4S1VA

Crystal structure of phosphoglycerate oxidoreductase from vibrio cholerae o395
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MMKIAILDDYQNVVRGLNAFQCLQGHDVTVFNDSVSDETVLIERLKPFEALVLIRERTPITENLLAHLPNLKLISQTGKVSNHIDVPLCERYGVTVLEGIGSPVAPAELCWSLILAASRHLPSYIEQLHAGHWQQNGGLGLGRTLSGRTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEASRQKALELGYQAAADKAEFFAKADVLSLHLRLNDATRGIVTKQDLLAMKPDSLFVNTSRAELVESGALYSVMQANPMRQAAVDVYENEPALPNNEPLLSLPNVLCAPHLGYVEKNSYEIYFQAAFENVVKFAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-3-phosphoglycerate dehydrogenase-related protein
publication title Crystal Structure of Phosphoglycerate Oxidoreductase from Vibrio Cholerae O395
rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.95: Phosphoglycerate dehydrogenase.
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4s1vA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4s1vA01
1OZAA 2Y05A 2P9GA 4URFA 2FPPA 2WSBA 2NM0A 4RORA 4BV9A 1GADO 1LNQA 2LDXA 4PG4A 1HEUA 2H5LA 2PY6A 3EDMA 4JJFA 4D45A 1EMDA 3VVCA 5DOZA 3FF4A 2IEDA 3F1KA 2O7SA 4DIBA 3KXDA 3WXBA 2I3AA 5B4VA 4P4NA 4CUKA 1VL0A 1TT7A 4HFRA 4PZEA 3F5SA 3QA9A 2YHIB 1P0FA 1E3WA 4BS9A 4XGNA 3ZWVA 5C7IO 5AVOA 3TZKA 2P2SA 3DFUA 3KBOA 1ISHA 4G65A 3WBFA 4C7KA 4NZ9A 4BGUA 5HBRA 2HK7A 4GQAA 3JQAB 1KEWA 2BMAA 2DTEA 3DWFA 3I9MA 3JTMA 5JYDA 4A7PA 1PJ4A 3OEYA 1CIVA 1O5IA 4Q39A 4YJFB 5K6AA 4DQUA 3PRJA 4RF3A 5CDSA 4R01A 1MV8A 2O3JA 3NGXA 5IXYA 3TL2A 5JY6A 1D4FA 2BH9A 3JSAA 3V2GA 1H2HA 4FFOA 1SNYA 1D1SA 1HSOA 4K6CA 1JW9B 4BIIA 2ZKLA 4JROA 4LN1A 3ZWCA 2VYND 3TZ6A 5ITWA 5ILGA 4OM8A 3C7AA 4D3SA 4KQXA 1PZHA 1B15A 1C1DA 1UZNA 3T4EA 5IXSA 3GC6A 1ZJZA 1JAXA 1YBAA 3FCOA 3I4FA 1D3AA 4GX0A 3RUCA 5JFOA 2UDPA 2QW8A 3F9IA 3JQGA 2EHDA 3PHLA 3TDKA 3WNVA 3E03A 3OQBA 5G4KA 2ZCVA 3Q0EA 4BNJA 2QZ9A 4D7AA 4IGEA 1MFZA 4B3IA 4J43A 2O4CA 3OH8A 4ND1A 4HP8A 3CMMA 4AICA 1PJCA 1H9BA 3VOSA 5L7TA 1NAHA 1LJ8A 3ETGA 4BNHA 4QFCA 2IZ0A 1F14A 1P1JA 1UXJA 3A14A 2VZ9A 4MKXA 5EESA 4A03A 4EUEA 4CLRA 1GPJA 2PZJA 1KVSA 4J6FA 4M54A 2AG8A 2GF2A 1DBVO 3D3WA 1EZ4A 2C54A 3M2TA 4IS2A 2PA3A 3RI3A 3ZWOA 4CV2A 1TT5A 2WM3A 2VTEA 4CQLA 5A5EA 2GN8A 2Y1CA 5TSDA 1LLQA 2B5VA 1PWZA 3KEQA 3JYNA 3MJEA 4G2NA 4PFJA 5KOIA 2Z95A 2RH8A 1AHIA 5AQ1A 3HDYA 3JQ8B 1XEAA 3WGQA 3I1JA 3RSHA 1QP8A 3SC6A 2XXJA 2FY8A 2EGGA 4XB2A 3OA2A 3IUPA 2YQ5A 4MJLA 3DBLB 4HWKA 3LZ6A 5GZ6A 3HG7A 2IZ1A 1FDUA 4NJMB 2ZB8A 3RU7A 1I3NA 3VAZA 4PCVA 3QVTA 4ND5A 4BNMA 3E48A 3JQBC 4PRLA 3WFJA 4CUZA 3JQCA 3PJFA 3UGKA 3QLJA 1KYQA 2FWMX 5IN4A 2EEZA 4B7CA 1JQBA 2GASA 4LISA 3Q3CA 2YV1A 4TWRA 1A7KA 3EGOA 3K5PA 3DBHA 3SJ7A 4AJEA 4J91A 5BSHA 3PHIA 2FPGA 3C1AA 1KVUA 2BHLA 2OL4A 3OIGA 4WLVA 3WLEA 1ZFNA 5A02A 3H4VA 3QVWA 1KEUA 1LRLA 4IQ8A 1M75A 1YH3A 3JQ9C 5EPOA 3DOJA 4C7JA 4NBVA 1FDWA 1E3EA 4L76A 3O8QB 4CM8A 3OJ0A 4J1SA 3HHPA 4NFHA 3WQQA 4PG8A 1LSOA 1Z74A 3AM5A 4MKRA 5I9LA 1LLCA 3V5NA 1J5PA 1ADBA 4KMSA 1T2EA 5TGDA 3DHYA 2YV2A 4FR5A 1E6UA 1UP6A 4PLHA 1PS8A 1V8BA 5L51A 1R4NB 5JS6A 4GX2A 5A04A 3M1LA 2D3TA 4W6ZA 3DTYA 1LTHR 1I8TA 4WUVA 1U28A 4Z0HO 1IZ9A 2TMDA 4TZTA 5CPBA 2X0IA 1BWSA 3FTPA 2E82A 3HDJA 4R1SA 3PXXA 4CQMB 3WGIA 3DOOA 3GHHA 1DXYA 4MVJI 1ADFA 1BVUA 1DHTA 2CMDA 3DZJA 1SCUA 4EW6A 3UVEA 2CDAA 5JSFA 1YQGA 5FFFA 3DZHA 4ZU3A 4ND2A 3SLKA 5F5NA 2YQ4A 1D8AA 4DL9A 3VTFA 4BO8A 3FNEA 3K73O 4CJXA 1UR5A 2I9PA 1LEHA 3JD1A 5JPIA 2GZ2A 3GOHA 4BMNA 4KWHA 1H6AA 7MDHA 2VZ8A 4XJSA 1W4ZA 3PFWO 4ROSA 4E12A 4P4LA 5DCYA 5ITVA 1S7CA 2J3HA 1JVBA 1XU7A 3HSKA 2QRKA 4DQXA 3H3JA 4PLZA 1PJLA 2D1YA 4P22A 2ET6A 2GERA 3L07A 2WYWA 3RBZA 4DLLA 3F4LA 6LDHA 1MXFA 4AJPA 1N1EA 4G5HA 3JYQA 2CF6A 3IMFA 1DRVA 1X15A 3WFIA 4BGVA 3DBRA 3LDHA 4UVIA 2P5UA 4XYGA 3I6QA 3L4BA 3JQ7A 3VZSA 4I5DA 2Q45A 2X8LA 3GG9A 1C0KA 3PFFA 3D3EA 4I5FA 5CG1A 2NVBA 1HLDA 3EW7A 1HF3A 4WK6A 2ZTUA 4N5LA 3HJAA 5T5QA 3LLVA 1XDWA 3M2PA 1LC3A 1Z7EA 1Y8RB 2JAPA 4KDFA 1I01A 4ZN6A 4IDDA 1ZKMA 2VYNA 3BAZA 2ZYDA 3BZUA 5LDHA 3OFSA 3QV1A 2GN9A 4XKJA 3ZWMA 3PEFA 2D8AA 2R00A 4E6PA 2O2SA 3PHHA 1T2DA 4ZGWA 2OUIA 4YB8A 4XRRA 1NFQA 3GNQA 5CEJA 5TIIA 2YZ7A 1NHGA 1EUDA 4U6SA 3WDSA 3WSVA 1UUFA 4JX8A 4J9VA 3IS3A 4IM7A 3DQPA 4M89A 5LDGA 3M6IA 5KJCA 3BHIA 3PZRA 3WYBA 4J3FA 3GN1A 2JCYA 2VWGA 3ROMA 3G3EA 4AJNA 2VHWA 4D44A 2X9GA 3IKVA 4HXYA 4FJ1A 2UAGA 5DOVA 1ENOA 4HNGA 1KY5A 4WLOA 4BO1A 2PTGA 3SEFA 3T4XA 3FSRA 2EWMA 2O50A 4CMEA 1N9GA 4JLWA 1JWBB 3ASUA 5JYEA 1NWCA 2OP0A 3ANNA 4Y67A 2A4KA 2O7QA 2W90A 4GL4A 3RAJA 5HS4A 3VH1A 2Y1GA 1X1TA 1QLJA 2AQKA 3C7DB 3GPDG 1HDCA 5JO0A 4AL4A 1CETA 4Z6KA 3LT0A 3W8FA 1O9BA 4HFNA 8ADHA 2CNBA 3AM4A 3D0OA 1SO8A 1F8FA 4E31A 3ON5A 2W2KA 4FOSA 3GZNB 1EEHA 3ABIA 4B3HA 3NTRA 3KLMX 4GKVA 1EFKA 5TQVA 5U4QA 1SMKA 2Z1MA 3OM9A 4BO9A 2E48A 1CQIA 3EZLA 1TI7A 5KKCA 4A0SA 1Y81A 3QJ5A 4YT5A 3ZH2A 1YGYA 2DBVO 2FRDA 4OQZA 1P0CA 3PPIA 3RC2A 4XYBA 3D4PA 1ZK1A 3V2UA 3WJAA 1I10A 3MOIA 2X4GA 1IZ0A 2RBEA 2NVWA 4CMBA 3IJRA 2Y1OA 3RUHA 3QW2A 3D1LA 3ZZNA 3CIFA 3FWZA 1MG5A 2J5QA 3A28A 3I83A 2HK8A 1HDOA 5CEEA 3PDUA 4BKPA 1WDKA 1IE3A 3K92A 3DDNA 4OSPA 1H9AA 1BSVA 1N7HA 5U1PA 3RUIA 4Q3AA 3OIDA 4UEOA 1IL0A 5GZ3A 2BKAA 3KB6A 4E2ZA 3W6UA 4DREA 3CE6A 1DC4A 1EUCA 1KERA 3A9WA 3UW3A 2B4QA 4XZ3A 2X5OA 4BO7A 1JA9A 1UZMA 3INRA 1GV1A 1ZK2A 2UUOA 1TB4A 5DZSA 2HMVA 4K1LA 1GAEO 4J49A 3Q11A 4ZVVA 4R1UA 3H2ZA 3WG9A 1U3UA 4BB6A 4L74A 1Z45A 1ARZA 5JAIA 2FR8A 4H16A 3EZYA 2RCYA 1R16A 2ZJ1A 2HRZA 3W8DA 1L7DA 5BQFA 4DLBA 3DR3A 4WLFA 3WIDA 3PYMA 1YL5A 1GCUA 4OXYA 4Y8VA 4B4WA 2NVUB 2D0IA 3I9LA 4YJHA 1GPDG 3DC2A 3PQEA 4JNKA 4E5PA 4CM1A 4OXNA 3HDHA 3TOXA 4TKMA 2Q2WA 2WD8A 4H15A 5G0UA 3WTCA 4TRRA 4S1VA 1Y7TA 4E5YA 1VL6A 1XG5A 2VN8A 1DIGA 1E5QA 3G1TA 2WEKA 3WGGA 4KUGA 4YJGA 1OMOA 3DBVO 1LBEA 4K9DA 5JAQA 1Q0LA 1YVEI 3WICA 3BMNA 3C3XA 2FZWA 1HDGO 1PX0A 4IJVA 5IDQA 2DPHA 1Y8QB 3I23A 3TSCA 4L0QA 1NVTA 5DF1A 2X0RA 3KRTA 4ZRMA 3G1UA 4AJLA 3KM0A 3ZNOA 4CL3A 1XQ1A 4BO5A 1E5LA 3GNSA 1LQTA 1DO8A 5HTOA 3PYLA 2Y68A 5CPFA 1I2ZA 3QWHA 1PGNA 3ITDA 1YQDA 1LXCA 3KZVA 1N1GA 3L9XA 1X0XA 2PZLA 1F0YA 3PQFA 1E3IA 1Y5RA 4W7IA 2GR9A 4MPDA 4YBZA 1ULUA 1YOVA 2P9CA 4YT2A 1R15A 3ZWPA 1PJBA 2BRUA 5CP8A 4JBIA 1NPTO 3PK0A 3PGXA 1FMCA 4JJGA 4BKUA 3DHNA 2VUTA 2D5CA 2VHXA 4W9NC 4XX0A 4BNLA 4GGPA 3ETEA 4BOYA 1VKNA 3IUSA 4IJUA 4IQ0A 3DFZA 1KEPA 3H2SA 3JQAD 3JQBA 5IZCC 2GLXA 3JYOA 4K6FA 3GEMA 4NJOA 4NBWA 1UZLA 4UUNA 4XEHA 1LC0A 3IP3A 2DAPA 1YB5A 2PK3A 5TS3A 2DUWA 2Y0EA 2V6FA 1BW9A 2V7PA 4GGOA 3EK2A 4OQYA 1PQPA 2C0CA 2VT2A 1OAAA 1NQTA 5A9SA 3UH1A 5G0VA 3E5RA 4BO0A 3JQ9A 4HY3A 1B8PA 1A9YA 4NBRA 3A4VA 2GDZA 1KIFA 3GGPA 3AI3A 3NYWA 3WWYA 1NAIA 2VUSA 1Q7BA 1EE2A 5I9MA 2Q1UA 3P2YA 3S2GA 4YPOA 5J23A 1DJNA 3DMYA 2OFPA 4YA6A 4BO6A 3ZHYA 1FDVA 1ISMA 1L7EA 4OH1A 3KLPX 3HUDA 1KEVA 1YWGO 3BMQA 1GZ3A 4MVJM 1C1XB 3Q2KA 5KNLA 1Y1PA 3WYCA 1CEQA 1Z6ZA 2QRJA 3N74A 2JCVA 3OJFA 4R9SA 1ZEJA 4E5KA 4GH5A 2GPTA 4BNIA 2ILTA 4Q9NA 5T6BA 4DYDA 4EEZA 1JLLA 1YE3A 2JJYA 4DGSA 1JKJA 1FF9A 2ZATA 4CLOB 3FBGA 2FSSA 5EJ2A 3WGHA 3KVOA 3KYBA 2YFHA 3SC4A 1G0NA 5FYDA 4B8WA 1XQ6A 4MVJP 1ZNQO 4G81A 4WKGA 4WCFB 4LMPA 3DAFA 5JW6A 4RPKA 4B8ZA 4DMMA 4E0BA 3JV7A 3ONDA 2FOIA 4OOEA 1R0SA 3PLNA 3NTOA 1Z75A 3Q1LA 3S2FA 4PG5A 1BXGB 2YYYA 4TRJA 2X86A 4CPDA 3C24A 3H3FA 3AOEC 4ZICA 4HBGA 2FPIA 5ER9A 4TRNA 5B1YA 4CODB 1I2BA 1EBUA 2OO5A 5F1KA 2ZB4A 3ZGYA 4RZHA 4UUOA 4DPKA 3H9EO 2UVDA 2D4AA 2G5CA 1HT0A 3B20A 4RVFA 3WGTA 4WLEA 4BNZA 4MP3A 9LDBA 2PKQP 4DPLA 3MJSA 4RZIA 1YB4A 2GNAA 4KP7A 4LSWA 4B3JA 5A5FA 3RKUA 3O4RA 4UVDA 2OXIA 4F6LA 4DLAA 4II3A 3D7LA 4D41A 2FN7A 3VH4A 1BMDA 2IRWA 4J1QA 4XYLA 1QLHA 1PS0A 5L4SA 4IJKA 4O5OA 1QR6A 1H5QA 1QXSA 1ZXBA 3F3SA 1O94A 1RJWA 3HN2A 4I8XA 4PIVA 4PG6A 5HM8A 2O3RA 1UXHA 4FOOA 2E49A 1EVYA 5HA5A 1AUPA 4YAIA 2H6EA 4RVUA 3QY9A 1UP4A 4FJ0A 1XELA 2Q1WA 4J4HA 2HMTA 4Y9DA 4Z9YA 4BHTA 4TVOA 3WWZA 1NFRA 2JAHA 3CSDA 4RLSA 5F21A 1E7WA 3RUDA 4LGVA 2AEFA 2Y1FA 1U9JA 1T25A 3NT4A 4CV1A 1I33A 3ZWYA 2HMWA 1NYTA 5FI5A 3UOGA 1X0VA 4BNNA 1ZH8A 1S6YA 3I52A 4MIOA 2WMDA 5KCZA 1KBZA 2F00A 1LDMA 2EG9A 3BMOA 3HZZA 4YT8A 1WWKA 3EYWA 5EIOA 3ZV6A 1YL6A 1K6IA 2ZJ0A 2BFOA 3NGLA 3HE3A 3X2EA 4O6VA 4Y98A 1R12A 4WPGA 1H6BA 2ZIZA 4YAJA 1VRWA 1JN0A 3RFXA 1E77A 3FNHA 5JY1A 4TROA 1LRJA 4BV8A 3JD0A 3C1TA 4GVXA 2B4TO 2HMSA 1DFIA 2JCXA 1DFHA 4EBFA 3S55A 4DWVA 4F6CA 2YHIA 3U49A 4PZDA 3QVXA 1C1DB 3GF4A 5DULA 3D5QA 3STHA 2ZK7A 1Q7GA 4PLVA 4CL8A 3DL2A 3JQEA 3ZU3A 1PZEA 4P8RA 3VC7A 3JQGB 3VH3A 2WYVA 1ZO8A 1QSGA 3JQAA 3MZ0A 1M6HA 1QORA 2GN4A 4DBZA 1P74A 2POQX 4M49A 4JP3A 5G4KB 3GR6A 2XAAA 1Q0QA 1B3BA 2ZTMA 2X23A 3K6JA 4MVJD 4UAGA 3DZFA 1DPGA 3EVNA 4IZHA 3VKUA 4GI2A 2O3TA 1ZBQA 4N5NA 3LF1A 3ZWAA 4N5MA 1X13A 2UYYA 3B1KA 4E13A 2DC1A 4IIUA 3MJCA 3UCFA 3GGOA 4IDCA 1C0PA 4PLCA 5G2OA 4CLRB 4YXFA 4TMFA 3H9JA 3F1LA 4J1TA 4U0JA 2NU6A 4IDFA 1TT5B 4FSHA 3F47A 4S3MA 4Q3BA 1JKIA 3CPSA 4CQLB 4YAKA 4KQWA 3TQHA 2CFCA 3TNLA 3TOZA 3JYLA 4DVJA 2ZYGA 1PZFA 2WDZA 4N7RA 4PLGA 3E9NA 1GEEA 4QT0A 4EUHA 3ADOA 4FIZA 4FDAA 4CMJA 5I9NA 4XYEA 4MP8A 2AE2A 4OGWA 2RHRA 2YDYA 4GSLA 1ZIDA 2I5PO 2BGLA 2UV8A 4ZRNA 1T2FA 4RDHA 2JFGA 1ISJA 3AJRA 4FPXA 5AXDA 5LC1A 2CZCA 3DXFA 4I08A 3WMWA 1H94A 4L4RA 4OL9A 4BNFA 2VQ3A 5G0TA 1P1RA 4TKLA 4BNTA 5T8KC 4KTVE 2I76A 3DBHB 3SJUA 2Q2QA 2Y93A 4ZQBA 4WOJA 1IUKA 4JP2A 1CJCA 5JO9A 1ZK4A 3S8MA 5TJHA 1FJHA 4QUKA 4B4UA 3MWEB 4B7UA 3OSUA 1PU2A 2Z1NA 1M2WA 1NNUA 5C3MA 3DBLA 4F45A 4O63O 4YRDA 3E9MA 3ZI0A 2H1SA 4EGFA 3KETA 3VDQA 3W4IA 3O9ZA 1VE9A 3P5SA 5EERA 4ZHSA 3WGOA 2JHFA 1EQUA 4AFNA 5I7EA 2Q4BA 4R3WA 3WS7A 4LCEA 4AJKA 1KC3A 4RF5A 3EVTA 3GH3A 4GAEA 4YYZA 2B0JA 3OQ6A 3WIEA 1KVRA 3EMKA 3OJEA 3K8ZA 4BNXA 4RL6A 2B37A 3PLRA 3GNTA 1IHYA 4FGSA 3IAHA 3KV3O 4I5GA 3ROQA 1E1LA 1DOHA 1E0DA 1WZIA 3ZDFA 1T2AA 1O0SA 4L9RA 3O8QA 3KEOA 2R2GA 3TZHA 5C7LO 3ICPA 4UEJA 2A92A 4LRSB 3R1IA 3OF2A 2PNFA 4XIYA 2RH4A 1MLDA 1XKQA 2AXQA 1VC2A 4DQVA 1LX6A 1OFGA 4WOKA 5EQFA 2W98A 4PVDA 4Z0TA 5JDIC 2I6TA 1R4NA 1PIWA 1KY4A 2C20A 4TSKA 2YHUA 1HDYA 1MC4A 4ILKA 1A5ZA 4J4BA 3OEWA 3S1LA 1WMBA 1XWFA 1AHHA 2EIHA 3CKYA 3RJ9A 1R66A 3HFSA 3WTBA 5COQA 1M76A 4WCDA 4IINA 4CMIA 4F46A 3D4OA 4OIMA 4HV4A 1W6UA 1LDBA 2NTJA 3AY6A 3T7EA 2F1KA 1GY8A 4R9RA 4YJDA 5I7SA 1YXMA 3DHEA 2DU8A 3GVPA 3GK3A 3DBRB 4WCFC 4W9NA 3JQ7B 4R5HA 3CEAA 2H63A 4DMLA 2VNSA 1RM3A 3GPIA 4TVBA 5IZCA 4BNVA 5JC1A 3WNQA 1U1IA 3HNPA 3KSDO 2FZEA 4H3VA 5DBIA 3V1UA 2AG5A 2HKIA 2GRAA 2PGDA 2IEBA 2FMUA 2G1UA 3GN2A 3I9KA 3BYZA 1KVTA 3G17A 5AXAA 4CR8A 4JQCA 2ZQZA 5BSGA 3VZPA 3ENNA 5A4DA 4NFYA 3PTZA 2RAFA 4EJ0A 1ORRA 2X58A 3IL2A 3TJRA 2BF7A 1Y5MA 5HWSA 1L1FA 2RHCA 3UUWA 1VLLA 4ND4A 1PL7A 2Q4EA 4NQZA 5JE8A 1I36A 3FPCA 2CDCA 2OGUA 5L40A 2Q99A 1SB8A 3L77A 3S2IA 1PGPA 2NQ8A 1X7GA 3IOYA 5A06A 2V6BA 4AJ2A 1ULSA 4QECA 4MVJA 4Q3CA 1DC3A 5EL0A 3CUKA 2AEJA 1RYDA 2WYUA 5THKA 3V2HA 2I3GA 3SVTA 1BGVA 1EVZA 3U9LA 1CQJA 4NBUA 1R0KA 4RLHA 2O3QA 4R16A 1U3VA 3COSA 4FD3A 2W8ZA 2E4AA 1TLTA 3JQFC 1Z7BA 4UEKA 4NNJA 4WASA 2YY7A 5IDWA 3IQDB 4I1IA 1UH5A 1MC5A 1X7DA 1N9GB 3FI9A 3GVIA 2VTDA 4XR9A 3BA1A 3MTJA 3W4KA 4CR6A 4U0KA 2A9FA 1B26A 4IDGA 2AMFA 4YQYA 2X0JA 1RYEA 3FBTA 4QSMA 3RUEA 2DBQA 4EYEA 4J7CA 3ANMA 2DBRA 3GRPA 1EVIA 2EGHA 3PDJA 4RPJA 4CLHA 5F1PA 5KJ1A 1ZSVA 3ZU4A 1P44A 4ONEA 3RD5A 1JTVA 2GO1A 3AOEA 1H2BA 2B5WA 3TF5A 1TVEA 3C7CB 4DTIA 2VNAA 1FDSA 3FRJA 3QWBA 3T7CA 5FWNA 3H9UA 1RWBA 1IHXA 2W2KB 3GG2A 4XR4A 3JYPA 3D64A 2X6TA 1P9LA 4JBHA 1YBVA 1GUFA 3ZWWA 2GGSA 1WAMA 2OOSA 1SC6A 1OBFO 3ULKA 1GZ6A 3NRCA 3GVXA 2FP4A 1WXDA 1MGOA 4RV9A 4I9NA 1O8CA 1SBYA 1K2WA 3DZBA 5KIAA 3K31A 1KC1A 2Q1TA 5KJ6A 4B4OA 1GYPA 1KS9A 1MX3A 3RROA 5A05A 3K30A 3IIEA 4IGFA 3D5TA 3E5MA 4L8VA 3Q2IA 4E2XA 2YUTA 1AGNA 4NPCA 3AU8A 3VZRA 2GCGA 4FJ2A 3RFVA 1WLYA 1O95A 3PGJA 2OP1A 5JAMA 4CMHA 4FBGA 2D2IA 2VWHA 4YTEA 3O26A 3GAFA 4GKBA 1BG6A 5IDYA 4E33A 1NR1A 1HDRA 2GN6A 1XHLA 4I9UA 2IXAA 4A5OA 1B8UA 3RQSA 4MVJG 2G17A 1I3MA 2B36A 1PZGA 3W4JA 4CM5A 3GZ4A 1NM5A 3HDQA 1HTBA 1W0CA 3FR7A 3VPSA 4CUJA 4D42A 5HRUA 2HJRA 3ZNQA 2Q50A 4NU5A 4MIYA 2G76A 1IPEA 3DMTC 7ADHA 1JVSA 3EY4A 2X22A 4CM3A 5CFZA 1YRLA 3GMDA 2VWPA 3W6ZA 3LC7O 3E1KA 1R6DA 2DPGA 3NTQA 3R6DA 1ADGA 1TXGA 4WLUA 1VM6A 1IPFA 2EP5A 3RJ5A 4CM6A 4IUYA 1A9ZA 5AXBA 3AU9A 2VRBA 1R0LA 1XSEA 2V6GA 3OA0A 3AK4A 3AWDA 3DTTA 4YJHB 2QQ5A 4QTZA 2AHRA 3WYEA 2WTBA 4Q3EA 1G0OA 8LDHA 3OHSX 3U5TA 1P77A 2NNLD 3G79A 3C85A 3ZNPA 4EITA 1IOLA 1M6WA 3SBOA 2HJSA 3A1NA 4WGGA 2Y0CA 4CLXA 1HRDA 2O23A 5DNAA 2WD7A 1FXSA 4YJGB 2HQ1A 2CD9A 2Q2VA 3KHUA 3L4SO 1ONNA 1GFSA 3GAZA 3F6YA 3GMSA 3M1AA 4H7PA 1DC6A 5EINA 3K96A 3GA0A 4BQPA 5CDUA 4J2OA 4CR7A 3K9QO 4LCJA 3ST7A 3I9NA 4FQ8A 4OYRA 2QYTA 1YJ8A 5DP2A 1DHRA 3BMNB 1KOLA 3AFMA 2C82A 3HADA 3I6IA 5BNTA 1A27A 1HWYA 3OIFA 4RCVA 4IIVA 4ALIA 4GSKA 4EDFA 3WGZA 2J5KA 4W7HA 3QRWA 3SLGA 1MFPA 4A73A 5MGBA 4JXKA 3GHYA 4YEDA 4XD2A 2NWQA 3RUFA 4E32A 5EQDA 2OBYA 1U4OA 4Y6RA 5FEUA 2J8ZA 3ZHXA 1R4MA 1LDNA 4GX1A 1A7AA 4J16A 4QEDA 3RFTA 3JQ6A 2C59A 5KVVA 1U3WA 2O2YA 4LVCA 3H9GA 1YOVB 4NBTA 1TA4A 1YQXA 3JD2A 3NX4A 2X1HA 3BIOA 2AQIA 1QV6A 4LVUA 1DAOA 3JQDA 4WLNA 3NT5A 1LDGA 3OJOA 1QYWA 5C7OO 3U09A 3GEGA 1LA2A 1Y8QA 2DTDA 2NU9A 2Y66A 3PHGA 2HCTA 4W82A 2B83A 4R54A 4YRBA 1HZZA 1B3RA 1ZVMA 1XGKA 2NACA 3FHLA 4IBOA 1A71A 1BTOA 5COBA 4QQRA 1BW9B 3KYCA 5T8KA 5TLSA 3GRKA 5LCXA 2X5KO 4OKIA 3FD8A 3WB9A 3LVFO 1DDOA 3K2EA 5BNIA 1PS9A 5DBFA 3VDRA 3E8XA 2AA3A 2YDXA 1NQOA 1V35A 4W4TA 5B37A 5TC4A 4NMHA 4D43A 4IMRA 4FB5A 4KDEA 1GQ2A 3Q9NA 4GX5A 2CUKA 4IQGA 4HFJA 4CMGA 1GYRA 1K6XA 1UXKA 3RC1A 1PTJA 2PH5A 3CH6A 2BELA 5F3RA 1DIHA 4CLEA 3DAGA 5L53A 3BMCA 2EKLA 4I5EA 3TZQA 3ROKA 3SXPA 2B35A 5GMOA 1E7MA 1SZJG 2P4QA 2PWZA 3G49A 4JK3A 9LDTA 1PEDA 4PLPA 3QWFA 4IPTA 2I67A 2RIRA 2Q3EA 2C29D 3E6AA 4Z9FA 3WGYA 2NLOA 1BDMA 5L4LA 5L4NA 1B7GO 2EW8A 4ALNA 1QKIA 1P1KA 2VT3A 2JD2A 4WE3A 1NPYA 4A26A 4ZA2A 3FN4A 5JLAA 1DB3A 3V8BA 3KYDA 2NQTA 4PZCA 5F1OA 3A06A 1C3VA 1T1SA 3H7AA 1D1TA 3P2OA 4Q3NA 3HB4X 2EXXA 1P45A 3AOGA 2J3IA 5JDIA 3LT1A 1E3LA 2VZ0A 4R4JA 5H82A 1HYEA 1Y6JA 2SCUA 2OMEA 3N7UA 5TX7A 4AJIA 4XIJA 4PLFA 5G4LA 1ZSNA 1LSSA 1E1NA 3UXYA 4CLOA 1NXQA 3RC9A 3LT4A 2ZB3A 3JD4A 3I9JA 1PSDA 2Y1EA 5TT1A 4PLTA 3X2FA 5A3JA 2PZMA 4OXKA 3RWBA 3KO8A 2NADA 5EMHA 3UF0A 4F3YA 3OJLA 2CDBA 2DKNA 2QZZA 1HSZA 4WCFA 5GY7A 1AE1A 4KTTE 5FF9A 2B4RO 5I8ZA 5TNXA 3PIIA 3LT2A 1QYVA 1GYQA 4M55A 1WP4A 5K9ZA 1HE4A 3RCBA 4DIOA 1DC5A 4JCOA 4U5QA 3IDSA 3ZWXA 3I5MA 3LU1A 5L3ZA 3ZHBA 3BXXA 5I8WA 4E2WA 1BXGA 2EERA 4RPLA 4XQEA 4XQCA 3U3XA 5DBGA 2P4HX 1NQAO 4K26A 2EP7A 3EC7A 3P7MA 4RO0A 3TFOA 4ITUA 1V0JA 3RU9A 5L45A 1ZMTA 1PJQA 1E1MA 5L7YA 2NV6A 2PH3A 4X54A 1GR0A 4XQGA 5ADHA 3W8EA 4M8SA 1U8XX 2NU8A 3ONFA 1I5RA 3H9QA 1VJ0A 3QSGA 1Q7CA 4J0FA 2GD1O 1LU9A 3KTDA 1NTOA 3DO5A 1NBOA 3KSZO 1O6ZA 1PGJA 3R3JA 3GFGA 4WECA 5JC8A 2ZQYA 2FR1A 1AN9A 1EDOA 2BI8A 4FS3A 2X9VA 1W8DA 4LMRA 4CM4A 3QE3A 4RDIA 2P68A 3NDRA 5B12A 2AQ8A 5G0WA 3WOHA 4BGEA 4M86A 4CQMD 3B6ZA 4RVDA 4IY1A 3OICA 5ICMA 5KVCA 5IDXA 1FK8A 1YKFA 2Y67A 4U7WA 3QQPA 1E3WB 5BSEA 1V9LA 3BMOB 4QX6A 2JD0A 3GUCA 3JQFA 3MJVA 4U8GA 2PKRA 4BB5A 4RVHA 1LDEA 3F5QA 3GDGA 3GVHA 1M67A 2HU2A 3OP4A 4CMKA 1ML3A 4ZJUA 3AY7A 2HLPA 1HL3A 4RPHA 4NI5A 2D5AA 1ENYA 1CWUA 2ZB7A 4IZIA 4RVSA 4Z0PA 4WEQA 4PRKA 4IDBA 4R1TA 1GQQA 4BNKA 3MOGA 2HAEA 1Z73A 2EF1A 4OJNA 4J7XA 4BO4A 4PN3A 2PV7A 1OC2A 1B8VA 3PQDA 1H6CA 2EKPA 4NU6A 1ADCA 1T4BA 3SX2A 1V3TA 3EHEA 4YR9A 1E3SA 2VHVA 1H93A 4FFPA 5KTKA 1EK6A 1YDWA 1ID1A 1F17A 1B0AA 3TL3A 3MTGA 4RGBA 2C7GA 5KJEA 3LC1O 2Q1SA 2DQ4A 4D79A 1C14A 4NR0A 5T64A 1NPDA 1XCBA 3ROPA 1ZSYA 4YJFA 1LRKA 3DZKA 1N5DA 4R69A 5H81A 4NK5A 2DT5A 3I4CA 1JDJA 1DRUA 1U4SA 1HE5A 2O4UX 4J2HA 3W1VA 1DIBA 4D0RA 5B4UA 5U9CA 5JCJD 1QMGA 3ANLA 3D3WB 3PJEA 1QV7A 4UUMA 5KJFA 4XGIA 1QYXA 3G0OA 3PJDA 4YT4A 1T24A 1NFFA 1YDEA 5C5IA 4J1NA 2IDZA 3LLSA 4BO3A 3HN7A 3OECA 2HUNA 5KVSA 3K2BA 1G1AA 1Y9EA 4BMSA 1UDAA 1HE2A 4J4TA 1GCOA 1T26A 2G0TA 2QHXA 3GDFA 1N92A 2PD6A 4E5MA 2NUAA 1U5CA 3TPCA 1DLIA 5T57A 1AXGA 2GYYA 1PJSA 5MDHA 3ZU5A 1XR3A 3NJ8A 1GV0A 2NSDA 3H65A 1NP3A 1XLTA 4XDYA 3L6OO 5DCUA 1E6EA 3VPGA 4GLLA 4AJJA 4C4OA 4IXWA 3U0BA 2QYSA 3H5NA 4WEOA 2QG4A 1PR3A 3DMTA 4I9HA 4JJIA 2JKVA 2DBZA 4QXMA 3MCVA 3JQ8A 2PFGA 3IP1A 3ZV5A 1GEGA 3GT0A 1WVGA 1ZJYA 3ZU2A 1DIRA 2PD4A 4EEXA 1CDOA 1PL8A 3CINA 4KWIA 3WQSB 4AVYA 3L0DA 4BVAA 1DSSG 1SAYA 3WSWA 1PGQA 3PYXA 1K3TA 5THQA 4CM8B 2OBNA 3FR8A 2QX7A 4NJMA 2B69A 5TF4A 5CEFA 4B7XA 5DT9A 3ITKA 5ENDA 2CY0A 4YRAA 5A9TA 1U8FO 2HRBA 1PJ2A 2AE1A 5FI3A 1SOWA 3LF2A 3LYLA 3KOUA 1P3DA 2JFFA 4XCVA 5C37A 1B2LA 4CM7A 1VKOA 1ZW1A 4R5MA 4TRMA 1C0IA 2AEMA 4INAA 5EN4A 1YL7A 1KVQA 1V6AA 3PVZA 1JWAB 2AQHA 4YCAA 3ZHZA 4YVFA 4YACA 3OMLA 3H5AA 3HQ4O 4FFLA 3BTVA 2EW2A 4E5NA 2WWRA 1RPNA 3UCEA 1UXIA 3HB5X 2OORA 4MKZA 3WMXA 1SB9A 4GMFA 4ZD6A 4B79A 1J0XO 4R41A 4OMUA 2EJVA 4CLDA 5BR7A 2PLAA 5BSFA 1HDZA 4RF2A 5B4TA 3DEYX 3FTNA 1VPDA 4AJOA 1X7HA 5H83A 3RIHA 1GUZA 3AFNA 4DYVA 1QYDA 1GU7A 2J6IA 2JL1A 4CMIB 3H8VA 4CQMA 3NKLA 1DEHA 1MP0A 2X9NA 1ZCJA 3CXRA 3V1TC 4GLOA 4Y6PA 3AUUA 1ISFA 2CSUA 1R37A 2IE0A 1YJQA 1G6KA 3I3OA 3QP9A 2FHSA 4O59O 1B16A 2I99A 4UULA 1LDYA 2VOEA 3GDOA 1JAYA 1MXHA 1PR9A 2DTXA 4KOAA 2ZYAA 1NVMB 3R3SA 4K28A 4AJ4A 4OO3A 2AW5A 4BUCA 1I3LA 3P19A 1EDZA 1GZ4A 1W73A 2PZKA 1IYZA 2YW9A 5BNFA 1H0KA 2GZ3A 4D46A 3WR5A 2H9IA 4BNUA 4KUHA 1MB4A 3DONA 1E7YA 2DM6A 3R0IA 3ZN2A 1EUZA 1U5AA 5KWEA 5F5LA 3ZWNA 5I7FA 4EZBA 1NWHA 2BI7A 4JIGA 1CERA 2DUUA 3IC5A 3AI1A 4UVGA 1H6DA 3MJTA 4BMVA 5ER6A 1ENZA 3D4NA 4PVCA 3DZGA 2WE7A 4FGWA 2J5RA 2J3JA 3HFGA 4II2A 3DZIA 4IDAA 3MEQA 1OOEA 5ICSA 5IAAA 1ONOA 4OHUA 4HX5A 1ENPA 1WDMA 5A3VA 1ZZEA 2X0NA 2EV9A 2E6UX 2C2YA 1NX6A 5I7VA 3UFXA 2YFQA 4YDRA 5JCJA 1Y8RA 3KUXA 1I24A 2Q49A 5TRTA 4BNWA 4GBJA 1N8KA 4MOWA 2E37A 4R68A 3VZQA 5JDCC 3MWDB 3WLFA 1VI2A 5ENVA 3NEPX 3E18A 2BFAA 1CRWG 1DFGA 1RM0A 4E3ZA 4EJ6A 1I0ZA 4R3NA 4RPGA 1IY8A 2VRCD 1E3JA 2VYVD 1NR7A 4XA8A 2Y99A 4XDZA 4CV0A 3B1JA 4BNYA 2BFPA 4RQUA 4J0EA 4NIMA 2P5YA 5T67A 2VHZA 1V3VA 3UHAA 1U7HA 5DDIP 3FPLA 4ZQFA 1QRRA 4CMAA 4XGKA 1GUYA 4MVJH 4XYMA 4UREA 1YS4A 1I2CA 4GPD1 4DRYA 1J49A 3PP8A 3ZW8A 2PGLA 4R1NA 4DPMA 3ZWBA 1YONA 1ZK3A 3RASA 5K6AC 1FDTA 4IJWA 3VPXA 3GY0A 1M66A 2FSVA 3VHRA 3AUTA 4XWYA 2HSDA 3PIDA 2CVQA 4PG7A 3INTA 4N54A 1Z82A 5COAA 4L73A 2NTNA 1X14A 5DP1A 2CVZA 2OZPA 3AY3A 1XA0A 4O0LA 4PLYA 1OC4A 4BGIA 2X5JO 5CDYA 1HZJA 3NJ4A 4LSMA 4RF4A 3U62A 2O48X 2C7VA 3QVSA 4ALMA 3AW9A 3GZNA 4AG3A 3IJPA 5HS6A 1LLUA 4R51A 4W99A 4GVLA 1EK5A 3NDIA 1DLJA 3NAQA 4J90A 3CZRA 3ETDA 4IDEA 3AUAA 4IS3A 2ZTVA 3BTUA 4M1QA 2Z5LA 2IZZA 3DB2A 1SOVA 3INGA 1PWXA 3GEDA 3MJ4A 3OETA 5JMPA 2A35A 1KETA 2JFHA 2EKQA 2W2LD 4J7UA 3EUWA 1DJQA 1ZK0A 2Y1DA 1NASA 4P38A 2PKQO 1T1RA 1NVGA 1PJ3A 3GQVA 1ZEMA 4HNHA 1EFLA 4ALLA 3ZW9A 1BVRA 4IMPA 3WQRA 2DFVA 5A1TA 4FCCA 2IODA 2JHGA 4JN6B 3TN7A 1VJTA 2BLLA 5KVQA 4N18A 3JD3A 3LK7A 3GGGA 1K5HA 4MP6A 4TZKA 1WPQA 3FWNA 1NQ5A 5A9RA 4YQZA 3ZNNA 3PHJA 1JU9A 3B1FA 5GZ1A 1GQYA 2VOJA 5JXWA 5AYVA 2A94A 5BT9A 4EUFA 3BHMA 4EI2A 5IN5A 3ICCA 1CF2O 1BXKA 3ZV3A 4A27A 1HE3A 2ZTLA 4AJ1A 3PZBA 3L6EA 1GL3A 2CF5A 4NHEA 2G82A 5IJZA 1OI7A 2C5AA 1E7SA 1MA0A 1ISIA 4OSOA 3VH2A 1C0LA 4ZQHA 5JCXA 5K0ZA 2WD7B 1P1FA 4CM9D 3JCZA 5JAZA 4XJTA 2XOXA 4E21A 4E30A 3H6KA 1GTMA 1JKFA 1J4AA 1K0UA 4ZQEA 4FFNA 2GSDA 4HKTA 1BRMA 2R6JA 1I32A 3BTSA 4Y6SA 5IG2A 3BHJA 3Q6IA 4MVJE 4BO2A 4YWJA 3S2EA 2LDBA 4ZQGA 1IB6A 4LK3A 4B4VA 2TMGA 3PWZA 1ISGA 1WNTA 3CZMA 2XPCA 3RBXA 5L9AA 1A4IA 2C2XA 1PQWA 2NVUA 1EBFA 3CMCO 3U4IA 2Y0DA 4NDNE 4BKOA 1UDCA 1DIAA 2PR2A 4D3DA 2BFMA 1RM4A 1UJMA 3F4BA 3L9WA 2NU7A 4GWKA 4DUPA 2VUUA 4DBVO 3CTMA 1R4MB 4ALKA 2HK9A 3ORFA 2DVMA 1E7RA 3V1YA 2HO5A 1U3TA 3TZCA 2JD1A 3O38A 4QFDA 1QYCA 3VVBA 1LQUA 4L4XA 4ALJA 3WJ7A 3NT2A 3UKOA 3GUYA 4GWGA 1WMAA 4KZPA 1D7OA 1ZUD1 3ENKA 3FNGA 1EVJA 4MO2A 3RC7A 4O1MA 2PGJA 3LSYA 1ZXLA 4BNGA 5CHEA 2P9EA 4NK4A 3KSUA 4XQ9A 2XXBA 3RKRA 3RVDA 1HXHA 3NUGA 6ADHA 1E92A 4Q3DA 2IXBA 2OHXA 3DOCA 4FN4A 1MUUA 1B14A 1HETA 3F46A 3PI7A 2HMUA 1SEVA 5ES3A 3KYCB 2IYPA 3E82A 4LRTB 4BL5A 4ESOA 1PL6A 2EJWA 1LI4A 4DC0A 1BHSA 4L75A 2VRCA 1F8GA 2VYVA 3DAPA 4Z3DA 4OKNA 1X1EA 4E2YA 5A9SB 1RM5A 5CDGA 1VJ1A 1UDBA 3LQFA 2WJPA 2DFDA 4HFMA 2NTVA 2O3UA 4DA9A 4E4YA 3L6DA 4HUJA 3ZCXA 1UXGA 4FC6A 1QG6A 3L4BC 3BMCB 2DLDA 3UCXA 4NH4A 5L7WA 1PJTA 1HYHA 1YB1A 1Q1NA 3PJGA 3BMQB 2FR0A 4FFMA 1DRWA 1VSVA 2QRLA 4PLWA 3QVOA 3UICA 1Q2XA 1SEPA 1E7QA 5DCWA 2V6MA 4WNIA 3U4HA 1GD1O 3QHAA 5IZ4A 1UP7A 1PGOA 5A03A 4J9UE 1RKXA 3H5RA 1CYDA 3ONEA 4BKRA 1HKUA 3FNFA 4RQTA 1LLDA 3OBBA 4LW8A 5CDTA 4BKQA 3C1OA 1UAGA 4CMCA 1T4DA 2I65A 1XIVA 4ID9A 1XU9A 1A4UA 1I30A 2VHYA 3PWSA 4MINA 3KYDB 5G0SA 3UAGA 1N7GA 1I3KA 2R00C 1J6UA 3AUSA 5IF3A 4XB1A 5AOVA 3AM3A 4D3FA 4UUPA 3EAGA 3WBBA 2HDHA 1E6WA 4JGBA 3VKVA 5AXCA 4UVEA 4L4SA 1MG0A 3B70A 1C1XA 1LSJA 1YBMA 1Y9AA 4FC7A 1WZEA 1NHWA 5DN9A 1HYGA 3LC2O 2CVOA 1DAPA 3GFBA 1E1KA 4QO8A 4TQGA 1TEHA 3C8MA 4JBGA 3PWKA 4RJTA 4QO7A 4U6QA 2W2LA 2C5EA 1LUAA 4MIEA 4P4GA 1WW8A 2QIOA 3TWOA 4WNCA 2W4QA 2WE8A 3RUAA 5L95A 4NG5A 4WJZA 4ND3A 2BD0A 3OQ1A 1F06A 3NV9A 5JBIA 1ONPA 2BGKA 1AXEA 3QIVA 1GDHA 5KKAA 2XF8A 4CMEC 5IFLA 4MVJF 1BXZA 1UAYA 1U2GA 3HWRA 4GMGA 3ADPA 3U4CA 3VPFA 4EJMA 5JMWA 1HLPA 1EE9A 1XYGA 4MDHA 4IXTA 1ZMOA 3VTZA 1PQUA 1N2SA 2YV3A 3U4DA 2D59A 5JNLA 4BQRA 2YJZA 4A10A 2BGMA 3IKTA 5TT0A 4DIFA 2VCYA 3GLQA 4Z9XA 4A2CA 1P1HA 2I66A 1VL8A 1F12A 3ASVA 4YAEA 2O3SA 3QWIA 2Q46A 2ZCUA 1K6JA 3Q9UA 4CM9A 3RBVA 4FW8A 4RVGA 1WDLA 1SPXA 5ILOA 4UVHA 3O03A 3E9QA 4M87A 1YO6A 1U2DA 1EQ2A 4DC1A 5CG2A 2J3KA 3TFQA 1HDXA 4CM4B 3BTOA 4NFSA 2P91A 4CV3A 3VPHA 2PD3A 1K89A 1LSUA 3GVCA 4PGFA 4YAGA 4D0SA 4OAQA 3ZV4A 3WX0A 3NDJA 1U7TA 1Q0HA 2C07A 1VSUA 3TRIA 1V3UA 5TJ9A 4Z3KA 2UUPA 2VWQA 1P33A 2X7HA 1IULA 3N58A 3QWAA 4HADA 4OOFA 1P31A 1P1IA 4XRGA 5CAEA 2GUGA 4DXHA 2V65A 1A72A 3AI2A 3I9OA 3UN1A 2IYOA 2GZ1A 4KUEA 5JDCA 4AJHA 4FFRA 1BDBA 1O89A 1T2CA
chains in the Genus database with same CATH superfamily
3AW8A 3ECAA 2PXXA 3AP2A 3E3OA 1X7ZB 2OWEA 2WSBA 2PEYA 4TS1A 1QWSA 3QKIA 4W1SA 2BR3A 2UZ3A 4QARA 5EZYB 2QL9A 5THXA 1GADO 3OI7A 5BUCA 4I99A 1ISRA 5HGXA 2H5LA 4JJFA 5JRDS 1RDFA 2NSHA 3OT1B 1EMDA 3WLHA 2IEDA 4XVUA 2O7SA 2ASEA 3KXDA 4RD6A 4RGYA 4MHTA 4FXOA 1NC3A 4UD6A 3A10A 1LTKA 3LQRA 4P4NA 5B4VA 1SUSA 2OV4A 3ABOB 1A1SA 3ITNA 1JHZA 2ZWAA 4PZEA 4Q3KA 2IV3A 3IP8A 4EHLA 1XPJA 1P0FA 4LXUA 4ZK6A 2YX1A 2P2SA 3DFUA 4C7KA 1M34E 3EFBA 3W2IA 2HK7A 4GQAA 2DULA 3I9MA 4B83A 5JAUA 5EMMA 5EJFA 4A7PA 2O2GA 4P98A 1ZQ1A 2V54A 3ICVA 3WK6A 5IWAB 4P08A 2ZRDA 3WMGA 2VO1A 4MW1A 4RF3A 5CDSA 4R01A 1E9AA 4WFKA 1TK2A 1VJRA 1TW3A 1K8QA 4DLWA 3TL2A 4Q02A 1R3DA 2BH9A 2ZAIA 3JSAA 1H2HA 4FFOA 4PC6A 1SNYA 3BKWA 5FOSA 5KSYA 1TA9A 1LNZA 2ZVDA 1D1SA 1OFIA 4K6CA 4BIIA 1HTTA 2BDEA 1M1ZA 2GDJA 3KKEA 1TJ3A 2Q3LA 4CT4B 5L3QB 4GICA 2C42A 2NU6B 3C7AA 2IQIA 3LL7A 4D3SA 4DB4A 1V8FA 4NBLA 3RIYA 2B6NA 1H05A 4W9MC 2GHRA 1YBAA 4YCMA 4H3HB 2OE2A 3WKAA 3GT7A 2ZULA 2CDRA 3MTIA 2PRJA 2MYTA 4PC7A 4YDQA 4WOCA 5JFOA 2MMGA 1FU4A 1ZDMA 3JQGA 1XMPA 3GLFE 1PD0A 3EXFB 3RHTA 1VB3A 3FIUA 4HEA6 3OQBA 5G4KA 2ZJOA 4B80A 2I2FA 4W5OA 4E4TA 4KE8A 4L8GA 3HB0A 4QPZA 4HP8A 3MQ2A 1F5NA 4Y2XA 5JARA 1W88A 3BB3A 3T7JA 5AOAA 1F0NA 4MI1A 3ETGA 3DFMA 5DKFA 4BNHA 3GDWA 2IZ0A 1UXJA 1XCOA 4M0UA 4W1PA 4A03A 2OHJA 3CUSA 4YV2A 3TEFA 4CLRA 2CLDX 2IYVA 2PZJA 1JJ7A 1KVSA 2Q6VA 3D3WA 3TRFA 2FSHA 4H6XA 1G4UR 4MW4A 4NYJQ 5AW5A 1IVSA 1JR4A 5CFLA 5AFSA 3GGDA 1QGZA 1PVVA 1T8RA 2WZCA 4D3XA 2HA3A 5DXJA 4P4UA 3EEOA 1G7RA 1WULS 1AD2A 3ED5A 2GN8A 3P9YA 1KP2A 3M3PA 4DCOA 3FTEA 1W47A 3SLRA 4EG4A 1PWZA 2G8LA 2W48A 2HHAA 3LOUA 4B3MB 1Y3BE 2Q1YA 2RH8A 1U2EA 3GMIA 3RODA 4BQEA 3RTAA 5AQ1A 3JQ8B 3C6QA 4DA8A 3IEKA 1KMHA 4J0DA 1RAAA 3OKAA 3N2YA 2XXJA 3OQHA 2FY8A 5H9VA 4CI0B 5A3RA 5KQRA 1DZIA 1KJQA 1A76A 2JDID 4LSZA 4QSHA 5TGZA 1DXOA 3DBLB 4QFMA 3DWIA 5CXUA 1L4LA 4TQ9A 1UODA 1GO2A 2F8MA 4XJVA 1FDUA 5LBTA 4NJEB 1N6HA 1ZD3A 5E6RB 2AOXA 1A9PA 3DMRA 3K1ZA 1H8EA 2G1JA 3AVPA 3BQNB 4JJAA 4Z9AA 4C7MA 2YMLA 5I4IA 2ZUFA 1E0SA 1C30A 1JZSA 2F64A 1FDOA 2HNKA 4PRLA 3WLSA 1TE2A 4PYOA 1E1QA 4ZOLF 1FLDA 2OO3A 4C5CA 4AQ7A 3UFBA 5DM2A 2EEZA 2I4OA 1JQBA 4PX2A 2IXEA 2GASA 5JWRA 1ZR4A 2PLFA 1Y82A 3Q3CA 4DCVA 5L3VA 3V2IA 2FOXA 1EVQA 2ZIGA 4NNOA 1L5OA 5BSHA 1RQLA 1JIUA 1KVUA 1XZGA 3RTDA 1KZ4A 4EARA 4W5TA 5KYTA 2ODWA 4WXYB 1G20E 1L7QA 1DKQA 3K9HA 2WVHA 3O92A 5EJIA 1EYZA 1BXRB 2E3JA 4IQ8A 3JQ9C 1YH3A 5EPOA 1LPMA 1SRRA 3DOJA 3OU2A 3G8CA 2ROQA 2IQ5A 1G6OA 4QYIA 3OJ0A 2HFJA 1WU8A 4OM7A 4NFHA 1MHPA 4FBLA 4RMJA 3LY7A 4X6UA 1WV1A 1Y5LA 1Y5NA 2C77A 1KH3A 1N0UA 2MINB 4BTVA 1JBEA 1J5PA 2J08A 1ADBA 2C98A 2L0XA 1WB4A 2Q5CA 1SG9A 2RK3A 2ZJYA 3FTCA 3LX6A 4KMSA 2YV2A 1Q7EA 2OG2A 4FR5A 5DLQC 3UTCA 1U0NA 3CVYA 4NTZA 3THXA 1MCZA 2OYSA 1IM8A 4EPXA 3M1LA 1LF5A 2D3TA 3DTYA 4ZXFA 4Z0HO 5JPDA 1U28A 2VTKA 4N01A 5FAKA 1EFDN 5TV2A 3ZXXA 3UG7A 3A4TA 3NRBA 4HTFB 2PSDA 2WMOB 2GTPA 2JGJA 4JP5A 2QNBA 4MRAA 1IONA 4NZMA 1BVUA 1DHTA 1FSFA 4PRZA 5EZ5A 1CJVC 3WLTA 3FMVA 1P4RA 1SCUA 4JR2A 4JR0A 5LU8A 3OE7A 3UT6A 5BR1A 1YQGA 4WD3A 4WKPA 5FFFA 1OSNA 3B82A 4NF2A 3EFHA 4N0QA 1WZ2A 2R4UA 2YQ4A 3AHIA 3I42A 4KFRA 1M8GA 3AYZB 5KI6A 5FFMA 5BN1A 3K0FB 1RQRA 2IDMA 4MDFA 1NI4A 1II0A 3JD1A 1FFSA 5JPIA 2G4VA 4BMNA 2R6HA 4AO6A 1HFKA 1W4ZA 4NU8X 1WCWA 3FMIA 3L1JA 4P4LA 2WFAA 3PFHA 2BKXA 4HTAA 3OOHA 4EKYA 4BLTA 2ID7A 5G3ZA 2GCEA 4DG5A 4AS1A 3H3JA 4PLZA 4PX5A 3ZCSA 2OCGA 1JG2A 3W5SA 2G9ZA 2HX1A 3L07A 3RBZA 3GP8A 1MXFA 3LGAA 4IIDA 4AJPA 2W42A 3JYQA 2CF6A 1N0HA 3HXLA 4QOHA 4EY4A 3OPYI 1I4TD 4YP9A 4L8LA 4NMWA 3ROXA 4BGVA 4C0QC 4C0HA 3DBRA 3ZLUA 5JOQA 1RJFA 1BEEA 3ESZA 4ZO4A 3SHWA 3ZHTA 3L4BA 2XDQB 3F3YA 3JQ7A 4FOTA 3VZSA 5B7GA 3NALA 3M6WA 3HWX1 5J5CA 2NO7A 2X8LA 3GG9A 3CRMA 1C0KA 4J3NA 3F71A 2ONJA 2AKEA 2J4DA 1FS5A 3AEXA 5CG1A 4YMVA 2NVBA 3L7MA 3N75A 3HLKA 3E9YA 3EW7A 1HF3A 4IWNA 2DX7A 4WK6A 1TYCA 4N5LA 3L02A 3PD0A 2QN1A 3PGMA 2ZE5A 4GKKB 3CLUD 2F4VB 3F5DA 1XDWA 4RW0A 2B92A 4RA9A 1Y33E 2C5GA 3M2PA 3HDVA 4ZGGA 5LLSA 4CIBA 4JI4B 3LWNA 2VYNA 1SXQA 4LJKA 4URZR 2C4MA 4ZVRA 2HT6A 3OFSA 4ZT7A 1ITZA 4GRDA 1R5JA 4PPYA 2EL7A 5DTIA 4BV3A 1F0PA 2D8AA 2M1ZA 2O2SA 1FL9A 2R00A 4HMOA 3TNJA 4XUDA 1JFFA 4BV9A 4YXWD 1KEEA 2IE8A 2V1UA 1Y98A 4YB8A 4XRRA 1Y6GA 3MWLA 4QG7A 3BD6A 3GNQA 4E51A 3RT1A 1JB9A 2GEJA 1NHGA 1MAVA 5D51S 1Y37A 2Q0HA 4ZXPA 4P5EA 2P6UA 3H2BA 4EY8A 2D2EA 4J9VA 1F9AA 4QOJA 3CF2A 3I6ZA 2JC3A 1E94E 4CIWA 2BPOA 1T0PA 3DQPA 4IM7A 4M89A 3SEZA 4ZYXA 5LDGA 4S12A 1DAEA 1VJGA 5IDVA 4YRLA 1QO9A 2JCYA 2R44A 2VWGA 3G3EA 4K9KA 5AI6A 3S6JA 1D6JA 2A3NA 4QXOA 3WWOA 3EIQA 4MQMA 1KY5A 4MYSA 2ATIA 3T4XA 1GKUB 2EWMA 3PQCA 1QPBA 4B9EA 4Y18A 3AF4A 4BYGA 1AQYA 2J6CA 4HDMB 1QP4A 2WA2A 2BBOA 2GPNA 4TYMA 3SR0A 2W90A 2WLSA 5ALPA 3A1FA 4GL4A 5CA1F 2Z43A 5K20A 1KEKA 1CEYA 4DG9A 4QBHA 5GONB 1PN3A 2A14A 5LXTB 4DR3B 3F49S 1N3BA 3AVOA 4HUTA 3OPYA 1KJ9A 4HQRA 1M6VA 4FFBA 3I0ZA 4TZ6A 4RY8A 4B48A 1ORDA 3W8FA 5AW3A 1O9BA 1SXJC 3EWAA 3C3AA 1ODKA 2D0DA 3I01M 2YVKA 2WIAA 2ZJZA 1L4EA 3O21A 1F8FA 3X1KA 4E31A 2OLJA 5JYCA 4Q4LA 3THYB 3ANXA 3AINA 3AGPA 2YIDA 4FOSA 1SKYB 4J75A 3U16A 4E11A 4Z4QA 1TOAA 2RSLA 4QPDA 3U13A 2HT1A 2E48A 1M10A 3F7TA 4G0UA 1EK0A 2XTMA 1RLMA 2XT9A 1SQ5A 1TM7E 2WM9B 2XADA 3EZLA 2J9FB 3U48A 1GSIA 3AR4A 2WHXA 4US2R 2ZDGA 3ZUGA 3CCFA 3QJ5A 1JUDA 5DFAA 1YGYA 3UWKA 1FTSA 2BMDA 3PPIA 3RC2A 3D4PA 2DQKA 1RHMA 4UBIA 4YJ3B 3WJAA 5KTYA 3MOIA 3TW4A 4URXR 3TOVA 4CMBA 1TO6A 5LDDC 3IJRA 4MVYA 3RUHA 1S8OA 1UMCA 2LCFA 3D1LA 3ZZNA 3CIFA 3FWZA 1ZD4A 2XYPA 4U9HS 4BU1A 5C8YB 1KZ1A 4HDKA 3N2LA 4IG9A 4P2BA 2ONCA 1CUIA 4HWTA 4D0LB 4FEYA 4FD2A 2C1ZA 1Z4KA 4RJIA 3FMPB 1HDOA 5CEEA 1WBDA 4Q03A 4LCBA 1R9JA 1U2PA 1T36A 2GK7A 2JVKA 1PR4A 1VXRA 3KPUA 3TBKA 1EB8A 1N7HA 2ENWA 2REOA 4CFZA 3RUIA 4G9EA 4BZQA 1C7EA 3PNMA 4G37A 5GZ3A 2HPAA 1E8MA 5HKOA 5H7XA 4DREA 2AS0A 1CFJA 2PX4A 2QTGA 1XDBA 1FVXA 2B0CA 4HYQA 1ZD8A 1KERA 2ZYTX 4V0NA 3UW3A 2Q5EA 2WIBA 2R85A 3DMFA 4R0VA 4HNTA 4XZ3A 2UXDB 4LJSA 4LHZA 2X5OA 5EMNA 1E2LA 2WWWA 4RD3A 1GV1A 2NPIA 3SQLA 5MN6A 4ED9A 3C3YA 1C7ZA 1XAGA 2BCGY 2P5TB 5AVTA 4I2NA 2AXEA 4L5CA 4J49A 4XASA 1CZKA 3QVGB 3ZDQA 4ENPA 4I81A 1U3UA 121PA 4NSNA 1TZMA 3F74A 5JAIA 2XVZA 4QFBA 4Q01A 4HAVA 3FTQA 3EZYA 3I72A 3CS3A 5HIKA 2ZJ1A 1R16A 1J07A 2X3FA 3F4KA 1T2VA 2Z2ZA 3L92A 3W8DA 3SVLA 5A3SA 2YTZA 1L7DA 4OFBA 3M81A 2XZDA 1NXOA 2MSEB 2BHTA 1QM5A 4IOJA 3P9ZA 3WIDA 3TQRA 2DZDA 3NC4A 3QBVA 4YPFA 3GJ7A 2OHGA 4JSRA 3RK0A 3JPWA 1CUBA 3R0ZA 4FE7A 1VBFA 3ZDBA 1Q5PA 5D86A 5FR1A 2VNJA 4BVEA 1CYEA 1RAHA 2FMIA 3NBKA 2YN0A 1GGFA 4G0NA 4MDEA 5IAJA 1GPDG 3DC2A 3PQEA 4E5PA 2QRGA 3IAUA 3X1DA 3FVVA 4LX0A 4PAGA 4XPIA 4EY5A 3HDHA 1Y9DA 3AETB 2C2BA 4QBTA 4ABTA 1I6WA 4KMRA 4BMCA 2XB2A 2QNRA 1PWHA 5LBIA 1IM5A 3IHWA 5E3HA 5JADA 1G5RA 1LGYA 2ZJ6A 4Q4JA 4E5YA 2RK6A 2WDPA 1DQRA 4XWWA 4ZJZA 4YJGA 1D9ZA 2W2QA 2XJ9A 2H00A 3L7KA 5ECWA 5C3UA 3IXMA 1TVKA 4UUAA 2I7DA 5CT4A 1RXCA 3M6VA 1NUQA 1ESEA 4R1PA 4TMZA 3CNHA 4G5FA 1L4BA 4K03A 1P2SA 4NKRA 1NTRA 4F9TA 1NW7A 3W3AD 4K0KB 3SY8A 1MF7A 5JS8A 1JPVA 3D8NA 5IDQA 1KSFX 1LPSA 1Z2OX 2GPSA 2V4UA 1Y8QB 3PT5A 4TM8A 1H3NA 3TSCA 5KO2A 5HJ5A 1XQ9A 3M6MD 5DF1A 3REQB 5CFPA 2A0WA 3B5JA 1FNDA 2VSFA 3PL1A 4Z9BA 3EASA 3M4ZA 2CJPA 3BCUA 1KMIY 1NN3A 5FUMA 3VJRA 3AHDA 4BO5A 3GNSA 4D02A 4MMZB 1ECJA 4MYCA 2VH1A 1BHO1 1FFEA 1G8KA 1NBMA 3L4EA 4HGZA 3PYLA 2CCKA 1QKJA 2Y68A 1N6PA 4HG2A 4I4IA 4AY6A 4AYXA 1YQDA 1LXCA 3M4YA 3KZVA 5ICEA 4A2QA 2CXTA 3TAHA 1X0XA 3E7WA 2NZ8A 4EQ6A 2C7OA 2J9XB 4F38A 3ZCQA 1Z15A 3PLAE 2VJPA 1ULUA 1YOVA 2NO1A 3GCZA 2P11A 5DV9A 4YT2A 2WPDD 1JDBB 4PW0A 1NPTO 3WWEA 2X8BA 4MEBA 4B3XA 3IE2A 1EJBA 3O9VA 2VUTA 4QLAA 2D5CA 1ONBA 4JXJA 4BNLA 2FA9A 3DNMA 4EFMA 4RJJA 5CYPA 3O95A 1TTPB 1VJ5A 3H2SA 4BRWA 4DMUB 4LZWA 5KCMA 5SICE 1UC5B 4XEHA 4JOCA 4RXUA 5HZGA 1P75A 4M0KA 4BPBA 2QGZA 5BNZA 1K08A 1SKYE 2PK3A 4DVGA 2DUWA 5LJIA 2V6FA 4NL4H 2FB9A 1HMPA 1VKZA 4KODA 2IXDA 4OQYA 4DZTA 4B6RA 4JU9A 4OBBA 1N2XA 5IKPA 3W5UA 1FRVA 1TC1A 2B9VA 2R68A 3CT4A 3HGTA 1THGA 3ABQB 3I2YX 3WLNA 3ZBQA 5A9SA 2OESA 4EHHA 2I6GA 3FPFA 3FVQA 3JQ9A 2QG9A 1LF0A 4HY3A 1B8PA 4BU0A 1NQVA 4I14A 4UPVA 4G67A 5FEMA 1JZTA 2KX7A 3JYHA 3AI3A 1YE8A 4Z4HA 1Q7BA 2J3LA 3DKIA 3I3SR 1W5FA 2RGWA 4BO6A 5B30A 1I0LA 1IY2A 1Q83A 2C95A 4X97A 2XUZA 1V37A 2EW1A 3CNNA 5ALZA 4I1VA 5A7GA 1K75A 3TR5A 1E2EA 1A8IA 2BKLA 2N9UA 3ZHUA 2CLCX 3D02A 3NYIA 3N74A 5C5DA 1JEAA 2X3UA 3CEHA 3Q7QA 4OA5A 3W8RA 2GPTA 3B1XA 3TW8A 5E9WA 1THZA 1YDFA 4CEHA 1U8YA 1G5TA 4L4UA 4EA6A 2ZATA 3BK2A 1D6NA 1DX6A 4V38A 4IUCS 4KIJA 4LHWA 1G60A 3S44A 3SC4A 1JHAA 5HDQA 1LVUA 3NHKA 3FETA 4MVJP 3L7JA 3VR5H 3Q15C 2R7NA 3EGWA 3LA8A 5JVDA 3IEPA 2GJ9A 1K7EB 3FSEA 3QGMA 5B1HA 4BUZA 4U7DA 4Y0VA 4DV2B 2FGJA 2X7XA 1W29A 2XQKA 3UMBA 5ARDA 1PG2A 3JV7A 3L40A 5BV0A 3K71B 4O4JA 3R7WB 5I3CA 5C35A 4BYMA 3DD5A 1RJEA 5ESXA 2I4IA 3NTOA 3U1TA 3ZS8A 2FLVA 1AHNA 1Z2AA 1DO2A 2CUTA 2V9PA 3QE0A 5AW1A 3S2FA 2Z5VA 1CR6A 2OZLA 1BXGB 2P0AA 2YYYA 5EZQA 3TD9A 4GKAA 4CCYA 4CPDA 3C24A 3S40A 4AM8A 3WO1A 3GARA 2FPIA 4MW5A 4KXVA 5A6SB 1Y6QA 2A84A 1SFRA 4EZIA 3R5SA 1EBUA 2HCRA 1XRJA 3ZGYA 3EVFA 2H92A 1RBYA 2B1GA 4O2AA 4UUOA 1PP4A 4H3KB 5ADVA 1LB1B 2H06A 4DPKA 3M6XA 3OCWA 1Z4QA 5AJUA 3AP1A 1T0BA 3IJ5A 1HT0A 1Y1QA 3DV0A 4RVFA 3WGTA 3DE6X 2YVUA 4EJFA 3M1YA 4PSUA 1A4XA 1GPKA 2AFIB 1PLJA 3RHZA 2QQGA 3THSA 1RBMA 4YMIA 2RHBA 3DMNA 5A5FA 4B3SB 4ITRC 3IAAA 5CX1B 5EQTA 1V16A 3T4PA 3FLBA 4XEUA 3RC3A 5DX1A 4GGMX 3OWHA 2RGDA 5L95A 1BQ4A 3D6TB 4J1QA 4QXPA 4WESB 1W0JD 1TMGE 4O5OA 3BKXA 5I5GA 2C9BA 3TGWA 2P8SA 1ZXBA 3F3SA 1RACA 5J2UB 4I8XA 3Q3HA 2AUTA 3OE1A 5EJ5A 1WRBA 1VE1A 1HYQA 1R9GA 4TV9F 4DA0A 2ZBVA 1T3ZA 4CQJA 2E49A 2PSHA 2WG1A 2RGBA 3RGWS 4U7HA 4AWAA 3AUYA 3GEBA 3TIXB 4HHEA 3PUYA 3SSOA 3QY9A 1SWVA 1N5LA 5TQ0A 1XELA 4J4HA 1MB9A 2BVNA 4MQEB 4UOQA 1NFRA 5F21A 1ACLA 2XW6A 3PG5A 5C1DA 1X9IA 1YS9A 3KJZA 4HVLA 5BN3B 4Z2YA 2Y1FA 2H8GA 1SQ0A 1PJZA 3OTWA 4RYDA 2H3HA 3ZXUB 2QRQA 3ZWYA 2H51A 5HVNA 5JYBA 2DR3A 3A31A 4OQDA 5DGHA 3RYCB 1XNRB 2ONKA 4N39A 1BJRE 4G56A 2B6HA 3S28A 3T94A 1QR2A 4FFSA 2PEZA 1ICEA 4U63A 2WU3A 2C83A 3NTUA 1KBZA 1UJ5A 1ZVQA 2F00A 4PS1A 2PUFA 2O57A 1FFYA 2XWBF 2UXCB 3R9XA 3KQWA 5EIOA 1YL6A 1BVHA 2GHTA 1K6IA 1OTHA 2W83A 1DEXA 1EFPA 4PNZA 5EPUA 1AB5A 3U3KA 3NGLA 2SKCA 3X2EA 4FYMA 1GGJA 2WG2A 4O6VA 5JZVA 4TTRA 4Y98A 1IRIA 3TQCA 5JH7A 2XT0A 3A8TA 3IT0A 3IBFA 2DECA 5LZ9A 2ZAGA 1E77A 2F2TA 4HX2A 2V7XA 4XPZA 4DAEA 4H31A 1T9DA 2COEA 4IUBS 1WXIA 3ZOKA 3D4IA 5FHRA 4C0AC 3DXZA 3C1TA 6GPBA 2B4TO 1Z6GA 1SXJA 2A78A 3BREA 4KRYA 5DULA 2QRNA 4B45A 2PMWB 2ZAMA 4R9UC 3K7EA 4CL8A 3X1WA 4AK9A 1R6XA 1JT2A 2C5LA 4LZPA 2LBPA 3E27A 3V9AA 4J3JA 4QLBA 2PANA 4AT1A 5KHOC 1C9MA 2PZFA 4M49A 4PYNA 4Q1BA 4WY5A 2ZFUA 3GR6A 3LY5A 5B1IA 1NUAA 1DMRA 1MQ8B 4DMFA 2P1DA 3ZXIA 1B42A 1QHGA 1JALA 1J97A 3UV3A 2O3TA 2Z1DA 3ZLBA 4D98A 1KK1A 5I6DA 1SXPA 1IHUA 4E13A 1XZJA 3B1KA 2Q6OA 1TZ2A 2A9QA 4LFAB 1RFLA 2NUAB 3MJCA 3EEIA 1EP9A 3FM9A 3H9JA 1EG7A 3ET5A 3F1LA 4UM9B 2B1JA 4M37A 3QJGA 4U0JA 1BIFA 3RUPA 2XWQA 3F47A 4LDAA 4S1TA 3HA5A 3KFXA 1Y4ZA 5CIYA 3CLTD 4Q9HA 5FBHA 3NP9A 1QH8A 1TO1E 4JOBA 1IY9A 3ORQA 3TOZA 1V25A 2OQIA 1GKLA 2HZBA 3IQFA 2BIFA 4IIJA 1UKCA 2CL5A 4N7RA 1N8NA 4QGSA 5AUNB 1K3UB 5FUQA 2HHHB 1GEEA 2XTNA 2WIGA 1NBAA 4QT0A 4KLCA 3VSAA 2PH7A 4KH1A 1VMKA 3FZYA 5FNVA 1FVOA 1T1EA 1KI6B 4GD3Q 4QRDA 4OI1A 4JEUA 1E66A 4E2WA 3O8OA 4GZ5A 1XNJA 2WJ6A 2BGLA 1T2FA 1V47A 3QXXA 3FIJA 4KMOA 5F2EA 5J4YA 3UK0A 3IQZA 3DXFA 4I08A 3WMWA 3W2TA 5AW2A 4RLFA 3OZBA 4BNFA 2O7VA 2VQ3A 1J1ZA 1M2JA 3PNSA 4OP1A 5G0TA 2I6XA 4M9XA 1FYDA 4BNTA 3DM9B 5T8KC 3WLMA 3TBHA 2NPOA 3K09C 3HSYA 3SJUA 3RDPA 4BBJA 4ZQBA 1Y7PA 2SECE 1SA0A 2FPGB 4OK5A 4WOJA 2GSWA 1TUEA 2Q3JA 4JP2A 3X1YA 5JO9A 3EGVA 2ZCJA 2AFIE 3NUZA 4QUKA 3MWEB 4BVGA 1JE1A 1Z22A 2N75A 3A3YA 3N39C 4QELA 4WW0A 4BFYA 1R88A 4PYLA 1Z5UA 4X63A 2YVAA 3EEYA 4F45A 4YRDA 1UOEA 3HEAA 1N5MA 1COWA 2HLHA 5K8VA 1CUJA 1L7XA 1QQ5A 2GPYA 3KR1A 3JAWA 1U94A 2V7VA 3CRNA 3Q7PA 4ZI2A 4YRCA 3O9ZA 4B6PA 3QUQA 1AGPA 2CBXA 4S24A 5LIRA 1EQUA 3LAWA 5AOVA 4XIGS 4DR6B 1H0SA 1O95D 3SHFA 4R3WA 3UA3A 4DJ5X 2ODTX 2VC2B 2XYVA 2O5VA 1FZTA 4U1RA 3OKCA 3UJDA 5AKZA 1NW3A 2ZT8A 1P7WA 3GH3A 1T3LA 4JYZA 1PF7E 3N2NA 3GQBA 2DJ5A 4DV0B 1M74A 1AV7A 1KVRA 2AFRA 3IV6A 3EMKA 3LY9A 3OJEA 3K8ZA 4C2AA 2G6TA 5JQGF 2UUAB 3IHLA 2B37A 3PLRA 3TH5A 1J06A 1IHYA 1GLGA 1NDUA 4I4NA 4DLTA 3FYDA 4LFCB 1IEWA 1SBIA 2CNLA 2EWWA 5ERXA 1BFUA 5AR1A 1USUA 3II6X 1EGQA 1NN0A 2D1QA 4DUGD 2X5XA 2NUTB 1PDVA 1I1HA 4EMUA 1ZRHA 2WJJA 1QZXA 2R2GA 3KEOA 2QB5A 2HXYA 5CXXA 4LRSB 3M6AA 3R1IA 5JJBA 3USCS 4MAAA 1MLDA 1XKQA 2HLDA 2IYSA 1VC2A 3EXEB 3QUSA 4MSUA 3NOVA 3KQSA 3B38A 3OX1A 4PQYA 2IPNA 2CE7A 3PC7A 1KO4A 2AR7A 1EPUA 1OX4B 2GUWA 1RWMA 2VJNA 4I8IA 4R8LA 3KDPA 5C34B 1T0IA 4RXMA 1W94A 1EG2A 4R2MA 1KWKA 1HDYA 1NBIA 1USIA 4I1RA 1QK5A 3MA0A 3ICEA 3QF7A 2FLWA 2HJ9A 1V26A 2R9VA 3RVBA 3SHOA 1SBZA 4UE3S 4V0LA 3CKYA 4D8YA 3V8RA 4GP7A 4B9AA 4DJDC 1NULA 2OFXA 1ZX1A 1RXIA 1GTG1 4CMIA 2V98A 4LOIA 3IFSA 3D4OA 1PHPA 3P9CA 4OIMA 4KN6A 3ZDXB 1W6UA 1XV5A 2CVPA 3FUXA 2P2ZA 3SEQA 3IXQA 4NE7A 3UKJA 1UWKA 4O8CA 1QE3A 3GVPA 1TU4A 3D1VA 1MMFB 5I3ZA 3FHJA 2B3DA 5ALMA 3O8DA 4QWMA 5C51B 2H63A 4DMLA 1B6TA 3GPIA 3QXHA 4KNVA 5B7QA 4JC4A 4BNVA 1MD9A 5DTQA 2JIMA 5JC1A 1NI5A 5IJ0B 1U1IA 5AIBA 1YC5A 2B9EA 3KSDO 1N2JA 3FGNA 2FZEA 5DBIA 1K8XB 5B1SA 3PRKE 4AW9A 5EWMB 2IEBA 1OGIA 2ODEA 3DP7A 3HWWA 3G17A 1YKGA 2XBLA 4KNWA 2YS7A 5AXAA 2ZQZA 3HN6A 3DT9A 1Q84A 3ENNA 3H05A 3VZPA 4NFYA 2RAFA 4MAMA 1ORRA 3KWFA 3H2HA 3KUKA 4KVAA 4LEIA 3WA7A 2YOGA 1Z3CA 1SK8A 2BF7A 2WWYA 2H4FA 3K70C 2QMOA 1G8GA 1LV7A 1XF9A 5IUKC 4N3AA 1L1FA 2HZ7A 4FFVA 5AW4A 2AMVA 2PRYA 1O57A 3A1TA 3AVQA 4UXIA 1GXSA 2I87A 5JE8A 5KDLA 1DO0A 1Z0KA 4TMYA 3FPCA 1ULTA 2BN4A 3U3ZA 2OGUA 2W6OA 5A4MS 4J0HA 1PGPA 2NQ8A 1YZVA 4C0LA 1XTZA 1ULSA 1Z4JA 4IWXA 2AVNA 1DC3A 3EG9B 5EL0A 3CUKA 3V2HA 3R8FA 3EPLA 1QHIA 2I3GA 2XCOA 1OV4A 1QTIA 3R0VA 1EVZA 3M33A 1S89A 1QQBA 1LQ2A 1FFCA 5BW4A 2ATVA 4NBUA 5CM2Z 4RLHA 1NJ5A 2H2DA 3MGCA 3L8ZA 4RKWA 3QEBZ 2O3QA 1ZVVA 4R16A 3NATA 1U3VA 2BZGA 1HNXB 1C8BA 3L04A 1E1CB 2FCRA 2W8ZA 2E4AA 1TLTA 3JQFC 3WRVA 2H2IA 1RZRD 5KYYB 3WHPA 5IDWA 1DTEA 1UH5A 3AHHA 4YFVA 1GPLA 1N9GB 1MTOA 3MWDA 2YC2C 1VL2A 2UYCA 2ORWA 3SM9A 3WQBA 1UFKA 3OJCA 3HMQA 2A0YA 4O2BF 4EYEA 1HEIA 5FD8A 1UBLS 1TEVA 3PDJA 4PBSA 1FYVA 2A58A 5REQA 4CLHA 1YA8A 1RRMA 2XH8A 3ZU4A 2XSZA 3JWJA 2DPYA 4F84A 5I4CA 2IELA 1BCRB 1H4TA 1N9ZA 2FP3A 4ONEA 3U9SA 5LNK6 2GO1A 1FDIA 3TMAA 1H2BA 4L9SA 1OJLA 4IG4A 4C3OB 4DTIA 1FDSA 3FRJA 3EBOA 3T7CA 4EWLA 3H9UA 2BTQA 1PEKE 3B48A 4QNRA 1ZRMA 3OKFA 2J31A 3GG2A 3MELA 3D64A 4BATA 1P9LA 1PWYE 4JBHA 2JEYA 1YBVA 1E69A 2C2MA 3MT7A 4IILA 1Q6ZA 4PX3A 3ZGNA 2D1FA 2MSLA 1T6XA 3BF7A 3C5HA 2CL7X 1PZNA 2KLBA 3ZHOA 5HPYB 1L8QA 2IVZA 2FUCA 3HSSA 3QLUC 3ULKA 1WO8A 2OKCA 4IICA 1EM6A 3VU9A 1R64A 4OD0A 4LSGA 1WXDA 7AT1A 3OPNA 4K05A 2RGUA 4RV9A 5DWVA 2E4ZA 1K2WA 4I50A 5KIAA 4G01B 3VR2D 4QT4A 3KTAA 3IVGA 1Z0DA 1GYPA 5TQJA 3RROA 4B4OA 1GN9A 1U9YA 2MSCB 4RS3A 3D5TA 5EZ6B 2PJDA 1A8PA 1WA5A 3E5MA 3HR7A 3RYTC 3VKWA 4GDFA 4FCTA 3MW8A 3PQ7A 4GEGA 5A6VA 2ZIAA 4E2XA 5KX5A 2XMZA 2R6AA 1I7NA 2Z4RA 3SDSA 1KZYC 3VZRA 4FJ2A 3KT0A 3PGJA 4W1RA 3RT7A 1KFBB 3FROA 5LZ5A 3ZWQA 1BCSB 1UFOA 2PZBA 4KCGA 5CVDA 2WU4A 5A5DA 2JG3A 2NZYA 3ZXYA 2D2IA 4TN5A 4XE5A 4ZARA 4AMYA 2P2YA 2ZWMA 3I0MA 4P83A 4R6WA 5CXSA 5DRYA 3G8DA 5KHAA 3LOQA 1GL9B 3SR4A 3GBPA 4UHKA 1US8B 1FNMA 1AKRA 4CKEB 3SZOA 1HH4A 2IXAA 4EYGA 1C0EA 4QC2A 1GQRA 3TKLA 3RQSA 4BP9A 1D5WA 2QP4A 2FEWB 3B2QA 1CY6A 2B36A 3TJMA 2A5YB 3DVAB 1L4FA 1HTBA 1Z88A 1XLTC 2FX3A 2VL7A 3TLZA 5KC8A 5E2BA 1R8YA 4LXIA 2XE6A 4M8LA 2WUEA 5AVSA 1OXTA 2W2XA 3R6TA 4P9NA 4AXXA 3GLIA 2ZVPX 4JB8A 5FNZA 1WKCA 3KCQA 7ADHA 2HSEA 1QGYA 2ACWA 1IHOA 2C61A 2R62A 5C2JB 4UKDA 4M9QA 1D9XA 4AJ9A 1DTWA 1NATA 5CFZA 3A6ZA 3GMDA 2F1HA 2J7KA 2VWPA 3B3GA 1IN8A 3L05A 4O4HB 5K3FB 3T34A 2DPGA 3DOEA 1ADGA 4WLUA 2EP5A 5DGDA 2CYCA 2W8BB 2YHAA 1A9ZA 1TUBA 4IVQA 4YAWA 1VL5A 2OEPA 4KIGA 2JI6A 2I6FA 3DKVA 3GJ6A 1SOUA 2P2DA 1VCIA 4K3UA 4TMWA 4UDOA 5EE0A 4C7VA 2ADMA 2WTBA 1S5PA 1K68A 3UM9A 4Z7JA 2A1IA 2PGOA 1RKUA 3E9EA 4WV3A 4GZ3A 4EITA 3FTDA 4ZVUA 4MGEA 3ZDYB 3DJYA 1JEQB 4CKCA 1YR2A 3A1NA 1DKLA 3PA8A 3QU5A 3CRZA 4N6GA 4ZDIA 4JQYA 2CXOA 1FXSA 4YUWA 3T1VA 1ONNA 3GAZA 4Q1EA 1TL7C 2XUKA 3GEIA 1DC6A 3GMSA 5DNDA 1RCFA 3IT2A 4KQEA 2PS3A 3TPFA 4ZVLA 3WB2A 1KR2A 3AHGA 4J2OA 3F6CA 3BX1A 3DLHA 3K9QO 3ST7A 2JI9A 3I9NA 3ILVA 4NS4A 2J0QA 5CBPB 1YJ8A 4YNBA 2JLWA 3E4CA 3BMNB 2D4HA 4O4LA 1IY0A 2VFAA 4G1UC 1U7UA 4MUMA 3I6IA 5F4BA 4HPXB 5H5JA 3OIFA 4FYVA 1QANA 4IIVA 2VDWA 1NE2A 3P0HA 3QKRA 1X7XA 3OCYA 4L51A 1KJNA 4WDRA 3M34A 3VJKA 2I29A 4W7HA 4DC9A 1XTBA 1IATA 4CKBA 1Z8FA 4H4DA 2JLZA 2GRUA 4LY6A 1U7WA 1G63A 3JATA 5AHOA 2IW3A 4E32A 5K8IA 1KQPA 1GP2A 2QG6A 2R8OA 4XW2A 1U4OA 5I9IA 1V7ZA 1X2BA 2PR7A 4NCHA 2PT9A 5E1DA 3ZHXA 4Y9RA 4UTVA 2CHVA 4MS4A 3L01A 4G4SP 3RFTA 2E0IA 3I0NA 3MSXA 4M1SA 2C59A 3FJYA 4CCWA 1RWKA 2A9KA 2XE7A 1N2GA 4JJ4A 4LVCA 5KPDA 2PL3A 4MV8A 5I7WA 1QV6A 2SHKA 4LVUA 4Z54A 3JQDA 2HU8A 4WLNA 1GL7A 2P8JA 4F3TA 1XHEA 1LA2A 2DTDA 2NU9A 3FZGA 3EVAA 3TX6A 2HCTA 3PC6A 4R54A 1I3OA 2I7VA 3Q72A 2GARA 3MLAA 3QOYA 1NLMA 1ST3A 4S0ZA 4C89A 2JGIA 2VDUE 1ABFA 2JZOA 1EK2A 1KSHA 1ZVMA 1XGKA 2K5UA 3L49A 4HXFB 3LKZA 4B47A 5AJWA 4Q4DA 2BJWA 1A98A 1A71A 1BTOA 1Z0SA 1YZLA 4CVNA 3FKQA 4Y2JA 4YP7A 4QAJA 3T3DA 2FX2A 3QLTA 4Q6WA 5COBA 5GVRA 4B75A 4QQRA 5F2NA 4LZJA 5T8KA 2FEAA 1ZH6A 3K09A 3F8SA 3MRTA 3WB9A 1X1BA 2HW8A 3OESA 3BL8A 4GYJA 5BNIA 3DW3X 5B58T 3W05A 2CMKA 3NASA 2NQ2C 3SFTA 2YDXA 1CULC 1R8SA 5B37A 5TC4A 3N05A 1MX1A 3NIDB 4DV7B 3H5OA 1ABBA 4KDEA 4U9UA 5E8RA 2CUKA 1KHHA 3VKGA 1PFUA 3MIZA 1K6XA 1L4HA 1ZM3A 4NVRA 3RC1A 1X1SA 1JR3D 3CH6A 1MZVA 4LHXA 4EGCB 3HH8A 4CLEA 4F4HA 1G21B 2EKLA 3BMCA 4I5EA 3X3HA 4EFNA 3KOXA 2C4TA 1ORIA 2QRPA 4FLFA 3R09A 1KI2A 3TQOA 2PX3A 1CZRA 3IALA 3MF4A 3OPQA 1GPH1 4KJZA 3NTXA 3ZKAA 3RB8A 3CW9A 2W00A 5CVTA 5KQMA 1GDDA 2P4QA 5M5BA 4JK3A 2K87A 4ND7A 9LDTA 3PT9A 4IPTA 2PX8A 3JRXA 2C03A 2QQFA 4PCAA 1JLLB 5HCUA 3VU1A 2H7CA 2Q3EA 3VX4A 2C29D 3WGYA 1JH8A 2NLOA 2V4ZA 2XHEA 4AQDA 5L4NA 4KR7A 1P1KA 2HEGA 4TUYF 2VT3A 2HA7A 2PZGA 4E5SA 1NPYA 2O8DB 3E2PA 1Y3FE 2LD4A 3O1JC 1P7CA 2XOKA 2QLBA 3LGXA 2HI0A 2XX3A 1X87A 4IVNA 4MWCA 2DWCA 4ZA2A 5HR5A 3TLJA 5HKBA 1NG9A 4HEJA 5I5EA 1G42A 1FMFA 3SR3A 1T1SA 3WKCA 1D1TA 2CZGA 4IIFA 4KQIA 4Q3NA 3RKSA 3G85A 4NG4A 4L2IA 2FPRA 1NYLA 2QVGA 3HV0A 4QPCA 1OFTA 1RT9A 3SSNA 1FFGA 1JG1A 1W19A 1E3LA 1UJNA 2VZ0A 5H82A 2WF5A 2I0FA 5B7PA 5BN5B 2TMYA 2QLMA 3KQPA 2MYPA 2OMEA 1WX1A 5TX7A 5AVUA 1XCGB 1D1QA 2HL6A 4PSDA 2G7ZA 1U1EA 4IV0A 4ZT4A 5JCPA 4L6CA 1CT9A 2XQVA 2Z56A 3ZCVA 3PC2A 3RC9A 3LT4A 2ZB3A 4HJXA 4MW0A 2Y1EA 4GL2A 1L6RA 1G41A 1XRQA 2QN2A 3X2FA 2PZMA 3TDMA 5EMHA 2ACEA 3T1TA 3GLRA 1UBKS 5AKYA 5E2IA 2H54A 1XEWY 1FP7A 5DN6D 2HNBA 3OQOA 1I9GA 1RHKA 1MAHA 3LZCA 1EAMA 2PWBA 1C9EA 3G89A 1JHPA 3LT2A 4YDHB 5EJGA 4BQSA 3ACBA 1GYQA 1RRGA 4RHCA 4NDAA 4F0JA 2BAGA 2OPHA 1KZ6A 2RGEA 4EI7A 3STXA 5K9ZA 1HE4A 3RCBA 5JLJA 2Z2XA 4U5QA 5HTKA 3ZWXA 3LU1A 2GVDC 2JGLA 5H9WA 5G40A 4UHEA 5I8WA 5JJIA 2WP8J 2QTCA 4FOPA 4LOHA 4XQEA 2F67A 5DBGA 2P4HX 3TX2A 2PKYX 1XZHA 4K26A 3KZKA 2EP7A 2IHZA 4J03A 3RU9A 1P1BA 5H1YA 1NUUA 1EFVA 1DV1A 1PJQA 1ZMTA 4QUHA 1CP3A 5AHRA 2REBA 2NV6A