4S1VA

Crystal structure of phosphoglycerate oxidoreductase from vibrio cholerae o395
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
b'MMKIAILDDYQNVVRGLNAFQCLQGHDVTVFNDSVSDETVLIERLKPFEALVLIRERTPITENLLAHLPNLKLISQTGKVSNHIDVPLCERYGVTVLEGIGSPVAPAELCWSLILAASRHLPSYIEQLHAGHWQQNGGLGLGRTLSGRTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEASRQKALELGYQAAADKAEFFAKADVLSLHLRLNDATRGIVTKQDLLAMKPDSLFVNTSRAELVESGALYSVMQANPMRQAAVDVYENEPALPNNEPLLSLPNVLCAPHLGYVEKNSYEIYFQAAFENVVKFAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-3-phosphoglycerate dehydrogenase-related protein
molecule tags Oxidoreductase
source organism Vibrio cholerae
publication title Crystal Structure of Phosphoglycerate Oxidoreductase from Vibrio Cholerae O395
rcsb
total genus 110
structure length 313
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.95: Phosphoglycerate dehydrogenase.
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4s1vA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4s1vA01
2A4KA 1Y8RA 5G0VA 4DYDA 4TQGA 4E2WA 1JW9B 1L7DA 4Y9DA 1IY8A 1HYEA 3HADA 4KUHA 2OHXA 3FI9A 4RPKA 3BA1A 3TL2A 4WPGA 3ASVA 1RKXA 4D43A 3GMDA 4IJWA 2VWPA 1BVRA 2BFOA 4J1NA 4YJHA 1EE2A 2WD8A 2PH3A 4MVJG 5JFOA 3JQGA 1EEHA 3LK7A 4R16A 1P44A 4S1VA 2Y1CA 4BV8A 4J1TA 3SJ7A 2CSUA 3G0OA 4E5YA 1R4NA 2PGLA 1R0SA 4OKNA 3WLEA 4A27A 4A10A 5JC1A 5KOIA 1XR3A 3JQCA 3RC2A 3VH2A 5CEFA 1MG5A 1DLIA 2PD6A 4IDGA 3UN1A 1PR9A 3GRPA 4NQZA 3K2BA 4NBUA 1O94A 3ZWAA 1Z73A 3ZU4A 3KSZO 4QXMA 1HDOA 5IDYA 1JAYA 4UUOA 4ZU3A 2IE0A 3P5SA 3W8EA 1G0OA 3K73O 2PA3A 3PIIA 4NK4A 1GQ2A 2PGJA 3WSWA 3OQ1A 2PD4A 3TZCA 1E3WB 2JKVA 3IAHA 3MJ4A 1ENPA 2WWRA 4XR4A 3GN1A 3KB6A 2AMFA 3SC6A 1X13A 4J49A 1EUDA 2JCVA 4IDFA 2Y1OA 5DP2A 1EFLA 4MP6A 1T1SA 1YOVA 4DLLA 3H3JA 1PU2A 4S3MA 4E5NA 5T8KA 1NM5A 3OECA 1VL6A 4BNVA 3KYCB 1TT5B 4FGSA 3ZNOA 3JD2A 3E1KA 5CDUA 5KKCA 1N2SA 4B7XA 3DC2A 1PJLA 1XQ1A 1IPEA 1H2HA 2WM3A 4MP8A 4CR6A 2DM6A 3C7DB 1GUFA 2V6BA 2ZB4A 5EN4A 4J0FA 1GQYA 4EUFA 1IULA 4A7PA 5IF3A 3KLMX 4BNYA 3K31A 4YRDA 3OSUA 4RZIA 4M54A 3H9GA 4E2XA 4IGFA 1NQ5A 4R9RA 3U09A 3Q2IA 2YHIA 4AJ4A 5A5EA 5I9MA 3DZKA 5DZSA 3AU9A 5DT9A 3UW3A 3ZV5A 1PR3A 2HJRA 6ADHA 2FR0A 2D4AA 5BQFA 4CV1A 3I9OA 3WS7A 4WCDA 2Y1DA 1D7OA 3PJEA 1C0PA 2A94A 3RFTA 4MP3A 1W73A 3HWRA 4BNUA 3GMSA 5L7WA 3F4LA 3PIDA 1YO6A 4MINA 1PSDA 5F21A 2ZJ0A 1T4DA 3K30A 4ALMA 3DFZA 1NR7A 3MJVA 5CPFA 4Z6KA 2Q50A 3H9JA 4R3WA 4IM7A 4QT0A 1RM3A 1FDVA 3RUFA 1A71A 3B1JA 3Q3CA 3UKOA 3FN4A 2CVQA 1ZMOA 4NR0A 4XGIA 2NU9A 2HRZA 1SNYA 2BI8A 4U0KA 3OQ6A 1KYQA 3HUDA 3G1TA 4PLZA 4ESOA 3IIEA 1ADFA 2O7SA 2VRCA 3RC1A 1Y8QB 4IDDA 5TF4A 1HT0A 4XQGA 3UCFA 4J4HA 4R9SA 4FSHA 4BNMA 3IDSA 4A5OA 2YV1A 3KLPX 1E6WA 5F3RA 3AM3A 3H65A 3QSGA 5T8KC 1XU9A 2ZK7A 1DXYA 4CLOB 1E3LA 5LDHA 5F5LA 1LSSA 1UAYA 4QQRA 3PTZA 3QJ5A 5U4QA 2BF7A 1IYZA 3AOEC 4J0EA 4BNXA 4GKVA 4N7RA 1ZBQA 1F14A 2D0IA 1R4MA 4M87A 3T7CA 5DNAA 1YGYA 1B8PA 1SB9A 4HX5A 3QE3A 5JY1A 4E3ZA 5L95A 3DQPA 1BXKA 3CTMA 4WOJA 2NTNA 4E5KA 1UR5A 2RHRA 4UEOA 3RAJA 4OXKA 4R5MA 1SOVA 1P45A 1IB6A 3L6DA 3ZWXA 1HDGO 1IZ9A 4GVLA 1JKFA 4NMHA 4UUNA 4YVFA 4P22A 5KIAA 1JLLA 1PJ3A 3IL2A 3FWZA 4I5GA 3U3XA 1Y9EA 3TWOA 4WEQA 1PS0A 4IMRA 5CHEA 4U6SA 5K0ZA 1A4UA 2HMVA 1V6AA 2PD3A 4DREA 1NNUA 3WYEA 3BTUA 1H0KA 2HKIA 3DMYA 5F1KA 4A03A 2AHRA 1GPJA 2CFCA 2C20A 3QRWA 3V8BA 3PI7A 3SX2A 4N18A 3ROMA 1I3KA 4FFPA 4PN3A 2VWGA 2EV9A 3RVDA 1EFKA 5DCYA 3O03A 5CDSA 4B7CA 1GYPA 3ZNNA 4MIYA 1AHIA 2BFMA 1YDEA 1XIVA 1ZK3A 4GX5A 3I9LA 4UUPA 4BNZA 3BHMA 2EERA 3DZBA 2C07A 2GLXA 1JVBA 1R37A 1MA0A 1O6ZA 3ANLA 1YVEI 3I6IA 1ENOA 1I3LA 3S8MA 4DTIA 1A27A 3HDHA 4IIVA 1NBOA 2BGMA 4WKGA 2DBVO 2G82A 5AVOA 1QMGA 4DL9A 4CLOA 3LDHA 1D1TA 2FRDA 3KO8A 3OEWA 4D45A 4IINA 3GEMA 2X0NA 3IKTA 4BNTA 3ETGA 1V35A 4N5LA 3STHA 5MGBA 1KVSA 4BGIA 4DA9A 4CM5A 4D42A 1PS8A 2A92A 3RUCA 2ZATA 4HFNA 3NEPX 2W2KB 1ZK4A 1J4AA 4AJLA 2ZTVA 3LT2A 3JQ9A 2AEMA 1ADBA 3WQSB 4DRYA 3L9XA 1BDBA 1W6UA 3JQAD 1EK5A 4TWRA 2SCUA 3ZWVA 3KZVA 1ONNA 3IJPA 3QWFA 3LF1A 1YS4A 4XGKA 5T57A 2FR1A 1R66A 1VC2A 1YBAA 2HLPA 3LC2O 2PH5A 3ZWBA 3SVTA 4EBFA 4CMJA 4M8SA 5JE8A 3IUSA 1HDYA 5K6AA 2WDZA 3HFGA 4ZQFA 1ULUA 1IZ0A 3KV3O 5U1PA 3DFUA 2VZ0A 2Y99A 3GPDG 5MDHA 2OORA 3A14A 1WDKA 3BTVA 3WGYA 4YT4A 1MGOA 4PLVA 4B3HA 1ARZA 1K89A 4Z9FA 3RU7A 1BRMA 1DO8A 4MJLA 1TB4A 2O50A 2G76A 3JYOA 5KJ1A 3JQDA 2QHXA 2ZCVA 4JJIA 1P1RA 1X1TA 5ITVA 5JCXA 1LUAA 2EKQA 3DMTA 2NNLD 3UOGA 5KJCA 3ZV3A 1D4FA 1PGPA 4TRMA 1Y81A 3OETA 4BO2A 4XQ9A 3VKUA 2F1KA 4WGGA 4YACA 4AJNA 5BNIA 5HTOA 2V65A 2OP1A 4BKRA 4J91A 1SEVA 2Q2VA 3F5SA 1L1FA 1ONOA 2ZB7A 3L6OO 1ZUD1 3X2EA 5G4LA 5A9SB 5L9AA 5FFFA 8ADHA 5BSFA 2VHYA 2GGSA 4RF2A 1BVUA 4ND4A 4LVUA 1U7HA 1Z82A 3L4BA 3ST7A 2Q49A 3DO5A 4R4JA 2VZ8A 3UCXA 1N1GA 2V6FA 3ZHYA 3KM0A 4BIIA 4DVJA 4Q3NA 3Q1LA 3ZHXA 3TFOA 1T25A 3AUTA 3CEAA 2OBYA 2RH4A 4IY1A 4NJOA 5DOVA 4WCFA 3VPSA 4OXYA 1SPXA 5IXSA 4PLHA 1IUKA 3DZGA 3FRJA 5CDGA 3I9KA 3QVXA 4YJDA 1HETA 3O4RA 5JYEA 4YQZA 3DHNA 2E48A 3BMCB 4OMUA 4B8ZA 1E7QA 3SEFA 3W4KA 4ALIA 2AQIA 3ETDA 5B37A 4UVIA 2QZZA 2VT3A 1CJCA 1I24A 4BKPA 4CLXA 5I7EA 1LTHR 1ZO8A 4J2HA 3UAGA 5ICSA 4EITA 3BZUA 4Q3DA 3I3OA 1V9LA 4NU5A 3RKUA 3DZHA 4OSPA 4IUYA 1O0SA 4R1NA 3DWFA 1VKNA 4M55A 4M1QA 1KY5A 3Q11A 2GN8A 4Z0TA 3S1LA 1JDJA 3BTOA 2BLLA 2Y05A 1QORA 2X5JO 2X9GA 3MEQA 4J90A 3R3JA 4RVFA 1P1FA 1MLDA 1U8FO 4OOFA 4ALJA 4WLOA 2J5QA 5JMPA 3JQAA 1KETA 3EAGA 5A06A 3S2FA 3AUAA 1PS9A 4J9UE 4BNKA 1ZIDA 4TVOA 2EP5A 2O4CA 4WOKA 1GD1O 5IZCC 1PJTA 3QVSA 1XCBA 2IEBA 1Q0HA 4E2YA 2AEFA 3S2EA 1PWXA 2AE2A 1DFHA 3RASA 3PHHA 3VC7A 5I8WA 5IZ4A 3I1JA 2B5WA 2DVMA 2W8ZA 4GI2A 5EIOA 5F5NA 1F12A 1A9YA 2B35A 2BHLA 1ISJA 3MTGA 3HB4X 3R0IA 4CQMB 3KETA 3W8DA 4FOSA 1DAOA 3V2GA 4BNJA 4E4YA 1RYDA 3EZYA 3ZV4A 3NDRA 1AN9A 4FC6A 2C59A 1FXSA 2VT2A 3L4BC 2WJPA 1H94A 3IMFA 5IDWA 4Y8VA 5BSEA 4PLPA 1MX3A 4YT5A 4KTVE 3AFNA 6LDHA 4Z9YA 3C85A 4CQMD 1GADO 2P5YA 5JLAA 5JPIA 2Z95A 4NJMA 3K9QO 4P8RA 4CL8A 4JBIA 1D1SA 2I66A 1JQBA 2DAPA 2IYPA 1R0LA 1BW9A 1XG5A 2H63A 1VE9A 2VHZA 2YDYA 2J3HA 1H9BA 1E7YA 3RROA 5DCUA 2D59A 3SLKA 4IXWA 4E21A 3MTJA 3OJEA 1V3VA 2FSVA 4PG5A 1T24A 2OUIA 4ONEA 1KEWA 1R16A 3E82A 5DP1A 1WMAA 4R3NA 4DPLA 1W8DA 3ASUA 1QLHA 1E7RA 3WGZA 3RCBA 1ZSVA 1C0LA 3BHJA 5LCXA 4MVJD 1DB3A 2POQX 1HEUA 2TMGA 1K6IA 3TFQA 3VDRA 4CQMA 2R2GA 1E0DA 2DBZA 2XAAA 2EGHA 4XGNA 2B0JA 2C2XA 4KUEA 1X15A 4WUVA 4KDEA 5HA5A 1HKUA 4QO8A 3HNPA 2DLDA 2Q1TA 3AM4A 5JW6A 1HE5A 1T2FA 3HN2A 4PG6A 2NQ8A 2DTXA 3ITKA 4G65A 3CPSA 2X5OA 4DYVA 4RF3A 5AXCA 4EJMA 2ZTUA 4R41A 4MVJF 3OBBA 4ITUA 4P4NA 4P4GA 1YB1A 2E6UX 3E18A 4BNGA 4CMHA 4INAA 2QRKA 1YH3A 3PYLA 5TQVA 3C1TA 4PZCA 1FDUA 3FTPA 3NGLA 2EEZA 1XHLA 2I9PA 4NG5A 4BO1A 2X5KO 4MPDA 1PJCA 1XWFA 2O3JA 3LC7O 1LLCA 5JAZA 3WGGA 5IJZA 3I23A 1Z74A 1K2WA 3E9NA 2WMDA 4L73A 3QVOA 5JAQA 1Z75A 2Y66A 3LQFA 4ZGWA 2P91A 2O2YA 2QRLA 2CNBA 3AOEA 3PP8A 3O8QB 3UFXA 1OC4A 4B8WA 4O0LA 3PFWO 2UUOA 3K6JA 1OMOA 2C7VA 5AYVA 4FGWA 1LLQA 1HSOA 4WE3A 3GDGA 3OIDA 4NIMA 1PQWA 4Q9NA 5AQ1A 5ICMA 3PLRA 4Q3EA 4RLHA 1N5DA 3MZ0A 1H9AA 4W7HA 3WYCA 1WMBA 1BXGA 1OBFO 3OA2A 1NYTA 1Y8RB 2BGLA 5L40A 1AHHA 1O8CA 2NTVA 1HXHA 2AG8A 3RFXA 2VOEA 3ADOA 4Q3CA 3H7AA 4ND2A 1E3SA 4QO7A 3QHAA 3CH6A 3DOJA 3RBZA 3TOXA 3TZQA 2QX7A 2WYWA 3H6KA 2AEJA 1B3RA 4LVCA 4Z3DA 1PL7A 1ADGA 2R00C 4BB5A 5I7VA 1F8FA 1V3UA 3GNSA 3I4FA 1DBVO 3KYCA 4IBOA 3VPFA 3GEGA 4DQXA 1U4SA 5T6BA 3WQRA 4K26A 2C82A 3P2YA 4CM6A 5JCJA 4DLAA 4KDFA 1P0FA 4XIYA 4HUJA 1AGNA 1UXGA 2AXQA 1LBEA 3RD5A 2R00A 2PWZA 4DIOA 2CZCA 3DXFA 4OQYA 1QV6A 3R1IA 3G79A 5IZCA 1IL0A 2ZTMA 5K9ZA 5HBRA 2CD9A 4AFNA 3LYLA 1VL0A 2EP7A 3GF4A 4OOEA 1I3MA 2X7HA 4ZRMA 1YRLA 5FI5A 4CL3A 4W9NA 3CINA 1WW8A 3MJCA 4BB6A 3DHEA 4CM3A 4DPKA 4N54A 3DEYX 4YTEA 1VPDA 1HE4A 2X4GA 2X0RA 3NAQA 5CG2A 2VUUA 5B4TA 3GEDA 2JCXA 4FFRA 1XA0A 2AQKA 4E32A 4IDCA 5KNLA 5EINA 4CM9A 5JCJD 4OM8A 3BHIA 1O95A 2HJSA 2VWQA 3WJAA 3SC4A 5IDXA 4RJTA 1GCUA 1LDGA 1YQDA 2FHSA 3KSUA 2BMAA 4XYBA 4CQLA 1K6XA 5JDIC 4FC7A 4TRNA 2Q1WA 3K96A 4YRAA 3WGOA 1KS9A 5A3JA 3AI2A 1H6CA 1ORRA 3H5AA 4EUEA 4KTTE 1GEGA 3WYBA 3ZWCA 4R1TA 2YYYA 3ZZNA 3JV7A 1E5LA 1U3TA 3D4NA 3I9MA 2H1SA 1E1LA 1UP7A 3MCVA 4GH5A 3RUDA 3TNLA 2B4QA 1Q2XA 3I9NA 3WIEA 3COSA 4D46A 5G4KA 1Q7BA 3ZHZA 4GX1A 2HO5A 5AXDA 2OGUA 5TT0A 2HAEA 1WP4A 1ISMA 4ALLA 4WCFC 1OFGA 2NVUB 3D7LA 4DIFA 4YRBA 4Q3BA 1U3WA 3C1AA 5DF1A 2IXAA 5AXAA 1YDWA 3NV9A 1T2EA 4NH4A 4XCVA 4MVJM 3G1UA 3X2FA 2RCYA 4DBZA 4UAGA 2VHVA 1X1EA 5IG2A 1UJMA 2VRBA 3AOGA 2VHWA 2HMWA 4OYRA 2BFPA 4MKRA 1LSJA 3RU9A 4PLTA 4CMKA 1VM6A 4GL4A 4E0BA 4O1MA 5HS6A 1KVQA 1PQUA 2GRAA 1MUUA 2VYNA 4J3FA 3DBLA 4BGEA 4UUMA 4O63O 4GPD1 2IEDA 4CM4B 3GZNB 3H9EO 5BR7A 5DBGA 3C1OA 4EDFA 1JKIA 2O3SA 4YDRA 1DIRA 2Q1UA 1GPDG 1QR6A 1YE3A 1FDSA 2LDBA 3F6YA 3ZWPA 4BS9A 2PNFA 4BQRA 2NM0A 2P2SA 4CM8A 3PFFA 3S55A 1CQJA 4JN6B 3ZNPA 4UULA 1DIHA 5L7YA 1LRKA 2TMDA 3PQFA 4ZRNA 2IZZA 2G5CA 2H6EA 1QYDA 1R12A 1A9ZA 3H2ZA 4FFMA 2PKQO 3WR5A 3OJ0A 1DAPA 2NV6A 1E7SA 1CWUA 2X9VA 3V1UA 2QG4A 4L4RA 3RIHA 4OKIA 1RPNA 1M67A 4ZQBA 3KYBA 1B2LA 1TLTA 2B4TO 3QWAA 5IAAA 2JFHA 3V2UA 1PZHA 1CETA 2W2KA 4GKBA 1YOVB 3UVEA 4WASA 4RO0A 5FWNA 3W1VA 5TLSA 4M86A 4BHTA 4GSLA 4QSMA 1Z7BA 3PK0A 5GZ3A 3DBHB 1HDRA 5T64A 2GSDA 5KVCA 1U8XX 4N5NA 3TZKA 4KWHA 5EMHA 1P3DA 1VJ0A 3S2IA 2D5CA 4PLFA 1Q7GA 3M6IA 2ZQYA 2Y0DA 1Y7TA 1WNTA 3I83A 3JD0A 2HUNA 2IZ0A 4PLYA 4CMGA 5EJ2A 1UDAA 1MXFA 3VOSA 4OGWA 4J4TA 5GZ6A 2PZJA 4R1UA 2JFGA 1U3UA 2J3IA 5JBIA 2GN4A 3KSDO 3JQBA 2WEKA 3GVIA 4DXHA 3CKYA 9LDTA 1N8KA 4XKJA 2NVBA 1PX0A 5KJEA 2OZPA 1SOWA 1N9GA 4OQZA 3QVTA 3OJOA 1E6UA 3QY9A 2G17A 1W4ZA 3OFSA 4LW8A 4QFCA 3WWYA 1EUCA 4J7UA 2YQ4A 3U4IA 2X9NA 4EI2A 4A0SA 2D1YA 2D5AA 4G2NA 4EEZA 4YAGA 2IRWA 5T67A 4UEKA 4PLWA 4WEOA 3C8MA 1NFRA 1UZLA 1XYGA 4BNWA 3PGJA 1XGKA 1ISHA 1I5RA 2FOIA 2NU8A 5C7OO 1I2ZA 1A5ZA 4RV9A 1H6AA 1BXGB 3NGXA 1YXMA 4U8GA 2ZYAA 2W98A 3VPXA 3ZWYA 2UVDA 3MWEB 5JDCC 1XLTA 3LT4A 2IZ1A 2GN9A 1CF2O 2E49A 4ZD6A 1MFZA 3PDUA 3QIVA 4QTZA 2Q46A 4JBHA 5FEUA 5KCZA 1R15A 4NZ9A 1FF9A 1QLJA 3UF0A 3WNVA 4XYGA 4DUPA 3PZBA 2CMDA 3RWBA 3KEQA 2ZB8A 1SC6A 4OL9A 2IDZA 1XKQA 1CDOA 3KYDB 4HXYA 3ONEA 3U0BA 3IQDB 5DDIP 1BGVA 2AG5A 1ZSNA 3F9IA 1D3AA 2EF1A 3BMOA 4FIZA 1FK8A 2YDXA 4B4WA 4DLBA 2X1HA 5L4LA 4RPJA 3ZU3A 2NWQA 3FBTA 4B4VA 3A4VA 2H5LA 4Y67A 4H16A 4IJVA 2P4HX 3WTBA 5JO9A 5HS4A 1U1IA 1YJ8A 3WBBA 2PK3A 1N1EA 4IJUA 1O5IA 1ID1A 4ID9A 3ZW9A 2Q99A 1RJWA 1DSSG 3FR7A 1HE2A 1F0YA 3WSVA 1M6HA 2W2LA 3WTCA 2UAGA 2VNSA 4JROA 1AUPA 1I32A 5CPBA 4HNGA 3DR3A 2GZ1A 2PY6A 4D0RA 3W6ZA 3JQ9C 3PYXA 4CQLB 4RZHA 4TKLA 3F5QA 5KVVA 5DOZA 2RBEA 4WNIA 3KVOA 4NPCA 3ICCA 3LSYA 3AUUA 3EW7A 1B26A 3GDFA 3P7MA 4ZN6A 2JHFA 2YJZA 4GX2A 1LDEA 4HNHA 1JWAB 2OOSA 1C14A 4CODB 5A1TA 5A05A 4AL4A 1VLLA 2NQTA 4DMLA 4MVJA 7ADHA 3GZNA 1GUYA 3ZNQA 1PGNA 3TQHA 2IYOA 3EY4A 1Y5RA 4AICA 3FPLA 1EK6A 1TA4A 4LRTB 2ZB3A 3GFBA 1GV0A 4PGFA 3AM5A 5I7SA 3VH4A 1AE1A 3FNHA 2P4QA 2W4QA 1R6DA 2VHXA 3VTFA 4CLHA 4CLRB 2E37A 3WJ7A 1ADCA 1FMCA 1UUFA 4AJKA 3AFMA 4DMMA 3QP9A 5KVSA 4YJFB 4YJGA 1MP0A 3B1FA 4KZPA 1EZ4A 1ZW1A 2JFFA 3TPCA 1B16A 4D41A 2CY0A 3KTDA 2JAHA 3VHRA 1NAHA 4R1SA 1ZK2A 3K92A 5CDTA 5ADHA 3OF2A 3JQFA 1CEQA 4AJOA 2Y1FA 1E3EA 4IS2A 1OOEA 2CF6A 5TSDA 5IFLA 3FBGA 4CMAA 2HSDA 4R5HA 4XYEA 4BNLA 1SZJG 4PG7A 3G17A 1C1XB 4PG4A 2DTEA 2OXIA 4F46A 4LISA 4R54A 4WJZA 3HDQA 4GWGA 1KVRA 2NVUA 3WB9A 3DAFA 5BNTA 2P5UA 2P68A 3DBVO 2PTGA 3VH3A 1P9LA 4U6QA 4GMGA 4RL6A 2G1UA 4PVDA 1QYVA 1Q0QA 4TSKA 4CUJA 5TNXA 4CM9D 1BSVA 3AY6A 3ZGYA 1DC6A 3GK3A 1ZNQO 4IMPA 4CM7A 1IOLA 3FR8A 2D8AA 5CDYA 4UREA 3RKRA 3VVBA 3NDIA 2JD2A 2FP4A 1E3WA 1RM4A 3F47A 2XPCA 4J9VA 2PGDA 4NDNE 4FQ8A 3JQ7B 3P19A 1TXGA 3PEFA 4FJ1A 4Q39A 5C7IO 1GCOA 3AI3A 3WMWA 4XQEA 1T26A 4CLDA 1N7GA 3I5MA 3D64A 1WZIA 3BYZA 1HTBA 4FD3A 4D3FA 3VTZA 2VZ9A 4BNNA 4I08A 5B4VA 4GQAA 3HJAA 2BH9A 3TRIA 3DB2A 3INTA 4MVJP 4CV3A 1PZGA 4O59O 3V1YA 4W6ZA 3GAFA 4DPMA 2IODA 1DRWA 4MOWA 1WZEA 2HK7A 2BELA 3U4DA 3DTTA 3GGGA 2GYYA 3RJ9A 3PWKA 1ISIA 3NJ8A 3RSHA 4LGVA 3D3EA 3GHHA 2G0TA 3ZI0A 1XU7A 4TZKA 3V5NA 4R01A 4XYMA 1XELA 1L7EA 5EESA 4IDEA 1DIBA 5L51A 5J23A 2X0JA 1J6UA 4XX0A 1YQGA 3CMCO 1P1IA 3GGOA 3BXXA 1EVZA 4FBGA 3DONA 4CR8A 2BKAA 3WGTA 3GR6A 2VYND 1DOHA 4GBJA 1S6YA 3I6QA 1QSGA 4CR7A 5TIIA 3K2EA 5L4NA 1HZJA 1VRWA 4TMFA 1Z6ZA 1E3JA 3QWHA 3EHEA 5CAEA 1ZFNA 1P77A 1EQUA 4WLNA 4H15A 1ZEJA 3BMOB 4CM8B 2QRJA 1HSZA 3DBRB 4XB1A 1P74A 3PDJA 4L75A 3RI3A 1WLYA 4BO4A 2CF5A 3DTYA 1UXIA 3UGKA 1E1MA 2HRBA 1SB8A 1U4OA 2Y68A 3DDNA 2YZ7A 4CM4A 4NNJA 1PWZA 3OJLA 3U49A 1S7CA 3U9LA 1RM0A 3WGQA 1DPGA 3ADPA 2EGGA 4OIMA 4XJSA 1LQUA 1HF3A 3R3SA 3ETEA 4JP3A 4BKOA 4II2A 4BV9A 4YB8A 1V3TA 4XWYA 1AXGA 1ZH8A 2B5VA 1GV1A 3KOUA 2FY8A 1VSUA 1ZKMA 1C1DB 3E9QA 1O89A 1E7MA 2HMUA 5KVQA 4D7AA 5IN5A 1FDWA 2JAPA 4M89A 5G0TA 1HYHA 3ABIA 1NWCA 4F45A 2NSDA 1DRUA 3OMLA 3Q0EA 4LN1A 3MOGA 3PHJA 3IS3A 5A5FA 3NJ4A 1T2CA 2ZCUA 4E12A 2EXXA 4J1QA 2W90A 3VPHA 1ZK0A 3DMTC 2ZIZA 1I30A 3N58A 3CZMA 3T7EA 2PV7A 3CMMA 3V1TC 1YBVA 3TL3A 1NPTO 1DIGA 3OEYA 4Y98A 4CMCA 4EJ6A 2ZYGA 3EMKA 1I0ZA 1EBUA 3D5QA 1QRRA 4RDIA 3FTNA 5T5QA 3B1KA 1B8UA 3EGOA 4XD2A 4PRKA 4HY3A 1LEHA 3HQ4O 3UUWA 4PZDA 2V6GA 4CMEC 5A4DA 5JDCA 3ZWNA 2BFAA 3PHLA 1U2GA 3DBHA 1OI7A 1PQPA 2PKRA 3BMQB 3U4HA 4AG3A 3RUAA 1KC3A 4BNFA 1KBZA 3NYWA 3OA0A 8LDHA 5HRUA 2VYVA 3GH3A 2Q45A 1GZ6A 3D5TA 4E5MA 1AXEA 4HV4A 4GWKA 1LSOA 3GVHA 3M2TA 3Q9UA 3S2GA 4FB5A 4JGBA 3DL2A 3WMXA 4LCJA 3MJSA 5A9TA 1EVYA 4ZHSA 4TROA 3ONFA 4FDAA 3JQ6A 3DZIA 5C5IA 5KWEA 1E3IA 7MDHA 1DC3A 1OAAA 2Z5LA 2CDAA 4NJMB 3SJUA 1LQTA 4MVJI 3NDJA 4M49A 4B7UA 2UUPA 3CE6A 5CEEA 5COBA 4FW8A 4GAEA 1DJQA 3L9WA 3ULKA 1DFGA 2AQHA 3GY0A 2EWMA 1D8AA 3HZZA 2DFVA 4KUGA 1RYEA 4CJXA 4EJ0A 2E4AA 5I9LA 4OJNA 1X7GA 4I9UA 4BQPA 1I33A 1QYXA 4Y6PA 4B3IA 1YQXA 3ITDA 4TVBA 1O9BA 3H8VA 3NUGA 4CLEA 2PZKA 2DPHA 5A9SA 3FWNA 1GYRA 2UDPA 1UP6A 2B83A 2DBRA 2GD1O 4BMSA 2I67A 5C3MA 2OBNA 3VH1A 2HMTA 5TS3A 3WICA 4EEXA 5G2OA 2O4UX 3PJFA 5L45A 4L9RA 4YJGB 3UXYA 3H5NA 4CM1A 2YUTA 5EQFA 3E03A 2AQ8A 2OFPA 5B1YA 5B4UA 2BD0A 3MOIA 4H7PA 4DIBA 1HWYA 1LXCA 3ROPA 4YEDA 1CIVA 4MIEA 1MC4A 1U7TA 3M2PA 3OHSX 3G3EA 1Y6JA 4U5QA 2HK8A 2HQ1A 2EHDA 1HE3A 1HRDA 1LC3A 1PL8A 4DC0A 4BVAA 1GFSA 4Q3AA 3JCZA 1LRLA 4K9DA 4NFHA 4WLUA 1ISGA 4IQ0A 3BMNA 1K0UA 3F3SA 3LVFO 4B79A 3WWZA 1E77A 2JD0A 4LK3A 2Q3EA 4LMRA 3L4SO 3NT2A 3JYPA 2DFDA 1Q1NA 1DIAA 4RPHA 4ALKA 5AOVA 1DC5A 2O23A 1NWHA 4RVSA 4RVDA 2P9GA 4URFA 1LDNA 1RWBA 2EJVA 1SMKA 5G0SA 4W4TA 5GY7A 1PJQA 2VWHA 3HSKA 3P2OA 1N7HA 1UAGA 1Y5MA 4LCEA 3VZPA 1ZMTA 1UXKA 1H93A 3GG9A 4RORA 3ENKA 1NXQA 5DBFA 4XA8A 4E30A 4RGBA 3EVNA 4B4OA 2QZ9A 5EERA 4XDZA 1XSEA 2F00A 1NP3A 3BIOA 4J7CA 2YFHA 4JXKA 1U5AA 5GMOA 1H6BA 3FNFA 4IZIA 4NBVA 2X86A 3QVWA 5JO0A 1UZNA 4RDHA 1ZVMA 3PZRA 1WAMA 3ZWMA 4OHUA 5TX7A 2FWMX 1M6WA 3AY7A 3PQEA 4AJEA 1BW9B 4J4BA 3EUWA 3HFSA 5FF9A 3B20A 5L53A 1FDTA 5H81A 4XDYA 5DULA 4YYZA 3JQ8B 3FNGA 3PHGA 5THQA 4BL5A 4BKUA 2I6TA 1GZ3A 4BGUA 1MG0A 2GERA 2J5RA 2JCYA 1WWKA 2QW8A 3NTOA 2Q1SA 4GGOA 4PLCA 3D4OA 1NX6A 2YQ5A 4W99A 4NK5A 4ZQEA 1T2AA 1UXJA 1CRWG 1OZAA 3DBRA 4PIVA 2B37A 1OC2A 4FFNA 4W9NC 3CUKA 1JAXA 1JKJA 3DZJA 4JNKA 4ZJUA 5IDQA 4BGVA 1ZCJA 4TZTA 3PJGA 4YAIA 1ONPA 4LSWA 4XYLA 1LDBA 4WK6A 1UDCA 3FCOA 1NASA 2ZTLA 3JQEA 4NBTA 1BMDA 2OMEA 3WBFA 2PFGA 5G0WA 4AJ2A 2Q4BA 1I2CA 3H9UA 4RVHA 1QP8A 2DPGA 2X8LA 3L6EA 3OIFA 4JJFA 4RF5A 1G1AA 4YCAA 1TT5A 4Z9XA 1N92A 3L0DA 2JD1A 4BMVA 4DQUA 3WFJA 4RF4A 5COQA 3T4XA 3OP4A 3AY3A 5COAA 3TSCA 2CVOA 2PZMA 2YHUA 3H2SA 2O7QA 3RUIA 4BO6A 1UDBA 4F6LA 4XQCA 3OJFA 5JY6A 2FPGA 5TC4A 2EKLA 1GR0A 4PLGA 1ZSYA 2OO5A 1M66A 2GCGA 5H83A 4MKXA 1QV7A 4FCCA 2VTDA 3RFVA 2UV8A 1DJNA 4AVYA 3O8QA 2FPPA 2HMSA 1YL5A 3IJRA 4JIGA 3ZH2A 2EJWA 2X0IA 4HP8A 3WFIA 3CZRA 1NQAO 4J16A 3IP1A 5A04A 5KTKA 3HN7A 1ENZA 3RBXA 2WYVA 4O6VA 4UVHA 4QFDA 1BG6A 1P33A 4MVJH 5JXWA 4GSKA 1I10A 4AJJA 3PWZA 2GNAA 4JP2A 3EK2A 3RC7A 3F1LA 1F8GA 2DUWA 2B36A 4P4LA 3NTQA 4AJHA 5BSGA 3AUSA 3JQ7A 4BOYA 5K6AC 4YBZA 4BO8A 3WXBA 3VZSA 2BGKA 3LLVA 4YT8A 2AA3A 3H5RA 3QWBA 1KEPA 5F1PA 4CMIB 3JD3A 3WGIA 2RIRA 3GNTA 1YBMA 1NQTA 3LLSA 1UP4A 1SEPA 2NU6A 4XRGA 2O3UA 5HM8A 3GT0A 5TRTA 3F4BA 2GZ3A 3VZQA 4I1IA 3INRA 2W2LD 1NHGA 5I7FA 3BTSA 4EZBA 3E5RA 2CVZA 3JQBC 1DEHA 4XEHA 1HDCA 3WX0A 2NTJA 4YWJA 4JBGA 3E6AA 3GUCA 3AJRA 2Y1EA 1LJ8A 1TVEA 1U28A 4RVUA 3GZ4A 1NAIA 1YONA 4HFMA 4YQYA 4KQWA 5ENVA 3PWSA 4F3YA 3AI1A 4YR9A 2FSSA 4NFSA 4K6CA 3KHUA 1NVTA 4MDHA 3GDOA 1C1DA 2VN8A 1B8VA 3WDSA 1A72A 3ORFA 2BI7A 3OQBA 4MKZA 1NQOA 1KEUA 2I65A 3D3WA 3E48A 3VDQA 1CERA 1SCUA 3EYWA 3TZ6A 1YL7A 3JQ8A 4XRRA 4E31A 3DBLB 5CEJA 4CLRA 4GX0A 2AE1A 4D44A 1X0XA 2ZQZA 1A7KA 3KXDA 5A3VA 5JDIA 5TJHA 4EYEA 4XR9A 3JYLA 1EVIA 1KOLA 3EZLA 2C54A 5THKA 3IP3A 5JS6A 3UH1A 3JYQA 2R6JA 1GL3A 4FN4A 4HKTA 4KWIA 4Y6RA 1KVUA 3GHYA 2X23A 5IXYA 5ES3A 1X7DA 4FPXA 1PGJA 1E5QA 3MJEA 2PZLA 2WE8A 2WTBA 1GDHA 3G49A 4HFJA 3ZCXA 1U9JA 3FD8A 5JAMA 1Z45A 1B0AA 1KEVA 3RQSA 1W0CA 1F06A 4L0QA 3TDKA 4DWVA 5L3ZA 1HYGA 1TI7A 3A1NA 2GPTA 2QIOA 1A4IA 4Z0PA 1CYDA 1EDOA 1JU9A 4N5MA 1PIWA 1J0XO 2Y0EA 2PLAA 2JHGA 4BO3A 1NHWA 3F46A 1HDXA 1ZXLA 3IKVA 1C0IA 3GPIA 3C7AA 4R51A 1ZJZA 1H5QA 1XEAA 1VJ1A 4JK3A 1E6EA 3AU8A 4IGEA 1P1HA 3QLJA 1LLUA 3F1KA 3MWDB 3HDJA 1TEHA 1KVTA 1NPDA 2VQ3A 4EGFA 4LRSB 4Y6SA 1J49A 3QQPA 3OH8A 1Y1PA 1QXSA 4E33A 2YV2A 2ILTA 1ZZEA 2JL1A 1T4BA 2HDHA 2RH8A 3CIFA 1VJTA 2FR8A 4NHEA 3RJ5A 1EDZA 4JLWA 4XJTA 2A9FA 2BRUA 2DC1A 3GC6A 4IXTA 1BHSA 3GFGA 3W8FA 1LU9A 3ZDFA 1I01A 1LSUA 1P31A 3ROQA 2VOJA 1DLJA 1IE3A 1MV8A 4A26A 2WD7A 3PQDA 2YW9A 2X22A 1PGOA 2DTDA 4R69A 4HFRA 1B14A 3H4VA 4YAKA 4C7KA 1F17A 1LX6A 2AW5A 2E82A 3FF4A 4A2CA 3A06A 1LRJA 5F1OA 3I4CA 1YKFA 1LC0A 3WGHA 2GDZA 5FYDA 2OP0A 1BWSA 1PEDA 1WVGA 4BO0A 4E2ZA 1E7WA 1B3BA 5FI3A 4UEJA 2P9CA 3GAZA 5H82A 5B12A 4I8XA 2NLOA 3D3WB 3NRCA 4DBVO 3L07A 1U5CA 3RUHA 1Y9AA 4B3JA 2Q2QA 2Y67A 4DC1A 4TRJA 4ZVVA 4BMNA 4K6FA 3O38A 2WYUA 1NFFA 2C2YA 1PJ2A 2I5PO 3BAZA 3ZV6A 2VUTA 3QW2A 1P1KA 1ZEMA 2J6IA 3KUXA 2QQ5A 4DQVA 3GOHA 4TKMA 4BO5A 1EUZA 4W7IA 3PRJA 2H9IA 3ZU5A 2C7GA 1WXDA 3PGXA 3OICA 2GZ2A 2Q4EA 2GN6A 1JWBB 4QUKA 4GMFA 2NUAA 3FPCA 4I5DA 5JMWA 2VYVD 5JC8A 3PVZA 1QKIA 3IUPA 3UCEA 1I3NA 4YJFA 5EL0A 4MO2A 1H2BA 2Z1MA 2O48X 1HLDA 1PJ4A 3ZW8A 1P1JA 1H6DA 1PJBA 2FZWA 2J3JA 3IC5A 3JQAB 2HK9A 1MB4A 1PZEA 4BNIA 3LU1A 4MIOA 1PTJA 4LSMA 3C7CB 3EDMA 3PPIA 4Z0HO 2HCTA 1DRVA 3GNQA 2XXJA 4HBGA 4I5EA 2PR2A 2WD7B 1T1RA 1Q7CA 2GR9A 3VVCA 2GO1A 3WLFA 4ALNA 2VNAA 3VKVA 5LC1A 1PJSA 2GF2A 5JAIA 2VUSA 1E92A 1M76A 3GLQA 3UHAA 5GZ1A 5L4SA 4H3VA 4AJIA 1EBFA 5IN4A 3INGA 4EUHA 4I9NA 4CUKA 2VTEA 1JTVA 4G5HA 1X14A 4ILKA 5CP8A 4I5FA 2ZJ1A 3JQFC 2LDXA 5BT9A 1GZ4A 3BMCA 3B70A 4RPLA 1XDWA 3GG2A 3WIDA 1UXHA 3WQQA 1ZJYA 3GVXA 3M1LA 4Z3KA 1YL6A 4ROSA 4J2OA 4CV0A 2XOXA 3JD1A 3E5MA 4WCFB 3HDYA 3ZWOA 1U2DA 1YB4A 4II3A 2NU7A 1LNQA 4GGPA 4BO7A 1DC4A 1QYWA 4MVJE 1UH5A 1K5HA 3Q9NA 3I52A 5A9RA 2Q2WA 1DHRA 3W6UA 3AK4A 1X7HA 1LA2A 4L76A 2IXBA 3RUEA 4BNHA 3HE3A 5BNFA 3Q2KA 2J3KA 1YB5A 3ANNA 4E6PA 3ZHBA 3GUYA 3O9ZA 1V8BA 4KQXA 2VRCD 1LI4A 4OXNA 4GLOA 3D1LA 3DAPA 5TGDA 5G0UA 2DUUA 4U0JA 2ZKLA 1I8TA 1T2DA 1X0VA 1C0KA 1EE9A 1ZXBA 3ROKA 3A9WA 3GN2A 3UICA 2X6TA 4IDBA 4OSOA 4KP7A 2C5EA 2CUKA 3AWDA 3ENNA 1M75A 3K5PA 1P0CA 5C37A 4I9HA 3HG7A 4WECA 1JVSA 5TT1A 3NX4A 3WNQA 1K3TA 4FFOA 4F6CA 4IIUA 1HDZA 3LZ6A 4YAJA 2VCYA 4RPGA 5CFZA 1I36A 3LF2A 3ZU2A 4QEDA 1NR1A 4UVEA 4TRRA 3JD4A 2EW2A 1KERA 1B7GO 2A35A 5ILOA 1ENYA 2GUGA 4XZ3A 3ONDA 4E5PA 1LLDA 5TJ9A 3LT0A 2O3TA 4J43A 4KMSA 3DOOA 1NTOA 1ZK1A 3WG9A 5LDGA 3FHLA 4UVGA 2XXBA 3O26A 3VPGA 3V2HA 1SO8A 3B6ZA 3C24A 4YA6A 3TOZA 3FSRA 4LMPA 4ND1A 1M2WA 2FN7A 4JJGA 3GVCA 3W4JA 2Y1GA 3WOHA 1N9GB 1E1KA 2O3RA 1GEEA 3JYNA 4NU6A 3PLNA 2ET6A 4KOAA 1I2BA 4RLSA 3U5TA 2DQ4A 3BMNB 4XIJA 2FZEA 3RC9A 3ICPA 1EQ2A 4D79A 2Z1NA 4ZQHA 2UYYA 2P9EA 4A73A 1G6KA 1Z7EA 4WNCA 1A7AA 3GRKA 4X54A 1Q0LA 1GY8A 1K6JA 4L4XA 4CMIA 4YAEA 4JCOA 2OL4A 4AJ1A 2J8ZA 3PXXA 5DN9A 2JJYA 1MXHA 1NPYA 3ZN2A 4GVXA 1YJQA 3KBOA 4DGSA 3GGPA 3SLGA 3N7UA 4J7XA 1MC5A 1EVJA 2V7PA 2NACA 3KRTA 4D3DA 1J5PA 4J6FA 1WDLA 3DAGA 4IS3A 1BDMA 1GTMA 4IQ8A 1VL8A 3GQVA 4PG8A 1E1NA 1Y8QA 5JYDA 2YFQA 2DT5A 2I76A 3TJRA 3DHYA 3QA9A 5DBIA 4NBWA 2QYSA 3NTRA 1NVGA 4L4SA 4ND3A 5I8ZA 3U62A 4FJ0A 4K28A 1IHXA 2QYTA 1SBYA 4IZHA 3D4PA 4C7JA 1GYQA 3PJDA 4OO3A 3E8XA 2WSBA 4JX8A 4YPOA 5U9CA 4PCVA 4J1SA 4RVGA 4PRLA 2HU2A 3ON5A 3QWIA 4FJ2A 4BO9A 1LDMA 1KIFA 4IQGA 3KEOA 4WLEA 5KKAA 3E9MA 4NFYA 1BXZA 3EC7A 2CDCA 2RHCA 3HHPA 3IOYA 3ZWWA 1VKOA 2FPIA 1KC1A 1G0NA 2V6MA 4FR5A 4RQUA 3QV1A 3W4IA 5JNLA 1R0KA 1TT7A 2Y0CA 4JQCA 4QX6A 3K8ZA 3GVPA 4HADA 5KJFA 9LDBA 4L74A 3ANMA 4FOOA 1DDOA 2EKPA 4EW6A 2O2SA 1RM5A 4PFJA 2YHIB 5ENDA 1LDYA 2B4RO 1NVMB 3DZFA 4C4OA 1V0JA 2YY7A 1JA9A 1DFIA 3AW9A 2DKNA 1UZMA 2J5KA 4D0SA 4U7WA 1ISFA 1R4MB 4D3SA 3BMQA 5ITWA 1HLPA 4BUCA 4UVDA 5KJ6A 3FNEA 3NT5A 4ZICA 2NVWA 1JN0A 4OH1A 3D0OA 1MFPA 2B69A 3GA0A 4B4UA 4RCVA 2DU8A 4W82A 1EMDA 3I9JA 5C7LO 5BSHA 4NI5A 3M1AA 3TZHA 1FJHA 1ML3A 4PZEA 2RAFA 5ER9A 4YT2A 3T4EA 3NT4A 1IHYA 3EVTA 3U4CA 2EIHA 3TF5A 2CDBA 5A02A 1B15A 4RQTA 2Y93A 5EPOA 3Q6IA 2EW8A 4L8VA 4XB2A 4CMBA 3C3XA 5ILGA 1XQ6A 1QG6A 1YWGO 3VZRA 2FMUA 3JTMA 5DCWA 4GLLA 3R6DA 5HWSA 5I9NA 3A28A 4ND5A 1HZZA 2I99A 4IPTA 3JSAA 4BKQA 5ER6A 2O3QA 1DHTA 4CUZA 5CG1A 3LT1A 1C3VA 1NFQA 5AXBA 1R4NB 3CXRA 4FS3A 5L7TA 1WDMA 1VI2A 4HWKA 3L77A 4PVCA 1GAEO 4CV2A 1ULSA 4QECA 3JQGB 1WPQA 1BTOA 3N74A 1KY4A 3NKLA 2I3GA 4YJHB 2C5AA 2PKQP 1PGQA 4ZQGA 2YV3A 5JSFA 2GASA 4P38A 2DBQA 1SAYA 3LC1O 4OAQA 4E13A 2I3AA 2EG9A 3VAZA 4FFLA 4R68A 3H9QA 3PYMA 5A03A 3MJTA 3OIGA 4CPDA 1GU7A 3PHIA 3KYDA 1VSVA 1CQIA 2WE7A 2D3TA 1GQQA 3RBVA 3HB5X 4WLVA 4K1LA 4IDAA 3SBOA 2C29D 4CMEA 1PZFA 3DOCA 3SXPA 4G81A 4NBRA 4WLFA 2X58A 1C1XA 1QYCA 1IPFA 3TN7A 2D2IA 1HL3A 3OM9A 5EQDA 4O5OA 4YXFA 4AJPA 2ZYDA 2C0CA 1GUZA 2NADA 3CSDA 4ZA2A 2XF8A 4IJKA 1U3VA 3H3FA 5G4KB 1PL6A
chains in the Genus database with same CATH superfamily
1GZ7A 2ASEA 1LBHA 2CCKA 4TQGA 2QVLA 4YAFA 3N70A 3NPAA 4XCXA 5I5EA 3FGZA 4K9KA 5D6OA 3ED1A 4TQ9A 4RIGA 4ER6A 3IEXA 3OIYA 3TL2A 1RXSA 4PONA 5K6RA 1RKXA 1XEXB 5KOYA 3T3OA 1U9IA 4N0EA 1YS1X 3P9QA 5J5VA 1BVRA 1NXXA 4P4TA 5KSWB 1VIDA 3H7IA 4KMOA 3U3MA 1DEAA 5JQGA 2IF0A 1AKVA 2WJJA 3JQGA 5FTJA 5IAOA 2D4HA 4O8CA 5K0GA 3NB0A 4R16A 4W5JA 4BV8A 3SJ7A 1K2VN 4DNPA 4C5AA 4B76A 1FSSA 1VBFA 1Z16A 2X3YA 3WLEA 5DM4A 4BNDB 3SE0A 3JQCA 1OU4A 1VL5A 3C5EA 5CEFA 1T91A 3ZVNA 2GHTA 1Q21A 1QTIA 3EFEA 2VAPA 3E15A 3DLHA 2XT9A 3K2BA 1X92A 1XCPA 2IEAA 1T0PA 3UANA 1ORHA 3O1IC 3KSZO 3P97A 4L9AA 4K7JA 5KCMA 4W63A 1JAYA 1KNQA 3P5SA 5BSTA 2IKQA 2PS0A 3V4ZA 3I32A 1VLMA 4GOKA 4ILEA 3MW8A 1TM1E 2DHCA 4WCVA 4F8JA 4HO1X 3AUXA 4UTVA 3MS2A 1UKBA 4Q9AA 4F3NA 2PD4A 3TZCA 5JXHA 1YU9A 3MTAA 2JKVA 1YJXA 1DCFA 2E5FA 2RFLA 2X6RA 3IAHA 3NHKA 4S1PA 3JARA 3P0HA 1YKSA 1YV9A 3P1JA 4J49A 5CBPB 3ER8A 2Y1OA 2IEGA 3LDUA 2VJMB 2ERXA 1YOVA 1UANA 3O82A 4Z4FA 1C7FA 4BZWA 4BZQA 3DP9A 1XQXA 3HL0A 3GYBA 3WGNA 4CDMA 1N5LA 1JEEA 3KFVA 5FJIA 3IPAA 3U56A 5KDDA 4L72A 3AVXA 3AYZB 5JNRA 3CIOA 5FCDA 4DNQA 3EH2A 3V2IA 4X6UA 3EBPA 1U65A 1NUHA 5J2TA 3E1KA 3IHLA 1KYXA 1N2SA 1OLUA 1JQEA 4LXHA 4DSZA 4QYWA 1H2HA 2WM3A 5LMNB 1TYCA 4JI4B 3LFUA 1GUFA 3TB4A 5HZKA 4BP9A 2CXNA 3QELB 3SU8A 1OR8A 2INGX 4L85A 1DEKA 1G4UR 2AR9A 3LUCA 3T3PB 2V5AA 4BNYA 2FPLA 3IR7A 5EJAA 3W1WA 1LWOA 1WXIA 2O0MA 1NOKA 4M54A 4K03A 1AKQA 4Q4JA 3WV5A 4OP1A 1FRNA 4R9RA 3UJ8A 5BUQA 1ZN2A 1P0MA 2NZYA 4RVNA 2GQ0A 3MB5A 1K88A 4ZPJA 5EIXA 6CHYA 1YK1A 4Y2JA 2WVHA 2HIHA 2OAGA 2YR0A 2W6IA 3CUWA 5I9MA 3IUJA 2F55A 1FTSA 4RD3A 3UW3A 3ZV5A 1HQYE 4KJZA 4M22A 1KARA 4FINA 2D4AA 5BYBA 4KIUA 5BQFA 3EXHC 3WS7A 1WVMA 4HDKB 3IT1A 4MW5A 2XLBA 3NLLA 1HYBA 1TM4E 3GMSA 4TYPA 5EHIA 2P75A 2ERYA 5JWHA 3F4LA 1V1RA 3QEKA 5DGCA 1SVLA 2ZWAA 1PSDA 2RH9B 2ZJ0A 1T4DA 2P35A 3K30A 3DFZA 3K9LA 3NNDA 4QPZA 4X93A 4ALMA 5B3LA 2PRIA 2J7KA 5CPFA 5HUQA 2BR5A 5CB4F 3Q10A 5HKKD 3U13A 3A4MA 1Z5OA 1FDVA 3HXTA 3BEOA 1KDRA 3LZCA 3Q3CA 1Z4IA 1C3LA 4FWIB 4G24A 4M9RA 3ZJUA 3UAYA 1I0LA 2P3QA 5EIEA 2HRZA 5HFAA 3L8HA 3I8SA 5LNK6 2ZAOA 4U0KA 1IIBA 4RJIA 1PNRA 3I6MA 4KB5A 3HUDA 2IELA 4PPQA 4LZOA 3NM5A 2FH5B 4D74A 2J1LA 4IDDA 4PYNA 2PYZA 1Z0ZA 1HT0A 3QUCA 4OUDB 1RLMA 5EMMA 2YS6A 3V4SA 1SD1A 4BNMA 4CCAA 4JI0B 2XEDA 3IDSA 4A5OA 1IEXA 4YPFA 2YV1A 3KLPX 4BLTA 5ELXA 3S3TA 4Z4GA 3CKKA 1T4CA 5CM2Z 5F76A 1KAHA 1O87A 2PN1A 3AM3A 1M6VA 1FXWA 2TECE 2YUIA 3E05A 3KB8A 1EDEA 4KPGA 4XSHA 1SWVA 3SICE 4EY5A 1GZSA 4DMKA 4CLOB 2LKCA 1A96A 2G7MC 4OHYA 1JBEA 4DCPA 5LDHA 1QP7A 2VJAA 4J0GA 2WIGA 4UM9D 3RTAA 1WS6A 1F7VA 5F5LA 4FYWA 2WUVA 3ZHOA 2C0QA 2MMGA 4DMFA 3LCRA 3QJ5A 2YMLA 1IY0A 5U4QA 2JVKA 3TVDA 2G28A 2ZWOA 4J0EA 3LVRE 4M2LA 3BQMB 4N7RA 4GI5A 2NT4A 1FTWA 1ZBQA 1FP2A 2ZUUA 4JQZA 3LWDA 4KR9A 3AEQB 4M87A 3VBCA 4G63A 1EHCA 1A4XA 4NV3A 5DNAA 2XUFA 1SB9A 3GWZA 5DWQA 3RPEA 2RBGA 5HEKA 5JY1A 2QLMA 1UBMS 3DQPA 2YJ4A 4K81B 4P4SB 1EYZA 4WOJA 3A3NA 1QBGA 2ZKIA 3CKMA 1EIWA 3RAJA 2O0HA 1DKPA 1SOVA 1P45A 4ZV9A 2IBSA 3T52A 2ST1A 4DLZA 3OC6A 3DSRA 4IV0A 2P0YA 4FVTA 1PT8A 3IVXA 5JH7B 1IZ9A 2JFPA 4UUNA 5GJWC 2GYUA 1XXHB 4F2PA 5JRDS 4C7VA 3PGLA 4K86A 4L6CA 3IL2A 1PF7E 2VPIA 1TVKB 4TL7A 4IH4A 4LZZA 1J2EA 1NX9A 1VGQA 3FWPA 1EXDA 3FSJX 4KU4A 5TE9A 1R6AA 1XN1A 1Y8AA 4IMRA 1L4UA 3B7PA 2B99A 4LHVA 4U6SA 1CFJA 2HMVA 4XUEA 5K0ZA 2NUAB 1V6AA 2DUJA 3VPAA 4DREA 3WLJA 4F5ZA 1JAIA 1KO5A 2HKIA 1ZQ1A 3A3PA 3K9GA 3KTAA 5F1KA 5G02A 1GPJA 1ZIYA 1QIGA 2CFCA 2LGJA 3DEAA 2QAJA 1IY1A 1WHTB 3D7NA 4M37A 4MVWA 4TN1A 1LPBB 4DJAA 3QRWA 3SQWA 5JYBA 1GOTA 3IOCA 1NRWA 1C9DB 1CFZA 1XALA 1KEKA 2V97A 2GYWA 5JNWA 1J99A 4JXZA 3CWQA 3RVDA 1EFKA 3DPIA 4RIFA 3RHFA 2FRVA 1P2BA 4A1FA 3E7WA 2DR3A 2I4LA 4MIYA 2ID4A 1L5QA 3H42B 5DTJA 1XIVA 1ZK3A 2HA4A 3R9KA 4A0FA 3L18A 1RYFA 4GHWA 5EYPA 5KNCD 1PQYA 2WJWA 3IP6A 5KTPA 3UJDA 2GLXA 1GKIA 2HGZA 1DG3A 2V7VA 1PHPA 1E5TA 1R37A 1O6ZA 1DARA 4L50A 1J0AA 3OE7D 3G8BA 1BEZA 3MAAC 2AB0A 2H17A 4NCNA 3ZQUA 3AKYA 1ENOA 3G23A 1KU6A 3HKBA 3T95A 5E3JA 1J0EA 1SHLA 1WDTA 4DTIA 5EUBA 3HDHA 3R40A 2XGSA 1NBOA 2QUHA 3I1FA 2DBVO 2G82A 1TFUA 2R6GA 3ORQA 4FP9A 4MQEB 4MPPA 3OZVA 4OXXA 4W5WA 3DAHA 1NRXA 5AVOA 4NG4A 1DC8A 1TJ5A 4CLOA 3ADCA 1IK6A 1K3UB 1D1TA 1L4FA 2FRDA 4LC1A 4D45A 5BV7A 5M5BA 3GEMA 1LVGA 1V5GA 1OH5A 1AZSC 3FTEA 1GGNA 5MGBA 1ZW6A 2DX7A 3H9BA 4D42A 4OSEA 1Y0BA 2GHIA 2IW1A 4KPUA 2J7PD 3CH7A 3WQSB 2QD3A 3FB4A 3OEHD 1MH9A 2C1EA 1HFKA 3B60A 1W6UA 2AXEA 2H0RA 2VNKA 1RLUA 2R47A 4HDOB 3KZVA 3O84A 1RQPA 4K8RB 3NHSA 4TV8A 1WMFA 2WT4A 4BAUA 1RI1A 4COOA 1J90A 2IYEA 1G8YA 3PFCA 4HWSA 4IIEA 4PXYA 1CUVA 2HU5A 1V6CA 2IIQA 3L8MA 4XGKA 2FR1A 1CE8A 3DZ8A 1R66A 3LC2O 1FQJA 4N6OA 4TYMA 2PH5A 3FPBA 1M8FA 3SXJA 3OZDA 5GQSA 4EBFA 4EG3A 4L5CA 2H4ZA 2D0DA 3RT7A 3DKVA 5K6AA 1CF4A 3F98A 4BQEA 1IZ0A 2I9KA 2QBYB 1RTTA 3DD1A 2BGTA 1XVAA 2OORA 3A14A 2LUOA 1NW5A 1Z0JA 3F97A 3IBFA 2ATXA 1UOQA 2GETA 5CLIA 3UK2A 3T3EA 3R3HA 4B3HA 1K89A 3RU7A 1KR5A 3FUVA 5BMVB 4MJLA 3F8WA 5AT1A 4RZ3A 2EKZA 2WYHA 1SUSA 1SVIA 4CKWB 5A3QA 4M46A 2OBMA 3DLBA 1GPKA 5JCXA 1JEYA 1NUUA 2P6MA 2EFCB 3H1TA 3TTSA 4MYHA 5KSZA 1Y81A 1RLIA 3B7WA 2E5WA 3B9PA 1YR9A 4OK5A 4FKBA 3CPHA 1OHHD 2E0IA 2OR3A 4MUKA 4H17A 5FBKA 4QJIA 4B9AA 4J8PA 1JR6A 3WNZA 2F1KA 4YACA 2B4KA 3FI0A 5HTOA 3AGPA 1YJAA 3AH8A 3KXPA 3QLVA 3F5SA 1OJLA 4Q6WA 1G41A 1L1FA 3ZJ4A 2QQFA 1JHVA 3LM8A 1XRJA 3NHYA 5UKDA 1RIFA 5DX1A 4F3TA 2HOQA 2ZJZA 3JY6A 5HIAA 4RELA 3X2EA 4WQMA 3A04A 5A9SB 5FFFA 5L9AA 4N0PA 4JX9A 5CJJA 1ZNWA 2ZYTX 2VHYA 3L8CA 1JDTA 1L6IA 1YOBA 4NE2A 3RS2A 3KCNA 1ZOIA 1QGUA 1U7HA 1Z82A 3S2UA 5DLDA 4KX5A 5IPFA 2FZGA 2GHQA 3UCXA 4BCBA 4GDFA 4IOKA 2ZVDA 3IMCA 1GHTA 3T5BA 2HLHA 3P27A 2A3NA 4QXPA 4BIIA 2VDWA 3TBFA 3UK0A 3CEAA 1J06A 3T6KA 1SPXA 4CF4A 4PLHA 4MUYA 2HCRA 2WT8A 1IUKA 5CDGA 5ITZB 4U3JA 5EIBD 2H2AA 3TAUA 4JI2B 1QQTA 1DBRA 3O4RA 3BF8A 3UENA 3BMCB 1E7QA 2MHCA 3VYVA 5BWOA 4EI7A 5HF8A 2C4WA 2I54A 4B46A 4C01A 4CG0A 1HE8B 3WADA 4CBVA 1JIXA 5CU7A 5JVDF 4UAVA 2V8BA 1E89A 2WWTA 2YRXA 1KE2A 1ZO8A 2NGRA 2WUDA 4F93B 2XW6A 4FHGA 5CNMA 3WP0A 3ZHTA 2E2WA 3SC3A 4A82A 3BZUA 2JEZA 4F8EA 1W36D 2QM8A 4YRSA 4YRJA 5HF6A 2QSZA 3JVIA 3M70A 1EINA 3DWFA 4TMKA 3KX2A 4R8KA 4M55A 4M1QA 4UKDA 2D7DA 1U7ZA 4Z0TA 4EZIA 1Z4PX 3EF3A 1JDJA 1RAGA 1SXHA 4KL8S 1CNMA 1Z15A 2AOWA 4P5EA 3CG0A 2X9GA 4RVFA 2GD0A 2EX4A 1QH0A 3VJRA 1MLDA 2FG7C 1GSAA 1L7BA 1MAUA 1SZDA 2JIZD 1UWLA 1FP4B 2N9UA 5KWSA 3DEJA 3C48A 4MV3A 1E6MA 5JMPA 5MGNA 1M74A 1DI0A 1TGVA 2C4TA 3OX1A 4PFKA 1YR3A 5IZCC 1W93A 1P5HA 4KC0A 4OU5A 5ADVA 2IEBA 4NECA 1WB9A 4L9SA 2AEFA 1JL3A 2WIBA 5AK5A 2W7TA 4LOLA 1DFHA 5FUMA 4EGAA 1ECLA 3PHHA 3VC7A 5I8WA 1L7PA 4JBWA 1T3GA 3S5UA 3OLXA 5E4JA 1EP9A 2C84A 1ZM7A 1NT2A 2F67A 5A5DA 2N42A 1ISJA 1SD2A 2YMMA 2APJA 3FZGA 3MTGA 2SKDA 5KTSA 1Y4DE 3W8DA 4LJ4A 4BNJA 4WAUA 1RYDA 1VMEA 2UVPA 3B2NA 2GCNA 5EGNA 5DW3A 1GUAA 2VT2A 2H4HA 1CCWA 1OWOA 1HY3A 3IMFA 1CQJB 1NBMD 2C8LA 4Y8VA 1P4JA 1IPHA 1CRLA 2B1GA 5GV8A 2VDWB 1MPXA 3C85A 3D02A 3FPSA 4CQMD 4ZJZA 1ZM2A 4GG1A 1W75A 1JSRA 3CJQA 1X7WA 3UUFA 3M6MD 1IJKA 3WL6A 5B3JC 5BOSB 5KBYA 2DAPA 4B73A 5A4JA 4R98A 1Z6YA 2VH2A 3K9NA 3UATA 4ZCLA 2H63A 1BRTA 2R6R1 1SKYB 4Z99A 4Z2AA 5EC8A 1UBJS 3LDFA 2XVAA 1HH4A 1H9BA 3N86A 3TJMA 3SLKA 4GXTA 1ZUNA 3PQ7A 4PPGA 4F21A 1JPNA 3OJEA 4WN9A 4YMWA 1NVEA 4EY4A 5IRCD 2V9CA 1YIOA 4DXDA 5KOHB 5FA5A 5A7GA 2H85A 2JBAA 3RIEA 1R16A 3E82A 1IBCA 3DH0A 3U16A 4BVLA 1FE8A 4DPLA 1QLHA 3WGZA 3KR1A 5LCXA 3BHJA 5BYAA 2P2LA 4UHCA 3AEZA 5EWMB 5E4YA 1UPCA 3TAXA 1K06A 1AB6A 1TF2A 3JS5A 2R751 3B53X 4FYYA 2D2EA 5E95A 4C0JA 4ED9A 4CQMA 1Q1ZA 4MYCA 4IWYA 4XGNA 2GM9A 1HZZC 1ZL2A 3HXLA 1XI2A 2BBTA 3U4GA 3CW8X 1X1BA 4IDQA 3VC2A 4B43A 2ZRGA 4MR7A 1PG2A 3D7RA 4KDEA 5EKDA 5HA5A 2D3WA 5J58A 1K3FA 2ATCA 2QAGB 2DLDA 3HNPA 1T4CB 4KSCA 4MVCA 4WDQA 3Q98A 5FTNA 3SBXA 2O2GA 1SM4A 2DTXA 3ITKA 4G65A 3CPSA 2IZ5A 4X71A 4C9BA 4DYVA 3ZX5A 1VHQA 2H11A 4TS4A 4A15A 3DP7A 3WK6A 3KZ1E 1UT5A 2XKJE 3COJA 1LPNA 4JBYA 4HXGA 5C7YA 2BSXA 2JFZA 2C9OA 1Z34A 3PITA 1USGA 4OBWA 1QCDA 4INAA 1K68A 3L7LA 4M3NA 1QO7A 5JT1A 3NO4A 4PZCA 5KQRA 3NGLA 5JAUA 1XHLA 2YC4C 1DEXA 5E7JA 5FD8A 1IQUA 4MLPA 4MPDA 1PJCA 1B93A 1XWFA 2JK0A 4BMDA 1TAUA 2AF3C 1TQDA 3ROFA 1JNYA 4INOA 4YRNA 5IJZA 3RYTC 4AM8A 2AX4A 1NKVA 2Q9CA 1B6SA 1K2WA 3LS2A 4L73A 3MRSA 3QVOA 1U80A 3THSA 5SV2A 3NH6A 1XJ5A 2ZS7A 3WLPA 4EVRA 1KSJA 3NUZA 3UFXA 1UC9A 1ZL0A 1DUSA 3AOEA 4M99A 5CVUA 3S99A 4O0LA 3SP1A 4B8WA 3U44B 4NYIQ 3CLSC 2VDNB 3FCXA 3JRNA 5AOAA 4IAOA 4FGWA 1LLQA 4DA6A 4HQFA 1OA0A 3GDGA 4WE3A 4NIMA 1HLGA 3V00A 1PQWA 4ZO6A 3REOA 2QG6A 3N0XA 4Q3EA 2BI4A 3WB2A 3I45A 3RT1A 3ZU6A 4BGDA 5ITZA 1L5HB 4MPTA 1GQRA 3WO0A 5CB4B 1X19A 3OA2A 4M1TA 1NYTA 1MAHA 5CUQA 2OV4A 2RK6A 4D02A 3PEEA 4TLEA 4A92A 4UXIA 3RFXA 1PE0A 1DAHA 1W5SA 1X3LA 3ZIUA 3W79A 4V0ME 1V41E 2VOEA 3ADOA 1T6NA 4Q3CA 3SS8A 5EXDA 3QHAA 3CH6A 3DOJA 4QTXA 1OWMA 2QNBA 1PO7A 1S2GA 2P6OA 1GGEA 2OV8A 5EMHA 3TOXA 3TZQA 3H6KA 1B3RA 2I6GA 1E1CB 4MRAA 1TVMA 4L3OA 2R5FA 5ALWA 4IWXA 1MHPA 5CDFA 5LLSA 4RNCA 2R84A 4IBOA 4RZSA 4IIBA 4DQXA 4KO2S 2B7CA 3KZKA 1OB5A 2Y9PB 1DX4A 4R8SA 2C82A 3P2YA 4EG6A 1SU8A 4TX1A 3UKDA 1FNNA 1WW3A 3A6DA 4L8GA 5DI3A 5DX0A 4W5NA 1Y34E 1AGNA 2B94A 1V4BA 3ZE7A 2Z2JA 2R00A 2QX6A 3RS5A 4Q6BA 4PYIA 3DXFA 4MGHA 5A6VA 3TLJA 3G79A 4O4LA 1X80B 2C3MA 5K9ZA 4OHFA 4KPFC 3DA8A 5DGIA 2O0JA 2C42A 2ZUBA 1KAOA 5ALOA 1WTCA 2QLTA 4CL3A 1RAIA 1WW8A 5TPZD 2VXBA 3DHEA 2PT9A 1KZ4A 3RS0A 5AKEA 5JZBA 6ABPA 4YHBA 2GUWA 3LFTA 4GDMA 4YTEA 3PXAA 3R23A 4E94A 4LRYA 2H54A 2XUDA 3OSZA 3AHEA 3PUIA 3IBTA 4JUFA 4QXRA 3WSTA 5B4TA 3HI4A 1QYIA 4YCDA 2GM3A 4Y1GA 5A0FA 4MKIA 2XNKA 1JFSA 5CFRA 5FLKA 4FGKA 1IFXA 1FP7A 4XUDA 3HDVA 4MW7A 4LDNA 1SR8A 2FPPB 2GXSA 3BHIA 3IYLW 3LI2A 3RVBA 2VWQA 2A6PA 1ANKA 1Z5UA 3P32A 4AZ3A 3O2JA 2BR3A 3HBFA 3KSUA 5BQPA 5DN6D 4G09A 1M34E 2JFVA 5JQGB 5CA0F 1SWWA 3KZCA 1A82A 2QD2A 4BB9A 5AI0A 5JDIC 1TZ2A 2D8MA 3GRRA 3NHUA 2BGRA 1TVCA 1ZU5A 1T4MA 2ECQA 2O2DA 5KDLA 3EZNA 1TYBE 4Q1EA 3OZXA 3H5AA 4C4YA 4OYLA 3ZJTA 1HMYA 3FNQA 3LPMA 3T9EA 3O8LA 4LBYA 3ZE1B 2YYYA 3IA2A 3ZZNA 4OUDA 4DCSA 2C9BA 5F4ZA 4RZQA 4D0NA 2WHQA 3KKKA 1J8MF 2XYVA 2PXAA 3KT8A 4MGEA 1GTSA 3MCVA 3W5JA 1Q2XA 3I9NA 4D46A 3COSA 3V4PB 5G4KA 1LV8A 3ISJA 3ZHZA 2XTAA 4X63A 1SA0A 1U0RA 2C7QA 4BVJA 2FFHA 4X7MA 4NV1A 2NVUB 5BY2A 1P8JA 3EZ6A 3H75A 4LQDA 5NULA 4J0CA 5KYTA 3NHBA 4M0DA 3C1AA 3HVHA 2IXAA 4DEVA 3BRQA 1M6YA 5JCZA 2YKGA 1Z4OA 4KN6A 4ENUA 4MVJM 3AF1A 2PLFA 2GBCA 2I34A 2J4FA 3TSYA 3AFOA 621PA 1YFKA 3GUVA 3W3AH 2VRBA 4YMLA 4ARZB 4QM7A 2AYZA 1J8QA 5ELMA 2VHWA 1LSJA 1N2EA 1FTGA 2OCAA 4CMKA 1IBRA 1IQPA 1DKMA 5HS6A 3KLOA 3JQRA 4BMXA 5IYZA 2GRAA 5MF6A 3I34X 4BDTA 4BE9A 1NN5A 4JBNA 2OHOA 4BGEA 1J7KA 1K7FB 2A0UA 4GF5A 4BMYA 2V9PA 4CM4B 4WZAB 5AM3A 1SBNE 1T6BY 3TW4A 1ID8A 2OYRA 3KTAB 3R5FA 1RABA 3EVAA 4YDRA 1Y3BE 1FYXA 2AOTA 1GPDG 2DB3A 1QYRA 4GOJA 4BQRA 4A0QA 1NW6A 3A27A 1P75A 1B2RA 3S55A 3QE2A 1IN8A 3FWHA 4YK7A 3U31A 1SBHA 4UULA 1CUBA 2R1VB 2TMDA 4A5SA 5C4GB 4DLKA 1IEQA 2BW0A 3BILA 4WKOA 3WK4A 1II9A 3CF4G 3VISA 2CNWD 2V3WA 3ZDYB 3H2ZA 4Q0MA 5JARA 2C3UA 2W0SA 3HWWA 5IBRA 3ZDAA 5JJLA 1E7SA 2MTBA 4TVKA 3DNMA 1L0BA 2JA1A 3BS4A 4PWYA 5C8XA 1E2FA 1VGRA 4DA0A 5T4FA 4OKIA 3AF3A 3O2QB 3MD0A 3EVBA 3EWNA 5K3CA 4ETNA 3R0JA 3KYBA 5HJ7A 1B2LA 1R6XA 3AVQA 3SYLA 4EJ2A 2J31A 2JFHA 3WAKA 2X8JA 1CETA 4AKHA 4US2R 1VYTA 1RAAA 1RHUA 1U94A 1YOVB 4WASA 4RO0A 4C0WA 2EJUA 3W1VA 1ZVKA 1SFRA 2IDJA 4LZAA 4ZOQI 5KQMA 3NBFA 1HM5A 3DBHB 4FDMA 4MW1A 5GZ3A 3K6SB 5T64A 2GAOA 4N5NA 3P9XA 4UE3S 2CB9A 1Q91A 3S2IA 2DHQA 1XXLA 1YCHA 1G8MA 3HYRA 4F1WA 4DKJA 4B3SB 5B6PA 2Y0DA 3KE8A 2Q7OE 1FPMA 3A1WA 1Y7TA 2WHYA 3GT4A 3AMVA 1UDAA 1MXFA 2IDMA 5FRDA 3G13A 1N2ZA 2CL6X 1SURA 4XVHA 4QEKA 1K97A 4WFIA 1SU4A 1KEZA 3GGJA 2GN4A 2W2VA 3NFRA 1E2BA 3KSDO 3JQBA 1A8QA 2AJCA 1JILA 2A5DA 2L18A 3R0VA 4DXHA 4ZZ3A 9LDTA 1IAQA 2G6BA 3SSAA 1DCTA 4CHGA 3VKHA 3CLRD 4ER0A 1ZNYA 2O1EA 4Y6GB 3VHQA 2FUG6 2J7PA 2XCOA 3OUTA 4OQZA 4CEIB 1E6UA 3KCQA 1SXQA 1PHRA 1W0JD 4LW8A 4WSOA 3WWYA 1EUCA 2ON6A 2OMKA 3OX3A 5IP5A 3TOSA 1PWEA 3A9CA 1XNHA 2I22A 4H18A 4G2NA 1TF7A 4QHSA 5L3SA 2CWWA 4H6VA 2HSJA 1HR0B 2FOXA 3C8MA 3H1GA 3D6UA 3KDAA 2PQ2A 3ZR4B 4I7EA 1XE3A 2QLNA 4NQRA 5C18A 1MH1A 3VZCA 1I5RA 1SQ5A 4TZ6A 3A6HA 2NU8A 2HIAA 1T2UA 4K6HA 4RV9A 4WBXC 1H65A 1OT5A 3GDHA 3NGXA 1YXMA 3HR4A 1SG0A 2JDID 2R44A 3VPXA 4BE4A 2GM5A 2PX0A 3EXHB 3BFKA 2AUMA 3N8DA 2IZ1A 2E49A 4IHQA 4Y9TA 3R7AA 4DM3A 3G5UA 1A76A 1RI4A 3R3XA 2JAUA 1XFDA 1RJGA 5DHRA 4QTZA 2ZJ6A 4YREA 1MEJA 3IT0A 1E79A 4JBHA 5FUQA 1G7CA 3O94A 4V03A 1QLJA 4JLPA 2JC3A 3RTDA 2FPOA 3SSOA 4B6RA 1SY7A 4HLNA 1YCDA 2CMDA 1EA5A 4L2IA 3HUUA 3KEQA 1E3QA 2ZB8A 3FTQA 2Q6VA 1G6HA 1DS6A 3N8GA 3U0BA 2H31A 2Z09A 2Z04A 4UBKA 1JEYB 2AG5A 1ZSNA 3OHMA 2VP0A 5D87A 4BASA 5JNSA 3WWOA 2EF1A 1U81A 5DNCA 4U39A 2ZJYA 4B4WA 3DDCA 2BGJA 4W9RA 2XDQB 1ZM3A 1YQUA 3MT7A 4ZHQF 2M9MA 1YQ9A 4M6WA 4E51A 2G6TA 4MRMB 3M9LA 4RXMA 5FHRA 3AEKA 4IVNA 8GPBA 4S05A 1OREA 2F3PA 3H4MA 3GJ7A 3KR2A 1NMXA 3A4VA 2PPLA 3EFHA 5EFZA 5IVKA 4H16A 3DUWA 1XTRA 1W1IA 1L5RA 5DYIA 4CQNA 2CYCA 1Y4SA 1P2SA 4X24A 3E23A 1O5IA 3KDPA 1ORIA 1ID1A 1ZHFA 1M2GA 4H6PA 3MJHA 1RJWA 3R5HA 5FR2A 4GKJB 4LXXA 3I01M 1M6HA 2QENA 4DKXA 1FFAA 4XB6B 3SLRA 3W7VA 2GNPA 4MW0A 4WMLA 1L7XA 4J1TC 4OP2A 4RLQA 1N5JA 1E32A 1RYBA 2EQ5A 4G1UC 3LP5A 5CPBA 1PEYA 2HIGA 2QJFA 3DR3A 4HNGA 5C5CA 4MUEA 5CB4A 1L3CA 1TQ6A 3JARB 3OLYA 4D0RA 3W6ZA 3JQ9C 4AQYB 1KI1A 2W6MA 3U60B 2WU4A 1M2FA 4RZHA 2OSBA 5DOZA 1MQ8B 3I72A 4ZZ1A 1KKUA 4NPCA 4TTRA 3VQTA 2C7RA 4KRGA 1BJTA 1SKUA 2KI5A 1E69A 2NYUA 5F1YA 5KYKA 1CY6A 2GBLA 3P7MA 5EWMA 1I2AA 3VKFA 3ZKWA 1MGPA 2MJLA 5IM5A 4E5SA 2IH4A 2JHFA 1PLLA 3DEFA 2QVYX 4FI3F 5DYNA 4ZO4A 5F78A 4DWWA 5GTDA 4UUBA 1FLVA 3L8ZA 1FRQA 4C0HA 4CODB 1R3UA 1U3GA 5CT4A 5A1TA 4XFKA 5EWJA 2HV8A 1MZPA 2ISSD 2F4NA 1VLLA 2NQTA 4LC0A 1GUBA 3TMKA 3KQMA 4FU0A 5A2GA 2WR8A 2YBDA 5AI8A 3SIRA 3T34A 1P7WA 3GZNA 3WA7A 3CRMA 2I2XB 2P77A 1ZU4A 2IYOA 4AUMA 2NW6A 2RC6A 4P98A 3FPLA 4LRTB 4EQZA 3RYHA 3H97A 4B9EA 2IIBA 4DMRA 1XV5A 1AUQA 3G9QA 4PGFA 3C14C 5DFAA 1MRSA 3VU8A 3BH6A 4ANFA 1WXGA 2GJ8A 2FFAA 1AK1A 2CHGA 2OCGA 2P4QA 4HGRA 2CB0A 4IW3B 5H16A 3RODA 3FETA 3RSOA 3ZLBA 4CLHA 4CU2A 1ADCA 4XVRA 1EGQA 4N12A 3VR1A 3X44A 3ZDBA 3ZD7A 2X14A 1MIOB 1MP0A 5G3ZA 2CYAA 1WSBA 1GAWA 2E9SA 2JFFA 3GFVA 4QELA 4RTNA 1Z5VA 3I76A 1WG8A 3KYIB 3VHRA 4QZVA 1YT5A 1XZGA 1U1FA 1QGOA 3LO8A 1ZK2A 2FZ5A 4QHYA 1WPRA 1T9GR 1NMSA 3M4NA 3SS7X 4IS2A 3VKWA 2CF6A 4CF6A 4FFVA 5A4IS 3U4QA 4XYEA 1B42A 4RW0A 4BNLA 3G17A 3I09A 4YDHB 1ZMXA 2GXQA 3ISVA 3LCUA 4F46A 4LISA 2UZ1B 4R54A 3WK7A 2Z1DA 4QYTA 4GWGA 4L5AA 5IVPA 3I01A 2BYTA 2DFNA 2XAUA 3DAFA 4IHJA 3OOWA 2P5UA 4RGQA 4PZPA 4PC7A 1RQNA 3DBVO 2IS2A 3SFZA 4F91B 2FSGA 2PTGA 1SCJA 3R4VA 4C0LA 1LK7A 5AVUA 1Z88A 1N2JA 5EP2A 4EL5A 2GBIA 1VQ1A 2I1VB 2I4MA 4U6QA 3GLVA 3KJGA 2BJWA 2IDKA 3R6TA 4RD2A 5AUPB 4PVDA 3ZDEA 3O95A 4CM9D 3ZGYA 5DLYA 1D6JA 2AJLI 3GK3A 4GW3A 1GRCA 3PC6A 3GRZA 4IMPA 3AR5A 1IOLA 3FR8A 3VU3A 3RKRA 3P4UA 1A2QA 2FP4A 4TTQA 1Q5PA 2AJ8A 2ECKA 1VHWA 4ID3A 5MHTA 1J9EA 1SBCA 1WM1A 2XPCA 4J9VA 5DM70 1U0JA 2FZCA 4HXEB 3F78A 3T3GA 3LGSA 4FJ1A 1QNFA 3AI3A 4Y2VA 2CN1A 1SOMA 3HA2A 1DNPA 4O2BB 5TQJA 3I5MA 3WMWA 3D64A 1YS7A 1M5RA 1WZIA 4AXXA 2RJOA 4UHFA 3HCFA 3RRZA 1M0SA 3TR5A 3D1VA 2R4QA 4LPKA 2IF2A 2Q3JA 5B4VA 2YINC 3HJAA 5C1DA 2QROA 3ZXSA 1QQ7A 3HM9A 4YJ2B 1FNCA 5BWBA 2BH9A 2NVOA 5CA1F 1SVSA 4IFBA 3VTKA 1XMPA 1Z2PX 2EQBA 4O59O 3KPYA 3QX8A 1QGDA 5MFZA 1KZGB 2EL7A 2IODA 3IVGA 1ZKDA 1DRWA 2JIQA 3DLTA 3FJYA 3JZIA 4LTNA 5FTKA 1ULHA 3U1TA 3HDGA 2DE0X 1JGTA 1ZGJA 3U7QA 1WUIS 3PWKA 1FU7A 5SZHB 1KSHA 4REQA 5CK4A 3GHHA 3GRCA 4TZKA 5T7BA 1KPIA 3KUDA 4R01A 4DDHA 4XYMA 1IJFA 1T5BA 5ESDA 3U3DA 2DHEA 3NIGB 4A6DA 1FYFA 3IB3A 4IDEA 1JMKC 1PVDA 3UUEA 5E6RA 3GJYA 5I6DA 3DXZA 3WDKA 1R0ZA 1XXHE 5AUNB 1J6UA 1HYQA 1NJ2A 2WNIA 4KFCA 2XUKA 2CL0X 4L4YA 4RK1A 2CMFA 3A6ZA 4FFBA 3DV0B 3DONA 4MX8A 4HTAA 3Q7EA 5DM2A 2AZXA 1W5EA 4ESEA 4CT0A 2J08A 4X60A 2CDNA 2GZDA 3K0AB 4N6NA 2IZ7A 5CXSA 3K2EA 5AJUA 5TQ0A 1GLVA 1SCKA 2QSYA 3NC1C 4I55A 2ZUEA 4DV7B 3ADBA 2WHXA 4NZMA 2WKSA 5DHPA 4YJ3B 2QNRA 4MQMA 4QQFA 1ZEJA 3BMOB 4D8TA 2ANBA 2XUIA 2JLQA 4XI9A 3RI3A 1YTLA 2NO4A 3OUZA 1U1GA 1AQUA 2VFAA 2VJOA 2CF5A 3DTYA 6PFKA 3PRHA 3K72B 3VVLA 3UV7A 4NXMB 4LHEA 4H59A 4HTFB 1TIPA 4YO7A 1VRCA 1WCIB 2IYTA 2VZLA 3JTEA 2YZ7A 2CW5A 4EMTA 1S7CA 1NJGA 1YTUA 4QUHA 4EOGA 1DPGA 1XPUA 1P4HA 3D6HA 3LDGA 4HUQB 1XNRB 5K01A 4R83A 4I6GA 5ESRA 3L7BA 4Q15A 3V97A 1QH8A 1HF3A 5AP9A 3TNFA 4HJXA 1JZSA 1MO2A 4MQFB 4BKOA 3DFIA 3NVDA 3UYKA 2YWRA 4X1OA 1JT9A 4KI0A 1ZH8A 1UKEA 5CA0A 1WSDA 3EQ2A 1BO6A 4JYAB 3E61A 3CO0S 2KB0A 3VBEA 3E9QA 4GZ3A 2HMUA 4LC9A 4MYSA 3FMVA 5IN5A 2H7YA 2MR5A 2ZT6A 1FDWA 2JAPA 2I80A 4Y2YA 3QVGB 1KYYA 3DHVA 4RZXA 4V3BA 3ABIA 1O1YA 1NWCA 1V16B 2YIVX 5HK8A 4M0CA 2RI6A 1YRWA 2NSDA 3KT6A 3N05A 3PTAA 1DRKA 3PHJA 3Q0TA 3IS3A 4P0PB 1T2CA 1FVHA 4E12A 4J1QA 3AVYA 2OA0A 2XWPA 1UWCA 1LTQA 2I4OA 2ZIZA 1JDNA 1I30A 4JSRA 2ZITA 5JI3E 1U0SY 1GCIA 3CZMA 3G8AA 4LDRA 4UEWA 3GW8A 4DCCA 4HWGA 2J3LA 4K9QA 2GA8A 1GNTA 2R3SA 2CXRA 1K4YA 3OVMA 3H2GA 1RR6A 1YQQA 1ITZA 3CEHA 1I0ZA 1L3BA 3RHTA 1T8TA 1T1JA 3S6JA 1DE0A 1RLJA 3ITEA 4IO1A 3C3CA 3WKDA 1SKBA 2LR0A 3FTNA 1Q3TA 5TY0A 3VR5D 4D6XA 4EKEA 4JI8B 4HY3A 1FUYB 2H1IA 2YASA 3HV0A 4HN2A 1VLJA 5JDCA 5KPDA 2O7RA 5ALZA 1M5TA 2D06A 3ITNA 2IHKA 1OI7A 4GD3Q 1WXEA 2QTFA 2A5LA 4IXDA 3U4HA 4BNFA 3K0CA 5LD2C 3H8JA 3NYWA 2FUEA 1KORA 3GH3A 3VSEA 2Q45A 4MQUA 4NZZA 2J59A 1PUJA 4QNMA 2BTQA 1UBNA 4LRQA 4Q12A 3I2FA 1X77A 4BRZA 3VGJA 3WMXA 3DL2A 1B0UA 1NF9A 2XZOA 3MJSA 5A9TA 1MQAA 3QF4A 4RY0A 1EVYA 3O3MB 4AU1A 5FPKA 4IUDS 4EK9A 3ONFA 2J3DA 2OGWA 4FDAA 1H1LA 1L1QA 4F4JA 1NVKA 1E3IA 5EJIA 3KEGA 1P5RA 4UQOA 1OAAA 3WNCA 2Z5LA 4TT3D 2FRXA 3ESYA 4UMVA 1JLRA 2E87A 2FPIB 4PXAA 1VMKA 5E0KB 3SJUA 4L4UA 1LQTA 1X1QA 3M34A 4MVJI 3RO7A 2I3DA 4ZQIA 2V6IA 4B2LA 1O0BA 1JA1A 4NBNA 3UH0A 4WBNA 1EWTA 2I7DA 3ICWA 3GUZA 2QU7A 4FW8A 3HTXA 4MJ7A 1YC2A 3ULKA 2O59A 5CJ2A 1XZAA 2VQDA 1OBVA 1D9ZA 2FR8C 4KUGA 3CVWA 4LXQA 4XLTA 4J94A 1KYZA 4WA7A 5KAMA 4ZGBA 3D8SA 3RFUA 1CP2A 1X7GA 3BE4A 4N8EA 4KPEC 3IIMA 2WJ4A 1Y5IA 4TVBA 1EUCB 3AV3A 3NUGA 4AG5A 1XA4A 1ZZGA 2DPHA 3OUUA 5A9SA 1RWVA 5IM4F 3IVMA 2UDPA 2B83A 5BYKA 2GD1O 1TA9A 5D5QA 2I67A 4F96A 2BUCA 2WU8A 3LKBA 4HRYA 3VH1A 4BCCA 1OFHA 4CG2A 5G2OA 4D96A 4EEXA 4EJSC 5BWCA 1TMYA 3QF7A 1GP2A 1JXQA 1P5JA 1MX1A 4BEBA 3DMHA 3ZCRA 3O5AA 3E03A 2AQ8A 2DQSA 4OJYA 1GG5A 1EB8A 2QAGC 4NLLA 4M60A 3WKAA 4HX9A 3ROPA 1SU7A 2V45A 1W44A 2W11A 1EJ2A 1MC4A 1ZR4A 3M2PA 3NC0C 4O3FA 3DFKA 3LQQA 5DMHA 4PCUA 4OG2A 4QUAA 4ZANA 2HK8A 1JG6A 3G0CA 4FLFA 2EHDA 1LC3A 3FHCB 3AWIA 2O8EB 1JEAA 5HKLA 1EVEA 2VTKA 4Q3AA 4R7TA 3FOWA 2NUPA 4K9DA 4D81A 3VR4A 3E9EA 2Q0QA 2WAXA 5LP1A 3FYUB 3ES9A 4WLUA 3CZ5A 1T5IA 4NXNB 4IQ0A 1MTZA 3WLQA 3TI7A 3O91A 1G4AE 4Z7OB 4MARA 5LQMA 1YRYE 4AY2A 3HJTA 3KWFA 2CLIB 2HREA 2CK3D 2ZSJA 5E6SA 1ULTA 3PUVA 1Q1NA 4ML3A 2ZZNA 4DUZB 3O7WA 4C0KA 1P0IA 3AR4A 5AOVA 4ALKA 1KGSA 1M8PA 2O23A 1NWHA 1Q92A 1UQTA 2WJYA 4V2IA 4C0BA 1LPOA 1LWNA 3ESAA 3OG9A 4RVSA 3IJEB 3SHOA 2QV7A 4UHHA 2P2GA 3A1UA 3CX4A 2PSSA 4RMNA 5BOSA 2VWHA 3HSKA 3P2OA 3VZPA 2PYIA 4XVUA 3WFZA 2FSVC 5F73A 5KWIA 1C29B 1GL9B 1OYOA 4URZR 2WTMA 4UBMA 2G7ZA 2VK8A 3RVKA 2DG2A 2G88A 4YP7