4S1QH

Crystal structure of a vrc01-lineage antibody, 45-vrc01.h03+06.d-001739, in complex with clade a/e hiv-1 gp120 core
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
232
structure length
228
Chain Sequence
b'EVRLIQSGAVMRKPGSSVKISCRASGYNFREYSIHWVRLIPGRGLEWIGWIKGMWGAVSYARQLQGRVSMTRQLSQDPDDPDWGIAYLEFSGLTSGDTAEYFCVRKGPSCPHCGDFHWQHWGQGTAVVVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 gp120 core
publication title Maturation and Diversity of the VRC01-Antibody Lineage over 15 Years of Chronic HIV-1 Infection.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 35
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2015-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1qH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1qH01
4RISH 5B39A 1OB1A 3G9VA 3LS4L 3LKRB 2AW2A 1KJ3H 3ALXA 3C5SA 3KXFA 3NCEB 5IK3A 5INDB 4Y19D 3IVKB 5C0NC 4OM1H 3NCCB 2HWZL 4PG2A 5LCVH 3CPLA 4M1CC 3UTQA 4NOFA 1JGLL 5FYJE 4HUXA 1MJJA 1TJIH 4Y5VC 4YBQD 3B3IA 4RMVA 5I16A 3VFPA 2BSTB 5I1HH 2QSQA 5DJ0B 3KWWB 1UXWA 5FYJL 1C7SA 4KXZH 1QLEH 3CX2A 3QQ3A 4N0YL 3ARFB 2O26U 6FABL 3U9UA 4TSAL 4JKPL 1OAZH 3U2SB 3RUGB 2VITA 4GKSB 4UV4H 2X4NA 4NO2B 2EIDA 5KVDH 4NQVA 4P2QB 5JHDD 4AIZB 5FO7B 4P3CH 3WDJA 3BYTA 3RJDA 1LO0H 2VABB 1NGWA 4OCYL 2EO9A 4HWNA 3MOQA 2BVPB 4HFUH 1M71A 2NXYB 2R4SH 3W2DH 1RIVH 3CDGA 4PJDB 5DGRA 1DBAL 4KHTL 2ZCHL 1KFAL 4WO4A 3KDMA 2BNQD 1FZJB 3PGCB 1ORQB 3P4NB 2Q8BL 4M61A 2HP4A 4J3OC 5FKPB 4LCYB 3KLDA 4Q0XL 5LGJA 5IVXA 2VLRE 5I1KL 1KSRA 3ZO0A 2DLFL 5DWUL 3BPOB 1EFXD 4ZUSA 1XCQA 1CBVL 1A21A 4UT7H 3QZWA 3C5JB 4O4YH 4OUUB 4XBGB 3L3HA 1J8HB 3MV9B 5E2WL 4CW1A 5GJSL 2HFEA 3B43A 3BKJL 3BGAA 3GSVB 3MLWL 4GW4B 5TE6H 4YXHH 3UPRA 5B38A 5FUCE 1XAUA 4HCRH 3OKEB 2H6PB 3LN5A 2FECI 4LHQB 3GSXA 4YO0A 1EHAA 5I8OL 1I8KB 4R8WL 3VXRD 1CD1B 5ESAA 4X80H 4FQ2L 5FO9A 3QQ9C 1DR9A 4QHNB 4KKBC 5D6DA 1KB5H 1MJ8L 2IAND 5BRZE 3D39B 3SOBH 2DQIL 5DHVB 3HMXA 4Y2OA 3ARBC 5C0BA 4YQXL 3EYFB 4G8IA 3GNML 5EU5A 1VACB 5MEOA 4PPTA 3RVWC 5GGQH 4YBLB 1LO3L 3RVXD 5D5MB 2VXQL 5L2KA 7FABH 1FZOA 4JPKL 4NP4L 4LVNB 1DQDH 1QPXA 4FP8L 3N1QC 4E5XB 1T1ZB 5I19H 2CLZA 3DTXA 4QRPA 3SGJA 1RUPH 4M9PA 3MR9B 1BZ7A 1LEIA 1SYSA 5E8EA 3UEZA 1P7QB 4PP2A 1TVHA 4IDJL 5J1SC 4X6CA 1M7DB 2HJFA 2NX5D 5CKGA 3K1DA 4IEFB 4V1DD 3A67H 2MSPA 3EZJB 3GJFK 1J87A 2GFBA 3LS5H 2DS4A 3OAZK 4KU1A 2LVCA 3GRWL 2P47B 3Q6GL 3W81A 3AUVA 3M45A 4YHML 4MS8C 4YZFF 2Z4QB 5C07B 1BQHA 2IWGA 1M4KA 3BKMH 3WFDL 4YHIA 1MHEB 3EO1A 3WEXB 1ZA6B 4U6HB 2AJVH 4APQB 4GRLD 2CDFB 2ITCB 2HJLB 3SKJH 4WI5A 2NY5L 4LCCA 4I0PD 4YDIL 3SJVA 5KW9L 1UKSA 2M26A 5E00A 3UC0H 4WJ5A 1G7PA 3MV8D 1ZMYA 1N0LA 1AR2A 3BKCH 1TTFA 2B4CH 35C8L 3PQYA 3HC3H 1D5IL 3MBEA 3ME0A 5T3ZL 1KPVA 4UT9H 3X13A 4LU5L 3RIFK 3IAGC 4NWUL 1IEBB 2F74B 1WFTA 3MRMA 5L9DL 5I76A 4FZEL 2OTWA 1P4LA 4OCMC 3ZKNC 5BQ7A 4FFYL 3G5XA 5FYLD 1OWRM 1HYSD 1WC7B 2X10A 1FFPA 1CXKA 1UGNA 5MEQA 4ZO6A 3KPSB 1FVEB 3MBXH 5IGXH 3CUPB 4MGXA 5K9JH 3QIBA 2PO6A 1DUZB 1ZLVH 4IRJA 4QT5B 5ERWB 1I9RL 4F80A 3MV7D 2RFXA 4M5ZH 4PIRF 1PZ5B 4EUPA 1GYAA 3KPNB 1NCBH 4DN4H 4YUEL 1MVUA 2EDFA 1KG0B 1ZANL 1HKLL 3LV3A 4CJ0A 4CVXA 4Y0GA 1QBML 1ADQL 1AO7A 3K4DA 4PRID 3GSNB 4QYOB 2QQNH 2YBRA 4EDWH 3GUTA 1G7JA 1KCVL 3DWTA 4QHLA 1NGPL 4MQ7B 2VXTL 4G8FB 1NUFA 2CLRB 3DVNA 4JR9H 3P4MB 4HIHB 1EHLL 4LGPB 4P4KD 4BK5A 1E6OH 1MNUL 1KN4H 5CP7B 5I73C 2OJEB 1CL7L 3V7AE 1DSFL 1S9YB 4KROD 5T1KA 3CDFA 4PRPD 4X5LA 1CGVA 4EZMA 4KK8C 1BX2B 2DM2A 3VRJA 4PRHD 2FX9L 1BJ8A 4HXBL 4TSCL 3TFKD 2E6QA 3S8WA 4JFYA 4OZHB 1MI5B 4CBPA 1HH6B 3P9LB 4YHZL 3BESR 1JN6A 5EU6E 4OZ4B 4U3HA 3DUUA 1DBMH 5FEBA 5A1AA 3MJ9A 2R1XA 5CEXA 4MNHB 4PG2C 2LTQC 2NZIA 3CFJB 3KYMB 3MUJA 3OR6A 1PSKH 3O11A 3NA9H 2HKHH 3TVMC 3D3VB 1FORL 5ALCL 3T3ME 5HYJD 1GGIH 4XRCB 1ZVSA 4YR6B 1NCAL 3RY4A 5I71B 3QRGH 4IRSD 3VW3H 5L8JB 1EGJL 3IDXH 1U3ZA 5E5MB 9CGTA 3MFFB 2F53D 1IGCH 4MXQC 3QDGD 3QA3B 2QQLH 2LVEA 1FZMA 1A9BA 3TWCL 1LE5B 5C3LD 1RZ7H 1QACA 3VXMD 4RGND 4DK6A 1KGCD 4H5SA 2DM4A 5DUML 1LE9A 3ZKSD 3S36L 3SCMD 3NH7L 5LAXA 2Z0BA 4L8CA 5E03A 3DVGB 4Y5YA 3U7YH 1J8KA 2B8OT 2BVQB 5B8CA 3L7FB 5LGKA 1QRNA 2OL3H 2F19L 3UAJD 4JFDE 1LK3L 1DBBH 4WUKH 4NQCA 3TPUB 3HLAB 1XF3A 4KMTH 2J6EA 1UWEL 3EO9H 3QFDB 2NR6C 4WO4C 3LKQA 3VGGA 3PWLA 1NSNL 2GUOA 1S9WB 4P59L 1A7RH 4JRXA 4HXAH 5AYUH 3HZVA 3UPCA 5FGSA 2HFFA 4XMLL 3QHZH 4LMQI 4NZUL 1YEIL 3GI8L 2QQQA 2XFXA 4JFQB 4AH2B 4HS6A 4O58L 1AHWA 1R24B 2XA8H 3F7VA 1TVDA 5I1GH 3GSOB 3BMWA 4HZAA 1UCTA 2EKSA 3PDDA 3DURB 2WM0A 4C54A 3SKOA 2KUTA 5EORL 5DO2D 2FHBA 3QUMA 5C0JA 1E0OB 4XBPA 2XQYK 2WSKA 4HIIB 1LO5A 4N0RA 3HZYB 2Q86A 2OZ4A 3RX5A 3AXLA 3FZUC 4XVSH 1OTSC 1FV1A 1ZGLA 2N7AA 2ZSVB 1ULVA 2CK2A 2A73A 2ZUQB 2BSSA 5D2NE 4ZXBD 3H8NA 4GG6A 5GGRA 4RIRB 4JGUA 1F4WL 4MA8H 3JUZA 4YHOL 1RFDH 2YA0A 3SKMA 5JIHA 3O0RH 5EZOH 4RAUB 5EZJB 1CFVH 3R8QA 2A6JB 3GSRA 1MPAH 3S3JA 3QWRA 3QRFM 2C3XA 2W65B 4YHLH 4IJ3C 2ZOLB 4PJ7B 3OKKA 5MERB 3CC5B 3SGJC 1HEZB 1WTGT 1P7KA 4R97B 3NZHL 4L3EA 3ULVC 3HNVH 1UM5H 4N8VG 2DIJA 1SEQL 4L4JA 5CWSA 4FQQA 5GHWL 1LO4L 1GGCH 4KJYA 5F7WC 3F5WA 1T21B 4GT7A 2IG2L 1RIUL 4X6DA 4GRWH 4CADB 5C09A 3IKKA 4HJGB 2ICWB 4KQ3L 2IQ9L 3ARTA 4Z7QE 1YJDC 2WIIA 4P57B 4YE4H 4OGYH 5TPWL 5ICZB 2YRLA 3CSYB 1AQKH 2BVUA 2R0KL 3ES6B 3DIFB 2X7LA 4NWTH 4U31A 2F5BH 3T2OA 5JTWA 1Z6JT 3GB7A 3O2DH 4D9RD 4LSTH 5A43C 1DQML 1JF1B 1FJ1A 2F54D 5EPMB 5HYEA 2VLJE 4LKXB 3LRGA 2UZXB 5C86A 4HK3N 4W4OA 4H8WC 4LCCC 4KK5D 4GG8B 4QY8A 4L9LB 2J8UE 5DJDA 2CPCA 3U0TA 5ITBH 3WNPA 3QSKB 4MX7B 2VDQL 4RMUA 5LVEA 3MBEC 1JGEA 1YYML 2ZOKA 1BPVA 1QNZH 4FS0A 1NKRA 1OGAD 4QLRA 3RI5K 2HTKC 4U6VL 1U6AH 4IRZL 4WNQB 1KBGL 4KI5C 3CFDB 1TZGL 2X89D 1PLGH 4NQDE 4NQED 2DN7A 2J88L 1WWCA 3QUXA 4DVBB 4MMXC 2XWTA 5DK3A 3O3BB 4WUUE 2DQFB 3Q6FA 1HDMA 1H0DA 4MQSB 3BWAB 3QIBC 5TGBB 4U1NA 1CE1L 3BIAX 4IRJC 3WFEH 3AS2A 1IM9B 1FL6A 3VFUB 1EIBA 2Q8AH 3UTTB 5D7JD 4UNTA 3C60B 1MHPL 3G6JA 3EOBA 4TUOB 5GGVH 3U9PH 3KPLB 1IRAY 5E6IA 1PJ9A 1CFQB 3OBAA 3IFNH 2A83A 1BZ9B 4NNYA 3Q3GA 3RZCD 4LLVB 1S7QA 4XP9H 1GC1C 3FB8B 1A1NA 1X5ZA 3DRQA 4UNUA 4LIQL 1I1FB 3BP7A 3U7AA 1A6TA 4JN2A 1IAMA 4ISVA 1OW0C 3O9WA 2UUDK 4OZFH 4RZCB 1IGJA 1A0QL 2PF6A 1SEBA 3KXFE 2NY3C 3H7BA 3U1SL 2BOCB 3QCUH 1FYTB 3UO1H 5FGRA 1Q94B 1JNNL 4HC1A 1VA9A 2ERJC 1S7SB 1MIMH 2D03L 4XVJH 1R3HB 4Y88A 2Y6SC 2H9GB 3O2VH 4P2RD 3FKUS 1RZJL 2BNUB 1K85A 3ELAT 3ULUC 2D3VA 2X4PB 4MWFB 3K4ZA 4ETQA 1YEKH 4MLSA 1V7NH 2XG4A 3MLUH 3C9NB 4KY1L 1RUKL 2HH0H 1ZLWK 4WEUD 3QO0A 4GXVL 1NCWH 2BC4A 5EU4A 2X70A 5CJQL 1U8KB 4I18B 5HHOE 3BEWB 4OQTA 4NZJA 4PB9L 5HHME 3PGDA 3SDYL 1KJVB 4X4XA 3S34H 2V9QA 5IESH 3H6JA 4MXVE 1OL0A 1PX3A 1RZGB 1XF4A 2QJDA 1H3XA 2YSSB 4JO2L 5GGSA 4XPTL 5IVXE 3PJSB 3F7QA 2BVTA 3C6LA 4OLVL 4YBLC 2Y5EA 4AQOA 4DVRL 1M6OB 3VD7A 3DX7A 5KN5A 1XGYH 5HHQA 2XKSA 4LVNC 3VFVA 1MCEA 3O4LD 4HX1A 4Q97A 2A6IB 1E4KC 4Y5YC 5B8CC 3QIWD 4OQ1A 2Q76B 3ECBA 3ZYZA 3NFPA 1BIIA 2ZP0T 1CGYA 5DJCA 3BRFA 3OKLB 4XZUA 4Y1AD 5E4EB 1FG9C 4KAQH 3U0PB 3E3QE 4CU6A 5EIIB 4PTTA 5DLMH 3NGBC 4J8RA 3S37X 5JORB 3V0AC 5GRYA 3V4PL 4L29A 3MQIA 5C0DA 3MYJA 2GYSA 3CVHA 1TCRA 1XGTB 4QOKD 4NBXB 5CSZB 2PYFA 3R0NA 5C0BE 5JIIA 3BN9C 1RVFL 3EFDH 4EQ3A 4Z0XB 3RKDD 2DYPD 3IETA 1XR8B 3W9EB 3SE9H 5L2KE 1HXYA 2YD1A 4UDTB 4BQ6A 5HI3D 3BJLA 2ADIB 4LLDA 5DJAA 4JM2D 3W0WD 1FN4A 3IDNB 2IF7A 4N0FA 2UVFA 2FYYA 3FN0L 4EQ2A 2GCYA 1KN2L 4QRPE 4RRPA 2E9IA 4OCXH 4WDIA 3RBGA 1ZGLP 4UTBL 3QJFB 1BLNA 2VUOA 3C8KB 1CYGA 1CIUA 4X6CE 3PP4H 1CF8H 5D7SH 3ULVL 4HWBA 1K8IA 4WTZA 1H8SA 5EBGA 4UILL 2CD0A 3WN5B 5IQ7H 5JIKA 4HGWB 5DMGC 4NJ9L 5F70A 4QGTA 2X9WA 5TDPB 2V2XA 4R90H 3SGDI 1JZ6A 3P4OB 1NC2A 1DLFH 3IXAA 4KPHH 4WEMB 4LBEA 1NLDL 3IAPA 4MZ2A 4PJXA 1WAAE 1E27B 4U6XB 1XCTA 4JFZL 5CSGA 3RIAK 1QA9A 3HAEA 2FH8A 2K9UA 3A6CH 4L4TA 3KR3L 3BD3A 3P0YH 1MRCH 1J5OH 4ODBD 5AZEH 3CAFA 3SJVE 43C9B 3M1BA 2CJUL 5AUMB 1J0KA 2AV1A 4LOUD 4ODVH 4QXUH 3WJJA 1A4KA 2B1AH 3PDOB 1RIHL 2E9BA 2P7TB 3HC0B 2Y06L 1OP9A 4FHBD 3EJZC 4OTXL 4X7FC 4X98B 2XRAH 3ZZ1A 3NTCH 4F33A 5FYKE 1MF2L 2FO1A 2QSCL 1JNHB 3K2UH 5DI8A 4JB9L 3RWHB 2G75B 4KI5E 1MFCL 3QDJB 4LLUA 1BVLB 1LQSR 1R5WA 1JYVA 4XP4H 5IBUG 1RZIA 4CN6A 1YY8A 1AD9B 5CD3B 1T1YB 4HH9B 4LRNL 1K9TA 1N2RA 5C0AE 4YFLI 1Y6NR 3H3BC 5BV7B 3QUZA 4Q9CA 5E99H 4H0HB 3JV4B 2WIMA 5DJYB 1RZFH 1FIEA 3L6FA 4YC2C 4M6OH 1L9MA 1TNNA 3L7EA 4G43B 4HBCL 2YUWA 4KHXL 5IROA 2ESVE 4P5KB 2BZDA 3TN0D 2NY6D 1DTUA 4I5BB 1KT2A 4RMQA 1AO7E 2GK0B 4GKNB 3QDMA 5CP3H 4ZSOA 3QUXC 4F37K 5DFVD 4JGMA 1L7IL 2J8UF 4OLXL 5ENWB 1IGML 2FGZA 1G7HA 4YGAB 2BHZA 1GC1L 1CE6A 5F7FA 5E8DL 2W0PA 3X11B 3TO4B 5IV2B 5I1EL 3WV0A 2Z9TA 3FQXB 5IHUL 5EA0L 4MD4B 2BNRD 3C5ZC 1I7ZA 2AI0H 3STLA 5C9JB 1U8HA 1CD0A 2UZIL 3BD5A 5JOFA 3MCG1 4RCAA 5IEKB 4FXGB 1MFDH 3A0OA 5E6IC 1ES0B 4OD1H 3HRZA 3DVFA 4N1CA 2FBJH 1MLCA 1GPOL 2JB6A 5KS9B 4F15C 3VRIB 1JV5B 2VMFA 3U6RB 1QBBA 1OP5H 4LNRA 1FVDB 3RA7L 1URLA 1VESA 2MWCA 4BH8A 4Y16B 3ULUL 3L95B 4NSKB 4AQ1B 3L5XH 3EIFA 1TITA 1O7SA 4YFEA 2A1WL 2D0HA 3IDYB 2EDKA 1GVIA 5DD1L 4NQSA 3RTQB 1JZ7A 4JFEA 1QSED 2JJTA 3GSWA 5IBLD 1RY7B 1DDHB 4NUGL 4GAJL 1WZ1L 1D6VL 1E4XL 3T09A 4PJFF 4OAWB 4NKIH 4NIKB 5GRVK 4Q9QL 5T3XH 3ROOA 2DQTH 5BJTA 5D7LA 2ZUYA 3BZ4A 5T5NG 2VL5B 4R2GD 4G6KL 5T1LA 3DV4B 1BWWA 2CO7B 3KPMA 1CT8B 1KXTB 2BHUA 5IB1A 2ZG1A 3WUWB 3BQUD 4ONGH 2VSDA 5D1ZA 1WCBB 3G5ZB 1INDH 3UYRL 3FRUB 3WHXA 2ORBL 4ELKB 1F8TH 1HILA 4OM0L 2UWEF 2JCCA 4YDJB 5F7HA 1YEHH 3ALPA 5A2IH 3V6FB 3EOTL 5J4MA 2H26A 1BJMA 5BZWA 1BP3B 5TE4H 3BZEA 5A2JH 1UXSB 3ARYA 4IOFC 1FGVL 4NQCE 3F58H 3T65A 5IW3A 1ETZA 2WUCH 3O6LH 2J6EL 4DGVL 4LCWD 1JRHL 3DPBA 5HDQH 3C87A 4G80A 4ZPTA 3MA7B 4JRXE 5HGDA 1F6AB 3GKWH 4QRQA 3CZFB 3PHQB 1ACZA 5EBLB 1KB5B 2O5YL 4GUPA 5E1HB 1S7VB 2X4RA 3ARGB 1OQXA 5T3XD 4R97C 3VMOA 3VI4E 4PRAB 2V7NB 4M7ZB 4MDIB 2DLEA 1S7TA 4ZOCA 3BVNB 2FX8H 1NGYA 3MUGA 3IU3B 3MJGX 3RWJA 5ILTL 1WICA 5SWSE 3WE6B 4D9QD 4PY8I 1I3UA 4WEBH 2VNCA 4BZ2H 2MCG1 4DUWA 4KDTA 4YHKH 4K3DL 5EUOF 4WGVB 4ZS6C 3CNKA 1MJ7L 3WSQH 3QUML 4FQJH 5TDOA 5H35A 4PJCA 1QD0A 5ADPH 1C16B 1S8DB 4OT1H 5C0EA 2AJ3A 4Y19A 4GG6E 2VXSL 1ZT1B 3NBNA 4FFVD 3D5OF 2ZCKL 3HI6H 4QF1A 5GGUB 4HUUB 5F71A 4NC1C 4K3EL 1RUMH 3IDJB 5CEZD 2CQVA 1Q9OB 1ZLUH 2VUYA 2Q1EA 1Q38A 1CU4H 1FE8L 4LSQH 4B53A 3RWIA 3OSKA 2B7DT 3LEXA 2ADGB 5EOCL 3GJFA 3TT3L 4L3EE 5TH2B 2N1KA 5LG1A 3IJSB 3GI9L 1U9KA 2YUZA 3RWDB 2PKDA 1UA6H 4P3DA 1HKFA 1LEKA 1B6UA 1S7RA 2Y25A 3OKOA 3LZFL 1ZS8B 3HMWH 1ZA3B 1HIMH 1FFQA 2FJGB 3GMQA 4WFED 5JHDA 3PV6A 5C09E 3T0BA 3UDWA 2D7TH 1U3JA 3V8CA 1CLYL 1P1ZB 3H0TA 4CVZA 2B1HH 1QOKA 5SX4H 2DQDH 3S4SG 2PW1A 2EYSA 1J0JA 5DK2A 4Z76A 3GSNL 3ULVF 3T4YA 1KENL 5CMAA 1YECH 2W9LA 4FMFA 1FH5H 3UTSB 3DV6A 4FFZH 4H20L 1X5KA 1SBSH 2BNQA 3LQZA 4K07A 1G9NH 1IEAB 2DQGL 1SY6H 1BVKA 4HMDA 4LASL 4P46B 4PG9A 43CAB 4JY4B 2LFGA 1MY5A 2B5IC 4Y4FB 1EFXA 1FC1A 1G7IB 3WJJC 1H15B 3DGGB 5F3HA 3H42L 4C4KT 1FBIL 4ZFGL 2Q7NA 5JW4R 2EC9U 3X17A 4LLYA 3NCJL 4UQ3A 4EI5D 4OF7A 1U8OB 4JAMB 2DQUH 1X5GA 5DS8A 4TRPL 3U7WL 1JGUL 3GSQA 3D69B 2ZCLH 1UJTA 4M8QA 4HWEH 1X5HA 5HHNA 3GM8A 3QXUA 3SO3B 1ZWIA 1BMGA 4LLQA 2Q3AA 4HG4J 1IGFL 3OV6A 2QHRL 3VXRA 4J2XA 3ROLA 3QUZC 3PWJA 3UJTL 5F9JB 3GIZH 4OJFH 1OAQL 4DFHA 2W38A 3ZTJH 4P4RA 4WU7A 4QHUA 2O5ZH 1NANI 2IANA 3QDGB 1ZT4B 5GSRB 3G6JE 3P77B 4KI5F 5IROC 5C2BL 2AJZA 4UU9B 4TQEL 3PHOA 1NCDH 3CVIL 3WXVL 4K8RD 3NZ8B 5FOBA 3H9SB 2A74B 3ZT7A 3WS3B 3QXDB 2IFFH 2Y7QB 4WFGE 5GIRA 2P8MB 1P5VA 2P5WE 2RCSL 3PNWA 3THMH 4PY7A 5IFAL 2W92A 4I18C 1FSKB 4EKXA 2QQKL 3UTPD 4W68A 4P5MA 2PYEA 4ONHB 2AEQH 4S1RH 3EOAA 2ZNWA 1BJ1H 2NX5A 4TVPH 2HN7B 5HHPB 3LS4H 2BJMH 4V1DA 3HUJE 3RUGF 4XMKL 3RWEB 1AGEB 4P49A 5C7XH 3BH9A 1A2YA 4N0UA 4HW6A 4HIXL 3BW9B 2AXFA 3AS0A 1BFVL 3MRRB 1D5MB 1U41A 3DMMB 1JGLH 1EMTH 4GBXB 3GK8H 3UJJL 3BSZH 3VD9A 1S7UB 3OAYH 3TIDA 5FYJH 5D93B 4MA1B 4YHNB 5JXEC 1FHGA 1A7QL 5F6IB 2IPTL 1CR9L 4QXTA 3DO7A 3MLZH 1UZ8A 4XC1L 5FCSH 2J8OA 4GRLA 4G6AD 4U33A 1FZKA 3WLBA 4NCC1 3CLFL 2QL1A 3D1MC 5LGHL 5DQ9A 3M07A 3O2WL 4HHAB 4I0PA 1CXIA 2BCKA 2DJUA 5CINL 1G0DA 2JJTC 3MV8A 2BOBA 3VMNA 2OL3B 1IC5H 1IGIH 5DR5L 1V3MA 1UM6H 4OCYH 3ULUF 2EDEA 4PS4L 4UZGA 3EYUH 4JQVA 2EE6A 1WBZB 4M7JL 4PD4K 4XBEH 1I8MB 5I8EA 3B9KB 3KYKH 3QEQB 3AROA 4H1LH 1NDMA 2ZCHH 5IOPB 4ZUUA 2Q8BH 3TBWB 4WV1A 3P3YA 4EDXA 4U1LA 2FCBA 4HLZH 5D1ZC 4YIQA 3RX8A 4ZMAT 5KBNC 5F1IA 2XXCB 1CDYA 5DWUH 1WIOA 3QJHA 1I7TA 4Z5RB 3MV7A 4LKCB 1CBVH 3IDGB 4RMWA 4HKZB 3DOSA 1OP3H 4OGXH 4JHAL 1T5XB 4FQCL 4H88L 1W2KT 4JFOA 4HUWA 1F6FB 4PGBA 3G5YB 3QFJB 5GJSH 4OZIA 3G9AB 3MLWH 3BKJH 5A40E 3KS0H 4XAKE 4LP4A 4GW5B 3NCBB 2NLJB 1U8LB 3LIZL 2A9ML 5IJVB 2HFGL 3CFKA 2ZUVA 3MO1B 1MFAL 4R8WH 3QB7C 4KKCD 3TPKA 1HHGB 4P4KA 4QKXB 5LQBH 1MLBA 1H5BB 2F54B 2YOCA 1PKQA 3RWCB 5D96C 2YUXA 1FG2A 1NMAH 1AIFA 1U8MA 3A6BL 1MJ8H 4ZAKD 4E42B 4PRPA 3AREB 5I66B 3V5DA 5HGBA 4YAQB 4R7DB 1CFTA 4PRHA 2QADD 3JV6B 1LO3H 3DHJA 4KDVA 2VXQH 3WIFB 1OTTC 4KDTC 4ZNEA 3S5LA 3NFSH 3MLSL 3OF6A 1X5LA 4NP4H 5HYQA 4FP8H 2VLRD 2ITDA 1T0MA 2WP3O 1IAIH 4IMLB 4RAVA 3MRFA 5ETUB 1JBJA 3DX8B 4GRWB 4XNYH 1PBYA 3KPQA 1AXIB 4OF6A 2FNBA 4U1IA 5EB9A 3W39B 5IM7B 2JK5B 2NY2B 3UYOD 1QFWM 2GJ6B 1YPZB 2KL6A 3BN3B 1A7NH 4YBQC 1IARB 3X3FL 2Z31B 5HYJA 2AQ2A 3NACL 3G6AA 4PJXE 4IRSA 2H8PA 2ZSWA 4PRBA 4ONFH 3ZSSA 4YHMH 5D7JB 1N8ZB 5GGTH 2C3VB 2F53A 4GG6F 1CGTA 4HPYL 3GO1H 3WFDH 4F7EB 1WT5A 4LEXL 1VADA 3IDMB 3CXDL 1EEUA 3B8SA 4I9WD 4NO3B 1YMMB 4JFFD 3VXMA 4JLRB 1RZKH 1ONQB 1UCBL 3UDWC 3T2PA 4LFHG 2D31A 2C7UB 2FEDD 3SCMA 2OI9B 4G6FB 1VFAB 1K4DA 1U8QA 2A6KB 2F8XC 5IVZB 1A6VH 2V2WA 1KULA 5BXFA 1K8DB 5LXGL 3TO4C 1S9XB 2FZ3B 5IG7B 1D5IH 5TF1L 2ZZUT 1W0VA 3VXUB 4C55A 3U82B 4FXKA 5F7DB 3IYLW 4X6DF 5FB8B 5T1DH 1F2QA 1ZHKA 2DAVA 4FFYH 1KEML 4ODTH 1JJUA 1D6EB 4TUKL 3RNQA 4CMHC 3KPOA 4KH2A 3HS0A 4OFYD 3I6KB 2XN9B 2CIIA 1S7WB 3VD3A 1OAXL 5F7MC 5I8CA 2V17L 4JJHA 1LK2A 4KUCF 1B90A 3BPNB 3G04A 4M9OA 1AY1H 1JE6A 5D7IB 3IFLL 4MQXD 3BP6B 3BJ91 1KLGB 2ZUSA 1CVRA 2HLFD 3QDME 4ZSOE 1HKLH 2PN5A 4RGOH 1KIQA 3OAUH 4OZFB 1EEQA 4BQBA 3VFWB 4GO6B 1Z3GH 5JDSB 4POUB 4UQ2B 3S96A 3QQ4A 2R39A 2IBBA 1KCVH 4O9HL 3QULA 5JPMB 4Q74A 1NGPH 4LPTA 5CEYA 3W5NA 3W9DB 5I6XB 3MRPB 3VH8B 2VXTH 4ZXBA 5JIPA 1T20A 2OK0L 4MCZB 4HKJB 1EHLH 5C0CD 2VWEE 1IC4L 1MNUH 2BFVL 3RDTB 3RVXC 1NEZG 1CL7H 2BHYA 5EZIH 4KK6D 5KSAB 4C58B 3VFMA 2HT4D 4WRLA 3P73A 1NGZA 1SJHA 4OZGB 3HI5H 3QIWB 1WBXB 4O00A 3VFNB 3E6FA 2GAZA 2FX9H 4LARL 2Z93A 1JHKH 1SQ2N 3MJ7A 3VWJD 4U49A 4Z77A 3QXAA 4TSCH 2YD8A 5JR1L 4WTWA 2GK2A 2WNGA 3GJEB 3BI9X 4S1QH 1C08A 4LRIA 5DRZB 3G6JF 3CFIC 4YHZH 1I1AB 4JZOA 5EZLB 3BDYL 4G8GD 1UT9A 2BY3A 4PGJA 2C1PA 3FONB 4LSSH 3VA6A 1CZ8L 3FQWB 3DGCR 3TA3D 4UT6H 5IHZA 4S0SD 2RIKA 2F8OA 4ORGA 1ED3B 1QR4A 1F3JA 4F7MB 4UUJA 5DHXB 3O6FD 1ZHLB 1FORH 1W0YT 4GQ9L 1JTTA 1NCAH 5HVWA 3DETD 5IR1A 4D0DB 5D7LE 1G0XA 1NDGB 1T66D 3WHE0 3B6SB 1R3JB 3PF2A 1ZHBA 4QHMA 1ACYH 2P46B 4GRLC 2WWKO 4M7ZC 1F90H 4H25A 5T1MB 1XEDA 5ID0A 1XZ0B 2YZ8A 1IM3A 1HZHL 1UWGL 5EBWB 4I0PC 2X4UB 4FQLL 5A2FA 4KVCL 1GL4B 3L9RB 1YDPA 1J0ZA 3FAXA 2YC1A 4UIKL 2P5EB 1HCFX 4PJEE 1Q72H 3WFHB 2JCCE 3U30B 4BSJA 3S36H 3NH7H 2EEDA 4P99A 5HPMB 4JQVC 1A6ZB 4Z7UE 1OGAA 4TOYL 5CGMA 5I8KH 2YK1L 4LPWA 4NNXB 2PTTA 5C08D 1BFSA 1GZPB 2F19H 4XPAL 3LKNB 3ULSA 4NQEA 1HYSC 1OAYL 4GXUN 3CFEB 4LPXA 3QEUB 3NIDF 3LDBB 4XPHL 2LQRA 3TZVB 1T1XB 2W59A 3FT2A 4QRRB 1HXMA 1YNKL 3IS0X 5IB2A 4HK0A 1QSFD 3MRBB 3BZFB 4XMLH 1T4KB 3R06A 1FPTH 1YEIH 2ENSA 2APBA 2UYLB 3GI8H 3KPSA 3Q1SL 4U1SB 1I9JL 5JXAH 2GJJA 1DZBA 3MLTB 1PYWA 5I1IL 5B39G 3D25A 4KRPD 4ODSL 3RZCA 1HHJA 2X4SB 3HI1B 3FO1A 4Z7VF 1N4XL 5FO8B 5HXMA 2XA3A 4MAYB 1MIEH 1KTLB 1TNMA 3S88H 3IDUA 5IMLA 5JW3L 25C8L 4KV5F 1BAFH 2JJWA 1D5BA 5FA3A 3K3QA 4PJCE 2QR0B 1C5BL 1J7VR 1J9CT 3BOVA 3PWVA 4Y19E 5A16B 4X8JA 4BKLB 1RSFA 2VISA 3QXTA 2VDML 1JPTH 4JCMA 3FCTA 2WBJD 1L7TL 2QLVB 1W72B 3P4MA 1FNHA 4HS3B 4KROC 5AD0B 1QQDB 2I25N 1NGXB 2D9QB 4PGZA 5E1AA 3H3PH 3HZMA 4U6YA 4NZTH 3GM0A 4OBSA 4P2RA 2ARJB 5SV4A 5FF6B 2ZJSL 1NMBH 1XIWB 1CDJA 4MNQB 3TFKC 2XKUA 1DL7H 2H3NA 4NZRL 1AP2B 1AQDA 4ODWA 3MV11 1RHHA 4Y2DD 3NZHH 3TIEB 5FKAA 3D6GA 4NJAL 2NY6B 1MREH 1LO4H 4JREB 5JHDE 3FOMB 2Z91B 3PDGA 1RD6A 4R4FH 4X7EC 5I15H 4MSWA 1QLFA 2RAMA 4Z78B 1U8JA 3V0WL 5E7BA 4XH2B 2YD4A 3O3EA 4WFFD 3PIQB 2W91A 3SDAB 4XTRD 4IRSC 5DHYB 5E08H 3KLHD 3MRLA 2IC2A 3PUCA 4RISL 3O41B 4RQQB 5EBMA 4E9LA 2R0KH 1JZ8A 4BM7A 1KJ3L 1GSMA 1AXSB 1FGNH 2PXYD 4LLWA 1TZIB 8FABA 1DVFB 1WT5C 3LRSB 4OM1L 1I3RB 5LCVL 1P84J 3NAAH 3V4VL 5D6CB 4JZNB 3SCMC 3BRGC 3O4LA 1PGRB 4PJXF 2EIBA 4MJIB 1QLEL 3HE6D 2CSPA 3LKPB 1YEFL 2HKFH 2GITB 3UAJC 3MRNA 4CKVX 1MY7A 4JJ5B 2XZQH 3NN8A 5J6GB 4GS7B 1JFQH 4HUKB 4MNGB 4Y1AA 1NPUA 4U6VH 5ICYA 5I17A 5IF0B 5KVDL 4IMKA 1KBGH 4PJ5D 3MRHB 4K9EC 1CDIA 4P3CL 1LO0L 2J88H 3MRCB 3VXRE 5CBAA 4G6JH 3O3DB 1A3LL 2NW3B 2YS4A 3DMMC 1DANT 4QOKA 4XPFL 1MCWM 3HHRB 4HFUL 3BEVB 2IANE 2GJZA 4I4WB 3QG6A 2EDXA 5HDLA 3QH3B 1Q9WA 1NAMH 4UTAH 3UBXG 3C6SA 5D93C 4JDZB 2YRPA 2N56A 1U93B 2DYPA 4OFPA 4PJAE 2VZTA 1MHPH 2HRPH 3VFRB 3HFMH 2BRQA 2KZ1B 3SKNA 4JM2A 4U1MA 1EZVX 3W0WA 5DO2C 4PV8B 4ZTOH 4ZFZA 2VLJD 5D9SB 3TBVA 1XGPA 3VG9B 2PYEE 3EYOB 4M3KB 4UT7L 4LIQH 5JO5B 5ACZB 2NX5E 4NDMB 1FVCA 5EN2A 4ZXBC 4V1DE 1A0QH 5DZLA 2GSIB 1B0GA 4X83A 5DT1H 2P8LA 1ITBB 1BD2E 5TE6L 3LSOA 2XQYG 4N0UE 4HCRL 2RQ8A 2AS5M 1T0NB 4ZUTB 1JNNH 5C0GB 3ZMRA 2EDYA 4KC3B 5GS0D 4X80L 4Y4HD 1AXTL 1QFUL 1KB5L 5JPNA 4XXDB 3SOBL 4FMKA 4LRIC 3CSGA 2Z35A 3RGVD 3D9AL 1X7QA 4D0CA 1I1YB 2I27N 4HDIB 4R7NB 7FABL 4NKMA 1H8NA 4UAOB 2NMSA 4NPYB 1IQWH 1D5ZA 4JM4L 4MLIA 1SVZA 1RUPL 2CKBB 2R2EB 3PG2A 3TBYA 4S2SA 5J9PA 5F3BB 2WINB 4NUJB 1NBZA 4I48B 1X5FA 4WI9A 3QUKB 2VKXA 3FL7A 4FQ1H 4ZYKA 2H2SD 3KXFD 4WCYH 1R5IA 3LS5L 5FYLL 2YEZB 4KK5C 5EC1A 3AREC 1T5WA 5HY9A 2HLAB 2FSEA 2HAZA 1Z2KA 1MCPH 5GRUH 2EDNA 4U0RB 4Y4KD 1RJZB 2P4AB 3F12A 4DKFH 3MV7E 1HSAB 3L3GB 4EEEA 2EE3A 1D7FA 1AR1D 4IIQA 4LF3B 4JG1L 5GRZA 4HEPG 3U46A 4PJHE 1PKOA 5F88B 2AJVL 2ZPKH 5J1AA 1BF8A 5E5UB 2R56L 4GW1A 3PXHA 3SKJL 1GHFL 2YA2A 2E5EA 2XKNA 1REIA 4N9GB 4ELME 4HIEB 2B4CL 4S10A 4WHTB 4EOWH 1YEDB 2JIXB 3HC3L 4F3FA 5HHVL 5EFIB 5HHOD 2BNRA 4PGDB 4FQHA 4UT9L 1PKQE 1KJ2B 5D7JC 3FRPA 1XR9A 1NC4B 3SDXE 2C5DC 1DBKL 4PRPE 5FDWB 3FQTA 3B9DA 3AAZA 4PRHE 1EEYB 3BP5B 3JV0A 3HMXH 1G9EA 2RB8A 2AEPL 2ATPB 3B5TA 4ZNEE 5JNYA 4P5TD 2H41A 3MREB 3TNNA 1A14H 4PLJD 5IMOA 2HG5B 1F6LL 2AJYH 4ZO7A 1INEH 1QFWI 3AMKA 2G2RA 1NCBL 2FL5B 2YD7A 3QI9B 4DN4L 5CP3A 1S7XB 4QRSB 1QSEA 1F3DJ 3HNTH 4X99A 1Y6MR 5HYJE 2NQCA 2QQNL 5IMKA 4EDWL 5MEPA 2FLRT 1V05A 2WMPA 4OBRA 4PJCF 5MHSD 2OX5A 5H2BA 3HB3D 4JR9L 1NLDH 4KGLA 2XZAH 4M7LH 1YJDH 4JE4B 3OGOE 3T77A 2BY0A 2R2BA 3KLAB 2Z92A 1NUDA 3BPNC 3BX7C 1PEWA 1E6OL 1CD8A 1B4JH 5ANMA 5SWZD 3VXME 4RGNE 1KGCE 2Q20A 2X4TA 3BQUA 3SE8H 3MLXH 1BREA 2CJUH 4OF0A 4U1GC 3BUTA 4P2QE 4U1HA 4RBPK 4H8WH 2PW2B 4G9FB 4O2FA 4TVSa 4I77H 3DSNA 4HBQA 2I07B 5H8DA 1RIHH 2A77L 5DMIL 5IB4B 3QNZA 4QRPD 3HPLB 1TXKA 5DGQA 4NRZA 5D4QA 3V6ZA 4OTXH 3MZTA 5F6HI 1TTGA 1QEWB 2QSCH 1DBML 3I50L 2RBLA 3L5WA 2JB5H 4LCWA 4PJDE 5FYKH 3UZQA 2W60B 3TH4T 4OUOA 1IKFH 5F89A 4ZFFB 2HKHL 1CFNB 4K9EL 5KSAC 1GGIL 5DJZB 3QRGL 3QIWC 4KRNA 3VW3L 4PYGA 2ICCA 3C8HA 1J05B 3OPZH 4DGYL 1U8NB 3RWFB 1UJ3A 2IAMB 4LSVL 3FTGB 3PABB 1IGCL 4HBCH 4LHUB 2FHFA 4KHXH 4XX1E 4EUPH 3MV9E 3IGAA 4IMKC 4ZDHB 5GISH 1G7MB 2NY1D 3FO9A 3BH8A 2CR3A 1B0RB 1KPUA 4OLXH 1Q0XL 1AGDA 3U7YL 4PBVC 3RX7A 1GC1H 2OL3L 2WLZA 1XF5B 2P24B 1JWUB 4Q9BA 2JTDA 5I1EH 5IHUH 4WUKL 5FECA 1I7UA 1OPGH 4J3WA 4NN5C 4OLZH 4KMTL 5DD6A 4YHPA 3RKDC 2MNUA 4C56B 4N0CD 1FL3B 3HE7B 2UZIH 5DRWB 5HI3C 2YPKA 4GJTB 3JTSA 4O5LH 1DLHA 1A7RL 4HXAL 2ICWI 5AYUL 2PR4H 1K6QH 1HWGB 4NT6A 1OOAA 1AKJA 1FCCA 4G9DA 3WDHA 5FOJA 3QHZL 5C0AD 3U30C 5EOCJ 3EJJX 2MQ0A 4U7SA 4AEEA 3L1OH 2CK0H 2PO6D 2XA8L 1CXHA 1UKTA 5I1GL 4POZD 3MOAL 3MRDB 5L2JA 2X40A 1JPGA 3UJIL 5GZND 5EO0A 2NY0D 3PP3H 4RX4A 2ESVD 4F58H 2JE8A 4UOW1 4JEGB 4XNZC 3MJ9H 2CRIA 5DTFA 5E2VH 3CFBB 4HH8A 4JANB 1VDGA 1WZ1H 2CDGB 2AJXH 4K94H 1D6VH 5F21B 3DI3B 2I9LA 5A3ID 4F7CB 4D9RE 4U3XA 4H1LB 4KK9D 5DA4A 1WZLA 4G5ZH 4XNQB 4NM8H 1LEGA 1WCQA 4MA8L 3BHBB 4JQIH 1RFDL 3P9WB 4G6KH 3O0RL 5EZOL 3SDCD 4JY5H 1CFVL 4LOUC 2EE2A 2HTLC 3STBA 1MPAL 5E2TH 1DQQA 1Z5LA 5IFJA 4CMMA 3QIUB 5E24E 4HKBA 2HJKA 1KIUA 3O8XD 1OGAE 4OM0H 5DMYA 5C0IA 1OD7A 4EI5A 1GGCL 4CU8A 3HCVA 4NQEE 1MH5B 3GHEL 3RU8H 1ND0B 2J6EH 3ETBF 4DGVH 2EEBA 2PCPA 3PWPD 1JTOA 4XMPH 4J3TA 1AGCB 1IC7L 4IHOB 3JTTB 2R9HD 4YE4L 5J12B 4OGYL 4S0TD 3DX6A 4NWTL 3KPSE 2F5BL 3U36A 4RMSA 5KJRH 1HSBA 3NABH 4AEHH 1G7LB 1GIGH 5F8RC 4LSTL 3UTZB 5BRZB 1UEMA 3TN0C 2CR6A 2IALB 2NY6C 4JREC 2X09A 3VWKD 5AG9A 5DFVC 4FTVD 3P9MB 4ODUA 4G8EB 1T04A 4OCWH 4I3SL 3OJDA 4WW2A 3N1FC 2DF3A 5ITBL 3O6KL 4R96B 5EOTB 1MJ7H 4WI2A 4Z7WA 4GKZB 2VB5A 5L8LB 3QUMH 1QNZL 5SWQB 2OZ4H 5GZOD 1U6AL 4LAQH 4OZIF 2VXSH 1P2CA 3K8LA 2R15A 2NXZB 1PLGL 3BP4B 5IT2L 1OP5K 5D8JH 3OXSA 1JWMA 2A6DB 2W0LA 2VXVH 3T3PE 4P2RE 1Y18A 1IAOB 3MRQA 2O93L 4JG0H 4PREB 2AXGB 4KJPD 2CIKB 2GT9B 1EXUB 1SJVA 4MB5A 5FYJU 3MROA 3T0ED 2Q8AL 1EAJA 4OKVB 1GZQB 2IH1B 2R2HB 5IEHA 2P42B 3TBSA 4ZS7H 3EHBD 3KJ6H 5GGVL 3U9PL 2MQCA 2HT2D 1MI5E 5EUKA 5C8JB 3BUYA 3LZFH 3IFNL 5IBLC 2G5RA 4NQXB 4P23D 1I3GH 1U3HD 4XP9L 4AL8H 1DUYB 3ZKXC 1CLYH 3FN9A 1NJ9A 4NGHL 3OXRA 5SWSD 3X14B 5C6TL 2WK2A 3BPLC 3DRTB 5HGHB 7CGTA 5DMKA 3T2NL 5JQHC 4AENB 1M05A 3QCUL 3S35H 2F9BT 2XTJE 5BS0D 5DYOA 4K3GA 5HVFB 4ODHH 3KYOB 4LHJB 3OKNA 4XP1H 3BQUC 4WWKD 1C5CL 4L8SB 4LASH 4XVJL 3O4OB 2AABL 2GSGB 3O4LE 3QNXB 3VWJB 3WIIH 3O2VL 2VLKA 4DUVA 2EDQA 3H42H 4ZFGH 3SGDH 4QXWA 5ESVB 4Y1AE 3MLUL 2ATKB 3MUY1 3JWDC 1WGOA 2HH0L 3NCJH 3OHXA 3VFOB 4JVPA 3REVA 3SEPA 1NCWL 3TA3B 4TRPH 3VXOB 4BSWB 2LU3A 4URTB 5SV3A 3QXWA 3RNKA 5I1LA 4YHYC 4EIZC 2NY4D 5DSCA 2ADJA 4QOKE 3OKDB 1CFSA 5DUBA 4ZOEA 4FN0A 3TO2B 1V8HA 5D70L 3UJTH 4YPGA 3S34L 1OAQH 5FA4A 2M1KA 1UJ3C 4RFEB 3RWGB 5IESL 5EBLA 1J11A 1C7TA 5EO1B 4FNLH 4ZAKA 1NLBL 2FATH 3QUYD 3HKFA 4TQEH 3W0WE 1VFBB 3RI5F 3CVIH 3WXVH 3FOLA 2GTZA 3SHSA 1VGEH 3BO8B 3D0VA 1FFNB 1M7XA 4MJ5B 5E0QA 3VXSD 3K81A 4Y5VB 4KTDH 4PJIA 2VLRA 3MLPA 3D0LA 2EDDA 4ZUVA 1B88A 5IFAH 5DRNA 1NFKA 1OAKH 1BQSA 4FFVC 4S1DD 3ALWA 5LKNA 1KACB 1W0WB 1W8NA 5EU6B 1X5JA 5IB5A 3O6MH 4KAQL 4QTIL 3S7GA 2I9TB 3DYMA 5DLML 3HAEG 4HIXH 2FR4A 2D2OA 4HC1H 1BFVH 5JA9A 4HJJL 1DN2A 2X4OB 1CGUA 3IFPB 4XNMB 5D2LA 4U0RC 3I9GH 4U2ZA 3SKUD 5KVFL 1U2CA 4AT6A 4L4VD 3EYVA 3MNVB 3ARDB 4RFOL 3GMRB 3DROA 4XC1H 4JFFA 1TVBB 1INQB 3CLFH 3VCLB 5JW5A 1A6PA 2XWJA 5GRVL 1AGBB 5B21A 5CINH 4ORZC 3M17A 3ZDZF 1HHHB 4NKOA 4Q7DA 2X5PA 4WFGD 4NM4L 5I75C 2K3TA 1XGUA 4H0IA 1TQBB 2P5WD 1WISA 3PP4L 3LN4B 1CF8L 3T0DA 4JHWH 4BFIB 3GIVB 4OQTH 3WNKA 1U8PB 4JFDB 4PV9A 4LLMB 3LRHA 4DCQB 5DJ6A 5EC2B 1TQCC 1YEGH 3IDIB 4DZBB 3D18B 1FQ9C 3ARWA 4R90L 3DBXB 4TNVK 1II4E 4XXCA 1DLFL 1GGBH 5AWNH 2DQHL 5DC0A 2BSED 4I0CC 4JZJA 4EJ1C 1MCSA 1X4XA 3V6OA 5GGTA 2YPLD 3ET9F 5C0FA 1LO2L 1UH3A 4O2EB 4OD2B 3D2UD 1IQDA 4EI5C 3IAQA 3A6CL 4JHAH 3ARBB 1T22B 4F2MA 3P0YL 3QHTC 4FQCH 4IOIB 4MD0A 2W0KA 2WANA 1Q9LB 5AZEL 3DUHA 3B83A 4CN4A 5DJ8A 1OM3L 4ODVL 4QXUL 2JLLA 1F4AA 3FB6B 3EGSB 2B1AL 1PW3A 4MJ6B 3VXNB 4Q6YA 1I8IB 1JPFA 2A9MH 1P4IL 4LSPL 3EZ8A 5SX5K 3QEGH 1MHCB 1V5JA 3NTCL 1MFAH 1JWSB 4PTUB 1Z9SA 1D9KD 5C0CA 4GRWF 3CVHH 5IMMA 5D2NB 5EU3B 1A9EA 3S36X 4MCYA 4XP4L 2J4WL 4ZD3L 3KYNA 4M02A 4FQXD 2OQJB 4P2OA 2W0FB 3TNMA 2DTMH 5KTEH 3R1GH 2EKJA 3GDBA 4WW2C 4ZUWB 3LD8B 3T8XA 2EEAA 1RZFL 4M6OL 1NFDA 4OV5A 1AE6L 3MTRA 3MXWH 4K3HA 5FK9A 4BUHA 2OMNA 4G8GA 4Q2ZA 3TCLA 1QSEE 4L3CA 4HWBH 1TMCB 2YXMA 4E41A 3BRDA 1UB6A 3OR7B 3R4DA 3U4EA 1D5XA 4HUVA 2XPGB 5DK0B 5FUZH 2BVOA 4XAKD 1X5IA 3O6FA 1ZE3C 5HYFA 3HZKB 2W9DL 32C2B 1A7PH 4JKLA 4DFIA 4Z7OE 2Q7YA 1ZHNB 3DLQR 3QCTL 3BIKB 4FXLA 3PWUB 4L1HA 2AI0L 4G6AC 2DWEB 4HQQH 5J8OA 3H9ZA 4H26A 1WBYA 4HKXA 4HPYH 5CJOH 1MFDL 3NCYS 1T0PB 4P0DA 1LD9A 4ZPVB 1UCBH 4OD3H 1FRGL 4J6RH 2J8UB 3NFNA 4C83B 2I5YH 4M93C 3C2AH 3FFCD 5DDHA 4TTDD 5CCKH 5C08A 4EN3D 5DJ2B 5FM8A 1RZ8B 4DTGH 1VKXA 4MQTB 4LCUA 5I2IA 2E7MA 4X5XB 4D0BB 3PL6D 4LCWE 1B4RA 1NBQA 3JWDL 3LPGA 4N90D 4HV8A 3RIAF 2AQ1A 3I6GB 1N59A 1VPOL 1TJHH 1VGKB 2BXZA 4WHYG 4NQDB 1BOGA 1OARH 4MHHI 5HYSB 4TUKH 1IC1A 1NAMB 1QSFA 3L3IB 4WUUB 3WLWD 4K7PH 3QEHB 3KYAA 2APVA 5GS1A 1DE4B 2HMID 5T3XL 5KSBF 2DQTL 2V17H 3O45A 1FNLA 4NNPL 1P9MA 4HJ0C 3MCLH 3WMSA 4A6YA 2DOCA 5GPRA 2V2TB 3PWNA 3F7YB 1R3LA 4D9QE 4HG4K 5I73B 3ARRA 1A7OH 2Q6WB 3FB5A 5INCB 5KZCD 3GMMB 4X4YA 2YKLH 5BO1L 5FFLA 3W11D 1QVOB 2UZYB 4JRYA 3T0XA 1YN6B 4ONGL 1INDL 1I4FB 3ZDYF 5HVGB 1F8TL 4QRTA 1I1CA 3OJMB 1ZEAL 3HG1D 4HFWA 5TE4L 5B39B 4PJ8D 1OB1B 2DBLH 3F58L 4M00A 4PJBA 3WS6A 3VXQA 1OD9A 3C5SB 1FO0A 3KXFB 5IK3B 2WBJA 1KXQE 2OK0H 4ZAKC 1KCUH 2WUCL 3O6LL 4QCIA 2CO6B 5CEZE 3IT8D 1YZZA 1IC4H 2LTQB 5KSVA 3CPLB 5HDQL 3UTQB 2WBKA 5CEZL 3GKWL 4HUXB 1MJJB 1HQ4A 3B3IB 5I16B 5DRXA 3VFPB 4XHQA 3FAWA 1UXWB 3QIUC 1IFHH 4K3JH 2VZ3A 4UDUA 4Y2DA 3QQ3B 3R0MA 1PQZA 3LEYL 3U9UB 1QO3A 4WFEE 4FABL 1BFTA 2VITB 2FX8L 2VSCA 1JVKA 4QRUA 2X4NB 2F15A 3KPRD 4NQVB 4MD5A 4WEBL 3MGOA 4YHKL 4AEIL 5DC4B 2FEEI 3QQNA 1IKNC 3WSQL 4FQJL 4N1EA 2OXHA 1SM3L 2YD5A 1M71B 4J3SA 4OT1L 1YC7A 5HHMB 4I8DA 1ZLSH 1F4YH 3V5HA 1XGQA 2PXYA 3CDGB 1T7WA 1QLRA 5IQ9A 3HI6L 4O51A 3X3GH 1BFOA 4WO4B 3KDMB 5DUPH 4M61B 4OLUL 4HWZA 1RUML 1UWGH 3BPCA 2FEDC 1D3CA 5LGJB 5IVXB 1ZT7A 1CU4L 15C8H 3MLVH 3QNYA 2O61A 1S5IH 5KVEL 4ZUSB 3HE6A 1XCQB 2M2DA 4UIKH 4ACPA 4PBWD 3QZWB 1MELA 4BJLA 2Y23A 3L3HB 4M62L 5BOPA 3KHQA 3MCKA 5GGVY 5IW6A 4CW1B 2HFEB 3HMWL 3MV01 1HIML 5HGAA 3KPPB 3UPRB 4PJ5A 4LNVA 5B38B 2D7TL 2WZPD 3LN5B 1J1OH 1WEJH 4HPOH 3VI3E 2CKNA 4XXCC 2AVGA 4FRWA 4LFHD 3GSXB 1JHLL 4XPHH 4YO0B 4JZJC 5ESAB 4Y5XA 5E9DD 1CGSL 3WUWG 2AK4D 5FO9B 2NZ9D 1CS6A 1FH5L 4FFZL 2VLLA 1HH9A 4MQXC 5C0BB 1RZKC 1GOHA 4G8IB 5IKCA 3QWOA 5EU5B 1SY6L 2HLFC 3INUH 5MEOB 3QQ9D 3TYFA 2ZWLT 5L2KB 2VLJA 1FZOB 2V9TA 5GS2D 3UTPE 5C9KA 3MJ8A 1I75A 5JW3H 1Y0LA 2CLZB 3DTXB 4QRPB 1OAUL 1Y6KR 1R5VA 2VC2H 1KC5H 1BZ7B 1LEIB 4LQFL 1SYSB 3ILQC 5E8EB 4M48H 3FN3A 3RL2A 4OCLC 4PP2B 1TVHB 5ITFA 4X6CB 1IAKA 2HJFB 3EJYD 2DQUL 2CH8A 4NO0D 3EFFA 3CCHA 2ZCLL 2VDMH 4HWEL 2GFBB 4KK6C 4OB5L 4UBDD 4DOHE 5E8NA 4CJ1A 1CD9B 4JO1H 5D72H 3VWJC 1KLFA 2EO1A 3GIZL 4OJFL 2ZJSH 4Y4HA 2DQEL 3ORJA 3O3UN 5KS9E 1BQHB 2CLVA 2O5ZL 2GKIA 4NZRH 1BZQK 1YY9D 1MRDL 4YHIB 3AB0C 3EO1B 3GJFH 4X6FA 3RGVA 2LABA 5F7EH 1CICA 3GMPA 3OAZH 3VGEA 2E7HA 1NCDL 1QFHA 4PBXA 1N5AA 2YN3A 2LU4A 4RMTA 3TA3C 4LCCB 2CUIA 3SJVB 3MLYH 4U1JA 1PAMA 2D7QA 2C3GA 5E00B 1E4WL 3K8MA 4WJ5B 3THML 1G7PB 1BBJA 1AGFA 3TM6A 3O6FC 1U8IA 1N3NA 1S78C 3DETC 3PQYB 2SEBA 1T66C 3BAEH 3MBEB 4N8VA 1ED3A 1KPVB 4QHKJ 3X13B 3FO0H 2BJML 4NO5A 1OSZA 3FHQA 3MRMB 5I76B 2OTWB 2XZCL 5C7XL 1P4LB 2NW2A 5GSVA 4XWGL 5BQ7B 2FGWH 2I26N 3G5XB 3T2QA 1LWRA 5AZ2H 3OX8A 1FFPB 1NCNA 2VLKE 4Y4KA 3V4VH 5E8OA 4ETYA 5CJ5A 3ZKND 1EMTL 5MEQB 4M6AA 3GK8L 3TYGH 3BSZL 2R0ZH 1CIDA 3QIBB 4JKWA 2PO6B 1ERNA 4IRJB 1NBYA 5DZNA 2RFXB 4CAGA 1KNOA 1EH9A 1YEFH 5EH1A 3LKOA 3QAZC 5ICXA 3MLZL 1BM3L 1KJMA 4EUPB 3DUSA 1XT5A 1MVUB 3ZT5A 1SJXA 4EIGB 5K59E 3LV3B 2X4QA 5DURD 4CVXB 5CGTA 4OLWH 1AO7B 3N50A 1QR1A 1N0XL 3G5VA 2YBRB 5TDNA 1IC5L 1IGIL 3GUTB 1NAKH 1G7JB 4QHLB 1PG7L 1UM6L 4DN3L 3SGEH 5HHOA 1A3LH 3EYUL 4AG4H 4XPFH 3DVNB 4DZ8A 4WI8A 5GS1C 1QSVA 1VEMA 2EDTA 4XBEL 3S5LG 4F7TA 4U6TA 2NY3B 2HT3D 4OFDA 1P9MC 3KYKL 2YPVH 3MMEA 3ARDC 4KRPC 4QO1A 3CZJA 2ERJB 5BVJA 1CLCA 5T1KB 3QISA 4YNYA 4P5TA 4PJIE 5DQDH 3VRJB 1KXVC 1IZJA 4GAYA 2ED9A 1ZSDB 3Q0HA 5DVOA 3REWA 4JFYB 4OGXL 2VDPH 4D94A 1TQBC 4B0MM 5D1XD 1JN6B 3WS6C 3DUUB 4PJ9D 2WBJC 1UQSA 4RGMC 5DQJA 3D85D 2R1XB 5CEXB 1F45A 2OM5A 2RR3A 5F44A 3OR6B 3IRPX 3TJEL 5JOPD 3B2VH 3O11B 5CHNA 5D2LE 2J3SA 1ZVSB 3EW3B 1MCNA 4X6EA 1EZVY 3IKCA 1FAIL 4Y2DC 5E94A 5LQBL 1N6QL 3TVMD 3P4LA 2AERT 1AXTH 1NMAL 4NRXA 4I9WE 1QFUH 4JFFE 2HVKA 5SWZA 3SDDA 1FZMB 5H94A 1KEGH 1A9BB 1EJOH 2BERA 1FNGA 3D9AH 2AJSH 5ISZD 4H5SB 1F58L 1YYLL 1LE9B 3NFSL 2HFTA 4XTRC 3KLHC 5LAXB 3CXHJ 4L8CB 3FT3A 3Q2CA 4JM4H 4Y5YB 1IAIL 5B8CB 4BELD 1QRNB 3PIQA 3AU1A 3OGCA 2PYED 2PXYC 4XNYL 4NQCB 1XF3B 3NCYP 5I1AA 3MX0A 2EC8A 5D2NC 3LKQB 4LSRH 5M7QA 3PWLB 5FV2A 2GUOB 1A7NL 3NGBB 3T08A 1BD2D 5FYLH 4D8PB 1A5FH 1NL0H 3GSUA 4JRXB 3V6OE 5ESQA 2NR6D 3HZVB 2VAAA 3HE6C 4DKEH 2HFFB 4R0LA 3LD8C 1TCMA 4ONFL 5GGTL 2XFXB 3CH1A 4JG1H 1WAAA 4KJWD 4HS6B 2EIZA 2XI9A 3DYOA 3DXAD 1AHWB 3GO1L 3F7VB 2AKRA 4ODXA 1RJYA 1N7MH 3AVEA 2EKSB 1RZKL 2GY5A 3SKOB 3VD4A 1R6VA 2AAVA 2R56H 1JI2A 1C5DA 1X44A 1GHFH 4JDVA 3S6CA 3CLEL 5DEZA 1J10A 3KJ4C 3QUMB 5C0JB 1KTRL 4XBPB 1LO5B 2WAHA 2Q86B 1A6VL 4Y5XC 4HGMA 3AXLB 1FV1B 1ZGLB 5HHVH 5C0CE 1A1MA 2A73B 3B9VA 4GG6B 5GGRB 5T1DL 3I02A 5K9QG 1DBKH 1WJ3A 4ODTL 2GW5A 3O3AA 3SKMB 1UB5A 3VI3F 3B5HA 2VAJA 4GRMA 1MSPA 3GSRB 2AEPH 2KBGA 4PGEA 2IH3A 3OKKB 4XCFL 5C0AA 1NFDE 1PY9A 1RURH 1P7KB 4L8BA 4L3EB 4LGSB 5CWSB 4FQQB 4G8GE 4KJYB 1AY1L 1CLZL 3F5WB 4E41E 2ESVA 4FOMA 3ULVD 4X6DB 3SPVA 5C09B 4RGOL 1Z9OA 3LH2H 4WW2F 1K4CA 3OAUL 3TESA 1Z3GL 1YN7A 5GS0C 1T3FA 2WIIB 3VE0A 5K9KA 5H37H 4Z7WF 5DJXB 4Y4HC 1BWMA 3EDKA 2Q3ZA 5JLZA 2FLBT 3U48A 2X7LB 1A6UH 2YRZA 3RGVC 3GB7B 1FJ1B 2XTLA 3SDCA 1I7RA 4JPWH 4OCNC 2K1MA 1Q0YL 5EZIL 3IFOA 4QY8B 5DJDB 5JW4M 3HI5L 1CK0H 3O8XA 1WWBX 4CRPA 1JHKL 3U0TB 4MZ3A 2DJSA 4YC2B 2VQ1A 3OF6D 1EUTA 5C08E 1RULL 1EDQA 1JGEB 2ZOKB 4S1QL 2A77H 1P84K 5DMIH 5K9OA 1MFEH 2H2SC 3NIGE 3I50H 2DMBA 3PWPA 4LSSL 4PRDA 3MGTA 3QEQE 1F42A 3KHOA 1S9VA 3QUXB 4UT6L 2XWTB 1V3KA 3RPIA 1QSFE 4Y4KC 4XCEA 4GXUM 3Q6FB 3VRLE 1HDMB 4K9EH 1ZTXL 1JHTA 1H0DB 2C1OA 3DYPA 2Y36L 3AM8A 3H7LA 2KZWA 4U1NB 1FL6B 4M1GL 3L3OA 5HD8D 3C5ZB 1ACYL 4PLOB 4DGYH 1KTDA 2R8SL 4LSVH 1F90L 3G6JB 3EOBB 3ZE1E 4N5UA 4IS6A 3VWKA 1YUHA 4JCLA 5E6IB 4Z8FH 4LPCA 2G9HA 4FTVA 3CSPA 1U0QA 2A83B 3GBNH 4NNYB 3ARFD 4JRYE 3Q3GB 4OCRH 1S7QB 5F9DC 4F15B 1A1NB 3DRQB 1Q72L 2DKSA 1KCSH 5B4MD 3BP7B 5TQ0L 1A6TB 3KAAA 4JN2B 1Q0XH 4ISVB 3O9WB 2YN5A 4P2QD 4XHJC 3C09C 1IGJB 5I8KL 2WUBH 4PJBE 1SEBB 5IW1A 1FL5A 3H7BB 1LP9A 4FQIH 1MWAA 2QTEA 5K59F 4W6WB 1GH7A 4ZFOA 4V2BA 1MAMH 4YH6A 2XQBH 4ZO8A 2NXYD 3GMOA 2IQAA 2J5LC 4P5TC 4LVHC 2R23A 2F5AL 4K2UH 4PLJC 2D4FA 1RK1A 1QRKA 3T0EA 3QHFH 3SE3A 2X05A 2ED8A 4YXKL 3V9FA 1FPTL 2OSLA 4ETQB 2Y6SD 4OZFG 2R1WA 1RK0A 4Z7NE 1RMFH 3EO0A 1VFOA 3RFZC 2WWMC 3FHAA 1EAPA 4WI7A 5JXAL 3MOAH 3P30H 3RL1A 1QPPA 1CXLA 3UJIH 3DNKA 3QO0B 3VH8G 1S3KH 2BC4B 4P23A 5EU4B 1U3HA 2X70B 4WFFE 1KPRA 1MIEL 4HUNB 1N5YH 3S88L 3E3QC 3FB7A 4PJIF 3TBTA 1A3RL 1NQBA 1FDLH 1J8HD 3MV9D 5SWSA 5IFHH 1BAFL 2GJ6E 3VJ6A 1UM4H 5CGYD 3WIHA 4PLKD 3HB3C 3PGDB 3BGMA 2MOVA 4X4XB 5EU7E 1E6JL 4JFHD 1EO5A 5BS0A 5D6DC 4E0RA 3MRKA 1JPTL 2GEEA 1IE5A 4I2XA 1XF4B 4HT1H 2IPKA 4WWKA 5GGSB 5EO9B 1G9MH 1NUNB 3H3PL 3C6LB 4Z7VB 3PGFH 4NZTL 1YMME 5CJBA 3D39D 3TH3T 3DX7B 1NMBL 5D2LF 5KN5B 3VFVB 1DL7L 4HX1B 4CNIA 1Z9LA 4FZ8L 1CDGA 1A6AA 3MRGA 2XWBA 3ECBB 3NFPB 1BIIB 3F65A 2E27H 1MREL 5DJCB 3CU7A 1MUJA 3L3DA 4PJ5E 4XZUB 4R4FL 3VXUE 5C0RL 5I15L 3GHEH 4R4BA 3CJJA 1ZK9A 2OCFD 2A9NH 2AJUL 4PTTB 4J8RB 1P7QD 3GMNA 1MCDA 2VDLH 1KIRA 1IC7H 2PUQT 3MLRH 4L29B 5D1QA 5C0DB 3MYJB 5E08L 3CVHB 1TCRB 1FCGA 4L8DA 3RY5A 5KG9A 4X9IA 2PYFB 4PB0L 4U0QB 1FGNL 3ZHKA 3QUYA 5FGCE 1NBVH 1X5AA 3IETB 2GTWA 3GKZA 3NAAL 4TNWK 4Y8AA 3HR5A 2AV7A 1HXYB 1TIUA 5E2UL 3VXSA 4LLDB 4NKDA 5DJAB 1FN4B 4G7VH 1UWXK 4N0FB 2FYYB 2GCYB 4I3SH 4APQD 4WDIB 1WIUA 5CZKA 2Y5TA 2HKFL 1U95A 3CH8A 1BLNB 3O6KH 2XZQL 3IB4A 1XF2A 1MQKL 3BWUC 3FMGH 1JFQL 2X1WL 4N0CC 4U1KA 1JYXA 1P7HL 3B8YA 4QWWD 4BZ1H 3CX5J 3ESUF 4KKAD 1NH6A 1VENA 1F00I 5IT2H 2V2XB 3FQRA 1NC2B 4Z0BH 1KIPA 4G6JL 1CG9A 2NNAA 3IXAB 3MPCA 4O2CA 3BT2H 2FWOA 4LBEB 5GS0L 1DQLH 5F72S 3EYSH 4PJXB 3MNWA 1NAML 2PO6C 4L4VA 4UTAL 1XCTB 4POZC 1QA9B 3HAEB 5GZNC 3ZYIA 2NY0C 3KPSD 3HPJA 2HRPL 4L4TB 1T6VN 4MA3A 3HFML 1BGXH 5FHAL 1CDBA 4CVWA 3M1BB 2X42A 1YMHA 2B5IB 2AV1B 4ZTOL 1O7VA 1A4KB 2NTFA 4L5FH 1T6WA 1CGXA 3MXVH 2P5WA 5A3IC 4GAGH 4NGHH 5C6TH 4KK9C 2APWA 3QO1A 3MC0A 4F33B 4TULL 4X7CC 2IBGA 4JFPA 5DI8B 5DT1L 3U4AA 3T2NH 3WO4B 2KDGA 4OF3A 4LLUB 1R5WB 3HUJA 1GGUA 2EH7H 4J1UA 5L0QC 1RZIB 1YY8B 4LSDA 4OI9A 1N2RB 3V79C 4QEGA 1C5CH 4X9HA 2AABH 2YPLA 3S4SA 3QUZB 1EBPA 3LPFA 3O8XC 3OQ3B 3L6FB 4NYLA 3D2UA 3LOWA 1F5WA 3OKMA 3L7EB 2D7NA 2R4RL 1TETH 3S98A 1KT2B 3QBTB 2FJHA 1C1EH 3QDMB 4ZSOB 1MI5D 1IQWL 4LDEB 2R1YA 2YA1A 1I8LA 3KLSA 1G7HB 2FD6L 3M8OH 4K94C 4U2YA 5F9WC 2GQHA 4Y8DC 1CE6B 2FJFA 4KRMB 4BUGA 2ZUUA 4PJGA 3AM8C 1HINH 4QRRE 1D9KA 3GZKA 5D70H 3H9HA 1FAKT 1PZUB 1I7ZB 3GMLA 3IJHA 4QGYA 1QFPA 3D3VD 3STLB 1U8HB 4F7PA 4FQ1L 4WCYL 5JOFB 1NLBH 4FQXA 4TUJA 4Z6AT 1P6AB 3KNBA 2WLYA 2XTJD 3HRZB 5CILH 3BXNA 1TPXB 1MLCB 3WXWL 1MCPL 5GRUL 2JB6B 3VRLF 3SO5A 2OS7A 1EEZA 4DKFL 1I3VA 3T3MF 2QSVA 1H3VA 4LNRB 5HI5D 1S5HA 2F8VA 2EDBA 2VE6A 4BH8B 4UI2A 1UZ6E 5T33H 2JKXA 3LCYA 2ZPKL 2OYPA 3CDYA 4MYWB 4NQSB 2CRYA 3H2WA 5F7KC 4QTIH 4JFEB 1GAFH 3GSWB 3FQUA 1R3KA 1X4ZA 5MHSE 4YWGH 4NN6C 4EOWL 3GRWA 1F4HA 4HJJH 3T0EC 5TQ2H 3SE3C 4R3SA 2MKLC 4WFHD 3ROOB 5BJTB 5D7LB 5KVFH 5SWZE 3BZ4B 5JMOC 3WNNA 1IVLA 2DWDA 2HT2C 1AHWC 1KLUA 2P45B 3O81A 4X6BA 5T1LB 1G0YR 4RFOH 4OSUL 3ZLQC 3HMXL 3KPMB 3WUZA 2BDNH 5BMFH 4P23C 5DA0B 5IB1B 1U3HC 1VFUA 3HTLX 5JMRA 2P8PA 4F9PA 1DEEA 1HHIA 4JHBA 4OGAD 5D1ZB 3ZKQD 4N8CH 5DF0A 1ODAA 3WHXB 2DDQH 1A14L 5DEGA 1HILB 3FFCA 2D4DA 2MPAH 2JCCB 2AJYL 3NPSC 4EN3A 1S9KC 4UINH 4NM4H 2H26B 2YWYA 5BZWB 1R0AH 1INEL 3VGHA 3OMZA 3BZEB 3PL6A 4K7FA 1LGVA 1B0WA 1G7QA 1NUGA 4MXWH 2GIYA 4LMQE 3T65B 4G42A 1K5NA 2E9JA 1ETZB 4P9ML 2DLGA 1HE7A 3MRIA 3HNTL 1WFUA 4G80B 4ZPTB 5HGDB 4QRQB 4YLQT 2DQHH 2H1PH 2Z8SA 5CBEA 1HNGA 4GUPB 3I6LD 5IJKA 2X4RB 2XZAL 2R69H 4M7LL 1YJDL 5KSUA 1HOCA 4CDHA 5D96B 2XNAA 1LO2H 2L0DA 3K0WA 5GXBB 1S7TB 3SQOH 1B4JL 1NGYB 4R9HA 2W07A 3MUGB 2DD8H 1F02I 1RJLA 1YNTA 4ZQKA 1N6VA 3RWJB 2ILLA 2DLHA 3SE8L 3MLXL 2NY4C 1YQ2A 4JPIA 1OM3H 4J12A 1ADQA 4WW1A 1U42A 1HI6A 2JJSA 4H8WL 3HG1A 3L3KA 4I77L 2K7PA 5IIEA 1PY4A 2C4FT 5TDOB 2VOTA 4PJ8A 5H35B 1BIHA 4PJCB 1DQJA 2ICEA 1P4IH 4LSPH 4P48A 3T4AA 5C0EB 2AJ3B 4KKNA 4Y19B 2VN7A 4ZS6D 4O02H 3QUYC 4NFBA 2VO5A 3GBMH 4QF1B 2JB5L 2DQJL 4AM0A 4TPRL 3LKSA 4QTHA 1IL1A 3IXTA 5FYKL 1IKFL 2VR9A 1KUMA 2J4WH 4ZD3H 1T03L 2EH8H 4W4OC 5F1NA 1QBLH 4XCYA 5E6YA 1HQRA 3RWIB 4Z7QF 3LEXB 3GJFB 4YBHA 3ZE2E 3OPZL 3E8UL 1AE6H 1NKOA 4S1DC 1EO8L 1KOAA 4P3DB 4HF5H 5DURB 5TF0A 1S7RB 2LAAA 3OKOB 3KPRA 1U58A 5JHDB 3GMQB 4NCDA 3PV6B 4Y7MA 5GISL 1O0VA 4LPVA 3H0TB 3STZA 4R4ND 4CVZB 4HUMB 2PW1B 2EYSB 4M1DL 5DK2B 4Z76B 3VGBA 2YHGA 3T4YB 2C4XA 2W9DH 1N64H 4UNVA 3DHMA 5CMAB 4NRYA 1OPGL 4OLZL 1CTNA 2EYTA 3QCTH 3DV6B 2BNQB 3LQZB 5CIPA 1OGTA 2IADA 1BVKB 4O5LL 4PG9B 1X6NA 1IM9D 4CMHB 3UTTD 1EFXB 2PR4L 1K6QL 3C60D 1FRGH 5F3HB 1NMCC 2H32A 2BMKA 3T1FA 3FFDA 3L1OL 2CK0L 5BZDA 3ZT6A 3O9WC 5E8PA 4LLYB 3V0VA 4UQ3B 2OTUA 4FFWD 5DS8B 2C26A 3GSQB 2ARJQ 3PWPE 2QBWA 3SY0A 3JWDH 4F58L 5CJ8A 4M8QB 5HHNB 3AMLA 5ALBH 1VPOH 4YXLL 1ZWIB 4M3JA 1UYWH 4LLQB 3SQBA 3MJ9L 1FYTD 3VXRB 4JGJA 5E2VL 5E9DA 3ROLB 5J57B 3PWJB 1E4JA 4AZ8A 2AK4A 2AJXL 4K94L 3EKCA 1WZKA 1A6WH 4P4RB 5IB3A 4WU7B 4QHUB 2IANB 1JGDA 4EI6A 3G08A 1X5YA 4JVUA 4G5ZL 4RMRA 4NM8L 2AJZB 2CDEA 1PDKA 4NNPH 2DLIA 3VG0H 3PHOB 4JQIL 5HPOA 4FTVE 3FQNA 2B39A 5FOBB 4JY5L 2I60L 1HHKA 4F9LA 4BH7A 2MHAA 5E2TL 1E28A 2F58L 1SYVA 5GIRB 5BO1H 4NHUA 1I8LC 2QKIA 1JPST 3PNWB 2IEPA 4PY7B 5JA8B 1A4JA 4PJEA 2Y9RT 2PYEB 4P5MB 1ZEAH 2EE9A 3EOAB 1D9KC 3L3JA 2J2ZA 3GGWA 4IBLT 2NX5B 3ZTJG 4Z7UA 4NO0A 1LP9E 1FYHB 4V1DB 5MENA 3VXPA 2GI7A 1X4YA 1WF5A 3BH9B 1A2YB 1ZVYA 4FQXC 1EHNA 1MWAL 1RPQA 4N0UB 3RU8L 4OIAA 4Q58C 4XMPL 5DD3H 3CGTA 2AXFB 4OCSL 3WJLA 1EERB 3LB6D 4MVBC 4LHUG 3C6LC 2IBZY 5CEZH 4M43L 5ID1A 2FO4A 3MNZA 3T0EE 1CTOA 5CLTA 1T2QH 3WFZA 3TIDB 2EECA 3I3BA 5KJRL 3NABL 4AEHL 2FIKA 1GIGL 4QXTB 3DO7B 1UZ8B 2UV3A 4WU5A 2G5BA 1P6FA 4GRLB 1C12A 2VZUA 3LEYH 1FZKB 4MDJA 4AJ0A 3WLBB 4MXVF 4FABH 5DQ9B 4LEOA 4I0PB 5JXED 1NEZA 4BYHA 2BCKB 3BYYA 5IVXF 4OCWL 3ARVA 3MV8B 2BOBB 3OL2A 5FM4A 4AEIH 3N85H 5CJXA 3OG4B 4ZNCD 4Q6IA 1OCWH 1UZ6F 1SM3H 3WIHL 5BS0E 2RHEA 4XGZA 1BJ1J 2OZ4L 4LAQL 5I8EB 4I2XE 4AMKL 4P2YA 1NDMB 5D8JL 2VXVL 3IU4H 4ZUUB 3SBWA 4WV1B 4OLUH 4XNUH 4ERSH 5J6HA 4EDXB 4F9PC 4U1LB 2YMXH 4ALAH 1MCIA 3BISA 4JG0L 4N9OB 3OB0H 4YIQB 1IGYA 3Q5OA 2AXJA 5F1IB 3QJHB 1I7TB 5KVEH 1JK8A 1H3PH 3MV7B 4XVTL 1AKJD 4TTDC 4EN3C 4G9FE 4JFXA 3VXTA 4ZS7L 5M95B 3PL6C 3KJ6L 4PP1D 1J12A 2D0GA 1K2DA 4M62H 4JFOB 5CLWA 1CL7I 4HUWB 4PGBB 4OZIB 3VFGH 4XAWH 2DMKA 1P4BH 3TF7C 4RDQF 4H1LG 4PRIB 1NCUA 4C4KO 1I3GL 4AL8L 4RX4D 3GBLA 3V5KA 3WLWC 1VCAA 3IJYA 1AD0A 1JHLH 1JF5A 4HLZG 3CFKB 5HJ3A 1IGTA 3TC9A 5IJKC 1Q9KA 4P4KB 2FX7H 1CGSH 1MLBB 4X6CF 1PKQB 3S35L 3KGRA 4N1HB 1FG2B 1AIFB 1U8MB 3MFGB 4YGVA 4ODHL 4KROB 1QHOA 4PRPB 4UIMA 4XP1L 3VXSE 3V5DB 3N1MC 3W11C 5HGBB 1CFTB 4K8RH 2VN4A 4PRHB 4DW2H 4DK3A 4XP5L 3WIIL 3ILPA 3BGFC 3S5LB 3DVIA 1P5UA 2CUMA 5HYQB 2ITDB 4RNRA 1T0MB 1OAUH 1WAAF 5D1XA 4RAVB 3MRFB 4LQFH 2DL9A 4PJ9A 3DARA 2OBGA 1EX0A 3KPQB 4U1IB 3VFSA 3D85A 3WO4C 4PJFA 4PRNA 4X0KA 3KS0J 2V7HA 1UC6A 4C56E 4OB5H 4XCNA 5HYJB 3G6AB 5DEFA 3QDJD 4IRSB 3Q48A 3FO2A 2H8PB 2ZSWB 4L4VE 4PRBB 3FT4A 4JN1L 2DQEH 3TVMA 2F53B 1KYOJ 1U3YA 4FNLL 3LEVH 3SE4A 1MRDH 4JY6A 5EOQH 1VADB 2FATL 1BEYH 4NCC2 2UWEA 2Y07H 2XIDA 4V2CB 2DICA 1JNLL 3VXMB 4RGNB 1XH3A 4PJAA 5ISZA 3AY4A 5B22A 1VGEL 1RQ5A 2C3WA 1G6RA 2D31B 4HAFA 5FIEA 2VIRA 4B41A 4KTDL 3SCMB 1B2WH 1L4IA 1K4DB 1U8QB 1E4WH 1MHHA 2XYCA 3ZE2F 4HZLA 1MCOL 1OF2A 2V2WB 4XPGH 5BXFB 1OAKL 2EDWA 4X5WA 1W0VB 4EBQH 1GOGA 4FXKB 3O6ML 2CRZA 3TCXA 2OXGA 2XZCH 3DX9A 2MMXA 1ZHKB 4XWGH 3TO4D 1BD2A 2VWEC 5I74C 3V4UH 3B2UD 3RNQB 3KPOB 3HS0B 1LVEA 2CUHA 3QDAA 4HC1L 2YPLE 1TPXC 2CIIB 1A1OA 4GLRI 3I9GL 2EYRA 5I8CB 4BSVA 5CAYB 1LK2B 1EUUA 2X1QA 3DXAA 3G04B 1BQLH 1BF2A 5EUOA 3V95A 4PR5A 1BM3H 2H2PD 4LDLB 1I9IL 2YXFA 4X7DC 1ZGLM 4PGCA 4Y16D 1L0QA 2XT1B 1GXEA 1ORSA 2CXGA 1KIQB 4HIJA 1DEDA 5C3TA 3KPPA 1N0XH 1UENA 1FFOA 4X7TA 1NFIA 3S96B 3WL9A 3QQ4B 4PJGE 1PG7H 1LNUB 1DN0A 3QULB 2NZ9C 4DN3H 2BSRA 5CEYB 3RTQD 12E8H 1M7IA 4JHWL 3TEUA 1WSST 4ZXBB 1T20B 4OQTL 1XGRA 3CIQA 5C2UB 3E6HA 1YEGL 3RVVD 1RUAH 4KQ4H 4CVUA 2OLDA 3I75A 4LP5A 3NMEA 4F9LC 1GGBL 5AWNL 2HVJA 3VFMB 1JUFA 3P73B 1NGZB 1SJHB 1IT9H 3MACH 2OR9H 3JUYA 3E6FB 2GAZB 5GS3A 2Z93B 3MJ7B 4Z77B 2VLKD 3QXAB 4HEME 1GJIA 3H9YA 3UBXA 1Z0NA 3OWEA 3EJYC 1C08B 1T1WA 4JZOB 4PJHA 3TJHD 5DD0H 1CLOH 2C1PB 1UVQA 4U3CA 4UBDC 3WJLC 5IHZB 4NC2B 3MRJA 4ORGB 4JO4L 3TJEH 1F3JB 3VFTA 4UUJB 1JZ5A 3B9EA 2P1YA 3IF1A 4ELMA 3EDDA 3QEGL 3V7AG 5IR1B 1EBAA 1YY9C 3X12A 4JKKA 1FAIH 3CVHL 1N6QH 1LP9F 1ZHBB 4QHMB 4PUBH 4H25B 5D7KE 5ID0B 3SDXA 1IM3B 1AFVL 1MCHA 3ARGD 4RFNB 1V3JA 4KKLD 1YDPB 2DTML 5KTEL 2E7BA 3R1GL 1MCFA 4EVNA 3WFCL 1FNEA 2YC1B 2A2QT 3FFCE 1F58H 1OSPH 1YYLH 1AH1A 5CJXC 1LDPH 2X1OA 3S3PA 5I1DA 4Q6IC 2KKQA 3MXWL 1U92A 1OGAB 5T3ZE 5L8KB 2PTTB 4N90E 3VI4F 1SJEA 2CGRH 2WBWB 3ULSB 4NQEB 1HWHB 4HWBL 3SBWC 4OFVA 1QKZH 3LKRA 1H3GA 4HAGA 2V5SA 5FUZL 5INDA 3V52H 3IVKA 4EXKA 3FT2B 1HXMB 5IB2B 4HK0B 3BE1L 1A7PL 2BK8A 2IFGA 4U05A 3QPQD 3R06B 2R0LH 1MQ8A 4P3WA 5BCAA 4HQQL 2BSTA 5DJ0A 3KWWA 1NCCL 4YFDB 4CGTA 4LCIH 5CJOL 1PYWB 3D25B 1UEYA 3ARFA 3RZCB 1HHJB 3FO1B 1XMWA 4OD3L 3U2SA 3RUGA 4GKSA 4J6RL 5IMLB 3HG1E 3CLEH 4NO2A 2I5YL 4TNVF 1BQUA 1D5BB 3C2AL 4P2QA 5FA3B 4AIZA 5J3HD 5FO7A 3E2HC 5CCKL 3PWVB 5T5NF 2HT3C 3A6OA 2VABA 4DTGL 4X8JB 4B7LA 1TJGH 2LAGB 5IBTH 2VISB 1OW0A 2PTVA 2BVPA 3FCTB 4GMTL 1TJHL 3JSSA 5E1AB 3GHBH 1G1YA 4UV7H 1OARL 3HZMB 5HDBE 4PJDA 4U6YB 4P2RB 1MEXH 3I84A 3WD5H 3UTSD 1FZJA 3PGCA 1ORQA 3P4NA 3CMOL 4K7PL 4W6YB 2H3NB 3BKYH 2D7MA 4LCYA 4XCFH 5FKPA 1AQDB 3EUUA 4LQ1A 4ODWB 5JW4Q 4P46D 5D1XC 1RHHB 4Y4FD 4PJ9C 5FKAB 1ZSDA 3MCLL 2IMNA 3KPRE 2AXHA 4OFKA 1CLZH 1A7OL 3C5JA 2YKLL 4OUUA 4MSWB 4XBGA 1QLFB 1U8JB 1J8HA 3MV9A 4HWUA 5MP6H 4AYFA 4U1GB 4XP6H 3GSVA 2V5RA 3J7HA 3O3EB 4GW4A 2E6JA 4TYUA 3OKEA 2H6PA 3MRLB 4XI5D 2ENYA 4P2CG 5EBMB 1RZJC 2DBLL 3U0WL 2E6PA 5C70A 5KSBB 4QXGH 3PV7A 1I8KA 4LLWB 3SE4C 1TTUA 8FABB 2VDKL 1KCUL 1CD1A 3DJ9A 2XTJB 3QXVA 5FAAA 4QHNA 3WKMH 3AY4C 2DRUA 3D39A 4K71C 3EYQD 4LDOB 1Q0YH 5DHVA 3EYFA 3O4LB 4P2OD 3OJ2C 4D9LH 1BBDL 1IFHL 1VACA 4K3JL 4OLYH 1WK0A 1GGTA 5D5MA 3H9SD 2XACC 3MRNB 3QYCA 4NQTA 3NN8B 5E95B 1RULH 2VKWA 4E5XA 1T1ZA 1E4KA 4Y1AB 5F1SA 3MR9A 5ICYB 4BFGA 5I17B 2E9WA 1P7QA 1M7DA 3F7PC 4E41D 5CBAB 5E9DE 5HVHB 3UBXI 3QR2A 5GRJL 2AK4E 5EDXA 4QOKB 4YFLF 2GJZB 1ZTXH 3QG6B 4D8PA 2Y36H 4KJWC 1Q9WB 1ZLSL 1F4YL 2YR3A 3C6SB 5EWIH 5FXCH 5J13C 4NN5B 5HHXH 3L5JA 3BIBX 4M1GH 3U4BH 3DMMD 3X3GL 2DYPB 3HUJF 4GBXD 2R8SH 5DUPL 2Z4QA 5C07A 4NHCH 4B50A 5GGRY 3SKNB 4JM2B 4U1MB 4KUZL 3W0WB 4A6YH 5J11C 1MHEA 3WEXA 1ZA6A 15C8L 4HSQA 4NBZB 4U6HA 3MLVL 4APQA 4ZFZB 1S5IL 4YK4C 3TBVB 2CDFA 2X9XA 1XGPB 2ITCA 5CS7A 2HJLA 3WBDA 1AI1H 5TQ0H 1FVCB 2V5YA 5EN2B 2NTSP 5HYSG 2FH6A 5MENE 3VGAB 2R2CA 1B0GB 1DP0A 2P8LB 3ARXA 4G3YL 4OF5A 3LSOB 3ZL4H 4ZG1A 1JZ3A 1J1OL 1T89A 1WEJL 1FO0H 2J7LA 4HPOL 1IEBA 2F74A 1ZLVK 4XNZB 3OG6B 4WV1C 3B9KD 1IBGH 1SVCP 4ZODA 4X8XA 3QEQD 1DBJL 2F5AH 4PJGF 1TZHB 1WC7A 5JPNB 4YXKH 2W1NA 1IMHC 1L6ZA 1FVEA 2WQ8A 3CUPA 2Z35B 5CZXD 1DUZA 2FB4H 4QT5A 3INUL