4S1VA

Crystal structure of phosphoglycerate oxidoreductase from vibrio cholerae o395
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MMKIAILDDYQNVVRGLNAFQCLQGHDVTVFNDSVSDETVLIERLKPFEALVLIRERTPITENLLAHLPNLKLISQTGKVSNHIDVPLCERYGVTVLEGIGSPVAPAELCWSLILAASRHLPSYIEQLHAGHWQQNGGLGLGRTLSGRTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEASRQKALELGYQAAADKAEFFAKADVLSLHLRLNDATRGIVTKQDLLAMKPDSLFVNTSRAELVESGALYSVMQANPMRQAAVDVYENEPALPNNEPLLSLPNVLCAPHLGYVEKNSYEIYFQAAFENVVKFAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords D-3-phosphoglycerate dehydrogenase-related protein
publication title Crystal Structure of Phosphoglycerate Oxidoreductase from Vibrio Cholerae O395
rcsb
source organism Vibrio cholerae
total genus 110
structure length 313
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.95: Phosphoglycerate dehydrogenase.
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4s1vA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4s1vA01
4NBTA 3K31A 1MLDA 4OMUA 3BMNB 3HZZA 2ZCUA 1VJTA 2BHLA 2O4UX 2V6BA 4D79A 4BV8A 4JLWA 1DBVO 2QRKA 4P4GA 1O9BA 1YVEI 3G1TA 3FTNA 3KYBA 3MOIA 3OA0A 4IQGA 3ROKA 5A9SA 3ZHYA 4XR9A 3KVOA 1IZ0A 3FF4A 2R2GA 4TRNA 4BKOA 1HYGA 3F1LA 1XKQA 1N9GA 4ZHSA 2VNAA 1DFIA 1G0OA 4NBRA 1O8CA 4DYVA 3GUYA 1F17A 1JAYA 2OFPA 2JD1A 2PD6A 3S55A 3QV1A 5JO9A 1E0DA 3IC5A 3W1VA 3DMYA 3NT2A 1E6EA 2W98A 3KO8A 3CMCO 1ZBQA 3JQEA 4XX0A 1PJQA 1Z74A 3VKUA 4BNNA 2EJVA 2X4GA 3DC2A 4DPLA 1GZ3A 1BWSA 1LU9A 3GF4A 5U9CA 4KUHA 4PLFA 1CETA 1GPDG 1CEQA 2PZJA 3OEWA 5JLAA 3C7AA 4EZBA 3RJ9A 1UAGA 1X1EA 3GG2A 2J3KA 5L9AA 4NK5A 5IZ4A 1HEUA 4NHEA 1PIWA 1AHHA 3QHAA 3WFIA 4BMNA 1Q0LA 1DC4A 3F46A 1KC1A 3JQ6A 5A9SB 3GVCA 4DMLA 4FJ2A 3O38A 3RSHA 4X54A 3KETA 1SNYA 2D8AA 1SO8A 3DOCA 5TF4A 4A7PA 2P68A 3PJEA 5H81A 4ALIA 1N9GB 1NHGA 4UUOA 4OQYA 2X0JA 3PGJA 4S3MA 1U4OA 2E37A 1JLLA 3JQFC 2I66A 3PLNA 4IQ0A 2IEBA 1OC2A 1TB4A 4OOFA 1DFHA 1DRVA 2AW5A 3Q1LA 4GI2A 1QYWA 2O4CA 3PXXA 2Y93A 4WNCA 4EEXA 2PH3A 5CDGA 1EUCA 1NQ5A 2H6EA 4ND2A 4YJGA 4MVJF 1Q2XA 5JDIA 1XLTA 2PZMA 3HNPA 2FP4A 5A05A 4ALNA 3HFGA 5IF3A 4NFYA 4D45A 1R66A 3LC2O 1EDZA 1G6KA 3OM9A 3OP4A 3TOZA 5A04A 1EUZA 2WD7A 1WZEA 2ZB4A 3HADA 1K6XA 4J6FA 4CMJA 3PZBA 3TZCA 3CIFA 4E12A 4BO4A 4Y6PA 1G0NA 4JQCA 1SZJG 5HA5A 3JD3A 2NWQA 4GKBA 4DXHA 1JKFA 3OEYA 2BGMA 1XA0A 2VT2A 4KZPA 1YO6A 3JD0A 1WPQA 3B1FA 5K6AC 3AOEA 4Q3EA 1HETA 3RUHA 4WPGA 4BNMA 5C7LO 3ZHZA 3ICCA 2ZYDA 3PDJA 3HDQA 3VZRA 3Q9NA 1YQXA 4G65A 4I08A 4B3JA 1CQJA 4CM9A 3AU9A 4J9VA 4W7IA 1E7RA 2VTEA 4MJLA 1GR0A 5T5QA 3TZKA 1EQUA 4BO0A 4YJGB 3NGXA 4NNJA 3RKRA 2CVQA 2VHZA 3GDOA 4WLFA 2P5YA 3DHNA 3LC1O 4MVJG 2DC1A 2Y05A 3GQVA 3RC1A 2Q3EA 4FC7A 2ZYGA 4OM8A 3D7LA 4E5YA 3CTMA 1O5IA 3E6AA 3WX0A 3HDHA 3L6OO 3RC7A 1TT5B 2WD7B 2WYUA 4JBHA 3OIGA 4FBGA 4ALJA 5ICMA 4BNGA 4TSKA 3WXBA 1U9JA 4A27A 4PFJA 4DMMA 3LVFO 1PEDA 2Q1WA 1V6AA 3NTQA 3JYQA 4HV4A 1DDOA 3TFQA 4WOJA 3QWAA 1NPTO 3IUSA 3GT0A 5GZ1A 5KJCA 1I36A 1E7MA 5HRUA 4CMEC 1ULUA 1VRWA 2HK9A 3BMOA 4EW6A 2HKIA 3E8XA 2P2SA 3PQEA 4BNYA 5JE8A 4BGVA 1KVTA 4YJHB 3LSYA 1C0PA 4JK3A 2DTEA 3PPIA 3IKTA 5G2OA 2AXQA 2EG9A 1YWGO 1FXSA 4J7XA 5DDIP 1A4UA 3PWSA 3NRCA 4R5HA 3C7DB 2X9NA 1O95A 4J16A 2B36A 4YRDA 2ZIZA 1ENOA 1F8FA 4GGPA 3GDFA 1H2HA 1GEEA 2PA3A 4Z9YA 2W2KA 4CLRA 5ER6A 4XQGA 4U6QA 3ZI0A 5FEUA 1QKIA 2C07A 4MIEA 3UOGA 4R1UA 4YAEA 2DTXA 1LSJA 3INGA 4BO8A 5I8ZA 5KWEA 3D4PA 4K28A 4MOWA 2ZTUA 3EVNA 4J4TA 3STHA 1LRKA 4MP3A 1PGOA 4QXMA 1R0SA 3NGLA 4FGSA 1ISMA 1KEWA 1J4AA 3GN2A 5F1PA 1Y7TA 4GKVA 2PY6A 3F4LA 3ADOA 4DWVA 1PZFA 1ZKMA 1T4DA 3TWOA 3B1JA 5BR7A 3BMOB 2DBQA 4XR4A 5EQDA 4RCVA 4J0FA 5JAMA 2EGHA 2PNFA 4RF5A 4CV1A 4KOAA 2E6UX 4B3IA 2AQHA 3QVOA 5B4UA 1WVGA 2Q50A 2QW8A 4AVYA 5JAZA 1UDCA 3GAZA 4GWGA 1M2WA 1WWKA 1KS9A 2I9PA 4BMSA 1VM6A 5LCXA 5CEFA 2YHIB 2WJPA 4MVJI 5JW6A 1KVUA 3BXXA 3GZ4A 7ADHA 1LDEA 2H1SA 1VKNA 2W2LA 5AYVA 3PWZA 1YKFA 4F45A 2W2KB 1BGVA 2IXAA 3KYCA 5A02A 1MXFA 3DAFA 2PFGA 3DFUA 4HX5A 3H9UA 3Q2KA 4DBVO 3ANMA 3Q6IA 2NTNA 4WLEA 4JNKA 4BV9A 4L4XA 1YL5A 2BFOA 3QSGA 4IS3A 2UUPA 5A03A 4QO7A 3PQFA 3CINA 4XIYA 1P74A 2CVOA 3D4NA 4ALMA 3L07A 4OGWA 4PG8A 1Y8RA 3AM4A 5EIOA 2PD3A 1HDCA 2FSSA 2DFVA 4E5PA 3ZHXA 4YBZA 1JTVA 4PGFA 4E2XA 4CM9D 3BHJA 4XRGA 4WASA 3IOYA 2JJYA 4FIZA 1Y5MA 3JYOA 5TT1A 4ZICA 3D5QA 4CL8A 2FOIA 1DC5A 4P8RA 4HFJA 5BNFA 1R12A 4NU6A 4CL3A 3IP3A 3QE3A 3S2GA 4XYGA 2FZEA 3K30A 4XB2A 1DJQA 3G17A 3SLKA 1QR6A 2HRBA 3KYCB 3W8EA 1EEHA 1OFGA 1ZH8A 1OOEA 4AJPA 2X5JO 2O48X 1LUAA 4XD2A 1ZJYA 2DBRA 3LT1A 4FW8A 4AJ2A 1VL6A 1HF3A 3NKLA 4QUKA 2FPGA 2QRJA 2OP1A 5B37A 2GDZA 2BFPA 5ENVA 3VH1A 2DBZA 1VC2A 2ZJ1A 1X7HA 3BTSA 1NX6A 2DUUA 4B7CA 1VI2A 4BQPA 4EITA 3AI1A 3CH6A 4B8ZA 4GL4A 3V2GA 3FR7A 3NDIA 3TQHA 2ZATA 3K9QO 4JBIA 2QZZA 2VOEA 4TRJA 4GMGA 4B79A 4Z9FA 2FPIA 4KWHA 1W73A 1I2ZA 4R9SA 1PZHA 2PWZA 3ZNOA 1KC3A 4BKUA 4FOSA 1LSSA 4YRAA 1SMKA 1T24A 6LDHA 3RC9A 3TFOA 2WMDA 4LVUA 5G0VA 4OJNA 5TS3A 4IMPA 1I3LA 1ZW1A 3PZRA 4AJJA 3T7CA 4CMBA 4YXFA 1L7EA 2RIRA 2EKQA 3LYLA 1KY4A 5IDQA 1B16A 2VHVA 4GBJA 2AMFA 3GOHA 3RBVA 1I2CA 1Q1NA 1NPYA 5GMOA 3U4CA 4CV0A 5DNAA 2HUNA 3FSRA 3UFXA 2OZPA 4P22A 3PYMA 2FY8A 1HWYA 4XJTA 1RWBA 4YJFA 1PGPA 1UXJA 3UH1A 3W4JA 4FFLA 3P2YA 4QTZA 4EJ0A 2JCVA 1ONOA 1U7TA 2B5WA 2YYYA 5L7YA 2Y1CA 4ZQGA 5THKA 1P31A 1JDJA 1JW9B 4H7PA 1TXGA 4ND5A 1LDBA 4NZ9A 1WDLA 3RWBA 4DLBA 3DBRB 1AXGA 3SEFA 4A26A 1R16A 3ZWBA 4XDYA 1TA4A 5DBFA 2FR8A 3Q3CA 1HZJA 4CPDA 4ESOA 1ENYA 1U2GA 2O23A 3AW9A 4DUPA 1TLTA 2XF8A 4CM6A 2X86A 2VUUA 1DJNA 3JQ9A 5KKAA 1P1RA 5TJHA 3AK4A 1X0VA 2VRBA 3MZ0A 1E1KA 2NTJA 4OH1A 4RF2A 2D5CA 3GPIA 3GGGA 3R1IA 3X2FA 3O26A 2A9FA 5JDIC 1VLLA 3VAZA 5GZ3A 4PG7A 4RVFA 1WDMA 2AEJA 1BXKA 4O63O 2C20A 1YONA 1LRJA 2W2LD 4TMFA 2HMTA 3IMFA 4TQGA 2G5CA 3ZCXA 3F47A 5HM8A 1Q7BA 4ZN6A 1IB6A 3WSWA 5A3JA 5EL0A 4FPXA 3D3EA 3CSDA 2YFHA 4J4HA 4YJFB 3MJCA 4BO5A 3H65A 1JQBA 1PZEA 4BNJA 4GVLA 3KYDA 5TGDA 1GADO 2ZQZA 2CVZA 1ZJZA 1BG6A 2EIHA 3GLQA 3S2IA 3AOEC 4J1SA 3L77A 4MVJM 3GMSA 1M6HA 1EVJA 3JD4A 5IAAA 5L7WA 3WYEA 4AJKA 4BNLA 2PR2A 5IFLA 4E5NA 1C3VA 3I9NA 3IL2A 2HU2A 4HXYA 2R00A 1P1JA 1H0KA 3DB2A 3UXYA 4HFNA 1I01A 3GHYA 3HDJA 2VHXA 4PLHA 1PS9A 3VHRA 2UDPA 1GZ4A 3SVTA 3G0OA 4Q3NA 4EGFA 3A9WA 2GPTA 4PZCA 1EE9A 3EGOA 4IDAA 3VH3A 1UXIA 2XAAA 2GCGA 2ET6A 1U3TA 4XGNA 1I2BA 1LC0A 2D3TA 1V9LA 1KOLA 1OI7A 2GF2A 2WD8A 2GN9A 3ANNA 4IUYA 3RUEA 3AUSA 4CMCA 1LJ8A 4KDFA 1JU9A 1GAEO 2DPGA 3EYWA 4XYMA 4EUHA 2C2YA 1JWAB 3KYDB 4DPKA 1B15A 2C2XA 4IDFA 4GQAA 5B4TA 2O2SA 1BVRA 3FWNA 4NQZA 5TNXA 2D1YA 2IE0A 4BO1A 5I7EA 3C3XA 2ZQYA 4FFOA 4EUFA 3ABIA 3ENNA 1R4NB 4CUZA 4EYEA 1DPGA 1YDWA 4XIJA 1W6UA 1B8PA 1OAAA 1PJBA 2GN4A 3B70A 1YJQA 2GASA 3GNTA 1QXSA 3BIOA 3MJSA 2C5EA 5CPFA 4CM1A 3LC7O 4WLUA 3H9GA 1X13A 1A7KA 4FJ1A 1YBMA 3MTGA 1DXYA 4JBGA 1E3LA 1LLCA 2XPCA 3ONFA 3DR3A 5U1PA 4MKRA 3BMQA 4RVUA 3D5TA 3WNVA 4FFMA 3OFSA 1BDBA 4R1NA 1IUKA 4UVIA 2HMSA 2Q45A 5IN4A 1I10A 2ZYAA 4OXNA 4D7AA 3VC7A 2O3SA 1JVBA 1K6JA 1K2WA 3K5PA 1ZZEA 1DIRA 2Z95A 1X7DA 1QSGA 3DZHA 1LLUA 3OHSX 4C7JA 1NQOA 3M2TA 4CV2A 4KWIA 3ROQA 4AJIA 1N2SA 5GY7A 1T25A 1K5HA 1S7CA 4R16A 4R51A 5JNLA 1KVSA 1P45A 3KEOA 3OIFA 5C5IA 1GCUA 3FNHA 4HUJA 2EEZA 1DAPA 3U9LA 1YE3A 4W82A 3ZV4A 2EW8A 1DB3A 1P77A 3JSAA 3OF2A 1JA9A 1X14A 3GFBA 3S1LA 4U0KA 4R9RA 2B4RO 3MOGA 3B1KA 2VNSA 1EUDA 1UZLA 4CMAA 5CG2A 2HK8A 2Z1NA 2VWHA 2NACA 5G0UA 4CLDA 2RHRA 4IM7A 1PJCA 5G4KA 4D44A 4B7XA 5BSEA 5JBIA 1PWZA 3PWKA 1JWBB 4RORA 3PP8A 5IDWA 3OJFA 1MB4A 1XQ6A 4WK6A 4M54A 4Q9NA 2NU9A 2HSDA 2IXBA 3I9JA 5CP8A 3QJ5A 4DQXA 1MP0A 3OH8A 5TJ9A 5TLSA 4Q39A 2HLPA 1LLQA 1ADGA 1DRUA 2X8LA 2NU8A 4CQLB 3BMCA 1GQ2A 4AJLA 2UV8A 5G4LA 1ZSYA 3VDRA 2AEMA 1C14A 2Y67A 3T7EA 1X0XA 3CMMA 2H63A 5C3MA 3JD2A 2WWRA 1R0LA 3PIDA 2G76A 4UUPA 3ASUA 1PJ3A 1YB5A 3RUIA 2DAPA 3MWEB 4RZHA 3U0BA 3JQCA 4G2NA 2NV6A 1VL0A 4U5QA 4E3ZA 3E5RA 5KJFA 2EKPA 2J5QA 4OKNA 3VPGA 4M89A 3EW7A 4IXWA 4J90A 4P38A 1E1LA 4WCDA 1PTJA 2Q4BA 3IJRA 4G81A 1ML3A 3H8VA 3COSA 2O7QA 3I3OA 1WXDA 5G4KB 4RDHA 4HNHA 1TVEA 2HMVA 4CLOA 4Z3KA 4BNTA 4IJUA 1SAYA 1YJ8A 4J0EA 4B4OA 2YV1A 3WGIA 3LDHA 4FFNA 3FRJA 3DDNA 5J23A 2DKNA 3FCOA 3CKYA 2X0RA 1MA0A 4Q3BA 5AXAA 3R6DA 1LX6A 4I5FA 4R3WA 4D42A 3BMCB 4INAA 1ADBA 4AJEA 1DLJA 3D1LA 5CG1A 3ZWCA 4RVGA 1P1IA 1K3TA 3H9JA 2HMUA 2Q2QA 2Y1GA 3GNSA 4Z0TA 4CR8A 4D46A 3MJVA 2JD0A 4EJ6A 3M6IA 5IDXA 3FR8A 3MEQA 2VWPA 1W8DA 2PZKA 5AOVA 1HSOA 2O3RA 4WCFA 4U7WA 1KETA 1HYEA 2HAEA 3E9MA 4AJHA 1HXHA 1EVYA 3GFGA 3ULKA 3W4KA 1HTBA 3G49A 5JDCC 5TT0A 3E9NA 1PL7A 2ZJ0A 5DP1A 1HLDA 3DMTA 4I5DA 4IY1A 4TRRA 3RQSA 2CSUA 2Y99A 5K0ZA 1IZ9A 2B0JA 3H4VA 3LT2A 1LBEA 3GPDG 4CLOB 1XU7A 2FR1A 2JCYA 4UEOA 4FD3A 5H82A 1WW8A 1B2LA 3CUKA 5JPIA 1KIFA 5DCUA 4CMIA 4FFRA 5JMPA 1NFQA 5MGBA 1E5QA 3GVPA 4G5HA 1NYTA 4E6PA 2QHXA 4Y67A 4CUKA 4HFRA 1QV7A 4GWKA 5BSGA 1M66A 4Y6RA 1VPDA 1KERA 1MGOA 2O3TA 2AG5A 2WE7A 3JYLA 5CHEA 2HRZA 3U62A 3DO5A 4LSMA 3ZWYA 1A5ZA 1ZMTA 3WGHA 1V8BA 1T2DA 1I24A 3IJPA 3ZU5A 3JQ9C 1W0CA 4UUMA 4OXYA 3NJ8A 3WR5A 5ITWA 1E7WA 1GYRA 4PLPA 4YYZA 5EESA 3GAFA 1CIVA 4QQRA 3UF0A 1YGYA 4AJ4A 1I3KA 3L4BA 2EERA 4JJGA 1QG6A 4PLZA 4M8SA 4BKRA 5BNTA 1ZMOA 2I6TA 3V8BA 1YH3A 1R37A 3QA9A 3RI3A 1I3NA 1YQGA 3P19A 4J91A 4CMIB 1PGNA 3TSCA 3E9QA 4XWYA 2ZB7A 4WOKA 3GVIA 3AY6A 5CDTA 3MJEA 2BD0A 4EUEA 1NR1A 2OGUA 2C7VA 3WMXA 1UJMA 2YV3A 4Y98A 4BQRA 4W99A 4FR5A 5DOVA 3ZHBA 3WDSA 1ZK2A 3BA1A 4FFPA 5JSFA 4RQTA 2X1HA 1F0YA 1BXZA 1NASA 2I5PO 3NTOA 1EVZA 1E5LA 1LXCA 3GEGA 1RKXA 1SEPA 3QWBA 3E5MA 5IZCA 1IHYA 2VQ3A 3WIEA 4DREA 2RH8A 4E4YA 3ITDA 1RYEA 2WYWA 1ZXBA 2EWMA 3PHIA 2R00C 4D3SA 3EZYA 1VJ1A 2CNBA 4J1NA 3NDJA 4J43A 4AFNA 1FDUA 2WM3A 1BVUA 4DQUA 3LLVA 4XQEA 3N7UA 4UEKA 3N74A 1GYQA 5DOZA 1O94A 1D8AA 4IZHA 4YJDA 3OJ0A 4BNFA 1I3MA 3WYCA 1MFPA 5AQ1A 4XGKA 3C8MA 3WLEA 1LDMA 2VCYA 2AQKA 5EQFA 1ZUD1 2W90A 4L73A 2IRWA 3FPCA 1KEUA 1FDVA 3QVXA 3WYBA 1ZK4A 4W7HA 1A72A 2Q2VA 3DBVO 3WTCA 1AXEA 3ROPA 3FNEA 1D4FA 2ZB8A 1Q0HA 4JXKA 3QWIA 3PJDA 1FJHA 5HWSA 1KEVA 1ZEMA 4MDHA 5KJ6A 3RAJA 3NEPX 1XU9A 3WGZA 4JJIA 2J3JA 1GV1A 1N8KA 2ILTA 3U4IA 3EY4A 4IXTA 4PVDA 2GZ2A 3KOUA 3EUWA 1S6YA 2YV2A 2V7PA 2FHSA 1M75A 2GN8A 4DBZA 3RU9A 2VOJA 1MUUA 3BTVA 3OQ1A 1DIBA 1YXMA 4CR7A 3H7AA 5I9NA 4RVDA 1U7HA 3INTA 3H2ZA 5HS6A 4RVSA 4DA9A 1Y5RA 4F3YA 3GNQA 5CEJA 2IODA 1A9YA 1NPDA 1OMOA 4LMRA 1PR3A 2CY0A 3OQ6A 1T26A 3ZW9A 2WDZA 1SBYA 1WZIA 1PR9A 5H83A 1MC5A 3RIHA 1OZAA 4I9NA 4R5MA 3MJ4A 1HE2A 1JVSA 3G1UA 4Q3AA 3JQBC 2P91A 2V6GA 4BNWA 1Z45A 1B8VA 1PS0A 1ZVMA 3PRJA 4RL6A 2GZ3A 2BI7A 3ORFA 2JAPA 3OETA 3GUCA 5L3ZA 1CQIA 1B3BA 3QVSA 5KJEA 3KM0A 1U5CA 1I30A 4R1SA 2JHGA 4CLRB 4PLVA 5AXBA 1GZ6A 4FC6A 4IGEA 4IINA 1B7GO 4BB5A 1JKJA 4D0RA 2FN7A 4NIMA 1NM5A 2CZCA 2JAHA 3ZWAA 3DL2A 1GUFA 4E2YA 3ROMA 2B69A 5KTKA 4ZRMA 1FDSA 1LRLA 3FNFA 5DP2A 1DHTA 2QYSA 4BNIA 1WP4A 5F1OA 1E3WA 1GL3A 3FTPA 3VDQA 1KVQA 3HN2A 3TZHA 3F6YA 4CM8A 4R3NA 4ZJUA 4OO3A 4EBFA 5L95A 4KTVE 1IULA 3VTFA 2RHCA 1J5PA 1F06A 4BUCA 5A06A 3IQDB 4GGOA 4YDRA 5KVCA 1SC6A 4Q3CA 3ZN2A 4RPHA 1NFRA 4BGIA 5BSFA 2JFFA 1GCOA 1BXGA 4ZD6A 4ZVVA 4FOOA 4MVJH 1ZSNA 4P4LA 3ONEA 1ADFA 2Y0EA 4OHUA 1Y8QA 4XYBA 3UKOA 4ILKA 3C24A 3H3FA 3PDUA 5I7VA 5EN4A 1ZK0A 2X9GA 3F3SA 5G0SA 4EJMA 2Y1EA 1Z7BA 2PZLA 1DIHA 5EERA 4KUGA 2O2YA 5EMHA 2Q2WA 3V1YA 3ZWVA 1P1FA 3KLPX 3OQBA 4UVEA 3ZH2A 2Y1FA 3O03A 3ETEA 5CAEA 2P9GA 1U3WA 2NVBA 1VE9A 2NADA 3PHLA 2PGJA 4FS3A 3AOGA 4A73A 2Q4EA 2X23A 1E7YA 3KZVA 2Z5LA 1GDHA 2O3UA 1B0AA 4BO7A 1E3WB 4LCJA 2B83A 4TZKA 1AN9A 3EC7A 5L40A 1Y8RB 4CM8B 4XQ9A 4XJSA 3BAZA 4YCAA 1R0KA 3EK2A 4R4JA 2VZ8A 3QVTA 4E30A 4E5MA 4WLVA 1YB1A 2DLDA 3DFZA 4CLEA 4L76A 1UXKA 3DQPA 3WQRA 1AE1A 2YY7A 2NSDA 4MKXA 1H2BA 1NBOA 5JDCA 4MO2A 1BXGB 3K6JA 2OO5A 4N5LA 4E31A 3HQ4O 3S2EA 4L75A 1N5DA 3K2EA 4U8GA 1Y8QB 5T6BA 3PJFA 4D41A 1LI4A 4DQVA 2G82A 4JGBA 4E33A 1QYCA 4P4NA 5KCZA 2PKQP 4YRBA 2NVWA 4AJOA 3V1TC 4IJVA 1NQAO 4YTEA 3UUWA 4Y9DA 3U3XA 3GR6A 3CE6A 3OECA 3AFMA 3EAGA 5DBGA 4WCFC 5JYDA 1XDWA 4RPJA 2EW2A 4YT5A 4CR6A 4RPKA 4O1MA 4N18A 2C54A 4HY3A 1ISGA 1T2FA 1XYGA 2WEKA 5F5NA 2GYYA 4TKMA 3WS7A 5A5EA 1YB4A 4J7UA 5LDGA 3F5SA 1Z82A 2C0CA 3DMTC 3OMLA 8LDHA 3VZQA 2YQ5A 3VVCA 3AY7A 1H6CA 2LDBA 4BO3A 4BL5A 3DTYA 3BHIA 2Y66A 2VYVA 1U8XX 3K92A 2B4TO 3IIEA 2LDXA 3RROA 4W4TA 4R01A 4JJFA 4GX0A 4M87A 1XR3A 3RUAA 5COBA 3U4DA 3WG9A 4NJOA 4ZQFA 1DIGA 4GSKA 3M1AA 3I23A 3QQPA 2FR0A 3O4RA 1N1GA 2NM0A 3N58A 1H6BA 3R0IA 1A4IA 2D2IA 3TN7A 5CDUA 3JQ7A 4XB1A 4EDFA 4CUJA 3SC4A 3ZWXA 3RCBA 2Q49A 3KSUA 2E49A 3RUCA 4C7KA 1LDYA 4L74A 4DPMA 1PQUA 4MVJA 4CLHA 2WYVA 3WGTA 2AE1A 4YAJA 3T4XA 1HZZA 5T57A 3ZWMA 2QG4A 3LZ6A 3IKVA 1Q0QA 1NWCA 5IXYA 3CXRA 1HE4A 4GX2A 2J5RA 4UVDA 3WNQA 2CD9A 2VZ0A 3L4BC 1XEAA 5A1TA 3DZGA 4L4SA 4UREA 5TQVA 4BB6A 1V35A 4J9UE 3ZZNA 4HWKA 5AVOA 3CZMA 3NTRA 1FDWA 5K9ZA 1LTHR 2Y0CA 2IYOA 4ZGWA 3ZWPA 4MIYA 4CM7A 2AEFA 5I9LA 1HDYA 3RBZA 1KBZA 1TEHA 1B26A 4N5MA 3GEDA 5MDHA 4CJXA 1ISHA 1D3AA 2DQ4A 2DBVO 3SX2A 1CRWG 3HN7A 3O9ZA 1MG0A 3HHPA 3A1NA 1DAOA 2B37A 1E6WA 3ADPA 4GLLA 3VPSA 4PRKA 2Z1MA 4YAGA 2ZTVA 4D3DA 5JFOA 1Z75A 3JQ7B 2C7GA 1GQQA 4J2HA 4LW8A 5B4VA 1UDAA 4BNZA 2V65A 2DTDA 2OMEA 3BHMA 4N5NA 4XKJA 5L4LA 4A5OA 1UH5A 3O8QA 3FBTA 3ON5A 4I9UA 2OXIA 2Q1TA 3RKUA 5IZCC 4FGWA 4NBWA 5KVSA 2PGDA 4KUEA 1UXGA 3PLRA 1MC4A 3FWZA 4A03A 3WQSB 4BNHA 4JN6B 5CDSA 2NU7A 4L9RA 3ZW8A 4R1TA 3UCEA 1HLPA 3PHGA 4QEDA 3V5NA 1Z7EA 1BW9A 2PH5A 4OL9A 2ZK7A 1P3DA 3E48A 4ZA2A 4FB5A 1AUPA 4YR9A 1IYZA 4PLYA 3IUPA 3G3EA 1CJCA 4OXKA 4ROSA 1HDGO 3GK3A 4MPDA 3IS3A 3NAQA 3JQ8A 5DZSA 5DF1A 3C1AA 3JQDA 4PZEA 3LU1A 4GMFA 3JQAA 1RJWA 4K1LA 4RZIA 1K0UA 4XA8A 1C1DA 3F5QA 4OIMA 3LT4A 3U5TA 3F9IA 3DAGA 1T2CA 2IZ1A 2HJRA 3TRIA 1GD1O 4ND4A 4U6SA 4CLXA 1WNTA 3UAGA 1HDOA 5ENDA 2QQ5A 1U8FO 2FZWA 1MX3A 2CMDA 3O8QB 3PI7A 4B4VA 4YAKA 2FSVA 4BNUA 2YW9A 1EQ2A 3QW2A 4IQ8A 3PK0A 3WBFA 1GTMA 1DRWA 5ER9A 1NNUA 1X7GA 2PTGA 3JQBA 1M67A 3KB6A 1DFGA 3DHEA 3V1UA 3H2SA 3X2EA 2GNAA 1PQPA 1A27A 1LSUA 3D64A 1PWXA 1BSVA 1BW9B 4ALLA 3DOOA 3QVWA 4WJZA 1QMGA 1HL3A 5I9MA 2X0IA 1I32A 3GVXA 1LSOA 2VT3A 3RASA 4CMGA 4E0BA 2VYVD 5L4NA 2WTBA 1ENPA 1VSVA 3LQFA 1YRLA 2I67A 3VH2A 2E4AA 3F1KA 4I1IA 1U3VA 2DFDA 2HQ1A 1A71A 5IG2A 3VPFA 4LRSB 2JD2A 4S1VA 3JQ8B 2FMUA 4LRTB 1VJ0A 2NU6A 3JQAB 1M76A 1Y6JA 1C1DB 1I5RA 3WB9A 5CDYA 4B8WA 1L7DA 2YQ4A 3WGGA 3SXPA 3BMQB 1HSZA 4PN3A 3MJTA 1NAHA 1H6AA 5JMWA 1UDBA 3ZWOA 2JL1A 1NFFA 1UZMA 3A28A 2ZTMA 1SCUA 7MDHA 3PFWO 3SBOA 3ETGA 3C85A 3KHUA 3LLSA 4MVJD 4LGVA 3GEMA 1WAMA 4IDGA 2HJSA 1EBFA 1GEGA 1F8GA 1MFZA 3WSVA 1U28A 4E5KA 3M1LA 4J3FA 2CUKA 2H9IA 2YFQA 3I6QA 1RPNA 4QFDA 4F6LA 4HNGA 2PGLA 1NAIA 2AQIA 4WGGA 1GUYA 2GERA 5TX7A 2X7HA 3AUTA 3DZJA 4IDBA 4Z3DA 4AICA 4CM4A 3QLJA 1J6UA 1UP4A 4OAQA 1JAXA 2NLOA 1ORRA 4GX5A 6ADHA 2HMWA 1WMBA 4IBOA 1FK8A 1ARZA 4YEDA 4R69A 3TOXA 5G0TA 1N92A 1LQUA 2J3IA 4Q3DA 3RC2A 4ID9A 5BQFA 2EP7A 3I5MA 1UUFA 4F46A 1B8UA 4RVHA 5KNLA 1G1AA 2VZ9A 3ZNNA 4DLLA 2GLXA 2ZCVA 3AY3A 1J0XO 1V3UA 5JCJA 2Y1DA 4Z6KA 1U4SA 4XEHA 2I99A 4JP2A 1EFKA 1D1TA 3DBHA 3SJ7A 4NG5A 5JC8A 2J8ZA 1XCBA 5LC1A 1MXHA 2X6TA 3I9OA 3I6IA 5EPOA 1Y9EA 1PJTA 3VPXA 2POQX 3K73O 2A35A 2BMAA 3I83A 1NVGA 4FDAA 4QFCA 4DLAA 4J1TA 1IHXA 3EDMA 3GMDA 3UGKA 3NT4A 4XZ3A 4YT2A 2O3JA 3L4SO 4XYEA 1H6DA 4HADA 2W4QA 1GY8A 4KMSA 3DBLA 1XG5A 3OJEA 4TKLA 4TRMA 4W9NA 5AXDA 4DIOA 3BZUA 2J3HA 2NQ8A 3UVEA 4CM4B 5CFZA 4PLTA 1EBUA 3KSZO 2RBEA 3MTJA 3PIIA 1CF2O 1P1HA 1XHLA 3JYNA 1H5QA 5EINA 2VN8A 3JV7A 2CF5A 3JQAD 4E2ZA 2FWMX 2A4KA 1T4BA 4U0JA 3HE3A 2CDBA 4Z0HO 4YACA 4E32A 1NHWA 4TVBA 3ANLA 2DT5A 4FN4A 2EKLA 5FFFA 3HJAA 2I76A 1ZO8A 3CEAA 3GRPA 1QYDA 1KEPA 4PIVA 3WMWA 3DBHB 3GZNA 4W6ZA 4LK3A 1NQTA 1UZNA 3HB5X 1BMDA 4IDDA 4TVOA 3PHJA 5DN9A 3T4EA 4IIVA 2IYPA 3DONA 3IP1A 4WNIA 2BFMA 2JHFA 4NI5A 1PSDA 1N1EA 1Q7GA 1QLHA 1DC3A 4XGIA 3AFNA 3M2PA 4MINA 3WWZA 2YHUA 4GX1A 1E3IA 2D5AA 3ENKA 3DZIA 4NFHA 4YVFA 3HDYA 3Q0EA 1EK5A 2EXXA 3WICA 2V6MA 1EE2A 2OL4A 2OOSA 1IY8A 1DSSG 3KV3O 2NVUA 2PKRA 3DBLB 3PEFA 4TROA 4E13A 4I5EA 4BMVA 1JN0A 3W8DA 4GSLA 1VKOA 2AE2A 4CQMA 4WCFB 3IDSA 4BNXA 1JKIA 4BIIA 3RUFA 2BGKA 4IIUA 3ST7A 5ILOA 5JY1A 1LNQA 5A9RA 1PS8A 1E1MA 3GN1A 5F5LA 1U1IA 3HB4X 4ITUA 2GR9A 3D3WA 1ID1A 2GO1A 2VUTA 3DAPA 3UW3A 4RJTA 3NUGA 3PVZA 4CM3A 4BHTA 3DEYX 3GDGA 4LVCA 1GUZA 1LDGA 2E82A 3JYPA 4RPLA 1TT5A 5T8KC 3GZNB 1GV0A 5C7OO 1IE3A 3NV9A 3DTTA 3Q9UA 2DPHA 3AUUA 2HCTA 1E1NA 4YPOA 5FI5A 3SLGA 3I9KA 4ZQEA 4DIBA 2DU8A 3ZNQA 2NQTA 2YDXA 1OC4A 4CMKA 3RVDA 5JYEA 2P4HX 5A3VA 4DGSA 1U3UA 4UVHA 5L4SA 1O89A 1LQTA 1V3VA 3DOJA 4FSHA 1CDOA 3HUDA 3H5NA 4R68A 4NR0A 1AHIA 4NBVA 2NVUB 3GG9A 4QX6A 4GLOA 3CZRA 3VZPA 3F4BA 4YJHA 2WSBA 4CQMB 1ZXLA 4XYLA 3AI2A 4BS9A 3AWDA 2C5AA 4FQ8A 3B6ZA 3WFJA 3WWYA 1L1FA 1OBFO 1IPFA 4LN1A 4EEZA 2OP0A 3D3WB 4MVJE 4NU5A 4OOEA 3QRWA 2C59A 2SCUA 4LISA 3KTDA 3EVTA 5JCJD 2XOXA 4HP8A 1ADCA 1P0FA 3RFXA 4D3FA 4YT4A 4PZDA 5JS6A 4YQZA 4NJMA 1LEHA 1QORA 9LDTA 1HDRA 1YQDA 4WEOA 1N7GA 4UAGA 4AJ1A 4B3HA 1VSUA 2RH4A 4NK4A 1U5AA 3V2UA 1ONNA 1Z73A 2IEDA 3ZV5A 4O5OA 3ZU2A 1YL6A 3GA0A 4CM5A 5L51A 3GH3A 3QY9A 4IMRA 1ZFNA 3K96A 3P5SA 1T2AA 4XCVA 1LDNA 3E18A 4QECA 4PVCA 1RYDA 3VPHA 2PKQO 3ZDFA 4ND3A 1HDXA 2UUOA 2BLLA 2WE8A 3EZLA 3ICPA 1V0JA 3I1JA 3JQGA 4BKQA 5KJ1A 4RLSA 4O6VA 1ZEJA 3H3JA 4Y8VA 2YHIA 1PX0A 1W4ZA 2Q46A 2QIOA 3NX4A 4IDCA 3WGYA 2Y68A 3TF5A 4FCCA 5KIAA 4H15A 3L9XA 1ONPA 1SB8A 4YA6A 1ISIA 4NJMB 4NPCA 2Q99A 5IN5A 3ZV3A 4BGUA 8ADHA 2EF1A 3FPLA 4HFMA 1B14A 2CFCA 1K6IA 2J5KA 2XXJA 3P2OA 3TZ6A 5DCYA 3AJRA 5COQA 3OJOA 1HKUA 2UYYA 4K6CA 2GUGA 4YB8A 5JAIA 5TIIA 1C0KA 4BOYA 5JY6A 2QX7A 2OHXA 4O59O 4WECA 3W6ZA 2FPPA 4MKZA 4A2CA 3BTOA 1C0LA 2IZZA 2YZ7A 1E3JA 3S2FA 2RCYA 4DVJA 2I3AA 2OORA 5GZ6A 2NTVA 4MP6A 4II3A 4RF3A 4D0SA 5ES3A 3A4VA 4CQMD 1PGJA 3UCXA 4Z9XA 2EHDA 1XQ1A 3OSUA 3NYWA 5DBIA 4GPD1 3WJ7A 3JQGB 1Y81A 2G1UA 1DC6A 2BELA 2ZB3A 3HG7A 5ILGA 4BNVA 3FD8A 1XELA 1FF9A 1PQWA 4RDIA 1PU2A 3PFFA 5TC4A 1RM4A 5THQA 1PJLA 1R6DA 2B4QA 5KVQA 3U09A 1N7HA 4BNKA 4JROA 5U4QA 3D4OA 3OICA 1P1KA 2X0NA 2PD4A 2C29D 5A5FA 5ICSA 4L8VA 4WE3A 2NNLD 3FBGA 1TT7A 1WDKA 5JXWA 2X22A 3UN1A 4RGBA 3GY0A 4WLOA 4DL9A 3FNGA 2D4AA 3ZU3A 3ZV6A 3B20A 1X1TA 1CWUA 1UR5A 1NR7A 4RO0A 3R3SA 3UCFA 1T1RA 4AL4A 1LA2A 3Q2IA 3A06A 1T1SA 4UUNA 4YWJA 5LDHA 5F3RA 2VRCA 3CPSA 3ITKA 1PJ2A 2R6JA 3QIVA 1HT0A 3L0DA 2I3GA 1E7QA 1EDOA 2E48A 2ZKLA 3I4FA 4WEQA 1YBAA 3OJLA 3PQDA 4F6CA 3RD5A 1NVTA 3E1KA 4YAIA 3UICA 2RAFA 3KBOA 2VWQA 3RUDA 3ZU4A 2F1KA 5KOIA 1ZNQO 4M86A 4AG3A 4KQWA 1R4MA 3PHHA 1KY5A 1FDTA 2C82A 2DVMA 4M55A 4IDEA 2X9VA 4DRYA 3SJUA 5ADHA 2QZ9A 4B7UA 1C1XA 2BF7A 2VYNA 4LMPA 2JFHA 1A7AA 1Y1PA 4PLWA 1HE3A 1E92A 2PV7A 4Y6SA 3I9MA 3GGPA 2H5LA 5AXCA 3TZQA 1C0IA 2JKVA 4DYDA 4Z0PA 1YL7A 3OA2A 2P4QA 2YDYA 1SOWA 1RM3A 4A10A 3C1OA 3KXDA 2J6IA 3QP9A 4HKTA 1EK6A 4K26A 1LLDA 5HBRA 1AGNA 4JX8A 3KLMX 2VTDA 2AA3A 4L4RA 1I33A 5G0WA 4URFA 4CMHA 1BRMA 1D7OA 3AI3A 2OUIA 1QP8A 3DBRA 1M6WA 2F00A 1ZIDA 3TL2A 4HBGA 4PCVA 4R54A 5IJZA 4I8XA 4JIGA 4H3VA 4KP7A 4PRLA 4KDEA 4YT8A 4IGFA 4W9NC 2BFAA 4AJNA 2Y0DA 3OIDA 2G17A 3PTZA 1P0CA 2X58A 3U4HA 4I5GA 2DUWA 1PJSA 1R4MB 4I9HA 5DT9A 2TMGA 3TL3A 1PJ4A 3RFTA 1EVIA 4H16A 5IDYA 2P9CA 9LDBA 2HO5A 4WUVA 3I4CA 1E7SA 3TJRA 1C1XB 1ZK1A 4DTIA 5L7TA 2EGGA 1EZ4A 4UVGA 2EP5A 3JQFA 2UVDA 2AQ8A 3RBXA 4OQZA 1BDMA 2HDHA 3W8FA 1IL0A 1NVMB 1ENZA 1LC3A 2BI8A 1DLIA 3VVBA 1P33A 2YJZA 4ONEA 3RU7A 1H9AA 1XIVA 3KSDO 1QRRA 4NMHA 3H9QA 3GGOA 3WGQA 3KUXA 4OYRA 3WOHA 4RF4A 3WQQA 3NDRA 1DOHA 1YOVA 3H6KA 2GSDA 5C37A 5I8WA 4BO6A 3JTMA 4E2WA 1R15A 4CODB 1NWHA 1QYVA 3INRA 3ZWNA 3RJ5A 1E3EA 4J1QA 3I9LA 2D0IA 4M1QA 4ZQBA 5T8KA 3P7MA 4PG5A 3W6UA 4YQYA 3Q11A 3GC6A 2XXBA 1SPXA 1D1SA 4N54A 1KVRA 4UEJA 4QO8A 4DC1A 2FRDA 1P9LA 3C7CB 3K2BA 3MCVA 3NT5A 3FI9A 1GYPA 4NDNE 4NH4A 5K6AA 1DIAA 5I7FA 1XWFA 4DIFA 1SB9A 1Y9AA 5BT9A 1ULSA 4D43A 4TZTA 1HE5A 1SOVA 1TI7A 3ZGYA 3LF2A 4LSWA 5B12A 4WLNA 3R3JA 1QLJA 1E6UA 2VHYA 2X5KO 3ZWWA 4RV9A 3L9WA 4IJKA 4O0LA 5CPBA 5FF9A 5F21A 1NTOA 5TRTA 1HDZA 3LT0A 4J7CA 2AG8A 3FHLA 1YOVB 3WIDA 2VUSA 3LF1A 1RM0A 2QRLA 3U49A 2VRCD 4OKIA 2GZ1A 4RLHA 2G0TA 3ONDA 1R4NA 3H9EO 1QYXA 2CF6A 2V6FA 1DEHA 4ND1A 1H93A 2GGSA 4II2A 4OSOA 1SEVA 1QV6A 2QYTA 3RFVA 4PLGA 4XQCA 4GVXA 1O6ZA 5DULA 2DM6A 3TDKA 1U2DA 4B4UA 1ZK3A 1V3TA 4K6FA 1MG5A 4KTTE 3E82A 5A9TA 3S8MA 1BHSA 3ETDA 1O0SA 2NUAA 2VYND 2PK3A 4CMEA 2BRUA 5I7SA 3GRKA 2IZ0A 3KEQA 4NFSA 4NBUA 4ALKA 4JCOA 2P5UA 2CDAA 4ZU3A 4L0QA 2YUTA 2O3QA 5F1KA 5TSDA 4PLCA 3MWDB 2HK7A 4ZRNA 4MVJP 3BTUA 1F12A 3DXFA 3TNLA 4RQUA 4J2OA 4A0SA 4BO9A 1XGKA 2UAGA 3FN4A 4IZIA 4GAEA 2W8ZA 1IPEA 3LK7A 4TWRA 4CV3A 4WKGA 1GQYA 2BH9A 5L45A 3TPCA 4UULA 3D0OA 1DHRA 4M49A 3SC6A 3ZNPA 5EJ2A 1GFSA 3V2HA 3VH4A 3W4IA 3H5AA 1K89A 3AUAA 1B3RA 3L6EA 2GN6A 3VTZA 2BGLA 5HTOA 1GU7A 2GD1O 3DZFA 4KQXA 5B1YA 1PGQA 3DZKA 4LCEA 2X5OA 1DO8A 3AM5A 3QWHA 1UXHA 2PLAA 3WGOA 5FI3A 1P44A 1Q7CA 3WLFA 4BVAA 1ZSVA 5JC1A 3ASVA 4IJWA 1ZCJA 4OSPA 3GVHA 1CYDA 4MP8A 2Q1SA 1VL8A 5COAA 2OBNA 5JAQA 2AHRA 2I65A 3IAHA 3KRTA 3JD1A 4IS2A 1KYQA 3HWRA 1E77A 4PG6A 1NXQA 2B35A 3VOSA 2JCXA 4GH5A 1YBVA 5IXSA 2BKAA 4CQLA 3AM3A 1H9BA 1T2EA 1CERA 2ZTLA 1ISJA 3C1TA 3NJ4A 3I52A 1YDEA 1Z6ZA 3H5RA 2A94A 4RPGA 1X15A 1EFLA 1E3SA 3PJGA 2GRAA 5BNIA 2JFGA 4QT0A 5CEEA 3AU8A 1F14A 4N7RA 4XRRA 3GHHA 1ISFA 1PL6A 4BGEA 5JO0A 3DZBA 3BMNA 1RM5A 4FJ0A 5HS4A 5KKCA 4J49A 2EJWA 4B4WA 4BO2A 5L53A 1UP7A 1FMCA 2TMDA 1PL8A 1WMAA 3PGXA 5T67A 4QSMA 5A4DA 1I8TA 3JCZA 4JP3A 4J4BA 1J49A 5T64A 1YS4A 1BTOA 2P9EA 5DCWA 3EHEA 4C4OA 5BSHA 4E21A 4EI2A 4R41A 2Y1OA 1UP6A 3A14A 4IPTA 3L6DA 1PZGA 1EMDA 3QWFA 5C7IO 1I0ZA 2B5VA 1XSEA 4DC0A 3WBBA 1HYHA 4PG4A 5JCXA 2CDCA 1IOLA 3WJAA 3WTBA 2VWGA 3EMKA 1MV8A 3K8ZA 3OBBA 3BYZA 5KVVA 2O50A 4MIOA 5ITVA 3VKVA 1UAYA 1GPJA 3G79A 3UHAA 1WLYA 4XDZA 4ZQHA 5FYDA 3VZSA 2OBYA 3PYLA 1A9ZA 3HSKA 4K9DA 2A92A 1NP3A 2O7SA 3DWFA 1HRDA 5FWNA 3DHYA 3HFSA 2EV9A 2IDZA 4BKPA 1H94A 2Q1UA 3PYXA 2D59A 3E03A 2VHWA
chains in the Genus database with same CATH superfamily
3M5DA 4F38A 3K31A 3B6JA 1E1QA 4Z7OB 4JEUA 1UBFA 2CUNA 2H9AA 5BOSA 4AP9A 1C7FA 3FHTA 3SNKA 1PUIA 3FTNA 4L5YA 3N2KA 4IQGA 4U3JA 4ZQCB 3P26A 1S0UA 4G67A 4D3YA 1FUEA 3BL8A 1N4AA 4DIUA 5K3SA 3WA7A 3QG1A 4PNZA 4XR9A 1A0OA 4LI0A 1OPRA 1L8AA 2V59A 1N3LA 2PWBA 1ZA1A 1RE1A 2P9FA 1RWNA 3QE4A 4NBRA 1B41A 1K8RA 1O58A 1Q21A 3PE3A 3ZKAA 1IJKA 1VE5A 2ZBDA 3FAKA 3HB7A 5ALNA 1JAYA 4D9HA 4KYTA 1P62B 3ZKWB 5HYVA 4RPCA 3H99A 4D81A 1C7IA 1JHZA 1M8GA 3IC5A 3O7MA 3DZDA 3VNSA 3ECSA 1JXQA 3NT2A 2YCBA 2HRQA 1SU8A 2W98A 3KO8A 2X2EA 1Q11A 1IRXA 4C08A 4WXYB 5AJHA 4BNNA 3VKUA 4YPVA 1L5MA 2EHJA 2CV0A 1QRSA 3SXUA 4HD8A 4NYJQ 4HUQA 4EY6A 5IWCA 1MRZA 5DX1A 1LU9A 3FYSA 3GF4A 4BX2A 1VG8A 4KUHA 1XAIA 1CEQA 1UQTA 3OEWA 2DPMA 5JLAA 4H7EA 1ZONA 3RJ9A 1CCWA 4HH3C 3L4KA 2C0QA 3ZK7A 5HK9A 2YXDA 1D5WA 2XSZD 4DJTA 1WVMA 5AUPB 4M1KA 2AC7A 1TM2A 3G8AA 3HM2A 4NK5A 4ZEWA 3PB3A 5C4GB 4DTCA 5HQTA 2HB6A 3ADCA 2BGIA 2Z08A 3P9XA 2VHQA 3WGMA 1Y1LA 2O6LA 4DS3A 1SA0A 1Q0LA 2PUHA 3BCRA 3T1NA 1DC4A 2WZQA 3F46A 5KQMA 1KC1A 2YJ3A 1H22A 3GVCA 4DMLA 3O38A 2ZVJA 1QH9A 4AUNA 5CVTA 4HDOB 1SNYA 2D8AA 3DOCA 5EIXA 4F7WA 4PY2A 2AFHA 2P68A 1X77A 1IXYA 1B1AA 1Z4LA 4ALIA 1NHGA 4UUOA 3SR4A 3T34A 2D3WA 2FGJA 2GA9A 2FVYA 4KO1S 4Y2SA 4L6CA 3DEIA 5BWLA 3AP2A 2E37A 1JLLA 4DUYB 1ZUNA 4P9NA 1FFYA 2ORIA 2IEBA 4GECA 2FQXA 3D8RA 4BLPA 2ONJA 4L6AA 2AW5A 3I5UA 3Q1LA 1GN8A 4A5SA 4DG9A 2O4CA 3C97A 2VPQA 3KZ1E 5TPWA 4D8YA 4Q02A 1NOKA 1S8FA 1T10A 4NE9A 2ZS9A 2VVTA 2PANA 4PGMA 2VPXA 3UIEA 3H1PA 5CDGA 1T3LA 1NQ5A 2H6EA 2I2CA 3D8UA 3PPXA 4MVJF 4BVFA 2QUBA 5JDIA 3BG5A 5JROA 3HA7A 4FQ5A 5KYYB 2PZMA 4ALNA 5IF3A 1DKOA 4HEA1 2O1EA 4KU4A 1S1CA 4HDCA 2F3PA 4L5IA 4MULA 4EY7A 2P90A 1YZUA 3C3JA 3TOZA 3WZ2A 4OBWA 2HU7A 1JXMA 1R0RE 3LUDA 1EUZA 2V55B 4RZ3A 2M6SA 2NTYC 2F55A 4EARA 4DDUA 4XUCA 3TOVA 5B3LA 1L7AA 3AVOA 4CMJA 4MGKR 2ZUWA 4K2HA 121PA 3CIFA 3TZCA 1AJEA 4TXMA 4D9KA 3G8YA 1SZJG 1VKJA 1Z56C 2JJ8A 3H1FA 2R44A 2GHQA 4AP5A 4DXHA 1ACMA 3ECCA 2BGMA 1Y3IA 1NBAA 3KFXA 1SCDA 1J0CA 2MR6A 2VT2A 3Q10A 2ZUBA 4KZPA 3LM8A 4LXXA 1WPQA 4LJ6A 4WZAE 1KQGA 3KDSE 2B25A 3ZS8A 1LW7A 1OI4A 1FQWA 2LV8A 2ZYUX 4V2UA 3K09C 3RUHA 4F9EA 2UYQA 1EGHA 1OW3B 4PWYA 3DQZA 2BEJA 3ILHA 3S8YA 3KT0A 3VZRA 2L42A 1PR2A 3Q9NA 3V4OA 1TM3E 3D8SA 1CQJA 3OTWA 2IOFK 5F35A 2UXCB 3QNMA 3LA8A 5I9TA 4W7IA 3ANYB 1S1MA 1XRLA 2CJPA 4N8SA 5T5QA 3VJKA 3BK7A 4PFSA 4FFBB 2W6ZA 4OL0A 1T8PA 4CIWA 2F62A 1WKBA 2CVQA 4RTQA 1Q3KA 1RXVA 2P5YA 2QW0X 3B3FA 4Q3LA 4GP6A 2EWVA 1P7VA 3S27A 4L0DA 2GF9A 3PDWA 3ZHRA 3HR7A 2VAWA 1Z3CA 5FPSA 3UATA 2Q3EA 2VEDA 2REBA 1Y1QA 3OQIA 4D57A 4OM8A 2FHPA 2A57A 2PRKA 4E5YA 3E6AA 1BS1A 1BU8A 2RGRA 1Q50A 1PR0A 2WYUA 2VJMA 4KR2A 1E1QD 4JUBA 3UHPA 3MT0A 4ALJA 2Y0PA 3ZGYA 4BNGA 2O54A 3WXBA 4DZRA 3QW4B 1U9JA 2D74A 3A3NA 1K7XB 3MCTA 4PFJA 2FVXA 4AQ7A 1PEDA 3L1UA 5LLSA 4JWTA 2BFEB 4AZVA 2AOTB 3NTQA 1QVRA 4JA0A 3SBEA 4E11A 1OFUX 1D6SA 2JCGA 4MYTA 2QLTA 1NPTO 3FUUA 4BLQA 4BUZA 4TN1A 1COWA 2O2DA 5DNDA 3V9AA 4EW3A 5KJCA 1RE0A 4KJZA 3V4SA 2JG3A 3P71T 1VRWA 3BMOA 3WLPA 5L6LB 1P2UA 3P94A 4EG6A 3E8XA 5KYUA 2QL9A 1S7GA 3PQEA 1WPXA 1PV2A 4BNYA 4HT3B 1UBJS 1IY1A 1KVTA 2XCQA 3NRJA 3TRFA 5C2JB 5K8TA 1OFTA 1NF9A 2DTEA 2NXCA 3PPIA 3T99A 4QOFA 5CH5A 5G2OA 3V6LA 4QASA 3P0HA 3OU2A 1YWGO 2Z6VA 4IV0A 2FX5A 2G8LA 3GDWA 3W8NA 4DR3B 3OZXA 4R5HA 3NRCA 2I62A 2EFEB 2X9NA 3MCWA 4RUKA 1VDZA 2XVMA 4WXRA 1GNRA 3DOUA 1ENOA 4GGPA 1Q7EA 2QR2A 1R8QA 4PS0A 3SF8B 3NVKI 3IEXA 3D2CA 1I7NA 2IV2X 3REQB 3VVLA 1J21A 1GEEA 3EIUA 5NULA 4DCMA 4I1SA 5FEUA 1YKSA 4TTIA 4U6QA 3LQ2A 4XQGA 5FOVA 3NHUA 2A78A 4YAEA 2DTXA 1NBMA 1UOPA 2GEDA 2POCA 3INGA 4GEGA 4W8GA 2ZJOA 5FB3A 3PSAA 4Q05A 2O8EA 4KPUA 1ZOOA 3H17A 3THSA 4L57A 4K0KB 4MOWA 2ECKA 1MAUA 2J3EA 3A3KA 4EPWA 4XFKA 1P91A 2X8JB 1PGOA 2F3TA 3F6SA 3BXEA 4P3NA 3GN2A 3IE0A 3L84A 1GKIA 5F1PA 3I9V6 4OPMA 4R1MA 4DHEA 4P84A 5BXYA 3F4LA 5IKEA 4OHFA 3L06A 4OQ4A 4DWVA 2HJVA 1GARA 3KYJB 4QUJA 1B00A 2VDUE 5EQDA 5L6MB 3GXOA 4BVGA 1GZDA 2HQOA 2WRZA 4Y1GA 5CXQA 3PUVA 3HRHA 5FTLA 1JALA 2LCQA 2NXJA 1FSFA 3P4UA 1IHUA 3NLLA 1XFDA 4FOLA 5T41A 5EJ8A 4EENA 1GDTA 1RTTA 4CV1A 2QMHA 3MJDA 1IHPA 1OIVA 4BVHA 3K9FC 2QYOA 2WMNB 3K6RA 4E46A 3AP3A 2AQHA 4DCUA 4M1MA 1VFNA 2RGUA 4F2WA 5AHWA 3FOFC 4LJYA 2AFIE 2QN6A 4AVYA 5B7QA 5JAZA 1ZH0A 4JASB 4QGBA 4BJ5A 3KQLA 1NG9A 1OX4A 2IHTA 1QIJA 2I9PA 4RK5A 4WFKA 3GNLA 4RK4A 4NBLA 2HLNA 1S5PA 3NWPA 5IPFA 4GPTA 2WJPA 1X7WB 1N4DA 4L7VA 1IU9A 1JU4A 1IIRA 5JW6A 2H1OA 1KZ6A 1KP3A 2G06A 2ZJ6A 1VKNA 4K2AA 5KQRA 1CVRA 3SYNA 1JF8A 4JBXA 2ZBVA 3X1MA 3OQJA 4GSYA 3OTQA 4QYMA 2XE8A 4BQNA 1BGVA 5BN5B 4DQ0A 4KL8S 3FXAA 2Q9AA 3DAFA 3TZBA 3H9UA 3Q2KA 3URKA 1F1JA 1PFKA 3ANMA 4DBVO 3IQHX 4UAUA 2F1IA 3GJ3A 4L3WA 3DE0X 3MMNA 4H6WA 1W47A 1JHQA 2GPWA 2ZU0C 1YL5A 4JNKA 4L4XA 3U7JA 3MB5A 3R5FA 4B7AA 1O08A 1U3GA 2QNRA 2FFRA 3UY4A 4Y2TA 1FP6A 3ZXYA 3ZX5A 2A33A 3CINA 4JT4A 1C3XA 4G5XA 3WC4A 4UNRA 4OGWA 3OHMA 5EIEA 3T5AA 1AV7A 3VO8A 3L5KA 1YIDA 2FUKA 4LHSA 2ARKA 2PS3A 3NI2A 4G0OA 1A5BB 1NTRA 5H70A 3RVQA 2R86A 3ZHXA 5BT8A 3G2MA 5CT5A 4B3GA 1JIIA 1T6NA 2HHAA 4YBZA 3B1YA 4E2XA 2NUTA 2GEJA 5EP1A 4XRGA 4HC4A 2C4KA 4WASA 3KPUA 3W90A 1X2BA 2JJYA 4G86A 1P0PA 3Q6MA 4KI0A 1PEAA 1OXTA 3U7FB 3HFJA 2FXVA 4ZIRB 3IP3A 4R1OA 3L1IA 2C95A 4ZGBA 3U13A 1PDOA 5HOEA 1KO7A 3KT3A 1XCLA 1OU4A 3HK2A 4XB2A 1QYRA 2P35A 5IT5A 5AM3A 2FG7C 1MMFB 2G4CA 1QR6A 1TE2A 3DMPA 5BWMA 1ZH8A 3H04A 1QR2A 2QTVA 3CTPA 3ENWA 3R20A 4AJPA 1E6CA 2O48X 4XWWA 3V4RA 1ZJYA 3NJRA 3LT1A 1NZDA 5ECDA 1GRVA 1R10A 3OE4A 1G63A 1VL6A 1Z37A 4NEHB 5TQ2B 1HF3A 3CVOA 4XWOA 5D51S 3V4ZA 2FJUA 2GDZA 3VH1A 2ZJ1A 3NOQA 3ZD8A 5EJ7A 4YV1A 4ZOLF 3BTSA 2VPZA 4C4YA 2CT8A 5LOVF 3AONB 2P2ZA 4B7CA 4EA9A 1HE1C 2B1GA 1VBFA 2VNIA 1XCOA 2YZNA 3AI1A 3CH6A 4ND6A 3HVHA 4RA6B 2VJAA 2ZR8A 3V2GA 3FR7A 3R44A 3N3AC 3TQHA 5F9FA 3FOEC 1UFKA 3F3MA 1ZBDA 3HR8A 4TRJA 1K66A 4HDRA 1VI6A 1I2ZA 2CWWA 3MCAA 3ZCVA 3KSBC 2ZROA 2EBFX 4BKUA 1AQIA 1MA3A 3TLCA 4Q16A 4YRAA 4DG8A 1T24A 3SQXA 1NKSA 3RC9A 3JSXA 4LVUA 2ON6A 3KQYA 1XRSB 2TRSB 2QQEA 2G8NA 5TVKA 1I3LA 4P3YA 4U7JA 3L8MA 1ZW1A 4X6UA 3T7SA 4AJJA 2EZTA 2OK7A 3LLMA 3S81A 2XMBA 4TTJA 3BF7A 2R4QA 2RIRA 2EKQA 1FLAA 3A6FA 3M70A 4M53A 1VLHA 2W6QA 3BQMB 4O29A 5IDQA 3ML1A 2VHVA 1EFPB 5JUWA 4YLEA 4ENQA 4TQUS 1WEKA 4CKWA 2CXXA 4C3UA 3KFVA 4TUYF 3NTUA 4A0FA 3U4CA 2F9FA 1NPYA 2AI1A 4CV0A 1YCGA 5DNAA 1NJSA 2GJ9A 1DQPA 1NBMD 4RK0A 2FY8A 4F1WA 4JU8A 1UXJA 2OLKA 2VDWA 1JT9A 1COZA 4IKEA 4WIAA 2WSLA 1PNRA 4OJYA 2IBTA 4BWVA 4DCGA 2RHTA 1SD1A 1BOFA 1U7TA 2JCVA 5E4FA 5ARCA 4Q0MA 3KOMA 1J70A 3RTAA 2ZSUA 2XZTA 4MWOA 4AKGA 3Q1KA 2HFKA 3OC0A 1WDLA 4G1FA 4HSEA 2YASA 4AMGA 1W5TA 5HQ3A 5L4SA 3AVVA 1R16A 1OFIA 2C99A 2GZRA 2JS7A 4MQMA 4YRCA 2ZRLA 1U2EA 4B7ZA 4TM7A 1AKTA 1PYDA 3Q3CA 3GJ5A 4L8FA 2E5FA 3OCVA 1ENYA 3B5IA 1P1CA 4Q4AA 4EK9A 2YBDA 1JR3A 2WT9A 5F73A 3O8BA 2PLFA 3JQ9A 1LF5A 4YROA 4EG0A 4QGFA 1AHPA 1REQB 3IFSA 1JIQA 2VRBA 2A7XA 5IVHA 4RF2A 2WG2A 1QO7A 2D5CA 2Q9BA 3QXHA 4DWJA 4RGVA 3LT5A 3OE1A 3HLKA 4YCLA 2BEVA 5FNVF 3X2FA 3FCEA 1XLTC 4G0MA 4PG7A 1Y48E 2AEJA 1BXKA 1OBVA 1NUHA 3GYBA 2IEYA 1YONA 2VXBA 2HMTA 4QODA 1GXSB 2EQ5A 1JSRA 2GZAA 3QBDA 4OK3A 3RS3A 1CS0A 2IEIA 5HM8A 4DJ5X 5FO1A 4DBLE 2FW6A 3JWIA 4RIGA 1CEEA 2IJGX 2YFHA 4JSYA 3U4MA 3MJCA 3H65A 4PZPA 4OLHA 5FUYA 4RV4A 4D1YA 2P9JA 1JJFA 5TGDA 4WJLA 3VC2A 1KI4A 3LDGA 4X6XA 4U02A 1KU6A 2CK3A 2EIHA 3GLQA 2QNIA 3VR6H 1E4OA 3GMSA 5IVPA 2FSGA 2RKOA 2WKSA 3K9HA 4E6EA 4BU0A 4F71A 2HPHA 5EXTA 4BNLA 4LKRA 4X5OA 2PR2A 5IFLA 2X3UA 1SVLA 3EZ9A 1BJKA 4R83A 5H16A 4E5NA 3IL2A 4LRYA 2PKCA 3KSRA 2R00A 1FPQA 1P1JA 1L2TA 5JJIA 3PGLA 3D6MA 3HDJA 2MSDB 1ABFA 4LYGA 4PLHA 4C6SA 1VDMA 4RMJA 4BFSA 4MVXA 4MW2A 4LDJA 7GPBA 4EJSA 4BWYA 5FOSA 4BFXA 1E0JA 2UDPA 2HBZA 4BEJA 1QIDA 3RTEA 3QX3A 1R64A 4Q3NA 5FBWB 4EGFA 4A6DA 3QKSA 1XUOA 2GAAA 4PZCA 1N6LA 2L19A 3GRUA 1EE9A 3LGAA 2YZMA 4IDAA 1UXIA 2B0CA 3K9CA 1U3TA 4D4HA 3AHFA 5KX5A 4H1WA 2ZSDA 4EGSA 2GKSA 1OI7A 4UBMA 1LPOA 2GF2A 2XYGA 4MGHA 4IUYA 3DO6A 1N7JA 3C1UA 3AUSA 2VATA 1VIMA 3AF1A 1HI9A 1QFMA 3DNPA 3HJHA 3S5JA 2Z8YA 3EYWA 1GZUA 1KI8A 2XHEA 4HAYA 1J8VA 4A82A 1FP7A 1R0ZA 2Z2ZA 4RY2A 4LGCA 2HUPA 3SYMA 5KPDA 3HBJA 3UXEA 3K0AB 3LA6A 3K70B 3SHOA 1JTFA 2JANA 2Y3IA 3AESB 2NPIA 2JVIA 2ZIFA 3SAJA 5CFRA 2IE0A 3CN9A 5JRJA 2MYNA 2F17A 1Q83A 2B6NA 5I7EA 4EFDA 2CLSA 5E2AA 1GG2A 4EUFA 1SCJA 3KJEA 4FDVA 2MYPA 4EYEA 5ITSA 2ZKIA 2XCTB 1TYZA 1YDWA 4FT2A 1TM1E 3F74A 2P78A 1IG0A 1I4LD 1B8PA 2FMKA 5DYGA 4V1CI 1YJQA 2A6PA 3ZJYA 3ZCRA 3GNTA 3BIOA 5BV7A 1N5LA 4AUMA 1SCBA 3NXSA 3PD1A 4CM1A 1CE8A 3P2JA 2DWPA 3UHOA 1XDBA 1A7KA 3MFQA 2NNWB 1VHLA 3WLNA 5F3DA 3MM4A 2RBGA 4B74A 2V4ZA 3A2KA 3SZRA 3V4FA 1VJ5A 4BNDA 3TEFA 1BE1A 3D5TA 2JARA 3WNVA 4HTFB 3C98A 1NVBA 1W52X 3FYUB 2WMOB 2WHPA 5FTWA 3SIRA 3KZMA 4K03A 4WKNA 1OTXA 2PXHA 4UW9A 1RWPA 2BZGA 2OCLA 3R5HA 1Y8CA 2FPMA 5KDLA 3VC7A 4K9KA 5TMDA 4B81A 1K2WA 1ZZEA 3USCS 3U4QA 3DZHA 3EQ9A 4WCVA 4IIJA 2FLKA 3FMOB 2AN9A 4LXHA 1KZYC 5K45A 4G0PA 4HI0E 4U7GA 1DGQA 1JIUA 4RWZA 3ROQA 3RYTC 4AJIA 2I2WA 4CDMA 1SBIA 3DDCA 3EVGA 3BICA 3NPMA 2J09A 3TLGB 4QYTA 4BLRA 7REQA 4R51A 1DXHA 1FUYB 3KJZA 2V7WA 4FWTA 3OIFA 1WHTA 2YC4C 5AW9A 2ZLBA 5F2KA 2EEZA 4DV2B 1DINA 2QE6A 1XMPA 1RYBA 3ELYA 3PNQA 5FQOA 3VA7A 1P77A 4PHCA 1JR3D 5EMKA 5F5XA 5FWAA 1CIPA 2GM5A 2V96A 4R9RA 1OHHA 1EEXB 3OM1A 4ZAZA 5JASA 4CCYA 1XX6A 3MOGA 4WDQA 2RGNA 4HUTA 5JI2E 4S1TA 4CMAA 3DD1A 2RHOA 2XMCA 3HFRA 3P2IA 4R8MA 5JZ9A 4MDYA 1MZPA 3VR1A 3COPA 4CLDA 3TXXA 2I7DA 1KQPA 4ML3A 4RKRA 3DLCA 5BSEA 1ODJA 1QIHA 1PWZA 4GP9A 3PWKA 4P98A 4RORA 5K3DA 5IDWA 5CHYA 2D6FA 1XQ6A 2JGAA 3OPYI 3A6HA 4WK6A 4Y0AA 4CL0A 4ENVA 2I6QA 1N2HA 1T9AA 3HXPA 3RAFC 5CFPA 1K86A 1M0WA 1MP0A 3OH8A 4YCBA 2ODAA 5TLSA 2HLPA 4YRGA 4AJLA 1HRKA 2P4EA 5BR1A 2XHZA 1QVZA 3QOXA 4DSZA 1F9EA 3UOAB 4UBOA 2DFNA 5G4LA 3UG7A 2C8JA 2DUJA 3HN7A 3N8HA 1C14A 3N8KA 1M2VB 2Y67A 1P17A 1X0XA 2CK3D 1JLKA 2Z3VA 5K6RA 2PEYA 3LY7A 2G28A 2HD4A 2WWRA 2G76A 2Z30A 1KMNA 2BC9A 1PJ3A 3A3YA 3G2JA 3MPOA 1MKYA 4UBJA 2BHTA 2GN0A 3CX3A 3RUIA 2CYBA 5JFTA 3DCNA 3ND6A 3M5PA 2NV6A 4U5QA 2FV8A 4CKCA 2DYKA 3A4NA 1N8NA 3ZIUA 1FU8A 4OHRA 4U2FA 2CKMA 2W0MA 4WCDA 2UZAA 1EUDB 2WZBA 1A8UA 4BMCA 1KI3A 1PEYA 5JV5A 1ML3A 1BA2A 4CG3A 1F6DA 4DOMA 2J6CA 3RYIB 2IIVA 3FWKA 4O1IA 3VBCA 3GLFE 2GAFA 3A32A 5G4KB 5LYJA 1SWVA 3O1IC 2HMVA 1X80A 4CLOA 4BNTA 4IJUA 4Y2PA 1WSDA 2Q62A 1YJ8A 1BC5A 2RGEA 3QPDA 4KE7A 3FUCA 2CXOA 3OE7D 4B79A 1QRTA 2NU9B 1U7WA 2C8LA 4OYLA 4R6WA 1ABBA 4Z3OA 3ZVMA 3EF3A 3P9IA 4Z1OA 1UMCA 1L5WA 2OOKA 1IDN1 2ASEA 3G5TA 1CR4A 1MA0A 3FOZA 4KLAA 1LX6A 1MH9A 3KKLA 4R3WA 1F3LA 1T4GA 2M1ZA 4A3SA 1UADA 3PF8A 4AJEA 5HUHA 3GBPA 4PANA 4V24A 5C31A 3I0ZA 1NV8A 2XVAA 3H9JA 3I30X 4BPRA 2HMUA 2Q2QA 5LN1A 5DCLA 1KJ9A 4JC0A 1G98A 2Y1GA 3GNSA 1THGA 3TD2A 4ZCRA 3QMWA 4MTCA 2BFCB 4Z0TA 1KZ1A 2II6A 4D46A 5EPUA 2JAUA 1ECPA 2JD0A 3AF6A 5H7XA 4DA4A 5FHRA 1NP7A 1T9DA 2X8BA 1XEWY 1BKSB 2DE0X 5KYVA 2PZKA 1GP2A 1KY3A 5AOVA 3AKZA 2O3RA 3B85A 2HAEA 2O1XA 4AJHA 4YMHA 1UFVA 4WI1A 5J4HA 3ZLJA 3GPLA 1IM2A 1CFZA 1E9EA 1EQAA 3GL9A 1O0CA 1DMRA 3ISTA 4LYJA 2O2IA 1C3OB 5JDCC 1TTTA 1M1YA 2A58A 1W88A 3HSYA 2AXEA 2V1XA 4LNUA 4XDGA 2YOGA 3CJTA 2ZIVB 5DP1A 4G5OA 4TRRA 4UNPA 5EUBA 3RIEA 5C8VA 1CNEA 2CSUA 2F8LA 2Y99A 2EJCA 1NW8A 3ROZA 5D3QA 5K0ZA 4HX2A 3LT2A 2HRRA 2DQZA 8AT1A 3O6VA 3T8YA 4OK5A 4PN7A 1RBMA 3G23A 2DERA 2LPMA 1VE1A 3JTEA 1EM6A 1YS6A 4UEOA 1N3IA 5FOUA 2YWBA 4P3OA 2R85A 1T36B 5BN1A 4US2R 2I6GA 1M0TA 1YFLA 2A5FA 4HPXB 1KIFA 5DCUA 4CMIA 4NZPA 3AIOA 4PAWA 2IP1A 4MI9A 3TKAA 1E5QA 3IOEA 4ZYWA 5BSWA 4MPJA 5BW8A 2H2WA 2BMDA 2SKCA 3SLRA 1ZM9A 2ZE7A 4YRLA 3CEJA 4BLUA 2QU8A 4DLWA 4QKQA 3UJ3X 1XU4A 1FDOA 3IX7A 4Y6RA 2PVCA 1BMQA 1TQ6A 1AQYA 1KERA 4FDMA 4HDKB 1QB7A 1XZCA 2G4LA 2W2QA 2ZRKA 3DVLA 2QT0A 4H1VA 3QPAA 3WLAA 1GGMA 1SXJB 2OFFA 5CHEA 4F9TA 2ZIGA 3N0RA 1D6JA 1UPUA 3OZIA 2GDJA 3ZWYA 5MF6A 2NZXA 2JFWA 3EVEA 5EQTA 3T5BA 4KBGA 4JI5B 5KNCA 4N3BA 1M2JA 1NRJB 1OHHD 1BQ3A 3CVVA 1I24A 2XH8A 4PYLA 3PC6A 3ZU5A 4D9NA 2MR5A 3ANTA 4OXYA 1A2OA 3NJ8A 3WR5A 4BFZA 4N82A 1BCRA 3THWB 1KDOA 1GYRA 1TM7E 1WLSA 5B3KA 2JLZA 1N2GA 4YYZA 2CZQA 3GAFA 4ON9A 4IHJF 2HPVA 4RQAA 1ZOSA 1LCIA 3EX7C 4C88A 2X0FA 3F7TA 5C1OA 3LO8A 1V8FA 1S96A 2GJKA 4I36A 5A71A 1I2DA 1YZFA 1NW5A 4KAAA 2WF5A 2Q5QA 4JJGA 3C3PA 4PLZA 4ZOAA 2OVBA 3DCYA 2BKLA 1ZMOA 2N9UA 3HYNA 3I2KA 3LL7A 2RGGA 3EDOA 3MAJA 4WY2A 2CMFA 3LW8A 2HF7A 4XUGB 2ZE8A 2RK3A 4JSRA 4BFWA 4PR3A 3E9QA 4V39A 1L5KA 3WV4A 3H0EA 1PSZA 4OUDA 1OQAA 1NR1A 3P9PA 2CJWA 1QTIA 1OGYA 2C7VA 6ABPA 1PWHA 3ZX4A 5KMGB 5IKMA 1RACA 2Y1LA 4FFWA 1EUCB 4FR5A 4OATA 2AIRA 4G9GA 5AW4A 5CX1B 5HIMA 2C5SA 2CL6X 4OJMX 1ZK2A 3W2TA 3WDSA 2FP4B 3WNDA 4ZMRA 3SR3A 5JRDS 5JSFA 4PGAA 3UMSA 5AO9A 4FI3F 4GZ3A 1E5LA 2XUPA 1SU6A 3MLBA 3GEGA 1RKXA 1SEPA 4RKFA 5SZHB 3D7SA 5HE8A 4RTLA 1FU4A 1IHYA 5TF0A 2VQ3A 3KOYA 2F6RA 1HEYA 1NI4A 1XZBA 4GFDA 4HRAA 4I4CA 4O2AB 5H3HA 1YCFA 2PWYA 4B4DA 3IODA 2WF9A 5JD5A 4B6OA 1L5LA 1MDFA 2FLVA 1K7YA 1NT2A 1ZXBA 3PHIA 4ZXFA 3S8EA 3GP8A 1EHCA 5PGMA 1Z6GA 2CNBA 2PM8A 2P8JA 4BWGA 4E5DA 1X39A 1FDUA 5DYNA 4GWLA 4BP1A 1Y1RA 4DQUA 3LLVA 2GB4A 4A8PA 4UEKA 1IUOA 2HA4A 4P35A 4M1OA 3P4YA 3RDPA 1SKQA 2VK2A 4QOEA 3COJA 1IJFA 1D8AA 5BSMA 5BQXA 2WSYB 3WLLA 4F3KA 3DMDA 3S70A 1PHRA 3SVLA 1W76A 2FPXA 1VIYA 4GPIB 1MFPA 2Q9UA 3E15A 3IOMA 4HJRA 4TYPA 4XJVA 4ICIA 3WYCA 6Q21A 4XGKA 1L7VC 2RHMA 3A31A 4ESVA 2PAFA 2AQKA 1ZUD1 2R96A 2W90A 4L73A 3PD7A 4EATA 4A36A 1TEVA 4KIFA 1KEUA 2FQYA 3L82B 4QTXA 1FDVA 3QVXA 3UJPA 3C16C 4W7HA 3NFRA 3ZOZA 2V3CC 1I4WA 3EA0A 2Y8EA 3WTCA 4O8ZA 1E98A 2GRUA 2J59A 1C9NA 2UYOA 4IDQA 3FNEA 1D4FA 4F3CA 5DNYB 1Q0HA 1VE3A 3QWIA 3ZS9A 1ZM4A 3GUZA 1CY0A 4ROTA 4RY9A 3OSZA 1RRVA 2MINA 1L9KA 2LNDA 1VB5A 4NTZA 5KJ6A 4NXNB 1ADJA 4NATA 3RAJA 2OB1A 2HU8A 2VDJA 2GAIA 3EGDB 4K87A 4C20A 1Q1AA 2O8CB 5AKIA 4M21A 2OM6A 3T5MA 3AERA 2IKQA 4S24A 2ILTA 1DCTA 3HVUA 3BJIC 3U4IA 2PGNA 1AKNA 1RBQA 4B6FA 2BF4A 1L4HA 4IXTA 1XAHA 1HG0A 2VG8A 3AHIA 1I7PA 3KOUA 1G5RA 3O8OB 4KBYA 1FZQA 1S6YA 2PQ6A 1O87A 2BFNA 3NHZA 4B2IA 4EQZA 4E1AA 2GN8A 2CLIB 2JK0A 4BB0A 1VMAA 1TYBE 1U0OC 5AHKA 3RU9A 4G07A 3H83A 5KO2A 4KQIA 1KMMA 4E5SA 3OQ1A 1MUUA 4FHZA 4KE8A 1QHYA 4CR7A 5MFPA 4JELA 1Y1KE 4NPHA 1U7HA 3C43A 4L4YA 1VMEA 3LQQA 4RVSA 5EA2A 1Y5RA 4DA9A 3TQQA 4F3YA 5CVUA 2G5GX 2QUKA 3SFTA 1MV5A 1A9YA 4AB1A 3T12A 1IXRC 1PR3A 3TVDA 3BWXA 5IVKA 1T26A 3ZW9A 3IAM1 3E1SA 1E1CB 2BT4A 3HJNA 1MC5A 3HV0A 1OZAA 4URHA 1I1NA 3RIHA 3VMFA 3U3OA 1IN8A 4M0MA 4MRAA 3R3XA 2HMAA 3LX6A 4Z7QB 2I87A 1J25A 2R6FA 1JVSA 1ZAKA 2Q5JA 5T4FA 4AECA 4CCAA 3E9EA 1PT8A 4PQFA 4Q3AA 3GIDA 3JQBC 5DBHX 2GYVA 4ZVLA 4B6RA 4BNWA 1Z45A 1J8QA 3MGKA 4DMCA 1ZVMA 1FSGA 1CVLA 4TLAA 4M22A 1EGQA 2BI7A 2K2QB 2FAXA 1AH2A 4INOA 2D4HA 3M4YA 4JL5A 4QU8A 3OETA 3RSLA 1Q77A 1DWUA 3L7KA 5L3ZA 1FS6A 2AK2A 4WOCA 1B3BA 2P0YA 3BRSA 4N4AA 5DTIA 1U5CA 3A4IA 4HVLA 4JP1A 2PS9A 3CNEA 4DLTA 5KNCD 2BCJQ 1GZ6A 2D5BA 1KO8A 4DJFC 3IDQA 4D3ZA 3A6EA 1JKJA 1IDOA 1HTWA 4WZBB 4P93A 4DCSA 4ECEA 2FN7A 4NIMA 4DF3A 1NM5A 2JAHA 4CE6A 4JJ8A 1PYOA 1XZAA 5AJTA 1T0PA 3ROMA 4XIGS 3OTGA 4FBLA 3FNFA 4MWCA 3K72B 4AN1A 4O08A 2QRVB 2BEWA 1Z5VA 3E3MA 2E4YA 3OF3A 1YZHA 2I3ZA 3JASA 4TTSA 3FTPA 4JKOA 3TZHA 3LCCA 1EX1A 1OLXB 1WXEA 3SBXA 1IULA 2FZVA 4MI3A 1KI6B 3T7KA 1HL7A 4JIMA 2ZG6A 2C4VA 5CYGA 3DE3X 1SC6A 1RAHA 4RPHA 1AU9A 5H4GA 5KOJB 5BSFA 2C61A 4FLFA 4IOJA 3BH6A 4WERA 3WKCA 2C57A 5AVXA 4G0ZA 4WGFA 1T29A 1ZSNA 3GEEA 2YYAA 2HT6A 3PCRB 4JOSA 4OHUA 4P4LA 3KZKA 4ILKA 1W8IA 4JC8A 5ELMA 3UKOA 4E2WA 3H5LA 4UZFA 5I7VA 3QE0A 3FVTA 1K98A 1N5RA 2BL4A 2QT9A 2Y1EA 1JR2A 1XZIA 1DIHA 4LJ5A 2OAEA 1RJFA 5FKJA 4LQLA 4K8RB 4ZOQI 2Z6UA 4L15A 4X20B 3W34A 2Y1FA 1NR5A 2Y76A 3L04A 3NNDA 3PXEA 4W5WA 3WL4A 3DR5A 5BN3A 3OQPA 4XPIA 4B5KA 2P9GA 4KZKA 3KTOA 4QLBA 1VE9A 1PTJC 2ISSD 2PGJA 3IVAA 4M7WA 4HQNA 3UG6A 3AOGA 2XMSA 1WPGA 2PKYX 3CEPB 1E7YA 1JEDA 1U2ZA 2B3DA 2V0NA 5HJ2A 1FA9A 2GBGA 2B83A 3JZDA 4TZKA 3IUMA 3K5WA 2A86A 4XM2A 4I2NA 4BASA 4BQEA 4PNEA 1AXRA 2OLJA 4HQKA 3D2AA 4QOGA 4RA9A 1HNNA 2YZ2A 3L1VA 2ISCA 3BXHA 3EZFA 5DASA 3R75A 4R4JA 3WO1A 3QVTA 4E5MA 4WLVA 4D2IA 1QGUA 4KQCA 4L76A 3DQPA 1BKYA 3HMKA 3QXGA 3RB8A 1AE1A 2YY7A 5BSKA 2QJWA 4V0OA 1NBOA 5EWJB 2IUFA 3ET5A 4MO2A 1BXGB 4QYWA 3K6JA 821PA 1LKZA 1SVUA 5HZMA 4E31A 2VDOB 2B9VA 4PZ9A 3RSFA 1Y8QB 5T6BA 1XJWA 5GONB 3IXLA 2E4UA 1TYAE 2G82A 3CF0A 3RABA 4E33A 3FBWA 1K88A 1AGPA 4BGDA 3C5HA 1CUYA 3KHSA 1C41A 2G1AA 1LPAB 2ZUVA 3X1DA 2QOEA 5CT4A 1SXPA 3JARB 1C3JA 5EKSA 2XUKA 4Y9DA 3UUWA 1KEEA 2AVNA 3TVTA 2CHQA 1VGQA 5AWFC 5HUJA 3KPJA 4WCFC 1UBTS 3ZDDA 3DHWC 2EW2A 4RX1A 4YT5A 4CR6A 1Z16A 5HCNA 5CAEB 3QSYA 1MGPA 2WFMA 1GAWA 5CH8A 5KWVA 2V03A 4P36A 3O92A 4R8LA 1WO8A 3W79A 3WS7A 5A5EA 4C4AA 2C2KA 3H8SA 2JLYA 4BVBA 4R2HA 4HATA 1RAIA 1FTGA 2EJUA 2ZRJA 3SX4A 3OPVA 3DMTC 5KOHA 4NYIQ 4PXSA 8LDHA 5LQRA 3EEFA 2I2FA 4MV7A 1BN6A 1JL3A 1H6CA 3O90A 3P9NA 3TO5A 1ZIOA 3C74A 4LNAA 3WB1A 4EW2A 3BHIA 4BVEA 2H2DA 2QZPA 4IUCS 5T6MA 3DP7A 4X3PA 1OLSA 2LDXA 4ABYA 4MRMA 4W4TA 3PUJA 4LHZA 2Z8XA 1IJEA 2BEUB 4M87A 2AN5A 4NONA 4C22A 3CLUC 1XR3A 4EKNB 5ADVA 5JAOA 1C8VB 1GGHA 3QKRA 3RE1A 2AEEA 4NJOA 2R6GA 3U4DA 2C9MA 2GWHA 5DTRA 4D5EA 4OYYA 5AW3A 1NLZA 3M1AA 4F6RB 3I23A 5IUKC 4P7KA 3GLIE 4JB8A 2OHIA 3EPLA 2NM0A 1P81A 1OT5A 4Z99A 3VC1A 3N58A 3QUQA 1EGVB 1H6BA 2W22A 3R0IA 3R3UA 4NJEB 4DIMA 4DT1A 2D2IA 1EK2A 5AD1A 3JQ7A 2AFHE 2XJ9A 4A1OA 4EDFA 2BN4A 3ME5A 5K20A 3VXKA 3V4PB 4MS3A 3SHFA 3DBOB 2VUHB 3GLTA 5F2OA 1N2EA 5AI0A 5K01A 3E9DA 2K7FA 1MB2A 3TMKA 3D7RA 1XMVA 4JYPA 4K6HA 4L74A 2R7MA 3LUAA 5EI5A 3U3RA 4MVJA 3TTWA 4CLHA 8OHMA 2BGTA 3PGVA 2AE1A 1LK7A 3C48A 5U4XA 1FMFA 1Z0ZA 3GT3A 3FZGA 4L8YA 4CETA 5HXAA 1HZZA 1XZKA 3DLBA 3GFSA 1CZRA 1TCAA 2OGZA 3FTCA 3NVMB 4B33A 1G7SA 1V9SA 3DOHA 4FYMA 4B73A 4ZT4A 4E7PA 2CBGA 5IXYA 2PEZA 1HE4A 2QUHA 4I3FA 5HTKA 2ETXA 1K27A 2J5RA 2VP5A 2IBSA 3QLEA 5LQJA 2P27A 2JAWA 1QLWA 3L4BC 5EJFA 4CYMA 4BV2A 1SIOA 1V35A 2B2CA 3BK2A 3JY6A 4Z2YA 1HC7A 3RSOA 1DQRA 3GFRA 4KXMA 2B78A 4MW5A 3DMHA 1LTHR 3RWOA 4BIMA 1J06A 2WWIA 3TRDA 4BPBA 1ZWKA 1HDYA 2EZ4A 2HK6A 3D8BA 5K8VA 3T5PA 2HQBA 1TEHA 3A1TA 3CLSD 3KLNA 3GEDA 3I64A 3ENQA 4Z54A 1X8JA 1QHFA 1CRWG 4C87A 3R23A 1MG0A 3A1NA 1XCJA 2PAAA 4XVRA 1WD5A 2LTAA 2GBPA 3K71B 2AMVA 1B6TA 1PW7A 3NZEA 4D3DA 4B6EA 2V65A 1U99A 4BXOB 1K9VF 4A0HA 5L4LA 1Z88A 2CHGA 4I9UA 2BUAA 3E1GA 4QLAA 1KTIA 3FCYA 4FD2A 1Z5PA 2JNWA 4JKYA 4KUEA 4MS4B 1QOZA 3FWZA 5CVEA 5E6RA 3V8QA 4A03A 5KTRA 1W7AA 4JLBA 1P4RA 3EQZA 2IX9A 4Q34A 1Z4NA 3CWQA 5C8YB 1CZNA 5DGTA 6REQB 2NZVG 2ODBA 2IU6A 5JAUA 2FKAA 1F20A 1AK9A 4DLKA 3F96A 4QEDA 1IEWA 4K5QA 4DZZA 1BW9A 3AUYA 2DR2A 4MYRA 4YIKA 5FWYB 1P3DA 3E48A 4BDTA 3KKZA 1XLVA 1AGRA 2R11A 1EJ2A 1DQSA 1RWVA 3JVUA 3IE2A 1P6QA 2JGMA 3BE5A 4X41A 4CXMA 4BZQA 2VZEA 3K2QA 4M8NE 3DBIA 5A0TA 1TQ2A 3T0IA 1NU6A 3DO8A 6AT1A 1MB9A 1QWOA 2AG1A 3K0FA 3C1AA 3SE7A 1OIXA 1G8JA 2O1WA 3IILA 2JF0A 3LU1A 4GMFA 4PZEA 4K1LA 2V74B 4XA8A 1FPMA 1C1DA 1NE2A 1OWLA 3QU4A 1MDBA 3U5TA 3F9IA 2VA8A 3G8BA 5K09A 2IZ1A 2ZREA 3FDXA 1U0TA 1AV6A 3ANXA 3VR5A 1ZUWA 4ND4A 3B5JA 4CLXA 5JBQA 1Z6QA 1EH5A 5DYIA 1HDOA 3HA5A 3UAGA 1MQ8B 1PI3A 1JSZA 1G8GA 5JR3A 2ZPAA 3SYRA 3PI7A 4B4VA 2CMDA 1I1HA 3F97A 5A5VA 5YASA 1JI3A 2XDYA 3GV0A 4J0KA 1M2OA 3K0SA 5LLDA 4QNNA 2YNMA 1W85A 3MOSA 3Q3JB 5D00A 1MT0A 1W1UA 2PTGA 1M67A 3KB6A 1DFGA 3