4S1QH

Crystal structure of a vrc01-lineage antibody, 45-vrc01.h03+06.d-001739, in complex with clade a/e hiv-1 gp120 core
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
232
structure length
228
Chain Sequence
EVRLIQSGAVMRKPGSSVKISCRASGYNFREYSIHWVRLIPGRGLEWIGWIKGMWGAVSYARQLQGRVSMTRQLSQDPDDPDWGIAYLEFSGLTSGDTAEYFCVRKGPSCPHCGDFHWQHWGQGTAVVVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HIV-1 gp120 core
publication title Maturation and Diversity of the VRC01-Antibody Lineage over 15 Years of Chronic HIV-1 Infection.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 35
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2015-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1qH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1qH01
3QXUA 3C60C 4MNQD 1MHPH 5K59E 1RZJL 3PWVA 4D0CA 2W9DH 2BVEA 3CSYB 5KS9B 1IC7H 2VN4A 2PW1A 4OIIL 3F58H 1KACB 3D2UD 3FB6A 5AUMB 5IFAL 1I7TA 4AK1A 3LD8B 4TVSa 4CJ0A 3SDDB 2OZ4L 5LAXB 5JNYA 3GJFB 2ESVA 3VXQB 4NZDA 4K3HA 2NNAB 3PHQA 1MFEH 5C07E 3VXNA 3GMQA 5SV3A 4YBLB 4YPGB 3BH8B 1NGYA 5DRWA 5L2KB 2R69H 3W9DA 4F7MA 1TJGL 1N2RB 1NCAL 3NCCB 3BI9X 4HDIA 3SKUD 1QR1B 2I07B 3RHWF 3CVHB 5HVGB 1HXMB 4ZAKA 4NWUL 1C5DB 5JQHC 4F7EB 5L88H 2V5TA 1C08B 5HYSA 4M5ZL 4ZOBA 3PWVB 1HHKA 4ZFZA 1I75A 4D0CB 3VH8B 4OZGF 2NTSP 5E4EB 3QPXH 4LRIC 1ZA3A 3FHQA 2FX8H 5JA9A 1S78C 3FB6B 1QPPA 2Y72A 3EBAA 5F7FA 1I7TB 4XXCC 1U58A 3SO3C 5EOTA 1A1NA 3UO1L 1XF1A 3IU4L 3G6JF 1KIPA 4WFED 5JNYB 2ESVB 1X44A 1QQDA 3KPTA 3PHQB 5HSFA 5FHBH 4RAUA 3VXNB 5FO8A 3GMQB 2VAAB 4WHCA 1INQA 3O6ML 1NGYB 5DRWB 5DSCA 1FG2A 5KOMC 3W9DB 3IRZA 4F7MB 3OPZL 2X70A 4U1GB 4KDTC 4HDIB 1DQMH 2VDMH 3QWRA 1Z6JT 1BECA 1DR9A 4LEXH 2EH8L 5DD0H 4TOYH 3LN4A 3OZ9H 1C5CH 2Y4SA 1WBZB 4IDJL 1KBGH 4I2XE 1I9EA 3VJ6A 2HJKA 2DTSA 3UTQB 3BZEA 5JHLH 5HYSB 1E4XI 1E0OB 1GC1C 4ZFZB 1HHKB 1B88A 1NGQL 2XA3A 4H20L 4J3XA 4U49A 2KL6A 2VXSL 3IDJA 1MHHA 5SX4I 1B6UA 1ZA3B 3B2UD 1E27A 3MV01 4HK0A 4IOFD 2R0LL 2VIRA 2VJXA 3QHZL 3ARBD 3K4ZA 2MQCA 1U58B 5EOTB 5FHAL 1A1NB 2J6EA 3T08A 2FEEI 4BYHA 3IJSA 1BM3H 3LIZL 4NPYA 4OFPA 4IOFC 1KIPB 1SJXA 3MRBA 3VI3F 1NFDA 5DHVA 1QQDB 1TVHA 2VUOA 3ARBC 4RAUB 4U0RB 3P4OA 5FO8B 5DUMH 1INQB 2ILLA 4HXAL 3T0VA 2VXVH 3TBVA 1FG2B 5K33A 3S4SB 4LIQL 4R26L 3CH8A 1ZSDA 2X70B 1V3LA 4P5TA 4BQ8A 2W92A 4G5ZH 4OZFH 4C4KT 2CH8A 3KYKH 5I1AA 4KJWD 4S1RH 5D6CA 4WFGE 3VJ6B 1HHHA 2HJKB 2GJ6D 4IDLA 1YYMH 4NHCL 1CXHA 3BZEB 3LVEA 3WN5A 1I8MA 2IMMA 4JO1H 1EO8L 1NSNH 1KTKE 2ZCKL 4KJWC 5C2UB 1MHHB 1YN7A 1OPGH 1CD1A 1E27B 3T2NH 2VTFA 4HK0B 4WU5A 4IRSD 1MAMH 3MCG1 3GIZL 1K9TA 1GAFH 3AB0C 1QBML 4FQ1H 2R8SL 3IJSB 2I9TA 3SE3C 4NPYB 3MV9D 5T5NG 1YDPA 4UBDD 3MRBB 4WVRA 1NFDB 5DHVB 4UUJA 2JCCE 1TVHB 3P4OB 3ILQD 2F58L 3ULVD 2PO6D 4KFZC 4PYHA 5HGGS 1BJMA 4CDGC 4POZD 5C0BE 4UBDC 3TBVB 1WGOA 1S7XA 1WC7A 1ZSDB 3ILQC 4P5TB 3WSQH 3ULVC 2PO6C 4PJDF 2CRYA 4RWYL 4POZC 2XQBL 2VXQH 5D6CB 4HH9A 1HHHB 4PJBA 3UC0H 1F2QA 4OKVA 3WN5B 2Y36H 5CEZE 1I8MB 4WW1A 4PRID 2I60L 1MCFA 3GJEB 4JHWH 1YN7B 1CD1B 4YQXH 5IHUH 3L5XH 4WU5B 3W2DL 4D8PA 3B6SB 5ABDE 4PLOB 4RGOH 2HH0H 1QFUL 1H15B 4GBXA 3WIHH 3LRSB 2VLRA 2ZG3A 5I19L 2BOCA 4NQCA 1LDPL 5HDQH 2I9TB 4O2EA 3GUTA 4EN3D 2WIMA 3F7RA 4UUJB 1B0WA 3UTPD 1CE1L 1V7NL 5AYQA 1S5IL 4WI2A 1N5YH 5HI5D 5J56B 1HWHB 1I3GL 1UB5A 1S7XB 1WC7B 1FNEA 4XP4H 1JN6A 5EG6C 3AFLA 3N06B 5HI5C 2P1YA 4JFFA 3E8UL 5GPRA 4B53A 5DFWH 4IS6A 1ZGLB 5F6IC 5KSVA 2AJYH 4HH9B 5CJOH 4PJBB 4KZDH 3AY4C 3FB7A 4OKVB 1AE6L 4DEPB 2DLFH 2YZ1A 4MJIE 3MRCA 4WW1B 1ZLUK 3CDYA 4M6ML 1AFVL 4OFIA 3LS5L 4ZMAT 4MYWB 5EIVA 4UT9H 1DQJB 5F7DA 1FNFA 5DQDH 1IGYA 1UGNA 2E7CA 4LHUD 4D8PB 2MPAH 5EOCL 12E8H 2AJZB 2I9LB 1ZAGA 2OP4L 5FF6A 2W0LA 2VLRB 2BOCB 4NQCB 3UZEA 3GUTB 5IOPA 3NGBB 4PRPE 1L6XA 5E24E 1QSFE 4ONGL 1OD9A 2B1HL 4HPOL 5D2NA 5E9DE 3D85A 4JN1H 1W72L 5CZKA 4MQXD 1OD7A 4MD5A 1S5HA 1NKRA 5A2LH 3N85L 1R5IA 5E6ZA 2VNCA 1UB5B 4UNTA 3BD3A 1KIRA 1JN6B 1CLYL 2BY2A 4MQXC 3G5VA 4JFDA 4JFFB 4IS6B 3OG6B 5KSVB 5LXGL 5E1HB 3FB7B 5JXAL 1AXSB 1CF8L 3MRCB 4PJ9A 3C60A 1AXIB 3JZ7A 4LSPH 2PXYD 4POYA 3I9GH 4P59L 4N0CD 5F7DB 1MCKA 1IGYB 1N7MH 2HKFL 4MNQA 2NY5H 4MQ7A 4YDJA 5DGQA 5FF6B 4F9PC 2PXYC 3ZE0E 2IPTL 3L7EA 4N0CC 3SKJH 5E7FA 5IOPB 4HIXH 1VESA 1AXTH 4X80L 2ADIA 5FYKL 2W59A 5HPMA 3D2UA 5D2NB 3D85B 4M4PA 5GS2D 5LCVL 1PD6A 5GJTH 4MD5B 4I5BA 1S5HB 1LEKA 1R5IB 3B5TA 1BHGA 5FIEA 1DDHB 1KIRB 1WBXA 2YA0A 4XVSL 2ERJB 4H88L 3G5VB 4G6JL 4JFDB 3IFLH 4UT6H 4FQIL 2FHCA 4RAVA 1FO0H 1Q94A 2PETA 5IMOA 4LCWE 4X6CE 4XAKE 1IEBA 4HIEA 3DPBA 1CVRA 1RU9H 4PJ9B 1INDL 3C60B 4M6OL 2VUYA 3MRPA 4G9FE 4BA8A 4JM2D 2J8UE 3B9VA 1PY9A 4LRIA 3X17A 4PGCA 4X4ZA 4MQ7B 4YDJB 4WENB 4PB0L 2CGRL 4OLUH 1BQSA 3MGTB 4XXCA 4JM2C 4GXVL 1AI1H 3VFOB 2BJMH 4JFHD 5IJVA 1MRCL 2ADIB 5HPMB 3D2UB 1ORQA 4G42A 1KFAH 4NQSA 1LO5B 3H9YA 2AQ2A 4I5BB 4HG4K 2XV6B 3PWNA 4XVJH 5L0QC 1WBXB 4KI1A 1B90A 5MEPA 4H1LG 2YD9A 4KDTA 5MHSD 4KH2A 4ZUWA 4OUOA 1Q94B 5T1LD 2WLYA 5IMOB 1NCTA 1I1YA 3KXFE 1I8IA 2RR3A 3QJFA 1IEBB 4HIEB 1LK3H 3U0WL 2OLDA 5AD0A 5JOFA 1JGUH 3A6OA 1FNLA 3MRPB 5ADOL 2FHFA 2P47B 15C8H 1DZBA 4WY7H 1LE9A 3T3ME 2VDKL 1DBJH 4RMRA 2Q8AH 4HJ0D 4PGCB 4PJDA 4AIOA 1J5OL 1FH5H 1EX0A 4YHOL 2R4RH 4RA0C 1W0VA 3R0NA 5JIHA 2ZUQC 3RNKA 1ZLWK 3DHJA 2VL4A 3SO3B 3VRIA 4HJ0C 5IJVB 1H3WM 2P49B 1ORQB 4G42B 3BUYA 3GRWL 3TYGL 4NQSB 3ARBA 3W5MA 2H9GA 3R0MA 4PUBH 4M6NL 5I8OH 1NMBL 1IBGH 1UWXH 1MCDA 3CFJA 2F74B 4M61A 4JAMA 1MCWW 3U4AA 4KC3B 5MEPB 2AK1H 1OF2A 2F5BH 4PJXF 4ZUWB 2J1KA 5ITBL 1OOAA 1I1YB 4LHUG 1I8IB 1FZJA 3QJFB 3BWAA 2LU4A 1A64A 3HMXH 1J1XL 2FCBA 2QSCL 5AD0B 1PG7X 2HT3D 3UJIL 2GFBB 5JOFB 1RUKL 1T80A 1N0XL 4M7ZC 4CN6A 1LE9B 1AP2A 4PS4L 3IYLW 2GJ6A 3VMOA 1LP9E 2HT3C 2IFGA 1W0VB 4LRNH 3RNKB 3QCUL 5L6YH 3OL2A 4UINL 4UV7H 1WAAF 4NJ9L 1I9IH 3CFCH 3VRIB 1VADA 4EEEA 3SE3A 1CGUA 2CSPA 4IRSA 1PGRB 2Y25A 4PJ7E 3BUYB 4XPGH 5TQ0L 3BDXA 1RHFA 2OL3A 1CU4L 1U2HA 1T6WA 2H9GB 3ARBB 4L8DB 1GRWA 3SDXA 3MV9A 2DQDL 3CFJB 1QP1A 1YMMD 1FC2D 4JAMB 3GB7B 4FHBD 5EBLA 1J0YA 4NFDA 1OF2B 2PO6A 3WIIL 1A3RH 4U1IA 2IQ9L 1FZJB 2IFFL 3VU2A 3BWAB 4FP8L 5CCKH 2YBRA 3MV7E 3FQRA 4JGMA 4JFZL 3O2WL 1JYXA 3B2VH 2AXJA 4JQIH 1KXTB 3FONA 1AP2B 3H42L 4NQTA 4XTRD 5MI0C 2GJ6B 3WDHA 4L8BA 1YYLL 1LO0H 2BVOA 3PQYA 4PRIA 4H1LA 1MCCA 1BVLA 1U8QA 4APQC 4LKXA 5KBNC 3AB0B 4XTRC 5EU4B 1VADB 4NQEE 2WBKA 4Y1AE 4E9LA 1TZHB 4S1DD 4G7YL 1JNLH 1X5XA 4LLMA 4X9FA 2OL3B 1OAKL 2CXGA 3P77A 4L8SC 3GSVA 4PJ8C 3SDXB 4S1DC 5D1ZD 4N68A 3SY0A 2IG2L 5IT2L 3DTXA 2VR4A 2KQMA 5EBLB 5LVEA 4TVPH 1RJLA 2PO6B 4DJMA 1MIEH 4TQEL 4U1IB 5D1ZC 5F9JA 1KEMH 3CZFA 1MEXL 4FTVE 3FQRB 3AY4A 5D5ME 2Y07H 5IBLD 3IDGA 3U4BH 3QUYD 1NCUA 4QGYA 3VGFA 4UI2A 1B2WH 3CMOL 3FONB 4R97C 4N8VG 5AAWA 1CXLA 4U33A 5IBLC 2BVOB 4NZTL 3PQYB 3QUYC 4AM0A 3VA2C 3NZ8A 4PRIB 5C0GA 1BVLB 1U8QB 1GJIA 3P30L 5C3LD 4LKXB 5E4IA 5IB1A 3PXHA 3WEXA 2ZCHH 4LHUA 4LLMB 2VISA 3R8BB 5CP3A 1OQXA 3B9DA 2IC2A 3MMEA 3P77B 5EBWA 3TM6A 1H9VA 1KOAA 3GSVB 5FUOH 3TT1L 1MY7A 2VKWA 2AK4A 4X6FA 4UQ3A 2FEDD 4CU6A 3SY0B 3DTXB 4C58B 1UADC 1MQ8A 2QSQA 3MNZA 2HRLA 1JWSA 5ISZE 1RJLB 5E8DL 2B2XL 3GMMA 4CMMA 2W65A 5JHDE 2FEDC 5FOBA 4NOBA 5F9JB 4LNVA 5F6IB 5KVGL 3CZFB 3CXDL 3LQAC 1DTUA 1UZ6E 3IDGB 1F90H 1HEZA 4MQSB 3NCMA 4J23A 1IAII 3VXSD 3K74B 4PJEE 3TCLA 5I8CA 1YNTB 4EUPH 3ZLQC 4I3RL 1N0LA 3DUSA 4X7FC 1D6EA 2C26A 2Z0BA 4AM0B 4CUCA 3NZ8B 2JIXB 4OM1H 5C0GB 1MRFH 1F00I 4XRCA 4F9PA 5L8LB 2PXYA 5IB1B 2HLFC 3N1FC 3WEXB 5F1IA 1MVFA 5DUPL 4LEOA 1OL0A 1J9CT 3BDYH 4WDIA 1AR1D 3MMEB 3DV4A 1JRHH 5EBWB 4DCQA 2BFVH 1GGBL 2AK4B 5JQ6L 4X6FB 1BZQK 4NCDA 4UQ3B 1MFDL 5ECJE 1PEWA 3IFPA 4R3SA 4EQ2A 3MNZB 2QQLH 4L9LC 4S2SA 1JWSB 1AR1C 1QYGH 3HNSH 3VA6A 4OUUA 4DKFH 4FQHA 1QBAA 5D6DC 3T8XA 3X3FH 3GMMB 3JVGC 2W65B 4N0YH 4ZFGL 4YWGH 5FOBB 3U6RA 3GKWL 5TPWL 3CGTA 5C2BL 4M02A 3REWA 2PR4L 3PWLA 1IMHC 3OGOE 3MXWL 1HEZB 1C5CL 1KPUA 2YWZA 2B4CL 4G8GE 4LSDA 4Y8DC 3MRJA 4YHIA 5KANI 2YOCA 4ALAH 5I8CB 1WTLA 4JRYA 6CGTA 1P4IL 3DUSB 4HBCL 1U8IA 1D6EB 1G7HA 5FGSA 4EI6A 4UIKL 4XRCB 4Q9BA 1FG9C 4PJHF 2PXYB 1CFVL 1CZ8L 1G7PA 4JM2A 2Y06L 4XNMA 4OIAA 5F1IB 3RA7L 1ND0A 4LEOB 4Z7UB 2A38A 1BGXH 2OCFD 4WDIB 3G6DH 3DV4B 4QY8B 2IH3A 4DCQB 4DK3A 4AZ8A 3QXDA 2YD3A 5EU6D 2YK1H 5JR1H 3ZYJA 1BIIA 4NQDE 1DCLA 3IFPB 1XT5A 4R3SB 1MPAH 4S2SB 1UCTA 5T33H 1KJ3L 1OB1A 2FX9L 4OM0H 4FQHB 4OUUB 3T8XB 5F7YC 4OFVA 5CINH 1U6AL 3REWB 1WWAX 5DJXB 1J1OL 2DM3A 2FH8A 1WITA 4CN4A 4E0RA 3OKKA 5I1LA 2X9WA 3TO2A 4UB0L 2BOBB 1IAIM 3MA7A 5C1MB 2O5ZL 3MRJB 5AYUH 5T1LA 4LMQI 3WIFA 4JRYB 5CGTA 1G7HB 1NCNA 4HH8A 1UH4A 1VFBA 4EI6B 5KW9H 4YXKH 1G7PB 4JM2B 4XNMB 1IKNC 2VDRL 2FHBA 1ND0B 5DJ6A 1XR9A 2H3NA 2IH3B 2EIZB 1DQLH 3QXDB 1KJMA 3NZHH 4RBPK 3UPCA 4JO4L 3OAZK 5CMAA 4MA7H 3LEYL 4P2YA 1BIIB 4H8WL 4RWHA 5GZOD 5BVPL 2ENYA 1VDGA 4PRHD 5KSAB 5L0QB 5JLZA 5HXMA 1OB1B 3VXPA 1RZKL 2D2OA 5GZOC 1Q0YL 1KELL 2CLVA 1SYVA 1KB9K 5J12C 3IXAA 1RURL 4E0RB 3OKKB 5I1LB 5IMKA 3TO2B 4F7TB 3MA7B 2G60H 1C8PA 1MCEA 1JGLL 3WIFB 4HKJB 4X4MA 4GAYA 3O6KH 1HYSD 3DVFA 4OGYH 1MCPH 2APWA 4OTXL 4Z7VF 1VFBB 5EOQL 2P44B 2W0PA 4WFFD 1VHPA 2ZUQB 1KT2A 1WZ1L 4S10A 5F7LB 1HYSC 3CVIH 3DYOA 1OM3L 4CU7A 2QQKL 5DJ6B 1XR9B 1J1PL 1NUGA 1KJMB 2XWTA 1MCBA 2D0GA 3F12A 3O2DH 4G6FD 4K2UL 1L7IH 5KSBE 3J7HA 1HQ4A 1V3JA 3IJHA 3VXPB 1V3MA 1CVSC 3U7WH 2ZCLH 2CLVB 1SYVB 2AXHA 2I27N 3HAEA 4LIQE 3S88L 1YMMA 2DDQH 3IXAB 4D9RE 3TP4A 5IMKB 3FQXA 3F6IA 3SPVA 1Q8MA 4HW6A 4PJIF 4TRPH 3FO0H 1F4YH 4HPYL 5GS0H 4M7ZB 3BD5A 4TNWK 4BZ1H 4XPBH 5BQ7B 5BJTA 1IT9L 1KT2B 3SE9L 4Z0BH 4FMKA 2IPUK 3JWOL 3S96A 2QKIB 4W70A 4APQA 4OF5A 3B9AA 3KJ6L 3DNKA 1IQWH 1RZIA 2BDNL 5BO1L 2F8VA 1GGTA 6FABL 4FQLL 2XWTB 4L8SA 4PJ8A 3P3YA 1F58H 5ACLA 1CWVA 3F12B 4ERSL 1A0QH 5E0QA 3Q5TA 2KPNA 3IAQA 3IJHB 4KROD 4P9HH 1LEIA 1FGNH 5J3HD 4KXZI 3B8YA 3HAEB 5I76A 4YC2C 1ZLVH 5D1ZA 1QSEE 1YMMB 4BZ2L 4PGEA 4N1CA 4LBEA 5CIPH 1RSFA 2ORBL 2R0KH 3T2OA 5J3HC 3SPVB 5I18L 4MA8L 2DQGL 1XGTA 1PG7W 1UXWA 3JWDL 3FT2A 2WZPD 4JE4B 1QBLL 5MI0B 1B4JH 5BJTB 1JMZA 3WNKA 3QUYA 4DUWA 5KVFH 2JB6A 3S96B 5HDBF 2NMSA 3U9PH 4APQB 2HRPH 4Z7WE 4YX2L 3Q5YA 1RZIB 3ZDXE 3L95A 2L7UA 3GJFH 4YHZL 1LO2L 2VDOH 4KJPD 4L8SB 3DMMB 3EO1A 1HYRC 2LVEA 2XN9D 3MGOA 4PJ8B 3T3PF 3TH3T 3V6OC 3IS0X 2YS4A 1GOGA 4B50A 2R29L 2MFNA 3UYOD 5DRZA 3QCVL 1FRGL 1LEIB 3QFJD 4KJPC 3BP7A 5C7XL 4WUKH 1G9EA 3WHE1 4RZCA 3CVHH 5I76B 3RHWK 5D1ZB 3QFDA 4B7LA 2R9HD 4U1HA 1G7IA 1V05A 4LBEB 4AY0A 4M7LT 4DGVH 2WUBL 4M1DH 5C0ND 5GGVY 3RY4A 5DUBA 3CLEH 1XGTB 2R9HC 1HDMB 3FT2B 4JG0H 3W81A 4NYLA 4R97B 2VMFA 2YA1A 4TTDD 2EC9U 5E5UB 4OQTA 1UKSA 3QUYB 5DJCA 5FYJH 4UTBL 2XI9A 2JB6B 1V7ML 3VXSA 5EC2A 4GG6E 3BRGC 3FMGL 4X7TA 5JDJA 3FAWA 1QHPA 2DLHA 3KAAA 3CX2A 2YPLD 2WP3O 3BESR 4TTDC 3L95B 2BY1A 4OD1L 4HK3J 3PDGA 2ADJA 2C9AA 3PJSB 3EFFA 1DEEA 1UCBH 1NGPL 1ZWIA 4JPWL 3QISA 2APFA 3MGOB 4YHKH 4WW2C 1G1CA 1YPZE 5C07D 3IF1A 1GHFL 4PJFE 5DRZB 4L9LA 1Y6NR 1SEBA 3MJ9H 1G6RL 4GLRH 2LVCA 5DEZA 2O5YL 5D6DA 1OTUD 3C5JA 4RZCB 1A7BA 3JVGA 4Z9KB 1AC6A 1HOCA 1J8HA 2DQIH 4LSSH 3W0WB 3QFDB 5FOJA 3WLBA 1FL6A 4U1HB 1G7IB 1GZQA 3JV5A 5F9AC 3I6KB 1Q0XL 3NTCH 3TIDB 4UIMA 1OTUC 3K7UA 2F15A 2P8PA 3MPCA 5E8NA 5DUBB 5KTEL 1A7PL 5ALBH 5FA3A 1HCVA 4HMDA 4NYLB 4FRWA 1OGTA 5FM4A 3ZHKA 5I0DA 1LO3L 4N90E 3TFKD 5DJCB 5HHXL 3EUUA 3UTSE 3VXSB 3NCBB 5EC2B 4HUVA 4I0KA 4X7TB 5LGHH 1UH2A 1CN4A 1S7SA 3LOWA 4I18C 4V2BA 1JK8A 1K4CA 3QXTA 1AKJD 3TFKC 3EJZD 3NFSH 4JGUA 3H9SD 3EFFB 1JBJA 1ZWIB 4AJ0A 5FYKE 4XNYL 5SWSE 5CGMA 3IF1B 4ETQA 3EJZC 4L9LB 1SEBB 2HAZA 2DQUH 1ADQH 5EU6A 3K2UH 4NQUA 4Z76B 1HOCB 1J8HB 3WLBB 4M7LH 1FL6B 4XCNA 5F1SA 1GZQB 4QXUH 5K59F 3BXNA 1S7VA 4ZO6A 5T3XD 3NCYS 4J3WA 3OAZH 2P8PB 3PP3K 4L9DA 5E8NB 4WI7A 4X9BA 5FA3B 1P7HL 1C1EH 4Q58C 4JB9L 2BSTA 1YNKL 5EWIL 4HUUA 3EO9H 4Z0XA 3MLZH 4J6RH 3DGGB 2Q86A 1ZANL 2J6EH 1S7SB 1D5IL 1JK8B 1K4CB 1IKNA 4Z8FL 4NNPL 3THML 1KNOA 1AQKL 1IGCH 2MQ3A 4N1HB 1PQZB 4ETQB 1YA5A 3V7MA 2P5WD 4PV9A 5FM8A 1C16A 4QRPE 1RK0A 3KPRD 2DAVA 1CGTA 4A6YA 5EU6B 4XHJD 3MNVA 3DX8A 4BFEA 3BZ4A 3LMJH 3L3DA 4PRHA 3BXNB 2XICA 1S7VB 4LCIH 2DIAA 2IF7A 1EIBA 4DKAA 4XHJC 2E7MA 1EAPA 2ADGA 5EO9A 5T1MA 3MODL 2ZG1A 3IDMA 2BSTB 2CQVA 1F97A 3IDXL 5C0IA 1RMFH 4MQTB 4Z0XB 2FB4H 4GAGH 4XNXH 3GK8L 4XH2A 2X1PA 2Q86B 2DM2A 2P5EE 4M5YH 3MLPA 1KNOB 1JNLL 3ZE2E 3DETD 3V52L 3W5NA 3MOBL 3UZQA 3ULUH 2YUWA 2BSED 3CXHK 2VR9A 5HGDA 2E8YA 4PV9B 1RZGA 1RK0B 4FZ8H 4A6YB 3DETC 2AJVL 3QCTL 3MNVB 1REIA 3DX8B 2QQNH 5J12B 3BZ4B 4Q0XL 5KG9A 4UV4L 3L3DB 3V4PH 4PRHB 4JZNA 2YWYA 2Z9TA 3D48R 1EAPB 2AEPH 1IJ9A 4GQ9L 2ADGB 5EO9B 3ISWA 5T1MB 3WFBH 3U83A 2GI7A 1DBKL 4KQ3L 4FFYL 3ECBA 1VB9A 3IDMB 3BP6A 5ADPH 4JDTH 1YEKL 4Z7NE 2O5XH 3MV11 1UA6H 3EZ8A 4U1KA 4XH2B 2DD8H 3CLFH 1GGUA 2XZZA 4LSRH 3MACL 4P3WA 4F57L 1YEIH 2VDPL 2W9EH 1QFWL 2XXMB 2CUMA 3OKLB 4XWGL 5HGDB 1JIBA 1RZGB 4G6KL 4PLKD 1IM9D 1PBYA 4XP6L 1NUFA 5B8CA 4KI5D 1DUZA 3RIAK 3QA3A 4G6FB 4JFYA 4JZNB 2D9QB 4PLKC 1NMAL 5DD1L 4JFEA 1DQDH 4KI5C 3MV8E 2VSCA 3EYQD 3FO1A 4GQPH 4F7PA 5ALCH 2J12B 4WV1C 3ECBB 4MJID 3NFPA 4PJCE 3RGVD 1AGCA 3SJVE 3L5HA 3MA9H 3BP6B 4TYUA 1FBIL 1C5BH 1QVOA 3B9KD 3EYQC 1QNZH 4U1KB 1A8JH 2AS5M 3RGVC 1H3PL 3L5JA 1J7VR 2D7MA 2MHAB 1TZGH 3K3QA 4AL8L 3B9KC 2GUOA 5CGYD 2B1AL 2NW2A 4F58H 4I77H 2AEWA 1YY9D 5E9DD 2BNRE 3KYNB 3V6OA 3LN9A 2YUZA 2EH7H 5CGYC 1FAKT 2IGFL 4KRMB 2AI0L 3HB3D 1YY9C 1E4XH 3RUGA 5JW3H 4MZ3A 4XP9L 3TT3H 4PLJD 2XN9A 4XNUH 1HINH 3B9EA 3QA3B 5BVJA 4YC2B 4JFYB 4LDLB 4ODHH 2XKSA 4JFEB 3HB3C 3A6BH 4PB9H 1T2QH 3QFJA 3ALXA 4X5XA 3FO1B 5D1XD 4ZS6C 4IRZL 4ODUA 3NFPB 1AGCB 2AV7A 3WE6A 1QVOB 5D1XC 4ZDHA 2CDGA 2UUDH 2ICWB 4XPTL 4PR5A 1YQVH 1JZ2A 3AC0A 2GUOB 5GS1C 2NW2B 1DLHA 1MFAH 1P6FA 5DT1L 1JNNL 5HHOE 1S9WA 2DJUA 1QBBA 3H3BC 5CZXD 2EKJA 4WW2A 2YPLA 4N0FB 4HGWA 5BRZD 3GHEH 4Y8AA 2X1QA 2WIIA 2YXMA 3RUGB 3P73B 1B0RA 1ZEAH 2XN9B 1A7OL 2RFXA 5CZXC 5BVJB 2OJEA 5C07A 4NP4H 2HT2D 4LVOC 2G5RA 1MI5D 1RVFH 3QFJB 3HMWH 3V5KA 1FYHB 4X5XB 3ZT5A 2OK0L 4NKIL 4K23H 4ODUB 3QH3A 3AM8C 1XCQA 2BRRH 5EUKA 4NM4L 2AV7B 3WE6B 3INUH 3H7LA 4G9FD 4ZDHB 1UWEL 2CDGB 1IZJA 3CFEB 2JE8A 4S11A 4PR5B 4ODTH 2CD0A 3KPLA 2X09A 4I18A 2VQ1A 4OF0A 4HLJA 3AXLA 5F1OB 1DLHB 3L6FA 2MJWA 2LAAA 4YXLH 4TUOA 1FPTH 1S9WB 3LQZA 4OT1L 4P2RE 1CLCA 4WW2B 2Y23A 2YPLB 1QLRA 3CSBA 1AKJA 2WIIB 1ZVYA 3H9SA 1B0RB 3CDGA 2OS7A 5EU3B 2RFXB 5HDOA 5C07B 3H3PH 4GRWF 2ZZUT 2FECL 2YD8A 2CIKA 1GVIA 3STLA 4P5MA 3KXFD 1GC1H 2DMBA 3QH3B 1CL7I 4UT7L 3Q2CA 3MLUH 4M1GH 5EUKB 1X7QA 4QHNA 2WUCL 3MRQA 3DBXB 3EJYD 3ZE0F 1WEJH 1EGJA 1G9NH 4RX4D 3UX9B 1PLGL 3KPLB 1RULL 5DVMA 4I18B 2VQ1B 1YEJH 1BD2A 1JHLH 3EJYC 3AXLB 4URTB 4NM8H 5AZ2L 1ACYH 3TZVD 2R2EA 3RFZC 3L6FB 3MCKB 5DFVD 4Z95H 1KJ2L 4R7DA 4TUOB 2GK2A 3LQZB 4ENED 1OGAE 3SGDI 1QLRB 2FATL 1BREA 1AKJB 1E4WH 3TZVC 4OFDA 1BQLL 5DFVC 2XQYK 1YEFL 3H9SB 1OAYH 3CDGB 4OB5L 4ENEC 4X83A 2A9ML 7FABH 3ZDZF 4QLRA 1RD6A 3ZSTA 2P5WA 4Y7MA 3QNXA 2YPKA 3KPRA 1FIGL 4BSWB 1RIVL 2CIKB 4JFXA 1KPVA 3STLB 4P5MB 3NH7H 2F54E 2J8UF 3NIGE 1EEYB 1NAMH 3Q6GL 2GEEA 1X7QB 3DARA 4GMTH 5EZLA 1RK1A 4HJJL 4ZNCD 3R4DA 1RUMH 3HI5L 4J8RA 3VXME 4LSVL 2ED8A 3G9AB 3C2AL 2D7TH 1BD2B 2R2EB 3ZZ1A 5BMFH 5JUEH 1DBML 2R0ZL 1JGDA 2DMCA 5D7IE 2DBLH 3TH4T 5IMLB 2F19L 5GZND 3WKML 1FE8H 3P0YL 3RZCB 4Y4KD 2JCCA 2E6QA 3BGMA 2P5WB 1O7SA 3QNXB 5GZNC 2YPKB 3KPRB 4D0BA 1JHTA 4O9HH 4JFXB 1MH5A 4U1MB 1KPVB 5EBMA 4Y4KC 1LE5A 4UAOB 5FO7A 5SWQA 3T3MF 2DQCL 5EUOA 2ZOKA 3I50H 2JJTC 1EDQA 3HUJE 2DQTL 2WP3T 4K7PL 3O6LL 5EZLB 4FQJH 1RK1B 4JFOA 4LVHC 4HFWA 1SJVA 4J8RB 4H1LH 1BZ7A 4JVWA 1MLBB 1A4JA 3BZDA 1L4IA 5IK3A 4XPHH 4F37F 4Y1AD 5E7BA 1PYWA 2DF3A 2QJDA 4TSBL 3VMNA 4JKPL 5HHVL 4AG4H 2RCSH 2G5BA 3NIFF 1JGDB 3BEWA 1JHKH 1T7VA 2E5EA 3A67L 1LO4H 1JGEA 5LGJA 3VFGH 3S9DB 5LGKA 2JCCB 2MWCA 1KCVL 1IC5H 3RWGB 4D0BB 3VXOA 1JHTB 1IM9A 1MH5B 2XTJD 3EW3B 4MA3A 1LE5B 2EYTA 4IM8A 5FO7B 5SWQB 1SHMA 3D1MC 5EUOB 2ZOKB 1D3CA 4FTVD 3QEQD 4OF8A 2A9NL 4CNIA 1V5JA 1INEL 4PJGE 1LP9F 4WV1A 1LMKA 1U42A 3VGAC 1FCCA 2XTJC 4JFOB 2R1XA 3U0PA 3S36L 4HFWB 5F7UA 3HCVA 5HGBB 3CFDA 5FCSH 3V0WL 4OFKA 1BZ7B 4XMLH 5I15L 1BOYA 1A4JB 1BJ1J 4KDWA 4MJIA 4PJ7F 4LDEB 3RGVA 3T09A 4M62L 5IK3B 1JE6A 3TLRA 4P23D 3B9KA 5GISH 1NCCL 1LEGA 3S37L 2EEDA 2G5BB 1P4LA 3L3IA 1FORH 4PJ5E 4P23C 2YD6A 2IH1A 1CLZH 1JGEB 4HIIA 3U1SL 5C6TL 2AJ3A 3KWWA 4HC1L 3EFDL 5D2LB 2A83B 3IFNH 4AT6A 1ZHLB 5E9DA 1MREH 1JTTA 4R4FH 4JVUA 4O58H 3VXOB 4LSSL 1IM9B 1EVUA 1MRDH 2IAMC 4QOKE 1J12A 5E03A 4FXGA 1L0QA 4MA3B 2EYTB 2NY5C 5DZOA 5EORH 2HKHL 4CNIB 5DD3H 1RHHA 2EEBA 2YD7A 4WV1B 1R0AH 4L4TE 1RFDL 2R1XB 3U0PB 2V6HA 3N1MC 1EJOH 3VFSA 3HCVB 2W0KA 4D9LL 5D1XA 5D7LE 4PRAA 3CK0L 4FQ2H 3VI3E 4MJIB 3CAFA 3RGVB 3ETBF 2EDBA 1A7QL 2DM4A 2QHLA 5D70H 3B9KB 5GS1A 3NA9L 3QUKA 3IS1X 4O5LL 4M3KB 1P4LB 3L3IB 4Y5XC 3EYSH 4M48L 2IH1B 4HIIB 4KQ4L 1KIQA 2AJ3B 1XH3A 3KWWB 1VFUA 1MWAL 1OT2A 4NC1C 1QLEL 1QR4A 3FOLB 4AT6B 4P49A 5E9DB 5D5MF 2DQUL 3PGCA 5BRZA 4P3DA 4LGSB 2R4SL 4HG4J 4FXGB 5K9JH 2BVPA 4OLVL 2DKUA 4K3EH 1VPOH 3QDGE 4ZTPH 1T7YA 5ITFA 2X7LA 1RHHB 4ACPA 3AM8A 2P46B 1WVZA 1JUFA 1MI5A 3VFSB 4PRAB 2A1WL 4X6CA 4JR9H 2AEQL 2ITCB 1WQVT 5AZEH 2DKMA 1BBDH 5BV7C 3M8OH 1K3IA 4K8RH 1UQSA 4UILL 4G9FA 5GS1B 1TITA 2R23A 1RZJC 2JJSC 3QUKB 2Z8WC 4DVBA 1KIQB 1XH3B 3FT4A 1MF2H 4NQDD 2VXUL 4MGXA 5D8JH 5A43C 4EIGB 3Q5OA 4NQVA 1UZ6F 4MNGE 3PGCB 1NANI 5BRZB 2VO5A 4P3DB 4UZGA 4Y19D 2ICEA 2BVPB 4P3CH 4PJEF 5FKPA 3WHE0 5ITFB 1BEYH 1CBVL 3P0VH 4FNLL 1JUFB 4DGYH 2YA2A 1MI5B 3AU1A 4P9MH 2DOCA 3KXFA 4KPHL 3MRNA 4X6CB 1EV2E 1T5XA 2ZPKL 3RVWD 3DO7A 1NC4D 2CK0H 3IT8D 4LLQA 1FFPA 4X6EA 4TSAH 5I1KH 2EDTA 1UQSB 4AMKL 4G9FB 4ZO7A 5IQ7L 2R23B 4GXUN 3RVWC 4AQ1B 5DVLA 1R3LA 4RX4A 5TE6H 4OZFA 3D9AL 2HFFA 4R7NA 4I3SL 4DVBB 1FZKB 3FT4B 3TZVA 1FGVL 1OAQH 2ZWLT 1L7TH 1WBYA 43C9A 4NQVB 1NPUA 2DQJL 1CLOL 1YC8A 2V2XA 4IOSD 2CKBH 4JPVL 4ZNEE 3PHOA 3MRGA 3EKCA 1KN4L 2ICEB 2P43B 1QHOA 4U1LA 5FKPB 4QHLA 4LSTL 3ZO0A 3VWKB 1T4KB 4CRPA 5ID0B 5FUCC 4YXHL 3AU1B 2OXHA 3FO9A 1CDIA 1CK0H 4KUCD 1A7NH 4NJAH 3OGCA 3KXFB 3O4LE 1P1ZA 3MRNB 3U82B 1CDHA 1T5XB 3DO7B 4MJ2A 4LLQB 4X6EB 4WEBL 1FFPB 2L7JA 2YUVA 1IVLA 3RVTD 2IALB 5FYJU 1SJEB 2MMXA 1T0PB 5GRUL 4NZUH 3BAEH 3WHXA 2XWBA 3GO1L 4X99A 4HHAA 4K3GA 3RVTC 1FJ1A 1R3LB 1F3JA 3DUHA 4OZFB 4XVTL 2HFFB 2V5MA 2X9XA 2R2CA 4R7NB 4L8CA 5SWZE 3TZVB 5C9JA 1NL0H 3WBDA 4PG9A 4YDLB 4MCYA 1WBYB 43C9B 3EOYG 2DQHL 4P2QE 4PJ7A 5DMIH 1IAIH 3NCJH 1ETZA 2V2XB 2ARJQ 3PHOB 3MO1A 3MRGB 5DGRA 2CJUH 5DTFA 2DQEH 2I26N 4GKNA 3ALWA 4U1LB 4D9RD 2CKNA 2ZUYA 4QHLB 4Y4KA 4YJZL 1NFKA 2ZUTA 3WIHA 2V5YA 5TDOA 2JJTA 3VG9C 1SVZA 2GKIA 2RBLA 3FO9B 1CGXA 5JW4M 3OGCB 3U9UA 2EECA 1P1ZB 4TVPD 4OZIF 3DYMA 1A5FL 4DOHB 5JPMB 1SBSL 4MX7A 3WHXB 2XWBB 1YECH 3MROA 4X99B 4JG1L 4HHAB 2PYEB 1X5HA 4OJFH 1FJ1B 5F8QC 1F3JB 4JO2H 3OF6D 4X9HA 2M1KA 3MRDA 4L8CB 4ELKA 1XGUA 3P4LA 4IMKC 5C9JB 2A6JA 4PG9B 5JA8B 4MCYB 4XCCL 1T03L 1ETZB 3PP4H 5AG9A 5JIIA 3MO1B 4HFUL 3TT3L 1JYWA 4Y2DD 1AJ7H 5DTFB 5TFSL 5BW7C 2QV2A 5F7MC 3WL9A 4GKNB 1QSED 2NY7L 4Y4KB 2VDLH 3DSFL 3A6BL 1HILA 2JTDA 4Q9RH 3P2TA 4Y2DC 5TDOB 1TJHL 5CZVH 5IW1A 4CVUA 1DANT 3ARDD 1E6OL 3U9UB 4LVHB 1XAUA 1IC1A 3C08H 1IGFH 4FTVA 3OWEA 3QEQA 5GSRB 4EDWL 1WTGT 1G7JB 3C87A 1GIGH 3ARDC 3FO2A 4QTIH 4XP5L 2X89D 1ZHBA 4JHAH 4ODVH 4MX7B 4B5EA 4F9LC 4CW1A 3MROB 4UU9A 5ICYA 4U2YA 1IGIH 1ED3B 5KSBF 1EBAA 3MRDB 4FZEL 1ZOXA 2DLGA 4ORGA 1DBBH 3QQ3B 5D72H 1XGUB 4ELKB 3MUHL 1TJIL 3D3VE 3HR5A 3U7YH 4P23A 4YUEL 1DJSA 2A6JB 1EMTL 2XPGA 3BPOC 3RI5F 1G0XA 4MZ2A 4EZMA 1IAMA 1CICD 1IZKA 3KDMA 4Z5RA 5J06A 3QEGH 3V4UL 2E6JA 3LQAH 1TVBA 4MMXC 1W8NA 3WL9B 3IVKA 2IAMA 4W68A 2BHYA 1CICC 5FGRA 4EIZC 1F6AA 2C7UA 3BKCL 2XA8H 1HILB 4M03A 2OMBA 4LK4A 3V4VL 5IW1B 4NWTH 5EZIL 2EE6A 1QFOA 3LQMA 3VGAB 2FBJH 3QG7L 3IKCA 2XTJB 3QI9D 2XIDA 1S7TA 5FCUH 4FTVB 3QEQB 3MLYL 2FGWH 5FUZL 2BNQE 3EYUH 4YHPA 2IADA 1ZHBB 3QI9C 1M7IA 1DLFH 3GBML 4MB3A 1TTUA 4CW1B 4UU9B 5ICYB 2R56H 3M07A 4ORGB 5A3ID 4G6ML 2JLLA 1P4BL 4GO6B 4Y5XA 3BT2L 1R3IL 5TQ2H 2XPGB 4XP1H 5ACZA 2ED9A 4KVNH 2FSEB 5A3IC 3DGCR 3MR9A 4KTEH 3HI6L 3KDMB 4ONFL 4Z5RB 4YFLF 3G04A 1UM5L 1CGYA 1TVBB 1ZT4A 3IVKB 5HI3D 2IAMB 4XCFH 1EVTC 5F3HA 3HPJA 1F6AB 2C7UB 4K94H 3VXUE 1G9ML 5I1GH 4CAGA 1UYWL 5HI3C 5T1KD 4YBHA 3IKCB 3RP1A 4DUXA 3WFDL 1S7TB 2XNAA 3STZA 3SOBH 5IVOA 3GSNA 3CFIC 4N90D 4YHPB 5IGXH 3FN0H 5J8OA 2IADB 3UTSD 1MCJA 1M7IB 4KK6D 4X6BA 5ENWA 3QHTC 1JGVL 2GK0A 3QHFL 4OGXL 5GRYA 2JJSA 2NPLX 3GGWA 2AXGA 3LB6D 4RMQA 1F3RB 4KK6C 4Y5XB 2RAMA 3ET9F 5JIKA 1RUPL 3BIBX 2J88L 2V17L 1SEQL 3WFEH 5I16A 5ACZB 3QDME 4X7SL 3LB6C 3OAUH 3MR9B 2PW2A 1FVDA 4DN4L 4JZOA 2FRGP 5FYLH 1V8HA 3G04B 4YE4H 5E8OA 1KB5H 1ZT4B 2OZ4A 4NQDA 2R0WL 2HP4A 5F3HB 3HPJB 3BKYH 4LLDA 1IFHL 1OTTD 2VZ3A 5KJRH 4Y4HD 2VWEC 4W6WB 4Y19A 1KB9J 4GG6F 1SM3L 4NUJA 5DZLA 2XNAB 3SQOL 3STZB 1OTTC 5EZOL 4XC1H 4Y4HC 3KPSE 3V5DA 5E99L 4FFWC 2UY7A 4EI5C 3GSOA 4X6BB 1MJ8L 5ENWB 2V7HA 3CH1A 2GK0B 1NC4A 3GGWB 4JDVA 4KXZH 5INDA 1NCWH 2AXGB 2OL3L 5FK9A 3GI9H 3GM8A 1OSZA 1Z3GH 1N8ZA 1N6VA 3PL6D 5I16B 1C7SA 3HMXA 2PW2B 4TPRL 4JZOB 1SQ2N 3BYTA 4QRPD 4Y88A 4BK5A 2PN5A 3KLAB 4EBQL 5H94A 3ULVL 5E8OB 3U36A 2LFGA 4TULH 4XX1E 1SY6L 3PL6C 2D3VA 4NQDB 5H37G 5LBSH 5HHPA 1FNSL 2QHRH 3RWIA 1HNGA 4LLDB 1T66C 5HYQA 2ITDA 5DQ9A 1CDCA 1OCWH 1BQHG 4P46D 4Y19B 4IBLT 3IDIA 1MHEA 2C3GA 3PE9A 4P46C 2GITA 3V5DB 5HDLA 4XMPL 1FVCA 3GSOB 3N1PC 3D39B 2EO1A 2V7HB 2K9UA 4OLXL 5IFJA 1NC4B 5INDB 4JDVB 3MLRH 2P45B 5FXCH 4LOUD 1A9EA 1NH6A 1HH9A 5FK9B 3DX9A 3OR6A 3HZVA 4WO4D 5H8DA 1WLHA 1OSZB 5GS0D 4L4JA 1YEEH 1N8ZB 3FT3A 4Q2ZA 5HJ3A 1I7UA 2BRQA 5D71H 4WO4C 2H1PH 3T2PA 4GSDL 4RA3A 3DJ9A 3U36B 5GS0C 1D9KD 5F96L 2HYMA 4NRXA 1MCRA 5L7XH 5HHPB 1BP3B 3RWIB 3LSOA 1PX3A 3UTTE 4RMWA 5HYQB 4ZXBD 2ITDB 4XBPA 3BD4A 5CLTA 4AEHH 1D9KC 4KUZL 3UJJL 3RWHA 2AJSH 2AJUL 2WQRA 1AH1A 2X05A 2OMNA 5DF0A 3LHPL 3U46A 5CBEA 3GNMH 4R8WL 4ZXBC 3HC3H 3IDIB 1F42A 4MD0B 5J9PB 4C59B 1CFTB 1MHEB 5KVEH 2GITB 4RISH 1P6AB 3TEUA 1WK0A 3K4AA 3ULSA 1FVCB 4XI5D 5E95B 2DKSA 4YGVA 4BFIA 1CS6A 3QXVA 4J3VA 1X6LA 4NDMA 5B3JE 3GMOA 5IFJB 3ARTA 2EDQA 1N3NA 3HG1D 5I1IL 3K8MA 1A9EB 3CU7A 1HH9B 3DX9B 3O8XD 4XI5C 3OR6B 3HZVB 1JF6A 2AEIT 1WISA 1QSZA 1CIDA 3MXVL 3FT3B 1JP5A 4IMKA 4DQOL 5IBTH 1BFOB 1CGWA 4Q2ZB 3S6CA 4KHXL 1A14L 5HJ3B 4E41E 4LNRA 3O8XC 3OF6A 2I5YL 3WFHA 1DVFD 3R8QA 5DK2A 5FM5M 2Z93A 1QSVA 2JB5L 1P7QD 3G5XA 4IHOA 4NRXB 5BW7A 4KTYA 4J12A 1X5JA 3LSOB 5T3ZL 2IBGA 4XBPB 1DVFC 1VGEL 1Z0NA 3EOTL 5EO1A 3RWDA 3RWHB 4LGRB 2GSGA 4DW2H 4Y2DA 1S7RB 3VG9B 4L5FH 3ZKND 4PJHE 2YMXL 3HNTL 4OKDA 4J3TA 3U46B 4BUHA 5CBEB 2QBWA 2V9RA 4MXWL 5CUSL 1RZFH 4NT6B 2ADFL 2J8HA 3ZKNC 1YEGL 3ARDA 3ULSB 3MCLH 4X6DF 5KS9E 2CO6B 4YGVB 3ZE2F 4BFIB 3ROOA 4G9DA 5ILTL 1N4XL 4NDMB 4F9LA 3GMOB 3RGHA 4OCRL 4U1JA 1N3NB 5EULV 1Y0LA 4LFHD 4ESKA 3F5WB 3MRMA 1R6VA 2X89A 1BQHA 2C1OA 3NPSC 4XBEH 2RHEA 2VZVA 4Z7WA 4OF7A 4K07A 2BNRD 3KHOA 4YH6A 4LSQH 4LNRB 3ARUA 5DLML 3S34H 1QRNE 3UP1A 2VDQL 4JKMA 5FYJD 3WFHB 4K55A 5DK2B 1YY8A 5DR5L 2Z93B 3G5XB 4IHOB 1QACA 1LNUA 3SQBA 3ARGD 4EUPA 5DD6A 3BX7C 3L3GA 2DTMH 2Q8BL 1MQKH 1CICA 5EO1B 1E6JH 4O4YH 5CP7A 3RWDB 4Y2DB 3VXRD 4E5XA 3FTGA 3QB7C 4KJYA 3ARGC 4Z7NF 5F1KC 2HT4D 4YZFE 5E2TH 4DGIH 3O2VL 1GGCH 4LLWA 1T5WA 3TV3L 4FA8A 3VDAA 1JTPA 1HH6A 3NFNA 1RAMA 2HT4C 3ARDB 3QI9A 3SE8H 3D18B 2FNBA 2YHGA 4ZO9A 5E8EA 2O61A 3ARVA 4NO3A 1VEOA 1BAFH 1FCGA 1Y0LB 4UOW1 1FAIH 3MRMB 2GIYA 1BQHB 4HCRL 1JF5A 4KHTH 3OAYH 1CR9L 4TUKH 2R1YB 3D87B 3EYOA 4Z7WB 5DD5H 2ESVE 2ZKHL 1RZ8A 3BPOB 4HQQL 4RMUA 1GSMA 4XPFL 3K0WA 4G3YL 1Q9WA 1MIML 1YY8B 1LNUB 1Y18B 4EUPB 8FABA 1YPZA 5DD6B 3L3GB 4PJFA 4MA1B 1CICB 1P69B 4H0GA 4PJCF 3TYFA 4QO1A 4Z7VE 4E5XB 4GMSL 3FTGB 4KJYB 3QJHA 2OTPA 4RGMC 1X5ZA 4JQVC 4LLWB 4OCWL 3QSKB 5DVKA 1HZHH 3DI2B 1HH6B 5GGUA 3NFNB 1QOKA 4MMZC 5BZWA 5T1KA 4BQ9A 4DN3L 4W81A 3QI9B 1OWWA 4WTXA 5E8EB 2O61B 1VFMA 1U3JA 4NO3B 5CD5D 1BFVH 2E27L 4X8XA 4MXVE 4KK5D 4OD3H 1T1XA 3UTSA 2OQJA 3MJGX 2X41A 2FJFA 3EYOB 3DROA 4P2RD 5DK0A 4DUVA 5CD5C 5I1EL 1RZ8B 4KK5C 1EAJA 5F7EH 3M17A 4QKXB 2MNUA 1PSKL 1Q9WB 1JNHA 3TESA 5FEBA 2JELL 4U6VH 2PYFA 1UACH 3T4AA 3CX5K 2V5SA 8FABB 4PJIE 1YPZB 4HIJA 4PJFB 4K3DH 5IFHH 4X98A 3LH2L 1F8TL 2IWGA 1HIMH 2XWJA 2JKXA 5IVXA 1NEZG 4YIQA 5CSZA 1JFQL 3QJHB 1FDLH 5F7WC 1JF1A 5C0AB 1N6QL 5BXFA 5GGUB 1T2JA 3F7PC 4UTAL 3JTTB 4Y4HA 4LQ1A 5BZWB 5T1KB 1BOGB 3I3BA 4LARH 4EI5A 3P9LA 4JY6A 1KEGH 2Q7YB 2B4CC 5CSGA 2E9IA 1T1XB 1II4E 2VH5H 3UTSB 2UZIL 4QXGL 2WK2A 1S9XA 1A6WH 1KN2H 2FJFB 3DROB 4XB7A 5DK0B 1NFDE 1M7DA 4HF5H 3DVGA 3M17B 5DK3A 3V5HA 1T04A 3DYPA 4PBXA 2VXTL 3LS4H 2YRLA 2PYFB 5DWUH 1OAZL 3PL6A 3GMNA 4HIJB 3OKYA 4GRMA 3CXHJ 3Q0HA 4X98B 2N1KA 5IJKC 4QRPA 3HNVH 3MRRA 5MERA 2XWJB 4OCYL 25C8L 3F65A 5AWNL 4AQOA 5IVXB 2D03L 4YIQB 5CSZB 4DKEH 1U3HD 2F54D 4ZUSA 4I0CC 3ULUD 2IBZX 4N0RA 1F4XL 4HIHA 5HDBE 3ZKMD 1JF1B 4HWBH 4LFHG 4G8EA 4CVXA 1TPXB 5BXFB 1NC2B 4PFEA 1U3HC 4P46A 1JYNA 3ULUC 1OSPL 5KAQF 3VXMD 1M4KA 3ZKMC 3O2DA 4KZEH 4EI5B 5I2IA 3P9LB 4JY6B 4F37K 2X4TB 3PIQA 1YJDC 3RVUD 3GSWA 2PTUA 1S9XB 4PBWD 2HMID 3AUVA 1M7DB 1UT9A 3DVGB 4UNVA 5I1CL 4KMTH 4WO4A 3WO3B 1I9JH 5E2VL 2HMIC 5EU7E 5IHZA 1MCOL 3WUZA 3IXTA 3PL6B 4HZLA 3GMNB 4MVBD 5L9DL 4LQFH 4GRMB 3GRWA 1WIOA 4QRPB 3MRRB 5MERB 3RY6C 2WWKT 4WCYL 1Q72H 1Z5LA 2E7HA 1D9KA 4ZUSB 4MVBC 4PJBE 4HIHB 1XIWD 1FSKC 4OCSH 4Q9QH 2BNUB 5C71A 1WSST 5FA4A 4ZXBA 1UWGL 2H6PA 4G8EB 4CVXB 3RNQA 5CEZH 2QR0A 1IEAB 1C12A 4P46B 3RPKA 4YDKH 2EC8A 3EYVA 1XIWC 32C2A 3DURA 3QXWA 5I2IB 3O11A 5IM7B 2AJXL 4G6AD 3S36X 5EIQA 3N9GH 1JI2A 3PIQB 5CD3A 1YEHH 2VLRE 4NQCE 3GSWB 1MCIA 4MSWA 1DN0A 1OAXH 3PUCA 1IKFL 3HG1A 3VFRA 1N64H 4P5KB 3O8XA 2DMKA 5SX5H 1CG9A 4WO4B 3T0XA 2DN7A 1ORSA 2DYPB 3BVNA 5IHZB 3IXTB 4HZLB 4MJ6B 2OX5A 2ZJSH 1JCKA 3LQAL 3O0RH 4JFFE 1P84K 1DVFA 3ARQA 1Z5LB 1D9KB 1P7QA 4K9EH 1J0KA 3ORJA 3MTRA 4GKOA 5FA4B 4ZXBB 1JPTH 4S1QH 2Q87A 3KLSA 2QR0B 3RTQD 1JPSH 4OQTL 2K7QA 3EYVB 1A3LH 3DURB 32C2B 4OZHA 4TNVF 3QYCA 3O11B 1H5BC 3PDDA 3RTQC 5D7IF 1KCRL 5DEGA 4OLWL 3TBWB 3K46A 1K6QL 3PGFL 4LPYA 3QDHA 3IRPX 4MSWB 4YNYA 1DN0B 5CIPB 1F4WH 4ZUUA 1YC7A 5D2NE 3FZUD 3HG1B 3JWOC 1AHWC 5MP6H 2OJZH 3O8XB 1CL7H 1CG9B 3TWCH 1ORSB 1IGTA 3BVNB 3OKMB 3FZUC 2HWZH 5A2JH 1UFUA 1VFOA 3HUJF 4JFDE 3H2WA 1NLDL 4QOKD 1DVFB 4WI6A 5CILL 1P7QB 3ARGA 5D7KD 1CGSH 2B0SH 5TE7H 1MFNA 3WD5L 1CFNB 2X1XR 3VXRA 3SGDH 4OZHB 3RWFA 4XPAH 2VLLA 1IAKB 4ZUTA 3LZFH 1HKLH 4DVRL 3MJ9A 4NO0D 4LSUH 1WF5A 4KTDL 3AMKA 4OSUL 1SVCP 4ELMA 4C56B 2XZCL 4MAUH 4N8CH 2CLRA 3FKUS 3H0TA 3QULA 3NPSB 4YNYB 3TJEL 4OCXH 1H3XA 3HC4H 5I8EA 3WFEL 4MS8D 5C0CD 3ZE1E 4K71C 1YN6A 4K3JH 2R39A 3JBG7 3ILPA 3CDCA 1IGTB 5TGBA 2PW1B 3BN3B 2IPUG 2EC9T 4PJGF 4MS8C 4ODSL 3HLAA 2XRAL 4DWHA 1XGYL 1WCQA 2R2BA 3QDGD 1LD9A 1EHLH 1Q1JH 3ARGB 4GKZA 2BXYA 2OSLA 4JQVA 4XMKH 3VXRB 1KYOK 1RIUH 3KLDA 5IW3A 3RWFB 1JZ8A 5GRJH 3REVA 1NCDH 3QUMH 2P8LA 5E2UL 4L3ED 1S7WA 4ELMB 1ADQA 3PWUA 2FH6A 3OKDA 2IQAA 4ZAKB 5HTSA 4CVWA 2CLRB 4ODBD 1NCWL 1DFBH 2EDWA 3H0TB 3QULB 3AROA 5I30H 2A0LD 4J2XA 2CUHA 4O51A 5E5MA 3IDNA 4NKOA 2ED7A 3GBNL 5I8EB 2EIDA 4XB8A 3FB5A 1YN6B 4A6YL 4KDVA 3H7BA 1RUAL 3ILPB 2A0LC 4P2RA 5TGBB 4WFEE 1KCUH 3WJLC 5C09D 1KC5H 2MKWA 3OXSA 5DC0A 3RU8L 3HLAB 2QHRL 1G9NC 2R2BB 3BMVA 3B2UC 2Z31D 1ROWA 2KH2B 3MBXL 4GKZB 3KLHD 2JJVA 2OSLB 4RGMB 3Q1SL 3KGRA 3U30C 5LWYH 1KCSH 1H3TA 3AAZA 1K2DA 3RX7A 3GHBH 3EJJX 1KLFA 5DSCB 3KLHC 3LEVH 3REVB 4ZTOL 2OXGA 2P8LB 5JIPA 1S3KL 3SEPA 1B3JA 2AQ3A 2YPVH 3FCTA 3PWUB 1ERNA 3OKDB 2IQAB 4B41A 4MJ4A 3LN4B 1IGML 5E5MB 2OR9L 2MCG1 1I9RH 4OLYH 4JCMA 3IDNB 4QWWD 1WWWX 4NKOB 4M93B 4N5UA 3VFMA 2J4WL 2EE2A 3FB5B 3DOSA 3H7BB 2UWEF 2J2ZA 2XZAL 3IDJB 3L1OH 4P2RB 2A77L 4QWWC 1X6NA 5BS0D 1AD9A 4LLUA 1EEZA 2VIRB 3OXSB 5IJKA 5FB8A 3BSZL 4IRSC 3V8CA 4YDIH 3SDYH 3AAZB 4JO3L 1KENL 4C57C 1K2DB 3HKFA 5CJQL 5F93C 4QRSA 4R90L 1U3HA 2F54A 3WXVH 3SDAD 3SKMA 2GJ6E 5HHNA 4OF3A 4HZAA 4A2LA 3UYPA 1JTOA 2AKRA 5KZCD 1TETL 3FCTB 5KVDH 4XC3L 3SDAC 3VXMA 5I1AB 2A6IA 4N0UA 2XZQL 4ZODA 4D3CH 3I3DA 3VFMB 1BX2A 3KPPA 2UYLA 4TSCL 3LKQA 3SDXE 2MOVA 1PEZA 3C6LD 4M1CD 1AD9B 4EOWL 1UM4H 4LLUB 1AY1H 4NNYA 1EEZB 4DAGL 2EDFA 3BFOA 2VRAA 3ULVE 3RY6A 5FB8B 4M1CC 1SBBA 3WYRA 1DANU 3VW3H 1YDPB 3U48A 2DLTA 3LKOA 4HGKC 1RIHL 2HFGH 1WIPA 1NCBH 4LAJH 1NDMA 1PAMA 2AABH 4ZD3H 5T5FH 5I1JH 3BP5A 4EN3C 1J87A 3IDYC 5J57B 3SKMB 1XIWA 5HHNB 3ZL4L 3PQYE 2AKRB 1IC4H 4GAJH 4PRIE 3BE1H 3P11H 2YD1A 3K1KC 3L3OA 3VXMB 1FNGA 1DL7H 2A6IB 4N0UB 4LU5L 3P40A 5CFHA 4JPKH 3KPPB 2UYLB 3RI5K 4NSKA 1MFCL 2XTLA 3GI8H 3LKQB 1HK6A 2V2TA 1NBQA 3X12A 3VG0H 4HS8H 1ZTXL 1J88A 3NN8A 1BWMA 1SMOA 4LPXA 3JSSA 3UTPE 4JY5L 4KAQH 5GGRY 3F7YA 4NNYB 3H9ZA 3ARFD 3MUZ1 3VFPA 2APBA 1U8LA 4GBXB 2ARWA 1D6VL 4LVNC 1A6VH 1UM6L 4WGWB 4Y89A 5IEHA 4O2EB 1U9KA 1FSKB 1W2KT 3ARFC 3LKOB 3L3JA 3NACL 2VZOA 4OZGA 1NDMB 2X5PA 35C8H 5F21B 4PBVC 4MCZA 3ZTNL 1RUQL 1QLFA 3SHSA 1XIWB 2G9HA 4CN1A 4MWFA 3KR3L 1FNEB 3OJ2C 2GQHA 4RFOH 1MJ7L 3CCHA 1H5BA 3RTQA 4NRYA 3RIAF 2OBGA 4HWEL 5TF1H 3L3OB 3SGEI 1FNGB 4CU8A 3S3PA 3G6JA 1NANH 1A7RH 1MNUL 4AEIL 2NYYD 3OJMB 4KHTL 3D3VD 3MLSL 4GRWE 4NUGH 3PDOA 4NSKB 1G6VK 1AHWA 5IW6A 2AK4E 3X12B 5KOVC 4N9GA 1IEHA 4PRBA 4DTGH 2NYYC 4LCYA 2X44D 1QKZH 4LLAA 5F9OL 3VFPB 2VC2H 1U8LB 5IEHB 4YHLL 4R2GD 1YNLH 4JM4L 5T3ZE 1NBVL 1BIHA 1NLBH 3L3JB 3MUJA 3V6FA 1ZHKA 4OZGB 4QOKA 3IJYA 4QHUA 4MCZB 1QEWA 3MOAL 1QLFB 3EAKA 1DBAL 1NAKL 2G9HB 3I2CH 4MWFB 4MHHG 2BNQD 5IB3A 5CJBA 3CCHB 3D0VA 1GPOL 1H5BB 2XXCB 3IDUA 3RTQB 2YKLL 4OFYD 2VDNL 4NRYB 5TE4H 4O02H 3G6JB 1FLRL 3ZDZE 4Z7UE 4NO0A 3V7AE 5HY9A 5B39G 3N0PB 3PDOB 4UDTA 3S35H 4PJAF 2F5AH 1AHWB 2KZ1B 1FZMA 5I1HL 5IW6B 4ZS7L 4N9GB 5D7SH 4PRBB 5EA0L 4LCYB 1GOFA 3NAAL 1ZMYA 1BFTA 4K8RD 4FFZH 3HRPA 4MNQB 2FD6H 1A1MA 5C0CA 1SJHA 4KVCL 1EJ6A 4CMHC 3BQUD 3L7EB 4KK8D 3R1GL 1PY4A 2A73A 4K8RC 1S9KC 3NOIA 3V6FB 4NZRL 1ZHKB 5T3XL 2XOTA 3GSNH 4QOKB 1L0YA 2MCPH 3IJYB 4QHUB 3BQUC 4KK8C 4OCMC 1TNNA 1LEKB 1QEWB 2BX5A 1ZS8A 2Z8SA 1CE6A 5I8KL 3QRGL 5BV7H 4I3GA 1EGJL 3QO0A 4JRYE 4KRPD 5IB3B 5E08H 1HN1A 1KF9B 3UJTH 3D0VB 5HHVH 3JV6A 1RZJH 1YZZA 3MUY1 4RAVB 4KRPC 4XAWL 1R24A 2UVEA 4OIIH 1OARL 4L3EA 4U0QB 3RDTD 5GGVL 1HXYA 5IFAH 4UDTB 1FZMB 2NZ9D 4POUB 4X7CC 1ZV5A 3BKJL 4K71B 4RDQF 3U7AA 4G7VL 2OZ4H 1Q9LA 3AVEA 3RDTC 4GKSA 3A6CL 4GUPA 3WJLA 2NZ9C 1CDBA 5C0CB 3TGXA 1SJHB 1X4YA 1OP5K 1MJUL 1MJJA 4NBZB 5DC4B 5C09A 1NCAH 2F53D 3ARWA 1OAUL 1BFSA 5MHSE 1AGEA 1QFWI 2AW2A 1ZS8B 4WGVB 1CE6B 4NWUH 3PWNB 2AERT 2FDBP 3QO0B 4CDHA 3VRLE 3OMZA 3NIFE 5F7HA 4M5ZH 3RKDD 3JV6B 2P48B 4MD4A 4NGHL 1NMCC 1RJZA 3MLVL 3NA4A 5CBAA 2NTFA 1DSFH 1R24B 4CL7A 1F13A 4L3EB 3RKDC 2IBZY 4PPTA 1HXYB 2CMRL 2C3HA 4UOW0 2IJ0C 1GGIL 1NAMA 1FC1A 3UO1H 3IU4H 2GJZA 2VZ1A 4GKSB 1MAJA 1BQUA 4GUPB 2BC4A 4PJDB 5IUSA 4M6AA 5C0RL 3MZGB 1FL5A 2CK2A 2VLME 3NABH 1MJJB 1NBZA 1XFPA 4HT1L 4S1SL 5HYFA 3L3KA 5BS0A 1ZLSL 1O0VA 3OPZH 2DLEA 4ZNEA 5C09B 3U30B 5B39A 3RL2A 4Z77A 1H3GA 1AGEB 3EZJB 1CT8A 2EH8H 1HI6A 1PKQE 1X5LA 4Y4FD 2DBJA 4IDJH 3S7GA 5DMYA 4M61B 2X40A 5E2WL 3TF7C 3HE6D 2V9TA 4MD4B 5FDWA 1NGQH 4H20H 1RJZB 4Y4FC 2GSIA 3BKML 4LPWA 5I73C 3SDAA 5CBAB 2NTFB 1S7UA 5EH1A 3AS0A 2VLKE 3HE6C 2R0LH 3MREA 4WI4A 3QHZH 4RDQG 3I6LE 4KY1L 1NAMB 3MRFA 3LIZH 5KVMC 2GJZB 4LASL 2EE9A 3UTZA 2BC4B 2HN7A 4HKBA 3ZHLA 4M7KL 1FL5B 1EUUA 4HXAH 1NBZB 4UDUA 3X3GL 3L3KB 5BS0B 3EYFA 4LIQH 4R26H 1CTNA 4IRSB 1ZLUH 1NGXA 2BVUA 5B39B 3RL2B 1IRAY 4Z77B 4WTZG 1PG7L 1CT8B 1QFWM 1HI6B 4JRXD 4NNXA 3OBAA 3MV9B 3CNKA 4EN3A 4HXBL 3T2QA 4NQXA 4NHCH 3S8WA 3GDBA 2BP3A 4C55A 5FDWB 1DN2A 4P57A 1EO8H 2EICA 4LAQH 4FQPA 2GSIB 1CD8A 2ZCKH 3K2MC 3QWOA 4FABL 3SDAB 3QDJE 5JMRA 4YHML 1S7UB 3C5SA 2UZYB 2YBRB 3WXWL 1A6UH 1EHNA 3FQTA 3MREB 5KZCB 1EHXA 5TDPA 4OQ1A 5ANMA 1AD0A 1QBMH 2R8SH 3MRIA 4FQCL 1MHPL 3CFBA 3QIWD 1A6ZA 3WMSA 4FQQA 4PV8A 3UTZB 4L8BB 1OQOA 2W9DL 4HKBB 5LQBH 1EFXD 4QNPF 2UY6A 4X4XA 1IC7L 3FFCD 2F58H 4H1LB 2K7PA 3F58L 2VLJE 4UDUB 4UMGA 1BJ1H 3EYFB 1F4HA 3RRQA 1NGXB 2GY7B 3RBSA 3ARFA 3X11A 2VZUA 3WJJC 2EO9A 4RWYH 4HUMB 2XQBH 4NNXB 5GGSY 2XQYG 3DO3A 1MFEL 2GHWB 3IDYB 3VRJA 4EN3B 5DHYA 4NQXB 5H37H 1FVEA 3BH9A 3GSQA 4BH8A 3DHMA 4JKKA 4P57B 4EXKA 3RPIA 2R69L 2I60H 1CYGA 3BDBA 3QWOB 2RJMA 3JV4A 5FAAA 3C5SB 4MAUL 1T1YA 3VGGA 3W2DH 3SDDD 3FQTB 5ETUA 5I6XC 4N5ED 4QRRE 1QFUH 5TDPB 4F33A 5ANMB 1AD0B 1CGVA 5L88L 3CDFA 4LP4A 3MRIB 5EZJA 3WFCH 5HYJD 3CFBB 1L9MA 1QRND 1A6ZB 1ES0A 4FQQB 4N5EC 1CE1H 1V7NH 3D3VA 3IFOA 3O81A 5CSBA 1S5IH 4X4XB 3QPXL 2FX8L 4LVNB 1XR8A 4ZG1A 3W0WE 4EXPX 4LMQE 1I3GH 4LHUB 3S97C 2VISB 3LKRA 3LRGA 3X11B 1ZVSA 4KGLA 3E8UH 3HZMA 3GMPA 3VWJD 5B3JF 1IE5A 5FHBL 3VRJB 3KPQA 5DHYB 5ICZA 1FVEB 1AE6H 3BH9B 3GSQB 4BH8B 2VITA 3KG5A 3RPIB 3VGBA 4M6MH 3VWJC 1AFVH 3VXSE 2EDEA 3VGDA 3LS5H 4ONHA 4CMMB 2YEZA 3JV4B 5FGBC 1WZLA 4JKWA 1DQML 2N7BA 2VDML 1T1YB 2BNQA 4LEXL 4XX1G 5DD0L 4TOYL 5EOCH 5ETUB 3VFTA 4BH7A 1GXEA 4OFYA 3OZ9L 2OP4H 4GG8A 5MEQA 2G2RA 1KBGL 4F33B 2W60A 4K94C 3FJTA 5EZJB 5JHLL 2WM0A 3MLTA 1F3DJ 5D1QD 3TCLB 3RBGA 1ES0B 1J11A 2B1HH 1TLKA 4HPOH 3D3VB 3IFOB 2CRZA 1W72H 3MRHA 3OHXA 1L0XA 4PJXA 2DLIA 1XR8B 1J8HE 5D1QC 2BHUA 3N85H 3MJ7A 5JW4R 4U3XA 5MENE 4KK9D 1CLYH 4M9OA 3LKRB 3QRFM 1BM3L 1ZVSB 4AIZA 4ZFOL 2ICES 5KS9F 3HZMB 3GMPB 3BQUA 5LXGH 5FYLD 3E6FA 4KK9C 4RGNE 5DUML 4N8VA 4OF6A 5JXAH 1CF8H 1ZLWH 2VXVL 1WAAA 4ONHB 1EERB 2IAND 2YEZB 5GGRA 3O3DA 3U6RB 1YMHA 4HUXA 4P59H 3HI1A 3TIEA 4G5ZL 3PWLB 2HKFH 4D2NA 3BIAX 3VFTB 4BH7B 3KYKL 2XG5A 3ZDYE 3FQNA 3UXFA 4S1RL 5MEQB 1J0JA 4GG8B 1DE4A 1KPUB 2W60B 3OTTA 4I9WE 2IPTH 3DECA 1YYML 1VERA 3MLTB 4YHIB 3MLWH 5J0BA 1PKOA 4LHQB 5HHMD 4X80H 4JO1L 5FYKH 1NSNL 3RDTA 1U8IB 3OKNA 1JWUA 1OPGL 3MRHB 3N50A 4LGPB 4PJXB 5LCVH 3T2NL 4YZFF 2NY4D 4U0RC 4CMHB 1MAML 1LQSR 1A6TA 3MZTA 4FN0A 1GAFL 4XVSH 4OZIE 1FIEA 4FQ1L 4H88H 1FFQA 4G6JH 3HZYA 4AIZB 4FQIH 2NY4C 1A22B 3SGJC 5F44A 3BQUB 3O6FD 4D9QD 3E6FB 4N8VB 4X7DC 2F53A 4KJQD 1LILA 3WFZA 1INDH 3O6FC 5DJ0A 5GGRB 2QLVB 1DUYA 1YMHB 4HUXB 3WSQL 3HI1B 2QSVA 1FL3A 2CKBA 4KRPB 4ZPTA 3TIEB 5A40E 3SKOA 4G80A 2VXQL 2P24A 3FQNB 4PB0H 1DE4B 4GH7B 2CGRH 5K9QG 3UC0L 3DI3B 2EYRA 2Y36L 4GXVH 5T1LB 4QCIA 3JWNC 1MHCA 1MRCH 3RDTB 4W4OC 4JHWL 3WNLA 3LRHA 3OKNB 1CXFA 4WHTA 1JWUB 1FNAA 4YQXL 5IHUL 3L5XL 1AY1L 2E8ZA 4RGOL 4O2CA 1A6TB 2HH0L 4PRHE 4XXDA 1U36A 3WIHL 1MOEA 5HDQL 3HZYB 2BMKA 2H3NB 1AO7D 1TDQA 3EDJA 5CMAB 2R1WA 1CXKA 1N5YL 3ZYZA 5JLZB 2F53B 4MXVF 5K93A 5J89A 3MC0A 4XP4L 4NRZA 1NMCB 5DJ0B 4Y4FA 5ADOH 1DUYB 2CKBB 2VDKH 4ZPTB 1FFRA 3WS6C 5EO0A 4G80B 3SKOB 3K81A 2P24B 1J5OH 3MOQA 5EIIA 2FZ3A 3HE6A 4WFFE 2AJYL 4YHOH 5CJOL 1PDKA 4KZDL 4L3CA 3DUUA 3SBWC 2EYRB 2DLFL 4QCIB 1MHCB 1URLA 5F1NA 1I1AD 2FIRT 4GAYB 4JHBA 4U6YA 3TJHD 3MLXH 3GRWH 2OI9C 4WHTB 3TYGH 4UT9L 3BPCA 1KJ2A 3UEZA 5DQDL 4M6NH 4NBXB 1NMBH 4Q74A 2MPAL 4P4KD 2GTZA 12E8L 4O2CB 1I1AC 3PNWA 5EPMA 4XXDB 3VH8G 4M43H 3TJHC 1KG0A 5F9WC 43CAA 3K1DA 5EU7C 2BMKB 2WBWB 3WDIA 1U8MA 1U95A 4P4KC 4EQ3A 5ITBH 4JN1L 4W6YB 3S35X 3NCEB 4TNVK 3TBSA 1HQ4B 1J1XH 5L2JA 2QSCH 4PY8J 5B8CC 4NRZB 4WFHD 3UJIH 4JRXA 1RUKH 3QIBD 4Y4FB 3VD9A 1NFDF 1N0XH 5I73B 1I1CA 5FO9A 1A02N 4PS4H 5EO0B 4HD9A 4KROC 4HUNB 2FZ3B 2QEJA 3HE6B 5EIIB 3FQXB 4G43A 1MCQA 4L3CB 3DUUB 3QCUH 3QIBC 2LQRA 4UINH 4NJ9H 4X0KA 1HNFA 4U6YB 4LPVA 4LSPL 5TQ0H 1CFQA 2Q7NA 5GGQH 5D4QA 1CU4H 3I9GL 1KJ2B 2ZSWA 3BPNC 3OB8A 1JZ4A 5MEOA 5HYSG 1N7ML 2GTZB 3PNWB 2DQDH 2NY5L 5EPMB 4XT1C 5IIEA 4JFEE 2VE6A 43CAB 1EFXA 1RJCA 4V1DD 3SKJL 1U8MB 2NY2D 3FFCA 4Z78A 1U95B 4HIXL 3OJDA 3WIIH 1AXTL 3WJJA 2ATKA 4LCCC 2IQ9H 2NQCA 5GJTL 2IFFH 4FP8H 2WNGA 4PTTA 2NY2C 3TBSB 4JFZH 5L2JB 3O2WH 4PJHA 2BZDA 4JRXB 2F8OA 3HZKA 5FO9B 3IFLL 3H42H 1D5BA 4PGEB 4UT6L 5IVZA 3T0EE 1FO0L 3TH2T 2Z91A 1YYLH 1ZK9A 4ZFFA 3X13A 4G43B 3S4SG 3UPAA 1JNJA 4X0KB 1UXWB 1G7LA 1RU9L 5E94A 4G7YH 1EPFA 3SDDA 2APVA 1CFQB 4ZO8A 3I85A 5C0NC 1K3ZA 1OAKH 3AS1A 3RUGE 2ZSWB 4PJBF 2XN9E 2AVGA 2NNAA 2ZNWA 1UJ3C 5HYJA 1QRNA 3CC5A 5IT2H 2IG2H 4OLUL 2VE6B 2CPCA 4DK6A 4HX1A 1EFXB 1IILE 4Q6YA 3U0TA 2J8OA 1U8JA 3QFJE 3FFCB 4L3AA 1AI1L 1MFBH 2BJML 2ZUWA 4Z78B 2IBBA 2ATKB 4TQEH 3EO1B 4TUJA 1KFAL 2I07A 1VKXA 1MEXH 4PTTB 3F6LA 5CJ5A 4ZSOA 4XVJL 3PF2A 4NC0B 4PJHB 3BP7B 1IGJA 3VWJA 2W07A 3HZKB 3CMOH 5FGBA 1D5BB 3CSGA 5ID1A 5IVZB 5JMOC 3VH8A 2Z91B 4ZFFB 4NZTH 4N8PA 2DRUA 3X13B 5JOPE 2PKDA 5I6XB 3P30H 1YQ2A 4P48A 3V0VA 1LK3L 1G7LB 1UVQA 2YPLE 5E94B 4QYOA 1LWRA 2WANA 1JGUL 2EXWD 15C8L 4WY7L 2DIJA 2FO4A 3TT1H 1DBJL 3AGVA 2Q8AL 3PGDA 2V5RA 3KPMA 3T04D 3C6SA 5HYJB 1TNMA 1FH5L 5D1QA 1QRNB 2R4RL 3CC5B 2VAAA 2EXWC 4H0HB 4HX1B 3U0TB 1U8JB 4HC1A 5E8DH 2APTA 2ADJB 5DYOA 2B2XH 2R15A 3CX5J 1DEEB 2LE9A 1NGWA 4GRLD 4NN7C 4TUJB 3G5ZA 5KVGH 3CXDH 1VKXB 4PUBL 5I8OL 4Z7VA 1IBGL 3WV0A 4ZSOB 1WBZA 3N1GC 3SGKC 1QG3A 4GRLC 3C5JB 1IGJB 3UTQA 3VWJB 1EO5A 3JUYA 3EDFA 2AK1L 1S78D 4X9IA 5ID1B 1JL8A 4I3RH 1KB5A 4BELD 1I3VA 2F5BL 2HJFA 2HJLA 3RKPA 4UIMB 4RBPH 1DSFL 4JANA 4YEFA 2IANA 1P9MA 3V0VB 4Q9CA 1UVQB 2VYRE 3HMXL 1A6PA 4S0SD 4QYOB 5DUPH 1OGTB 1A1OA 4JDZA 5GGSA 3H9SE 2FO4B 2Q1EA 1FHGA 3PGDB 3KPMB 5T5NF 1GGBH 5JQ6H 4HUVB 3C6SB 3G9VA 5D1QB 1MFDH 4LRNL 4J1UA 3MRKA 5L6YL 1G7QA 3NABL 4UV7L 3QO1A 1I9IL 3CFCL 1MWAA 5DYOB 4H5SA 3S4SA 2D31A 5HD8D 3V0AC 4PJIA 4NO5A 4WJ5A 1NGWB 2D7NA 4ZFGH 3SGJA 4XPGL 3DXAE 3GKWH 5TPWH 3G5ZB 5C2BH 2PR4H 2VZTA 5T3XE 4Z7VB 4YK4C 3MXWH 5HD8C 4J3OC 2B4CH 2EDLA 3ZHDA 3RJQB 4I4WA 3O6FA 1G9MC 2Q76A 1MCLA 4XCNB 5GHWH 4CKVX 1VSCA 1BD2E 4QGTA 1P4IH 1ZGLM 1KB5B 1A3RL 4NOFA 4HBCH 2HJFB 2HJLB 2EDRA 3MQIA 3ZE1F 4UIKH 4JANB 4WFGD 2IANB 1CDGA 5CCKL 1CFVH 1CZ8H 1XF3A 3ZYIA 1AIFA 2Y06H 1U3YA 3RA7H 4HWUA 3B2VL 1A1OB 4JDZB 4JQIL 4J3UA 4W4OA 5GGSB 1IQDA 4HUUB 1LO0L 1FYTE 3KPNA 5HHMB 4J1UB 3VDCA 2Q20A 3MRKB 2P5WE 1KJ3H 1G7QB 3KPRE 3QO1B 2FX9H 1MWAB 4H5SB 2D31B 5CKAA 4X6DE 4PJIB 4NO5B 2NY4B 1I3RA 4WJ5B 5JW5A 1Z9OA 4L1DA 1U6AH 4ISVA 4YLQT 4CBPA 1J1OH 3AS3A 5GJSH 1C16B 1WFOA 3NIDF 4UB0H 5C0BD 1AO7A 1FP5A 4I4WB 3GMLA 3O6FB 2O5ZH 2Q76B 1XF2A 4TVPL 1U8PA 1YJDH 1FZOA 2EDNA 4LAQL 4EJ1C 3GJEA 3WS6A 1MIEL 5E00A 3O45A 1KEML 1ZHNA 2XY2A 1UWXK 3SBWA 1XF3B 1A6UL 3B6SA 4XZUA 1TXKA 1AIFB 2Y07L 5CEZD 3U4BL 2VDRH 1H15A 3U2SA 3LRSA 4QRQA 1KULA 1O5DT 3BPLC 1IQDB 1B2WL 5C0IB 2C3VA 4JO4H 5LQBL 1GGYA 3LEYH 1MVUA 4RMSA 3KPNB 4MB5A 4H8WH 4U1NA 5BVPH 2EIBA 1I1AA 2O93L 3V79C 3BJLA 2BVTA 2N7AA 1Y6MR 1E4JA 2ZCHL 1I3RB 5JW5B 1RZKH 4P4KA 5EUOE 1Q0YH 1KELH 4BQ6A 4ISVB 3PV7A 1P84J 1RURH 5FUOL 2DWDA 1ZGLA 3L5IA 1AO7B 4WEMB 1JGLH 1X5IA 3GMLB 4CADA 3Q48A 1XF2B 3PQYD 1U8PB 1FZOB 5KG9B 2CDEA 5E00B 4OTXH 1H3VA 3O45B 5EOQH 1DQJA 3ALPA 1ZHNB 5J6HA 1WZ1H 3QIBA 5KSUA 4ZYKA 1KCLA 4XZUB 2AJZA 1DEDA 1UB6A 2I9LA 1F90L 1BJ8A 3U2SB 5INCA 1OM3H 4QRQB 4K9EC 2QQKH 5TH2A 3WFCL 4CVZA 1PVHA 5F6HJ 2OI9B 1J1PH 5D2LE 2C3VB 3DIFA 1MVUB 4U1NB 5JW4Q 5CAYB 5IESH 4NFCA 5GRVL 4OM1L 5B21A 1I1AB 1MRFL 4K2UH 2CUIA 1U93A 1TTFA 3CFKA 5F9WB 3ZKSD 4KI5E 3ZSSA 4PRPD 2NXZD 4P4KB 1QSFD 3S88H 3BDYL 1JRHL 4LCCA 3D0LA 3TPUA 2DWDB 2BFVL 4V1DA 2NXZC 5GGTA 1F6LL 3KYOA 4CADB 2QQLL 4HKZA 5B8CB 1AXSA 5FGCB 1DUZB 3VD7A 1NQBA 1QYGL 3HNSL 1ZVHA 4DKFL 1XF4A 3O3BA 3OR7A 4HPYH 2COQA 2JIXD 4LL9A 3X3FL 2CDEB 4RNRA 4TTGA 4WI9A 1F11A 2B5IC 4X4YA 4N0YL 4YWGL 4KROB 4J7RA 3SDXF 1IT9H 3WS3A 5J6HB 4PLJC 3SE9H 5C0JA 3QIBB 4ZYKB 4F7PB 3JWOH 5KSUB 2NXYD 1UB6B 5INCB 3KJ6H 2BDNH 3ULVF 5TH2B 4BQBA 5BO1H 5HVHB 2AK4D 4CVZB 2FL5A 6FABH 4ALAL 2NXYC 4FQLH 3BPNB 3DIFB 4Q97A 1OTSD 4RSVA 2XT1B 4ERSH 4DFIA 1UJ3A 1WV7T 4XHQA 1OLLA 4JN2A 1U93B 3ROLA 3CFKB 2PNDA 1WJ3A 4B0MM 5EB9A 2Q6WA 1DDHA 5T3ZD 1OTSC 2PCPA 1KXVC 1R3JA 1BGXL 4BZ2H 3G6DL 4LCCB 3D0LB 3TPUB 3C8KA 3QT2A 2YK1L 4V1DB 2ORBH 5JR1L 2NY2B 3C2SA 1OP9A 3KYOB 5I18H 1MPAL 4MA8H 2DQGH 3UBXI 4HKZB 5T33L 4HWNA 4PY8I 3JWDH 1XF4B 3O3BB 2E7BA 3OR7B 4OM0L 4RNRB 1QBLH 1F11B 3H9HA 1UXSA 4WU7A 4X4YB 5CINL 1KYOJ 5IB5A 3WS3B 2D4FA 5C0JB 4LCWD 5JTWA 4XAKD 3W82A 4YX2H 2HT2C 1U41A 3J8F7 1BMGA 3MGTA 5D93C 5AYUL 2DJSA 2FL5B 3MLWL 5TJWK 4YHZH 3VFOA 1LO2H 1F4AA 3P9MA 2AGJH 5DJZA 5ESAA 1UJ3B 1LO5A 4HS3A 4JN2B 5KW9L 5BRZE 2R29H 4YXKL 3ROLB 3PP3H 4DFHA 3QCVH 1FRGH 5C70A 3FL7A 2F9BT 5IBUG 1S8DA 2AV1A 2Q6WB 5C7XH 4MB4A 2PCPB 1R3JB 2I25N 2D0HA 1G84A 3QQ4A 1ODAA 1DQLL 3LN5A 1MI5E 3C8KB 3NZHL 4HGWB 5GRVK 2OYPA 4BFBD 3WUWG 4MA7L 2WUBH 2VB5A 4NCC2 5IB2A 4JRYD 5D9SA 3SGKA 4GRLA 3O4OC 2D7OA 2OJEB 4RAHA 4WU7B 3H9HB 1UXSB 5IB5B 3V5KB 4MXQD 4UTBH 2ZP0T 4WHYH 1V7MH 3UBXG 3QNYA 2CR6A 4U7KA 3FMGH 1XCQB 5LG1A 1I8LC 2G60L 4QHMA 5C6WH 4YHYC 4OD1H 1TIUA 1TVDA 1YEDA 4MXQC 5C8JA 4LCUA 3P9MB 1LHZA 4MAYD 4I2XA 3O6KL 5KSAD 1EH9A 1NGPH 4JPWH 5DJZB 5GRXG 4OGYL 1MCPL 5ESAB 2LU7A 1NBYA 4HS3B 4QEGA 1GHFH 1EBPA 1G6RH 1S8DB 4TN9A 4MAYC 1JPFA 5KSAC 2AV1B 2O5YH 2F74A 3CVIL 4JJHA 1N26A 5I74C 3DVIA 4NN7B 3QQ4B 3LN5B 5J11C 2WWMD 1Q0XH 2NY3D 2E9BA 4F15C 3O2DL 1HE7A 3TVMD 5IB2B 5DA4A 5D9SB 1L7IL 2EDJA 5KTEH 3H6JA 4GRLB 1A7PH 3DV6A 4Z7UF 3OSKA 2WWMC 2NY3C 2GFBA 2P4AB 3U7WL 2ZCLL 1LO3H 1R5WA 3QDAA 3TVMC 5JOEA 5HHXH 1AGDA 1RI8A 2DDQL 3TBTA 4BK4A 3QNYB 1TCRA 5JXED 2CDFA 4WWKD 2P7TA 1D5MA 4YR6A 4QHNB 2B8OT 3RIFK 3TPKA 4QHMB 2JK5A 3MRQB 2VABA 2XACC 1YEDB 4TRPL 5C8JB 4LCUB 3FO0L 1F4YL 4JCLA 5GS0L 4LPTA 4I2XB 4R0LC 5JXEC 4HWBA 4WWKC 3MLXL 2CRMA 4XPBL 1MLCA 4BZ1L 4JHZA 2ATPA 1RJYA 4XNYH 1NBYB