 1JGVH 1HSBB 4BQ9A 4NWUL 1ZS8A 2VLJB 3JV5A 3PP3H 4PY8I 5AUMA 4Z95H 4LNRA 4F3FB 3IDGA 5CLTA 4JRXB 3V5DA 4GG6E 5EBMA 3HPLB 3BI9X 1AFVH 4YJZL 3Q3GA 2B0SL 2VERN 4IDJL 1YYLL 1M71B 3UC0L 1YMMD 3GSOB 3V9FA 2EDBA 1N5AA 4HIIB 4CDHA 1G7PB 1JUFB 5GJTH 3FQNB 4KKLD 4TULH 4KJYA 5DJ0B 1JI2A 4LPVA 4MNGE 4MZ3A 4JFEB 4QYOA 1S7TA 3S4SG 4LP4A 1PX3A 1MEXL 4NBZB 5EIVA 5EZLB 2V9TA 3F7YA 3H9YA 5ITBH 5EC2A 2OCFD 4GRWF 3JTSB 2MQ3A 1KXVC 2W9DH 5A16A 1GHFL 1OTUD 4OUUA 2I9TA 3R1GL 5IEKB 1XH3B 4KI5E 2PYEA 3S35L 1T1YB 2GQHA 4P9MH 4PY8J 1KPVA 4H20L 2OL3H 2GUOB 3BH8A 4TYUA 4C4KO 1X7QA 1OP3K 5DLML 2XZQH 4LSRL 1KN4L 1FC1A 2A74B 4AK1A 3IDGB 4U3CA 2MCG1 3BXNB 1L9MA 2HKHH 1Q38A 5D9SA 2WWMC 3MNZB 3VDBA 2VXUH 5TQ2H 1B0RB 3VG9C 1W0YT 3GM0A 4XP5H 1ZA6B 4I9WE 3MX0A 5FUOL 1RUPH 1F13A 4PJAA 4K3JH 2LTQC 5A40E 4FXLA 4Y4FB 2DJSA 4ZMAT 4KJYB 3QNXA 5DJAA 1AGEB 3MLXH 4QYOB 2D2OA 1S7TB 4XHQA 2QBWA 4LSSL 2F9BT 2XWJA 3C6LD 5FYJH 1NBZA 5ANMA 1PY9A 2OL3B 1I8IB 3F7YB 3ZT7A 1IGFL 3PP4H 2GJJA 1KLFA 4LNVA 3MJ9A 2LU7A 1G7JB 2BJML 3OKOA 5DD0L 3WJJC 5EOCH 4N8CL 4OQTL 3NACL 1X4XA 1JF5A 2DF3A 2W92A 2YD1A 1PYWB 1AD9A 1A9BA 3QDJB 4AT6A 1KPVB 4WI4A 3BH8B 5C0BE 4EXPX 1OD7A 1ED3A 5M95B 3KDMB 5C7XH 1G1YA 4CRPA 5E9DA 4NCC2 4QOKD 5TPWH 3IU3B 4U2YA 4K7PX 2DQJL 2C3WA 4M6OL 5KW9H 2FEDD 1BD2E 4IHOA 4PJAB 4GUPA 4HPYH 4BFIA 1R3HA 5DR5L 3X3FL 1QKZL 3QNXB 4DEPB 1EZVX 4Y0GA 4J7RA 3CXHK 2FATH 5HVHB 5JOPD 1QSEA 1IRAY 2XWJB 1NBZB 1N64L 1KC5H 1KTKE 2C3XA 3L5HA 4XP4H 3L6FA 4X4ME 3S4SA 1NMAL 3UJIL 4EDWL 3MTRA 4UDUB 3OG4B 2X4RA 2B2XH 1KJ2L 4GKZB 3OKOB 3ORJA 2GIYA 4ELME 1JWSB 4GLRH 2K9UA 5F88A 1J1PL 3HI1A 5AAWA 5FF6A 2X1QA 4JKLA 4X6DB 5AD0A 4DZBB 1EFXD 3CGTA 4MXWH 4FQ1H 5E9DB 5HHNA 1ADQA 4DQOL 1C12A 5IW1B 1CFTB 2GJ6D 4HWNA 1G6RB 2LAGB 4H88H 4JKPH 1S7UA 5F1NA 4KWUA 4KKAC 4MA3A 1A7PH 4OFYD 3DUUB 1MUJB 5LQBL 4OBSA 5E03A 3HPJB 1YY8A 1NGZA 3EO9L 4WEBH 4LSVL 4P9HH 5E8OA 1D6EB 3RU8H 1GGIH 5FYJE 4HLZH 1WEJL 3L6FB 1YPZF 5AYQA 1YJDL 5D2LE 4E41E 2X4RB 1XAUA 4J23A 1SYVB 4L8DB 3VXRD 4P4KA 4FZEH 5KSUB 1F90L 4MCYA 5SX4H 2ADJA 2HLAB 3UPCA 3VWKA 4OFKA 5C09E 3LEVL 5F88B 2A77H 2E5EA 3HI1B 5C0RL 2E8YA 3OB0H 4LCIH 1DANU 1I9IH 1U3HD 5IW6A 1TETH 3NMEA 4UTBL 3LPGA 5DUPH 3DI2B 2BFVL 3H3BC 2X2YA 4KZDL 4DGYH 1EAPA 3IXAB 5D70L 5HHNB 1WIUA 4I0KA 12E8L 1TJGH 3MJGX 5M7QA 1A7QH 1FDLL 2O93L 1ZLWH 4JN1H 3CZJA 1S7UB 4PRNA 5HHME 2J1KA 1GYAA 2R0LH 3C8KA 1FJ1B 1FFNB 1AO7A 1NGZB 4PJ7A 5DVNA 4KKLC 1AGFA 3MODL 3TCLA 3IFOA 2GAZA 4M7ZC 3S36H 1BECA 3T77A 4RNRA 3O6FA 4YX2H 4KRPD 1SJHA 5KOVC 1MCLA 4RRPG 5CGMA 5D7IE 1BGXH 4Z5RB 1U95A 1R6VA 2FX7L 4XPHH 5EU6A 3SJVA 4P4KB 5EUOF 3VGHA 1WBYA 1OTUC 3MBEB 5F8RC 4PUBH 1FIEA 4H8WC 1NC4A 2VLRE 4XBEH 5DRNA 5I75B 5IW6B 3I9GH 4X7TA 1G7HA 4EI5A 2DBLL 3FQTB 4BJLA 3ROLB 5ADOH 3QUML 2VLME 4HPOL 4G3YH 1D5IH 1KJ3L 3CFEA 3ZE0F 3NCYS 4LCCC 1INEH 3DXAB 1HI6A 3PF2A 2L7UA 1HH9B 1KCRH 2XRAL 4CMMA 1OGAE 4NP4L 3VFOB 4X4XA 4YDKL 4YHLL 2QHRL 1AO7B 4JQVC 4ZDHA 1XGRA 4F57H 4F58L 4PJ7B 4HT1L 5K59F 3P3YA 5DMGD 1U8OB 1MJUL 4ODBD 5JNYB 4APQA 3U79A 1PBYA 1CLOL 3C6LC 4ZAKD 4RNRB 4O9HH 3RBSA 1DE4A 1SJHB 1ZT1A 5J89A 1A7OL 3QIWD 1GPOL 1RUKH 1U95B 2YKLH 3ALPA 2QQNL 3GO1H 3VWJD 3SJVB 1RJYA 3QFJD 2ZP0T 2BSRA 4NC0B 1DQDL 2KQNA 2VMFA 4YQXH 2VZOA 5B8CC 4D0CA 5I1DA 3SQOH 1MCOL 5GGTA 4HH9A 4XVUD 4BSJA 3OPZH 3ISWA 4EI5B 4NRXB 2AJZA 4JQXA 4QHNB 1Z2KA 1OW0C 4Q9BA 3CFEB 4XB7A 2EIZA 4P48A 1HI6B 1WZKA 5IV2B 2V6HA 3EYUH 4JG0H 5BJTA 1QBBA 2FEDC 3M17A 2F54B 4HFUH 5ABDE 1AJ7L 1JGLL 5F6HI 2R0KH 1XGRB 4ZDHB 3DO3A 5E8DL 5KSAA 3CMGA 2X09A 2XWBA 4APQB 3JWDH 4JY4A 2C1PA 1GGTA 3P9WB 4QTHA 1ZT1B 3JUZA 1MI5D 5D2NC 2P5EA 3OXRA 2D9QB 1NMBL 3P77A 2LFGA 4P2RD 1RJYB 5FB8A 2AEPL 5I8OL 3B2VL 4RRPA 1U8PA 2BSRB 3NAAH 2DQEL 4JZOA 2A38A 1H3UA 4PY7B 5I1DB 4KJQD 2L4OA 4KTEH 4HH9B 5I74B 4U0QB 3TBTA 3TNNA 3RUGA 1AE6L 5C0AB 5DEZA 3R0NA 1JHKL 2AJZB 1JMXA 4EXKA 4LARH 4OLWL 3SE9H 4GXUM 1P2CA 2BVOA 4S10A 2EDYA 1IGML 2EIZB 4RWYL 3LQZA 1HWHB 1PEWA 5F6HJ 3HC4L 5DJXA 2VL4A 2ICEA 4QXGL 1F3DJ 4LMQI 5BJTB 2MQCA 4O58H 1F00I 3CK0H 4U1LA 4U1NA 3M17B 1MPAH 2AQ3A 3GMOB 4OZGE 2HYMA 2FX8L 1IT9H 2XWBB 4QRRD 3WUZA 4PB0L 4JY4B 2C1PB 5JR1H 1F2XK 3FCTA 5HDBF 1U8QA 5SWSE 1CBVL 5ISZD 4YH6A 5HGAB 3LEYH 5IHBA 3OXRB 4LQ1A 4WI3A 4YDLB 4IS6A 2RIKA 4F33A 5F3HA 3X17A 1YQVL 2EO1A 3ECBA 4YXLH 3DECA 3TBTB 1U3HC 2EE2A 2EH7L 4FTVD 5SV4A 1FPTH 5HYSG 1HHJA 4P5MA 1RPQA 3KYNB 4PJXF 2EC9U 4MD4A 4XP6H 3LMJL 3IDXL 1QEWA 1DLFH 3MROA 4HJJL 1P2CB 3SDAA 2BVOB 1TQBB 3QWRA 4JO1L 1LP9E 5DJXB 2ICEB 3G04A 4M93C 3KXFE 1VEPA 3TBWB 4YR6B 5EA0L 3CFCH 3IDNA 4U1LB 4M5ZL 4UOW1 1AKJB 2DYPD 4D8PB 4GRLA 2CK0L 2IGFH 5KOMC 3T2PA 5B38G 2B4CC 3D3VE 3W9EA 5I8KH 1T03H 4OV5A 3SQBA 3MOBL 4CJ1A 2XZCH 3AS1A 5I18L 4OQ1A 5CCKH 2F53A 3FCTB 1U8QB 5TJWK 4ONOA 5L2KD 3AS2A 1QRNA 4KRPC 1HKLH 3E0GA 5HHXH 5IMKA 1G84A 4KJPD 3MGOA 1EAJA 3PGCA 4OT1H 3DX8B 4NQDD 4BFGA 1OSZA 1YMHA 4FFVD 4F33B 5F3HB 3RQ3A 2VXSH 2CIKA 1CGUA 3ECBB 3QZWG 1INDL 1A3LL 5C71A 4YHZL 2R0WL 5D96C 5DD1H 1IGYA 4PJCF 5DTFB 4XMPL 5EOQL 1HHJB 3N9GL 4L9LA 1R3LB 4P5MB 4DK6A 5GGRY 4MD4B 1LK3H 5D7LB 5CINH 1QEWB 1WITA 3V8OA 1NCAL 3MROB 5CSGA 3SDAB 4L8BB 3OKLB 4NYLB 3HE7A 4U31A 5LBSH 5EC1B 4K2UL 3ALWA 4NN5C 4XBPB 5HDOA 3W39A 1YEGH 1EMTH 3SO3B 4FQJH 4IRJA 3O2DL 1G7IA 2XTJD 3E2HB 4JRYE 1SMAA 5IEHB 3HNVL 3T0BA 2FH8A 1AXTH 3DV4B 2WUBL 4OZFH 4JPKH 3TT1L 1JHTB 4OV5B 1RJZA 5DMGC 2AEQH 4QLRA 5C0FA 2VSDA 1NSNH 3KPSD 2VISA 1FYTA 4ZAKC 4U2ZA 1U8JA 4P57B 4QRTA 5F44A 4YFEA 2B4CL 3CDGA 4HMDA 2V7NA 3QIWC 3L5XH 5D1QD 3VXNA 2EEAA 2NMSA 3MV8D 4IBLT 5E8NA 2NY2D 1Q0YL 3PGCB 3VWJC 2N4IA 3PWPE 2E7BA 4B7LA 3ZSSA 1XGQB 1F6FB 4HAGA 1BFTA 1BQLH 1YNLH 1PW3A 4Q0XL 4R4FL 1IGYB 1FNGB 4XVUC 1ROWA 4PRHB 1WJ3A 5C07D 2XA8H 4L9LB 3BE1L 1QFWI 3ARBA 3MGAA 5KG9A 3VU2A 1ONQA 4LSTH 4XPGL 3VW3L 3FOMA 1QHPA 3EYQD 5HYSA 4OZFB 1T1WB 1FLRH 1IEHA 3QRGH 4M3JA 3CAFA 3CU1A 4JVUA 3RVWD 1MWAH 5SWZD 3L3HA 1BFVL 1UWGL 1E4KA 1G7IB 3N85L 3CPLB 5CLWA 5JMOC 1MH5B 2J12B 1HINL 2XKUA 4HAFA 3W0WE 3C2AH 1RZGB 1K6QL 5C0FB 4XAWL 1RULL 2KBGA 4NHUB 2AABH 3OAUL 3OHXA 1GC1C 5B38A 1FYTB 4NFCA 2V2TA 1U8JB 5IMLA 1A5FL 5IWLA 2Q7YB 4XC3H 3CDGB 2V7NB 3VXNB 3PGDB 3FQRB 3K0WA 4K7PY 1T1ZA 3I75A 4JQIH 3V7AE 1RZKH 2VDNL 4HDIA 4P3DA 1A6UL 4M9PA 4MVBD 5F1KC 3K2UL 1OAQL 3O6MH 4KJQC 1LGVA 1V7ML 4NUGH 1P4IL 4ZYKA 1MWAB 4B53A 1EZVY 2R69H 3U83A 3QZWA 1L7TL 5HJ3A 1ONQB 4TPRL 4NT6A 3SKNA 3KLSA 1FORL 3MLUH 5HGBA 5HYSB 1TTUA 3FO1A 4WY7H 1OAXL 2OI9C 3KAAA 1AGBA 4MNQD 3DVGB 3KYMA 3ALXA 4GMTH 1MFEH 4NZTL 4YHYB 3T3PE 4WUUA 5F9OH 1CXFA 3L3HB 1FGNH 4PRHE 4FQPA 1FAIH 4X9FA 1TTFA 1JYNA 1UM6H 2HH0L 4PJDB 4WHYG 3GMRB 2JB5L 4OCYL 3S36X 3O4OC 4WFEE 4M7LT 3P0YL 3GJFB 5IT2L 2BMKA 5DJCB 3FFCB 1R3KA 2ED7A 2HWZL 4G6AD 4O2CA 4XCFL 3OHXB 5B38B 3SDDA 2HG5A 4PGCA 3EFFA 4AMKH 1T0MB 4JN2B 2BVQA 2E7MA 2YD5A 1GC1L 4I4WA 4HDIB 3GZKA 2IAND 4Y4KD 3KYAA 4H0IA 1K8IA 1PG7H 3QZWB 5HJ3B 5L0QB 4ZG1A 3SKNB 4NT6B 3MV7B 7CGTA 2X4NB 3IF1B 5HGBB 4EQ3A 3FB5A 3NCJL 2FECI 4PJFB 2PN5A 5F9WB 3FO1B 5FFLA 3ZHKA 4FN0A 3BYTA 2BDNL 3HG1A 1AGBB 2OXGA 3KYMB 3OKNB 1IQWH 3QULB 4NM4L 3G08B 5JHDE 4DVBB 4YHMH 4WGWB 5E08L 1BQHB 4X99A 4LCYA 5KAQF 1HEZB 3BH9A 3BPOB 4RZCB 4BH7A 4YZFF 1FN4A 2Z93A 3F62A 1RZFL 2BMKB 1UZ8A 3D85D 4G8GA 1OP3H 2Z92A 3SDDB 1VEMA 4PGCB 3BESR 3F12B 1F8TH 3EFFB 1GJIA 3QDGE 4AENA 2BVQB 1ODAA 4KJPC 1FVEA 2D4DA 1I8KA 1Y18B 3ARXA 4FFVC 2PR4L 3D18B 4E42A 4I4WB 2A9NH 1KXQE 1F4YH 4XTRD 1F11A 2CKBL 2R2CA 4AL8H 4WGVB 2IPTH 2VWEE 4L4TA 3AY4C 4U1GC 1B0WA 2VLKA 5MEPA 5DRXA 2GFBA 5FYLD 4BZ2H 2VITA 3OTTA 3A6OA 3W9DB 3MCLL 2WANA 4DJMA 5DD5L 5I66B 1SJXA 4Q97A 4X4YA 3WFDL 5F71A 3TGXA 4BUHA 5IW3A 1GAFL 4UTAL 3HI5L 1F5WA 3FB7B 4N0YH 1BWWA 5KS9F 3UYRH 1K4DB 4KJWD 1ZLVK 1EXUA 2OR8A 2OTUA 4HIHB 3MJ6A 1NMCB 2FNBA 3P0VH 5LGHH 1KLUA 3LH2H 4K9EH 5EN2B 2H6PB 2Y06H 4X9GA 1N59B 4MXVF 4X99B 4LCYB 4WHDA 4NNXB 4XH2B 3ULVH 4PREA 3TNMA 3BH9B 5TE4H 4BH7B 5FM4A 1FN4B 5DRZB 3TCXA 2Z93B 3WUWG 3X14A 1UZ8B 1DLHB 2ZOKB 5DQDH 4P5TA 4PJHF 2Z92B 1J0ZA 4HUMB 4J8RA 1EV2E 2QQKH 4AENB 5J6HA 4N1HB 4KROB 5D1QC 3EFDL 1QTYT 1FVEB 1NGPL 2NY2C 4EZMA 1I8KB 1HHKA 1I7RB 4KDTA 3RNKB 2J6EH 4GW5B 2EIEA 4PP2A 4CU6A 4LLMB 4YIQB 4L4TB 1Q0XH 1JPSL 2OQJA 1NDMB 3H3PH 2GFBB 2GI7A 3WIIL 1UXWB 4LVHB 5EUKA 4KVNH 3MRJA 5CSZA 1G7LB 2V5RA 3QJHB 2R1XB 1A22B 5IB5A 3U6RB 1X5ZA 3EYQC 1MIML 2ARWA 1TTGA 3E6FA 3LPWA 4O00A 5FUCE 1MAMH 1B6UA 1CGWA 1MELA 4DGVH 5EORL 5GGVY 4HIXH 1LD9A 4HJ0D 3RVWC 2FX9H 2VXTH 3RGVD