4S1VA

Crystal structure of phosphoglycerate oxidoreductase from vibrio cholerae o395
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MMKIAILDDYQNVVRGLNAFQCLQGHDVTVFNDSVSDETVLIERLKPFEALVLIRERTPITENLLAHLPNLKLISQTGKVSNHIDVPLCERYGVTVLEGIGSPVAPAELCWSLILAASRHLPSYIEQLHAGHWQQNGGLGLGRTLSGRTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEASRQKALELGYQAAADKAEFFAKADVLSLHLRLNDATRGIVTKQDLLAMKPDSLFVNTSRAELVESGALYSVMQANPMRQAAVDVYENEPALPNNEPLLSLPNVLCAPHLGYVEKNSYEIYFQAAFENVVKFAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-3-phosphoglycerate dehydrogenase-related protein
publication title Crystal Structure of Phosphoglycerate Oxidoreductase from Vibrio Cholerae O395
rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.95: Phosphoglycerate dehydrogenase.
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4s1vA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4s1vA01
3FI9A 4IDGA 2Q50A 1ADGA 1JWAB 4BO5A 1ONOA 3IAHA 1FDSA 2X0RA 4FSHA 4OXYA 2IZ1A 3ZWBA 4J49A 2SCUA 2WE7A 4GAEA 2Y1EA 2UDPA 2FR0A 1HF3A 3RC7A 4CMHA 1P1RA 5JDIC 2YDYA 2X0NA 4XKJA 4MIEA 4PFJA 1UR5A 2G82A 5AYVA 1N7GA 1PIWA 2JD2A 3RUCA 3VH2A 2QZ9A 2VYVD 1ZEMA 1WLYA 3EYWA 2JCYA 2V65A 3L07A 3RFXA 3CMCO 3HSKA 4EJ6A 4FFRA 4RPJA 2ZK7A 1Y8QB 1AHIA 1KETA 5EERA 2VTDA 1NAHA 4MIYA 3JQAD 3W8DA 3JQFC 4DYVA 4BO9A 1PJTA 1YQDA 1KVQA 4RGBA 5A9SB 4WEOA 1XIVA 1R66A 1SO8A 1U4SA 5EIOA 2O3UA 3DMTC 3KYCA 4BMVA 4Z0PA 3RIHA 3WTCA 5KVQA 3OP4A 5L4LA 3SC6A 4PG6A 1YVEI 4UUOA 5DOVA 3Q0EA 3DFUA 5GMOA 4TMFA 2BI8A 3BMQB 3UAGA 1PZFA 4PG7A 3GEMA 2G17A 3HUDA 1LTHR 1GQQA 3S2EA 1BVUA 1T4DA 1Z74A 2E4AA 1NAIA 3PQFA 4J4BA 2WD7A 5TIIA 1R0LA 2F00A 1H9AA 1HT0A 4FDAA 5ENVA 3TZKA 4H15A 4UVHA 5LC1A 4TRNA 4CQMD 1R37A 1ULSA 2EJVA 4R1SA 3ITDA 1GPJA 1PL6A 4OH1A 5FFFA 5JAIA 4CLDA 1XG5A 3E03A 1E3IA 3RROA 4L74A 1KY4A 3GDOA 4WCFA 1ZSVA 3DFZA 3TFQA 3FPLA 3K2BA 2IXAA 1C1DA 1C0KA 2EF1A 4CM5A 1I32A 1H94A 4K6FA 1FXSA 1LC0A 2EKLA 2AA3A 2QZZA 5KJCA 4W99A 3NJ4A 2VWGA 2EHDA 4JBHA 4E13A 3WGGA 1NASA 1E92A 3BMCB 2D8AA 3WGYA 4K9DA 3AUAA 1OC2A 4J43A 4DPMA 4ALKA 5U9CA 4YT5A 3OETA 3JQGB 1KEPA 1LXCA 4Z6KA 1HXHA 4GX1A 1LNQA 2ZYAA 1LSSA 3E9QA 1CEQA 3GA0A 3G1UA 2Q1UA 3PWZA 2WMDA 4XZ3A 3ZNPA 3RUHA 4I5DA 5TGDA 4AFNA 2PZJA 1ISFA 2DBVO 4IPTA 1J4AA 2P2SA 2YJZA 1QV7A 3ZWOA 4CL3A 2AW5A 4ND5A 4RVSA 1DAPA 5TJ9A 4OQYA 3H5RA 4DLAA 1DO8A 1R0KA 2W4QA 3F5SA 3D64A 1ADCA 5JFOA 3FPCA 4BV8A 1V3TA 2VCYA 1QORA 3B6ZA 3FF4A 3I9OA 4RPGA 4XDYA 3RAJA 4BKPA 3GN2A 4YAEA 1DJQA 1MFZA 2V6MA 4NK4A 4YEDA 5L53A 4TWRA 4XB1A 4RL6A 4PLFA 2VT2A 4LCEA 1XR3A 4TRRA 1ARZA 3HN7A 1EUDA 3T4EA 1BRMA 2Y93A 2FOIA 1XQ6A 4DTIA 2CSUA 5JDCC 2YQ4A 3X2EA 1VKOA 1WXDA 1E3SA 4NFYA 5TT1A 4E12A 3H2SA 4XQ9A 2GZ3A 4IJUA 1GZ3A 3ZU3A 4KTVE 1PGJA 5FI3A 1I2ZA 1M6HA 2VZ8A 4AG3A 1V3VA 1K6IA 1X1TA 4IBOA 4J0EA 5H82A 1NNUA 1WDMA 2QIOA 1MV8A 2OGUA 1U7TA 1QSGA 3FRJA 4G65A 4QEDA 4N7RA 2C7VA 3T7EA 4CLOB 2QRJA 3ONFA 1YKFA 3D1LA 4BNGA 4RJTA 3ADPA 3BTVA 1RKXA 2VHWA 3OJ0A 3EVNA 1N2SA 2ZB4A 2BRUA 3PIIA 2Y66A 2J8ZA 4U0KA 2OL4A 3G1TA 3RCBA 3PVZA 3AI1A 4I8XA 1NTOA 2V6FA 1SOVA 3HADA 4FPXA 3PPIA 4MVJH 1BXGB 2QQ5A 3O03A 2H6EA 3C1AA 3QWBA 1T1RA 1PJBA 3K31A 1DFHA 4EUEA 3EDMA 4E2YA 1YL7A 3TZCA 1PQWA 3HHPA 1VL8A 4YR9A 3AWDA 1AN9A 5T64A 4J2OA 2P9GA 5C7IO 4QXMA 5EN4A 1ZK3A 1Q7BA 4OGWA 3VZPA 1N5DA 1YBAA 3O8QB 3GGGA 4AVYA 1KEWA 1YL6A 3E5RA 4IJVA 2HMTA 4A27A 1ZXLA 1A7AA 3QSGA 5GY7A 3GLQA 3IMFA 3RFTA 3DZIA 4DRYA 4UVDA 1PR9A 1LDEA 3LT2A 8ADHA 1ADBA 3GF4A 3DL2A 4BNFA 1GDHA 4LVUA 4RV9A 3JD0A 1C0PA 2G1UA 3DHNA 1DLJA 4IXWA 5I8ZA 4IDAA 5THKA 1XDWA 3DZHA 2X5JO 4RF3A 3FR8A 5KOIA 2W2LA 1NR7A 3AOEA 5HS4A 5IZ4A 5I8WA 4M54A 3EW7A 2PY6A 5EQDA 3AI2A 1UXGA 2PZMA 4UUMA 1FDUA 5A4DA 1E7QA 2Y0EA 4NBVA 3WJ7A 3C3XA 3H9JA 2JL1A 3BYZA 3ON5A 1N8KA 3UH1A 3OMLA 2XAAA 3I5MA 4YACA 5JAZA 3OBBA 4AJ4A 4ZQEA 4IS2A 2NADA 2NV6A 4ZICA 1PJLA 4RPLA 2AG8A 2GNAA 4KUHA 4LK3A 2I99A 4BNMA 4CJXA 3K92A 2BKAA 3VAZA 3NJ8A 3A06A 4FGWA 4BNZA 3GG9A 4OM8A 3W1VA 1Y9AA 3H9EO 3WB9A 4CM9A 4WEQA 4XA8A 1ZSNA 4TZKA 2B4QA 5TC4A 3JD2A 2VUTA 4WNIA 1PJCA 3Q1LA 4CLHA 1YB1A 4RVDA 1AGNA 1NPYA 4YXFA 2FMUA 3UF0A 2LDXA 3NGLA 3UXYA 2E82A 3WWZA 1B3BA 2BMAA 1E3WB 2DFDA 3GZNB 4RF5A 4UEKA 1LRJA 4PLZA 5CP8A 4BQPA 2X1HA 5I7FA 4NBUA 1I3LA 1QLJA 1C1XB 3TOXA 3GH3A 4YTEA 5KIAA 2VHVA 5DNAA 1P1JA 1DIHA 1PZGA 2F1KA 2YY7A 2OMEA 3C7CB 4ZA2A 4CM4B 1KEVA 1CYDA 3I4FA 3KTDA 3KRTA 3QWAA 2Y1FA 5TQVA 1Z7BA 1ZK4A 2Z5LA 1GYPA 1Y8QA 2IXBA 2J5KA 4A26A 3RQSA 2QYTA 3PHGA 3QE3A 4I5GA 3CUKA 3OH8A 1H6CA 1U8XX 4Y8VA 4GKBA 3HB4X 5G0WA 2A92A 3RU7A 4U5QA 1BGVA 4MOWA 3OIFA 2NU8A 1SAYA 4KDEA 1T2CA 1TLTA 4JLWA 4OIMA 1WW8A 4L4SA 5A02A 4IINA 2P9EA 1UXHA 4KTTE 5CPBA 4NK5A 3U62A 2O3RA 2HKIA 4XYBA 2R6JA 4EI2A 2B4RO 1A7KA 3IIEA 2DQ4A 1UH5A 3L0DA 1SB8A 3SXPA 2W2KB 5A03A 4NNJA 1YOVB 3WYEA 4MP6A 1B8UA 2JFHA 4IJWA 4URFA 3DQPA 1PZEA 2XXBA 3EMKA 5JSFA 5L40A 1GFSA 5DBIA 2O50A 4MP3A 4W4TA 1WP4A 1B7GO 4F3YA 2GPTA 3VZQA 3JCZA 2X4GA 4DVJA 4IS3A 4HFJA 3A1NA 1KEUA 2JJYA 4ZRNA 4D0RA 2POQX 2J6IA 4RCVA 3ZWAA 1ZXBA 4E2XA 3TJRA 1K0UA 1ZK1A 2BD0A 5CG2A 3ZHZA 3N58A 2OUIA 2AEJA 3S2FA 3WNQA 3R6DA 4HUJA 5HM8A 1NXQA 4PRLA 3ZZNA 4XD2A 4NJOA 4E33A 3BMCA 4R1UA 4J7CA 4XIJA 5G0UA 5IDWA 1ZUD1 1KYQA 4BO7A 1WVGA 4F45A 1MX3A 1LC3A 2Q2WA 1F12A 3WFIA 2JAHA 3JQGA 1VKNA 3L4SO 1CQIA 3ZH2A 3WGOA 2CDAA 2QX7A 5COQA 2I67A 4PZDA 2WD7B 3OJFA 3WGQA 2Y68A 3GY0A 1RM0A 3UCFA 1JQBA 3LLVA 4IXTA 5HTOA 5HBRA 1EMDA 2WM3A 3ZV6A 1DHRA 5KJ1A 3ANNA 2CZCA 1MXHA 4S1VA 3CEAA 1YDEA 2Y67A 2YZ7A 1CETA 1DSSG 1UDAA 2EERA 2IEDA 3DBVO 1R12A 3VHRA 1V6AA 3MCVA 4GPD1 1SZJG 3PDUA 1C14A 2VRCA 3GAFA 3I9NA 1J0XO 3M6IA 4NDNE 4YBZA 1JWBB 4Y9DA 2CF5A 1OFGA 2FWMX 4XGIA 5MDHA 1U7HA 5TSDA 4G2NA 1VJ1A 2E48A 2RBEA 4U0JA 4BNLA 3BHIA 1ZCJA 1M6WA 1PWXA 2OOSA 2ZTUA 3WBBA 2GRAA 4HBGA 1UZMA 1K2WA 3ETGA 7MDHA 4RVHA 2DTXA 3PGJA 1Q0LA 5L9AA 3ZNNA 4OXNA 4BVAA 4G5HA 2NU9A 1P44A 3DOJA 3MJTA 3GVIA 3PP8A 5FEUA 3KYBA 2B35A 5L45A 2J5RA 1X0XA 3U09A 4BGVA 3CZRA 2UV8A 4BO1A 2X5KO 3IP1A 3CH6A 5IFLA 7ADHA 1HZJA 4GGPA 3NT4A 1BXGA 3H3JA 4NQZA 2RHRA 1GEEA 3JQ9A 3ZW8A 2VHXA 3JQAB 1EDOA 2X22A 3INTA 4GVXA 2E37A 1YB5A 3GMSA 5KKCA 1KY5A 2QHXA 4PVDA 3I4CA 4CMJA 1ZSYA 1P1FA 2PFGA 4EITA 1I2BA 5JAMA 1Y5MA 3LT0A 4MPDA 4CR8A 2Y0DA 3O8QA 2HAEA 2X5OA 4KOAA 3GQVA 3OQ6A 3LVFO 2YW9A 2D1YA 4IGFA 4WLUA 3DAFA 3PYLA 3V1UA 4A73A 4FFPA 2I65A 3Q9UA 1DRWA 3JD3A 2HMUA 1IYZA 3NX4A 2ET6A 2OO5A 1J5PA 4RPKA 3WGHA 1DC3A 3JQDA 5DN9A 4O59O 5CEEA 1LDMA 4XB2A 2GO1A 4QFCA 2I3GA 3WGIA 4FB5A 3EHEA 4CQMB 4WCFC 2BFAA 3UCEA 3DTTA 4XCVA 3QVTA 2EGGA 4Q3NA 1T26A 1RM4A 2EP5A 2CY0A 3X2FA 3AY7A 1P1IA 2YV2A 3UCXA 3JD1A 4QSMA 2ZQZA 3Q2IA 1QLHA 5JPIA 4YQZA 4WGGA 3GVPA 4CV3A 4Y6PA 5AVOA 1DJNA 4WASA 5IJZA 3OA0A 2E6UX 3A14A 3WLFA 1B8PA 1M75A 2YHUA 1P3DA 4QO8A 3RUEA 4KQWA 3V8BA 4TVBA 4INAA 1HDYA 4U6QA 4DYDA 3I9MA 4GX5A 5EINA 3LK7A 4EJMA 1D7OA 1ZIDA 3HE3A 1YBMA 2DBZA 2D5AA 5CDYA 2GF2A 1LQTA 1W0CA 4QUKA 4R1NA 3TZQA 3WBFA 3QHAA 4MVJE 4J91A 2CVOA 4D43A 2BHLA 1EVYA 1EFLA 3IS3A 3L6OO 1I30A 4NFSA 4IM7A 1N92A 4XEHA 2B5VA 1TT7A 3NUGA 2D5CA 1QRRA 4YJDA 5B12A 5F5NA 2BFPA 1E3WA 3GZNA 1A9ZA 1JVSA 2DM6A 1H0KA 4N5LA 1MG0A 1OOEA 5HWSA 2HCTA 4CPDA 4C4OA 3G0OA 3RD5A 5ITWA 3DR3A 3AOGA 4WE3A 4E6PA 1WPQA 1JW9B 3UFXA 2ZJ1A 1NHWA 3TZHA 2UVDA 4HV4A 2ZTVA 5C7LO 4E0BA 4R51A 4OKNA 1HRDA 1EQUA 4CM4A 3R3JA 3ENKA 3PEFA 4BO2A 4DMMA 4PG4A 2AEMA 3AJRA 4PLYA 5L7WA 1IY8A 1E7SA 1XYGA 1IE3A 5EQFA 4E31A 3KLPX 2PD4A 1O5IA 4RVGA 5C7OO 5JCXA 3V2UA 4XQEA 2P68A 2CUKA 2VYNA 3PHIA 4AJPA 4NFHA 5AQ1A 4NPCA 3DAGA 1E7MA 4UUNA 3PRJA 4CLXA 1NPDA 1U8FO 2D0IA 4M55A 1EZ4A 4MKRA 1GV1A 5TLSA 4IJKA 3E9NA 5F21A 3NRCA 5BNTA 4OHUA 5ILOA 3H9QA 3LT1A 1DEHA 1UDCA 3BHMA 2Y1OA 3KXDA 4YB8A 1D1SA 3VDRA 4CM3A 2GDZA 3ENNA 1NYTA 3GPIA 3QVOA 4PVCA 4ND4A 5K9ZA 1M66A 1TEHA 4Q9NA 4TQGA 3L6EA 4PLWA 1VSUA 4MVJD 2W2KA 1YO6A 2OFPA 4J1QA 1YOVA 4LVCA 4GSLA 1C0LA 3P2OA 2PGLA 4BKUA 3LLSA 1HDXA 1LBEA 1DAOA 4JCOA 4D3FA 5IXSA 2FP4A 3EZLA 3AY3A 1XQ1A 1CDOA 4NI5A 1P45A 1LSJA 1NWCA 3NTQA 4GKVA 2AE2A 3KEQA 4WLEA 3RBXA 3RC1A 1H9BA 3TRIA 4DQXA 3D3WA 3AM3A 1O89A 4XDZA 2ZYGA 1LJ8A 1QYWA 3CE6A 4YRDA 4AJHA 1X13A 3EUWA 3BAZA 1HWYA 5F5LA 3FNGA 5F3RA 3IOYA 2C20A 1PR3A 1H6BA 4P4GA 1EVZA 4EYEA 3GC6A 3WQRA 3E82A 5BNIA 1P77A 2VQ3A 4FC6A 4DPLA 1E3LA 1MXFA 1PJ2A 1O8CA 3OQBA 4FGSA 1XU9A 3VH3A 3AOEC 3JTMA 1O9BA 1UXJA 1GQ2A 3IJPA 3A9WA 3VH4A 1YXMA 1V35A 4IUYA 1H93A 1AXGA 3AFNA 3DAPA 3ZHBA 1JKJA 1G6KA 2NVWA 4L4XA 3DOOA 4I9UA 5CEJA 2C29D 1L7EA 5B4UA 2PKQO 5BSFA 3VC7A 1E3JA 2AXQA 4PG5A 1UZLA 3TFOA 2Q99A 5TF4A 3QA9A 3FN4A 3KSUA 1Y81A 1K3TA 3DBLB 4ESOA 1OI7A 2XF8A 5KJ6A 5G0TA 1R15A 1EVIA 5T57A 4CODB 1EFKA 4BNJA 4FOSA 1TVEA 1T2FA 1E1NA 4GL4A 2HSDA 2Q1SA 5BSGA 3N74A 4R5HA 1TT5B 4XRRA 1EQ2A 3LDHA 4YT2A 3PQDA 1EUCA 4DBVO 4Z9FA 1MGOA 3DEYX 3KLMX 4B7XA 1MB4A 3VZSA 4HP8A 1A9YA 1IUKA 2IZ0A 4IQ8A 4KUEA 5JMPA 3K9QO 3ZWPA 1ID1A 5CHEA 1N9GB 1PL8A 1K89A 5A05A 2JCVA 1ENOA 1LI4A 3SJUA 5G4LA 6LDHA 1IPFA 2C7GA 2O3SA 5CFZA 1E5LA 4Z9YA 4ZGWA 4LN1A 3JQ7A 1C3VA 2NLOA 1HEUA 5C5IA 4ALLA 1E5QA 2LDBA 4ZQFA 5F1OA 2NVUB 3DO5A 1PL7A 5IDXA 4UREA 1HDRA 4PLTA 5G2OA 2E49A 3VPXA 5JY6A 2B4TO 1A71A 3G49A 2VYVA 1F8GA 1GEGA 2GD1O 1HYHA 4OKIA 1PSDA 4O1MA 4XIYA 3F9IA 5ENDA 1V3UA 1NPTO 3AUUA 1BVRA 4D41A 1ZK0A 1D4FA 4LSWA 1P0FA 4IDCA 3JQAA 1TA4A 2IYOA 4YT4A 1KVUA 4P8RA 1JA9A 3ZWXA 1XLTA 4XGNA 4PLPA 4ALMA 1LLUA 3MJEA 2W98A 1FJHA 2H9IA 4L4RA 3H9UA 4WJZA 1ULUA 4WOKA 3ZV3A 1I5RA 1HSOA 1GL3A 3RFVA 3QIVA 2ZJ0A 4RO0A 3S55A 4GLLA 3RU9A 1EK6A 2V6GA 3D7LA 3JV7A 4E5MA 3RSHA 1RYDA 5JBIA 4CV1A 1YB4A 3GGPA 1YONA 2X0JA 4AJJA 2NQ8A 5B4TA 3IDSA 4GMGA 2ZB7A 5A04A 1A4UA 3K6JA 1MA0A 2O4CA 4ZU3A 3ZWCA 2O23A 3WOHA 4Z3KA 3Q9NA 2IODA 1I0ZA 1A5ZA 3BHJA 5EL0A 4R69A 2PTGA 2WE8A 5I9NA 4CQMA 3ZWYA 3PTZA 3WJAA 5IDYA 3KYDB 3ZW9A 2HK9A 1GPDG 1R0SA 4N5NA 3NT2A 3KOUA 3O9ZA 3V2HA 1A72A 2I5PO 3E8XA 4XYGA 3HJAA 2FRDA 2CF6A 1BW9B 4NHEA 2PZKA 1KVSA 1NQ5A 3MJCA 1S6YA 3WX0A 3WSVA 4FOOA 5G0VA 2GR9A 2IEBA 3L9WA 1W73A 4J6FA 3ZV5A 4Y98A 1UUFA 3LC2O 1BSVA 4AJKA 3MJVA 4CM1A 2EXXA 2DUWA 2VOJA 3GNQA 4HFMA 4R9SA 4JJIA 3IJRA 4KUGA 3IC5A 1OZAA 1BXZA 2P5UA 3SLGA 2DTEA 4B79A 2OP0A 2VUUA 1NFFA 1PEDA 3OECA 2DLDA 4FCCA 1T24A 5JLAA 4PCVA 1EBUA 1XCBA 2PNFA 4XYEA 4KMSA 3NKLA 4WLOA 3OFSA 3FHLA 5BSEA 4OAQA 1IL0A 4B4VA 3Q3CA 3FR7A 1ZMTA 3GHYA 4LMPA 4ZD6A 5LCXA 5CDUA 1IZ0A 4I1IA 4L73A 3W6UA 2EG9A 4CMEA 1LSUA 1GTMA 4D44A 5IZCA 4QT0A 2FHSA 4MIOA 3ANMA 5CDSA 3NT5A 5B4VA 2PD6A 1XA0A 3GG2A 3HZZA 2QW8A 4D45A 1MC4A 3JQ6A 4BNKA 3PJDA 3I1JA 4ZQHA 3WICA 4DGSA 4MJLA 1AHHA 1AE1A 1BG6A 1DFGA 4H3VA 3AY6A 3PZBA 4P38A 1P33A 3LYLA 3LC1O 1GV0A 3ZDFA 2ZB8A 3FWNA 3WG9A 4MVJF 1RPNA 3AI3A 3W8EA 2BFMA 4FFOA 4RLSA 2OBNA 2OBYA 3B1KA 4OSOA 4IGEA 2DVMA 2EWMA 2RHCA 4LCJA 4NU5A 4DXHA 1RM3A 4RLHA 2WWRA 5TJHA 5L4NA 2EKQA 3PLNA 5TS3A 2UAGA 3DZJA 5H81A 2HDHA 2AMFA 3MWEB 3JQ9C 4NR0A 3OIDA 1K6JA 1ISHA 3WIEA 1RJWA 2FZWA 3V1TC 4E4YA 5DOZA 1U3VA 3UW3A 3AK4A 4TKMA 3WTBA 3FTPA 1QYVA 3LF2A 1B2LA 2EV9A 2IZZA 3U4IA 1VLLA 1X1EA 1CJCA 4FC7A 3QVXA 1DLIA 2G76A 3C85A 4IY1A 1PS9A 4ND1A 2NNLD 3KM0A 2FR8A 2WYVA 3F1LA 2NSDA 3WFJA 1XELA 2X0IA 3OF2A 3DXFA 4MVJP 1QYXA 5CAEA 4I5EA 4MDHA 3INGA 1ORRA 1VPDA 3HDHA 1LRLA 1MC5A 4AJLA 1RM5A 1HYEA 3SBOA 3GRPA 1VSVA 4YCAA 5LDHA 2HMSA 1XKQA 1DIBA 4GSKA 8LDHA 3H7AA 2YHIB 1HETA 1Z73A 3I83A 2RCYA 2YYYA 4GQAA 4RZIA 5I7SA 4TSKA 1LX6A 5KVCA 1FDTA 3ANLA 4CMCA 3NTOA 2A94A 2BH9A 3H9GA 1PQPA 1E0DA 2J5QA 3PYXA 1NQAO 4KWHA 1X7GA 2GN4A 4IMPA 4KZPA 3U4HA 4UAGA 4XJSA 1ENYA 5G4KB 1V0JA 1T25A 3D4NA 3ZCXA 3GR6A 4Q39A 3VPSA 4NIMA 1CRWG 3ASVA 4MO2A 1K5HA 5L7TA 4R5MA 3DBLA 4JP2A 1ZJZA 1I33A 1UZNA 2OZPA 2PKRA 3PGXA 1ENZA 3ADOA 4XWYA 1UXKA 3P2YA 1VC2A 3LU1A 3W8FA 2EJWA 2PA3A 4JX8A 3DZKA 3ZWNA 3D3WB 1DRUA 3D5TA 1ISJA 1TT5A 3PDJA 5A3VA 4LMRA 4JQCA 3SEFA 4O6VA 2CVZA 1F8FA 3GFBA 1NP3A 1N9GA 4JK3A 4XQCA 1YE3A 2YV1A 3R1IA 4A0SA 4LSMA 4BV9A 2BLLA 3F4BA 5JC8A 3E5MA 1EBFA 2JAPA 3MEQA 3DWFA 1NQTA 4B4UA 2HUNA 4YAGA 4E5PA 3MOIA 4WLFA 3ETEA 1HZZA 3U3XA 3E18A 4CLRB 1E1MA 1G0NA 1DRVA 2RIRA 4IIVA 2NVUA 4JGBA 4JNKA 3UN1A 3VVBA 4KQXA 3U5TA 5KVSA 4HKTA 3WMWA 5T5QA 3TPCA 4RDHA 4AICA 4ALNA 2H5LA 2JFFA 2X9VA 5AXCA 1W8DA 4JBIA 1KS9A 3JQBA 5KCZA 5BQFA 2ZKLA 2AEFA 4M1QA 2C5AA 3GUYA 1VRWA 1B8VA 2HJSA 1R4NB 3DBHB 4R68A 3ST7A 2X23A 4JXKA 5GZ1A 4YRAA 3GVXA 1WZIA 4I5FA 3VPHA 3F5QA 3GOHA 3ONEA 4U8GA 3KV3O 2DUUA 4ZQBA 5FWNA 3RBVA 3F1KA 5AXBA 4YYZA 4YJFB 5JYDA 2WEKA 1GD1O 2C2YA 3QY9A 2NTJA 5L3ZA 1BMDA 2OHXA 3U4CA 4BGIA 3GHHA 5BNFA 4P4LA 3ZNQA 1YBVA 5HS6A 3C7AA 1E6UA 1I2CA 3I6QA 1NWHA 3WDSA 2Y1CA 3L4BA 3JQ7B 4ROSA 4MVJG 1I24A 4JBGA 2DFVA 3QVSA 3VDQA 3WYCA 3W4KA 4DUPA 2H1SA 4J7UA 1OBFO 2X58A 2VWHA 2RAFA 3PYMA 4HX5A 4JROA 4BB5A 4L76A 4DIFA 1QYDA 4J9VA 5DF1A 3GDFA 5CG1A 5TNXA 4E32A 5FI5A 4J1NA 4DBZA 3HNPA 1JVBA 4D3DA 1QKIA 2PKQP 3KYDA 4FBGA 4HFNA 5A9TA 1HE5A 1HE3A 3TWOA 5KNLA 3I9LA 4CV0A 3SLKA 4L0QA 4B7CA 5ER6A 4QFDA 1BW9A 2Q3EA 3KEOA 3K96A 4A2CA 2VT3A 2O48X 2Y1DA 4OOEA 4O63O 3JYPA 3BXXA 2GUGA 1SEPA 2O4UX 3D4OA 2G5CA 3NTRA 3I9JA 1Z82A 3ORFA 3RVDA 1UXIA 2P9CA 1XGKA 1Z45A 1GUFA 2A35A 3DZFA 2CNBA 1FDVA 4CM7A 3QWHA 1F0YA 3OSUA 4JIGA 1JDJA 1DIGA 1CQJA 1GU7A 3DHEA 4KP7A 1WMBA 4K6CA 4D46A 4I9NA 1CERA 1HDOA 1G0OA 5IN5A 4IIUA 1ZK2A 4ZHSA 1JU9A 3D4PA 2GERA 5ER9A 3TN7A 5L95A 2J3HA 3IUSA 2TMGA 2Q45A 1B16A 1DC5A 1SCUA 4AJOA 5I7VA 1GQYA 4JN6B 5B37A 1UAYA 3DMYA 3GNSA 4BOYA 4CMBA 4WCDA 1ZKMA 1O0SA 2IE0A 1QMGA 4HADA 4YQYA 4UULA 3VPFA 4Q3EA 4OL9A 3A28A 1VI2A 4CR6A 1I10A 1HTBA 2Q49A 4J4TA 2PGDA 4QX6A 3PJEA 2J3KA 1PGPA 3GN1A 4XYMA 3KETA 1SPXA 2D4AA 4J3FA 4OSPA 2D59A 3HQ4O 5COBA 2VN8A 5JC1A 2HQ1A 4J90A 4PLHA 1WZEA 3E9MA 3WSWA 2VHZA 3KSDO 5JCJD 1Q7GA 3A4VA 3MTGA 1VE9A 1E1KA 5K6AC 4E2WA 4X54A 4PZEA 2C59A 2IRWA 1FMCA 3AUSA 3F6YA 4EUFA 4RORA 1NQOA 2PR2A 5GZ6A 3S8MA 3LZ6A 4GBJA 1NR1A 4BHTA 5DT9A 1Y7TA 1HYGA 4DA9A 3DONA 4PLGA 4IQ0A 1GZ4A 4IQGA 3BTSA 3FNEA 4WNCA 2Q46A 3MTJA 1NHGA 3P5SA 4HXYA 2PH5A 2EW2A 2AE1A 2Y05A 4NBWA 5JMWA 4ID9A 4TZTA 1KVTA 1HLPA 4WECA 4YWJA 1PX0A 2ZTLA 3EVTA 1ADFA 4GH5A 2EIHA 1HDCA 3F47A 3F3SA 4WK6A 1PJQA 2A4KA 3JQ8B 1JAYA 1GYQA 5THQA 5BSHA 5CEFA 5IN4A 3U49A 4TRJA 3FTNA 3H6KA 2RH4A 2ZCVA 5EESA 4BNHA 2EEZA 2YUTA 3NAQA 1X14A 4B7UA 1R4MA 4FFLA 2VTEA 2B5WA 4R41A 4FJ2A 4N5MA 1Q0HA 2FPIA 4YRBA 4ALJA 3VZRA 2UUOA 3GVCA 1ISGA 1GUYA 3ETDA 4Y67A 1Y8RB 1PGOA 1ZBQA 5F1KA 1PQUA 3OJOA 5DDIP 3H5AA 3T7CA 4XR9A 3HDYA 4LW8A 1WMAA 4MP8A 4IZHA 3EGOA 1P31A 4J4HA 3RC2A 1YWGO 2YHIA 3UGKA 4A03A 4OJNA 5I9MA 3EK2A 1SB9A 3ABIA 2Q4BA 2ILTA 2JFGA 4J1TA 1IPEA 4C7JA 2R00A 1LQUA 3D3EA 1E1LA 2I6TA 4EZBA 1PU2A 1I36A 3BMOB 5HA5A 1ZVMA 3WQSB 3HN2A 4RZHA 4PLCA 4IDFA 1GZ6A 4MINA 1KBZA 1U5CA 3ZHXA 5G4KA 1YL5A 1I01A 1GYRA 3G79A 3AW9A 3E6AA 4FJ1A 3W4IA 4UVGA 3GMDA 3LSYA 3BIOA 3TOZA 4AJIA 3V5NA 5JY1A 3TQHA 4N54A 2B36A 1IOLA 4S3MA 1XU7A 5ICMA 4YJHB 4Z3DA 2X9GA 3S2IA 1KVRA 2NQTA 3TDKA 1ISMA 4GX2A 4B3JA 5A06A 2AQHA 5G0SA 4YJGA 4BNVA 4D3SA 5CDGA 4FFMA 4BMNA 5EJ2A 1J6UA 3OM9A 2ZQYA 2JD1A 3H8VA 3WXBA 2Y1GA 3BMNB 4CMEC 3GPDG 1OAAA 1HL3A 4FN4A 5TRTA 3I52A 4Z0TA 5I9LA 5IZCC 3RC9A 3K30A 2AQIA 3QW2A 1FDWA 2ZYDA 4ILKA 3C1TA 4UEOA 4OO3A 4A10A 2C54A 1P1HA 4GVLA 4CLRA 2Q2QA 5MGBA 2DKNA 3JD4A 1WDKA 4BQRA 4E2ZA 4E5YA 1TI7A 5TT0A 1MG5A 5FYDA 5JE8A 4NMHA 1ENPA 3PQEA 3F46A 3PFWO 1ZNQO 4J2HA 3B1JA 1JAXA 4AJ2A 3GT0A 4KWIA 1Q2XA 2XOXA 3WQQA 1CF2O 1GADO 2W90A 2BELA 3TNLA 3CMMA 1R4NA 3DBHA 4E5NA 3T4XA 2P91A 5IF3A 2VHYA 3BZUA 3U4DA 4GI2A 3PWKA 3IKVA 3V2GA 4Y6SA 4R3NA 5I7EA 2OXIA 2GASA 4YJFA 3RUDA 9LDBA 2VZ0A 2DC1A 4H7PA 1B0AA 3ZWVA 1ONNA 2FPPA 2NM0A 4K1LA 4QECA 3Q2KA 4DC1A 4W9NC 1QP8A 4PRKA 3PLRA 1HDZA 3BTOA 1T1SA 2PGJA 1LDNA 3C8MA 5K6AA 3N7UA 1DXYA 3O38A 4FQ8A 1BXKA 1T2AA 1YDWA 1PS8A 3GVHA 2O3TA 4M87A 3CKYA 4BB6A 4D42A 2D2IA 2HJRA 4ND2A 2YFQA 5CPFA 4DIBA 2WJPA 2PLAA 4MVJA 1JKFA 5GZ3A 4NZ9A 3KUXA 5HRUA 2O7SA 1LSOA 4RF2A 4BNTA 1EK5A 1ONPA 3QWIA 1KOLA 4L8VA 3KO8A 3SX2A 4DIOA 3WGTA 2X9NA 2GN8A 4JJFA 4ZRMA 3C24A 3M1LA 4FIZA 4CMIA 4DQVA 3TL2A 1ML3A 3E48A 3PHJA 4M86A 1M2WA 4FD3A 4BKQA 4PZCA 5JO9A 1PZHA 3IQDB 4FJ0A 1P74A 3D5QA 2BF7A 3PIDA 4CUKA 1JN0A 1NFRA 3PJFA 4Q3AA 3ZU5A 4B8ZA 2GYYA 3TZ6A 3PXXA 3OICA 3PFFA 1KC1A 1NVGA 2W2LD 4WKGA 3RUFA 3U9LA 4CMKA 4E5KA 5B1YA 3ZHYA 3Q6IA 1A4IA 4R01A 1T2DA 3G17A 3OIGA 1LUAA 3OA2A 4CM6A 3DOCA 3M2TA 3I3OA 3QVWA 3RUIA 4RPHA 3CIFA 4AJNA 1EE9A 5T6BA 3JQEA 3SC4A 2B37A 1QR6A 3UOGA 1TB4A 1VJ0A 2EP7A 3F4LA 3WLEA 5A9RA 2ZIZA 3DBRB 4CV2A 4I08A 1Y1PA 3TF5A 1HLDA 1E6WA 1I3MA 4CQLB 2P4HX 4BMSA 2VWPA 1HE2A 4EJ0A 1SMKA 2WTBA 3DZGA 4J9UE 2NU6A 3FCOA 1M67A 3M2PA 2R2GA 4FS3A 1PJ4A 4HNHA 1LDGA 5L7YA 4CM9D 3VOSA 5BR7A 2WDZA 4L9RA 4YDRA 2Z1MA 1UAGA 4CUZA 1TXGA 1DC6A 3JYNA 3GRKA 1QV6A 3WNVA 2YFHA 3HDJA 3AM5A 1Z7EA 2YV3A 4GWKA 4ZJUA 3ICPA 3QP9A 2WD8A 3PJGA 1HDGO 5IXYA 4EGFA 3I6IA 4BGUA 4Q3DA 4F6CA 5KJFA 3ZI0A 2HLPA 2I66A 4CM8B 4Q3CA 5CDTA 4OXKA 2JHFA 4WUVA 3MZ0A 9LDTA 2VWQA 3SJ7A 4UVIA 3OEYA 1U4OA 4BO3A 4B3IA 5DBFA 4NG5A 2VZ9A 2FR1A 4LRSB 4YT8A 2GGSA 4B8WA 1E7YA 5IG2A 3L77A 2WYUA 3LQFA 3I23A 2TMDA 3GK3A 1H2BA 5JDIA 3B20A 3JQBC 1E7RA 1U1IA 3CPSA 4J7XA 2NACA 4R9RA 4XYLA 1MFPA 1PS0A 1WWKA 3UICA 4BO0A 2DBQA 2DPHA 3CSDA 4BNWA 1IHYA 1OC4A 1WNTA 5JAQA 2X6TA 2Y99A 1H2HA 1Q0QA 1VJTA 1NX6A 1I3NA 2EW8A 3JQ8A 4M89A 4ZVVA 1GY8A 1SBYA 4ONEA 2WSBA 1P1KA 3L6DA 2QRLA 5T8KC 3VTFA 3DHYA 3ONDA 3OHSX 5KJEA 1QXSA 1U9JA 3NDJA 1E6EA 3JQFA 4NU6A 1FF9A 1N1GA 5JW6A 2GCGA 2UUPA 4B3HA 1H5QA 4MVJM 4BIIA 1ZEJA 3JYQA 1DDOA 5IAAA 3JQCA 1B14A 1VL0A 2OP1A 3L4BC 3H2ZA 3R0IA 3DMTA 4B4OA 1ZW1A 4CMGA 1Y8RA 3ICCA 1UP7A 1BHSA 2NU7A 4D7AA 4HY3A 3MJ4A 4JJGA 4WLNA 2B83A 3KVOA 3KZVA 1X15A 2C07A 3TL3A 3VKUA 1ZFNA 1E3EA 1NBOA 1DHTA 1DPGA 3W6ZA 4DC0A 2CDCA 1DC4A 5AXDA 4FR5A 1VL6A 3D0OA 2C82A 1YS4A 3INRA 4K26A 4YVFA 2FY8A 4BKRA 2HK8A 1X7DA 3AUTA 3QRWA 3BMOA 5DCUA 5L51A 1LDYA 1EVJA 4W9NA 4DWVA 1LA2A 2J3JA 2DTDA 3UKOA 1EEHA 2Q4EA 2NVBA 4OQZA 1JLLA 3FBTA 1O6ZA 1I8TA 2AQ8A 1Z75A 3Q11A 4W7IA 1NM5A 3COSA 2ZTMA 3VVCA 1CWUA 3ZWWA 5JS6A 3IUPA 2ZATA 2Q1TA 3S2GA 1E7WA 2PV7A 2QRKA 1FK8A 3OEWA 1R4MB 3FSRA 4RQUA 3RKRA 3VTZA 4BO8A 4M8SA 4R4JA 4ZN6A 1T2EA 3EC7A 1N7HA 2VNAA 4BL5A 1PJSA 5ADHA 1LLQA 1LEHA 2HK7A 3PZRA 5DULA 5A1TA 1HSZA 1NVMB 3DZBA 2CDBA 2YDXA 3GEDA 4YJHA 3TSCA 4N18A 1LLDA 4P22A 4XQGA 2PH3A 1PWZA 2PZLA 2RH8A 4ALIA 2Y0CA 1A27A 1OMOA 2WYWA 3MWDB 5AXAA 1DIAA 1GUZA 4D0SA 1MUUA 5H83A 1DB3A 1ZZEA 1UP6A 2QG4A 3MOGA 2CD9A 4D79A 3FD8A 1D3AA 5TX7A 4W6ZA 3BMNA 4O0LA 2NTVA 4R3WA 3IP3A 3AFMA 4P4NA 1LLCA 1Q1NA 3FNHA 3NV9A 2O3QA 1B15A 4DQUA 4MKZA 1E77A 2I3AA 2GZ1A 2JKVA 3OJEA 3JYLA 4NJMB 4OMUA 2HMVA 2PK3A 3ULKA 4DMLA 2P5YA 3H4VA 2VRCD 3UUWA 2GN6A 1UP4A 1N1EA 3EZYA 2P4QA 2IDZA 3NDIA 3QV1A 3UHAA 5A9SA 3AM4A 4EBFA 2DT5A 4BGEA 1IULA 3GEGA 3WR5A 5ITVA 4EEXA 3NGXA 1U3TA 5JDCA 3IKTA 4YA6A 3I9KA 1ZH8A 2I9PA 3BTUA 3WYBA 3BMQA 2AQKA 1X7HA 3G3EA 4WOJA 2BFOA 5DCWA 1BDBA 3RI3A 3WMXA 4XR4A 3B1FA 3FNFA 1LRKA 5ES3A 1Y6JA 3GFGA 4QQRA 2Z1NA 2O3JA 3WWYA 3PI7A 4YJGB 3RKUA 4I9HA 1GR0A 1KERA 4LRTB 4TRMA 4DPKA 3P19A 4DLBA 3EAGA 2JHGA 2DAPA 2EKPA 5COAA 1SC6A 1NVTA 3IL2A 3OJLA 2VOEA 4EUHA 5DP1A 3MJSA 4DREA 2IYPA 1JKIA 2B69A 3K5PA 2FN7A 5T67A 3PWSA 4J1SA 4II2A 4RVUA 1ZMOA 4PN3A 4M49A 4II3A 2G0TA 4Z9XA 4A7PA 2JCXA 4EEZA 5JO0A 1GAEO 1L7DA 3STHA 4UEJA 3KYCB 2V6BA 1SOWA 4MKXA 1WAMA 3P7MA 4IMRA 1XWFA 1IZ9A 3WS7A 3L9XA 1SEVA 1Y5RA 1R6DA 5U1PA 3RUAA 3DDNA 3RJ5A 2ZCUA 4G81A 1I3KA 4EDFA 1J49A 5T8KA 1DIRA 5KTKA 2BGKA 4J0FA 2O2YA 3B70A 2NWQA 3HB5X 5DCYA 4BS9A 5LDGA 4IZIA 2A9FA 4Y6RA 2R00C 2BGMA 5AOVA 3E1KA 2X7HA 3NEPX 3O26A 1KC3A 4WCFB 1QG6A 2NTNA 4NH4A 5A3JA 1U3WA 2BGLA 1BWSA 4QO7A 1C1DB 2PD3A 4WLVA 5ILGA 3GDGA 4E30A 1UDBA 2GZ2A 1HE4A 4FFNA 3DBRA 1VM6A 5DZSA 3V1YA 1V8BA 1YH3A 4HFRA 2C5EA 4GWGA 3NDRA 1BDMA 4H16A 4UUPA 3ZU2A 2O2SA 3GZ4A 5C37A 5IDQA 4CQLA 4IDBA 4UVEA 1YJ8A 4GMFA 4Q3BA 2HRZA 3RJ9A 3DC2A 3QJ5A 2HO5A 3SVTA 1XHLA 1YGYA 3K8ZA 3KHUA 1O94A 1YRLA 1ISIA 4CMIB 1DOHA 1P9LA 5U4QA 3HG7A 4BNXA 2VUSA 2GN9A 1YQXA 5F1PA 3ASUA 4XRGA 2FSSA 4YPOA 1XSEA 2XPCA 5KVVA 3RBZA 2AG5A 4CLOA 6ADHA 2JD0A 5J23A 4HWKA 1U2GA 3H5NA 3QWFA 3WIDA 2CMDA 3EY4A 4OOFA 4O5OA 1U28A 3PHLA 4PGFA 4U6SA 4CM8A 4YAIA 4YAJA 2VNSA 2C2XA 4GLOA 5JYEA 3GNTA 1AUPA 1GCOA 3H65A 1B26A 4AJ1A 4E3ZA 1CIVA 4CUJA 1HKUA 2FZEA 4NBTA 1B3RA 3AU9A 1EDZA 4PLVA 3JSAA 3KBOA 4AJEA 4LISA 5L4SA 1EUZA 2X8LA 3GUCA 3ZV4A 3R3SA 4TVOA 4BNIA 4ZQGA 5FF9A 3ROPA 1PJ3A 3JYOA 4Z0HO 2I76A 5A5EA 4R1TA 2Q1WA 3W4JA 4HNGA 1ZJYA 4L75A 1C0IA 2EGHA 4BO4A 3RASA 4CLEA 2W8ZA 1JTVA 4GGOA 2HRBA 2D3TA 2V7PA 2VYND 3AU8A 2GSDA 5KWEA 3ITKA 1LU9A 3M1AA 3PK0A 1H6DA 1RYEA 4BNYA 1U2DA 3H3FA 2BI7A 4CL8A 1Z6ZA 3GAZA 4BNUA 1GCUA 4XGKA 2C0CA 3FWZA 4RDIA 4CR7A 3CINA 4K28A 1MLDA 3HDQA 5JXWA 1DFIA 2Q2VA 1NFQA 3CXRA 3C7DB 4WPGA 1X0VA 3ZN2A 3DTYA 1Q7CA 4TKLA 3ROKA 2CVQA 2H63A 3O4RA 4BKOA 5K0ZA 2DPGA 1YJQA 3FBGA 3RWBA 3WGZA 2YQ5A 1IB6A 4JP3A 1QYCA 5EMHA 3HFSA 3HWRA 2OORA 3KSZO 1U5AA 3UVEA 4BUCA 5C3MA 1P0CA 3QLJA 2FSVA 4R54A 4PIVA 2X86A 4OYRA 3NYWA 3K2EA 1WDLA 3ZU4A 1W4ZA 2AHRA 4XX0A 1EE2A 2Z95A 4KDFA 4LGVA 4RF4A 2DBRA 2UYYA 4RVFA 1G1AA 2J3IA 4U7WA 1YQGA 1SNYA 1PGNA 1XEAA 4GX0A 1AXEA 1M76A 1T4BA 2QYSA 4DLLA 4J16A 1D8AA 3LF1A 4ND3A 4XJTA 1U3UA 4W7HA 1PGQA 3VH1A 1RWBA 4F6LA 3S1LA 4EW6A 4QTZA 1KIFA 4CMAA 2HU2A 1F06A 2ZB3A 4BO6A 4TROA 5EPOA 2XXJA 3QQPA 2O7QA 3VPGA 3KB6A 1DBVO 3BA1A 4R16A 3C1OA 2B0JA 1C1XA 5KKAA 4PG8A 1D1TA 4A5OA 4IDDA 5DBGA 1V9LA 2NUAA 4RQTA 3ZGYA 4DL9A 2VRBA 3GGOA 4YAKA 5DP2A 3ZNOA 1H6AA 4IDEA 4E21A 4C7KA 4BNNA 3VKVA 1LDBA 4FW8A 4F46A 3HFGA 5A5FA 4MVJI 3CZMA 1UJMA 4W82A 3OQ1A 4NJMA 1O95A 2GLXA 4ITUA 4NBRA 3LT4A 1PTJA 2CFCA 3ROQA 1F14A 2DU8A 4B4WA 5BT9A 1K6XA 1L1FA 5JNLA 3ROMA 1Y9EA 1R16A 2HMWA 3U0BA 3PHHA 1W6UA 2FPGA 3K73O 1ZO8A 3DB2A 2PWZA 3LC7O 3ZWMA 4AL4A 1F17A 1S7CA 5JCJA 1IHXA 1MP0A 3CTMA 1BTOA 5ICSA
chains in the Genus database with same CATH superfamily
2ZRIA 3FI9A 4IMJB 3OIVA 1ADGA 1JLSA 4M0CA 5B1SA 1XTPA 1JWAB 1ONOA 2B2CA 3NHYA 5CH3A 2X0RA 4OXYA 1H4SA 1NE2A 2IZ1A 3C4JA 1JR3A 2WKRA 3QE0A 4J49A 2PUWA 4RESA 1S7GA 2VP3A 2IHKA 1NW3A 2UDPA 3G89A 2FR0A 2A30A 4H31A 1TU0A 2H07A 1HF3A 3K0AB 1K68A 1Q16A 5DI3A 4H9GA 5JDIC 3LD9A 4BUJA 1RTKA 3K1JA 1OBOA 1R64A 2CLIB 2QRGA 1QOZA 3I2GA 1N7GA 2H2AA 2OM2A 5ERXA 3UBMA 3VH2A 2XYVA 4DJEC 4UTRA 5IYZB 1X1CA 4ZU6X 2CBXA 3SXUA 4KXQA 3LQ2A 4QJBA 5T7BA 4IDOA 1H2XA 2XX3A 5JASA 3BXPA 5CYGA 5HGJA 3COWA 3RFXA 4DANA 3U16A 1XDGA 4EJ6A 1WD5A 1IZZA 2ZK7A 2EIXA 4ER7A 2VDPB 3JQAD 5A3SA 2DJIA 5CX4A 1QG0A 3JQFC 3LPNA 4EQ6A 1N4DA 2QZJA 1PJTA 5ALPA 2PVSA 1DUIA 3SQOA 1MZVA 1KVQA 1YQDA 3K35A 3T9BA 5A9SB 4RH1A 1COWA 4R2LA 1Y37A 2IH4A 2Q9CA 1YHYA 2CNNA 3ZHRA 3IEVA 3GYBA 4LJ8A 3HLTA 3EWSA 4J7AA 1RJ9A 3H6GA 1NURA 4YP9A 2ZSBA 5AKZA 5KVQA 1F20A 5L4LA 2GEKA 5GMOA 5CCEA 5AVZA 1WV1A 2BI8A 2HCRA 3BMQB 2YJTD 1IK6A 3WYNA 1E1RA 1NYLA 4GKJB 2G17A 3I42A 3S2EA 1BVUA 1JA1A 1KI8A 2B7BA 4J4BA 1L7VC 1ODSA 5G1NA 2B0CA 2C58A 3CZ5A 4BE4A 1NXVA 5BUZA 2WD7A 3Q7IA 5KNCD 1QVZA 1VFPA 4RH3A 1PK7A 2BEJA 2AI3A 3M5DA 1N75A 4GHWA 2MR6A 2O1EA 1HT0A 3JZAA 4GXTA 5J4VA 5ENVA 3TZKA 1MAAA 3NVKI 1RQ2A 3OCYA 4C0JA 4UAUA 4CQMD 2FF5A 3FLMA 2EJVA 2XYGA 3KPUA 1PL6A 3PNMA 1G6Q1 5JAIA 5M7EA 1QRTA 2UZ4A 4FNMA 1E3IA 3L5OA 2Q5IA 2O1SA 1CUWA 3S8EA 3Q88A 2ZSFA 1C8LA 2JFOA 3GDOA 3L2OB 3V00A 2WSSD 5CJJA 3GIDA 2IXAA 2VAPA 1C1DA 3HLKA 3DE0X 5IP5A 2CYAA 4H18A 1I32A 3TD2A 5F7OA 2HJVA 3U4GA 2QZZA 4ZO4A 3AGPA 3CX7A 2JGNA 1GARA 2Z2XA 3HS3A 4JBHA 4YGYA 5MGNA 3M3DA 2P5SA 5JRDS 3GGDA 4PCLA 3TS1A 1PQYA 2D8AA 4NYJQ 3KQMA 1J5EB 1HI9A 3OFND 1VPTA 4ZYTA 1VOTA 1Z8NA 1ZGGA 5U9CA 4G37A 2HHLA 3KP1A 4KVFA 1QDUA 1ZYUA 3JQGB 1VSQA 2I7DA 4L15A 4WW0A 1CQIB 2EFDB 3SJZA 1HXHA 1K6MA 3I2YX 5ALIA 2Z3VA 4DARA 4KLNA 1L4FA 3E9QA 3GA0A 5KYYA 2WMDA 4A91A 4IEEA 3KDSE 3SHWA 3EZXA 2QLMA 4J0HA 2Y92A 3ZWOA 3HYCA 3ND5A 1ND5A 1Z4QA 1W19A 4M0PA 5TJ9A 4C3ZA 1D2NA 3GDWA 5D00A 3K20A 5LUAA 1R0YA 1RHJA 4OUDA 1R0KA 2GPNA 4B5LA 1W4AA 2W4QA 4DLAA 5HQ3B 3D64A 1DWPA 3R44A 3A1TA 1ZGJA 1E6KA 2IP2A 3L7CA 1G3UA 1V3TA 1ZJ6A 2EFGA 2QNBA 3HCRA 4FR0A 4QUBA 4X7MA 1WKBA 2IELA 2XUHA 3B6ZA 3FF4A 4GI1A 4BKPA 3AVXA 3U7FB 4YRQA 4OKSA 5BOSA 3IRVA 4NK4A 5CA1A 2NVOA 3UK6A 2PXCA 3HU3A 5AVRA 2HTEA 2C2GA 5MN6A 1X94A 4BBZA 3I58A 4GP9A 3JAKB 2CNWA 3GJSA 3LXRA 2DY0A 5BWNA 5E9AA 5CVJA 3TUJC 1BRMA 2WRZA 2XB6A 4EM6A 3GJ4A 2FOIA 4NBNA 1XQ6A 2C7PA 1RHRA 1SBIA 2QT0A 5JDCC 4A5SA 1PKEA 2YQ4A 1SU4A 2FQWA 2Q4DA 2WU3A 5GGYA 2K7FA 1GPLA 2ATEA 1ODIA 3R6LA 4NFYA 3ZY2A 1RAAA 5GADl 3NC0C 1CJTC 2GZ3A 4F0JA 4IJUA 3K9NA 3MA0A 5K45A 3ZU3A 1ITZA 1NVFA 1QFJA 1PGJA 1DUSA 3DEHA 3PNQA 1I2ZA 3NBUA 4O4LA 3AUKA 4P92A 4W7SA 2BGUA 4LHZA 1QHXA 4AG3A 1YNOA 2IZ6A 5J3JA 1OBCA 1X1TA 3FSGA 4AMUA 4X6LA 1H05A 1SVSA 4QATA 1NNUA 2VUIB 4HEHA 3AR8A 4EB3A 2G9VA 2QRJA 1TK3A 1WXGA 1EQAA 2ZJBA 1OLUA 2GESA 1KDTA 4CG1A 1TGYA 2V7XA 1T0PA 4MCHA 4L6CA 1U2PA 3EVNA 1EKXA 2ZB4A 1O87A 4D26A 4LJSA 2Y66A 4NPAA 1MT3A 2EWWA 1KPHA 2J8ZA 4K46A 1RLJA 4U0KA 4ZK6A 5INTA 3HKEA 4UFOA 1OASA 3G02A 3AG6A 4PONA 2QU8A 4K2HA 1SOVA 3GFQA 3SYLA 1J1UA 3ZVMA 3N0WA 5K0SA 3O03A 3NEYA 2DG2A 3Q3VA 4FYWA 1RRMA 1OFIA 3VJMA 1PJBA 4BVJA 3F3KA 4U2KA 4JXXA 1YL7A 1VL8A 3SLRA 3TR6A 5J2UA 2P9GA 3BK1A 4LTDA 5EN4A 5GONF 5IT9A 1Z88A 4QOEA 1YBAA 3O8QB 2B99A 3N87A 1POXA 5LQNA 4MW6A 1AKVA 1YL6A 1YHZA 4XDHA 4ARVA 2HMTA 2WHXA 3IP7A 1KDZA 1ULTA 1ZXLA 1A7AA 1L0BA 3L02A 4CCAA 2UYHA 5CFOA 2BBWA 4EF4A 5GY7A 1QJCA 3I1YA 5IJWA 2VXOA 3DZIA 4DRYA 1BYIA 1V1RB 3DVRX 2MJLA 3L18A 5KOHB 1KZ1A 3DE1X 1PR9A 4GOXA 3X0DA 2BEWB 3I34X 3N05A 3TECE 1H8EA 1KAGA 3UUGA 4D6XA 2EDCA 2XKKA 1X8XA 1FS6A 5DK6A 2BM9A 1YK1A 3CM0A 3KU4A 3U61B 4DE5A 2AG1A 4RM2A 4RF3A 3FR8A 3ZGNA 3FPBA 2L69A 4WHMA 4N7BA 4DY6A 2PWPA 4WY8A 2PIAA 4R3UC 5EP4A 1E64A 3UT0A 5LSAA 1NR7A 5ABPA 3K1AB 5HJ5A 1JPNA 3F3MA 4M54A 4JS0A 1DX6A 4RK0A 1AGXA 1FTSA 2AVDA 1TJYA 1L5YA 3TSWA 1NXWA 1GN9A 2ZB2A 1UWCA 3OPYI 4U1RA 3RK4A 3UYLA 5BNZA 2E2WA 3QEKA 4R9VA 1JYSA 1U7WA 2JL1A 2WW8A 3BYZA 3ZE8A 3PQ5A 3WKBA 2BFDB 3G8DA 4WDRA 1KK3A 3PPXA 4TUYF 1XI2A 2ZJYA 2V9CA 3OBBA 1GCGA 2PT5A 3KLBA 4G0PA 4IS2A 3LL7A 2P78A 4OI4A 5EI5A 1PJLA 4BKMA 4MW1A 1UK6A 4ROTA 2X6QA 2GNAA 2I99A 4BNMA 2R7MA 4CJXA 1F38A 4Q9HA 3L92A 1H3EA 1C9NA 3GG9A 4DLPA 1NR5A 2W6MA 2XD4A 3A1FA 5CNIA 4RTRA 2XDYA 3E70C 1LFAA 5HX7A 2HPZA 3IXMA 2QYOA 3MSCA 4XA8A 1MN6A 1J7KA 4N47A 3JD2A 4GLBA 1KQGA 1PJCA 4UFNA 4FFSA 4PYQA 5KTNA 1GXSA 3FW1A 5D87A 1AGNA 2C95A 1JPVA 3HJNA 3EUAA 4ZZIA 1KZ9A 1XX6A 3KK0A 5B2ZA 3S8YA 3V7YA 1B3BA 2R7AA 4H7HA 1ESNA 2DFDA 3L6RA 1XEXA 3EUFA 1D5WA 2ZYRA 5DYTA 2HH9A 5ERGB 2GETA 3SIPA 1RQNA 4A16A 4F9EA 2QVXX 4IX1A 3TDNA 1RWVA 4LOIA 5EWMA 2DQKA 4PLZA 3DFFA 4WDQA 2IYFA 1FFBA 3DE7X 3OCUA 4NBUA 4WXHA 3IUQA 1QLJA 4DUGA 1REQA 3AJ8A 5C5CA 1XA3A 5KIAA 3WKEA 1TIBA 1JHMA 1AKQA 3V34A 2J85A 2Q28A 2VHVA 4NMMA 5DNAA 2CNDA 2QLFA 1TO1E 1PZGA 2F1KA 2P6PA 3LPAA 2QLNA 3LTNC 1PV1A 2Q27A 3I62A 4YCBA 4I4IA 5A7FA 3NM6B 4GM4A 4QNMA 3BXHA 3KRTA 2Z43A 2RHJA 2OECA 3MMZA 3IPXA 3QWAA 4H7KA 4IIFA 5PNTA 4E1BA 5KYXA 4FMBB 5CGZA 1CUZA 4HDRA 4PXSA 3VPDA 2ODEA 2W2XA 4A26A 4JLJA 3RQSA 2GCIA 1KH1A 2V96A 4IVNA 5JZVA 1N5MA 5HK8A 2YOGA 3CH4B 4MK4A 2TECE 4MIEA 4NNPA 2W9XA 3QEOA 2RK3A 3BWYA 2A92A 5G0WA 5JFTA 1KK0A 4A9AA 5BWOA 3OIFA 3C5WP 1XTRA 5CVEA 4KFTA 2PS9A 1T2CA 3BDVA 1ZRHA 4OIMA 1VCMA 3OHPA 3G0CA 5EUQB 5CB4B 2FRXA 4JNCA 2R11A 1YBFA 4KXWA 5AQEA 2O3RA 3FDZA 1KZHA 2QTFA 3P32A 3O3CA 5CDHA 3RAEC 2WV7A 5E6SA 2B30A 2HKIA 4XYBA 1C7FA 2R6JA 2OORC 4MW5A 2O0MA 1N5OX 1TMKA 2BDTA 2Q1XA 1SB8A 3SXPA 5A03A 4HR7A 1SCJA 4R2XA 1FVFA 3MINA 5DI3B 1ST3A 2JFHA 3A70A 4S2EA 4UHEA 1MKYA 2OXCA 3DQPA 4GOOD 1YMQA 2XXBA 4KN5A 4QFMA 5CM9C 3VJKA 4ZDJA 4JJKA 4YNBA 5L40A 5DBIA 3SXUB 2I80A 3QBEA 1V5IA 4HB0A 1L5KA 5LZ7A 3OWHA 4GNKA 3JCZA 4PGAA 5MHTA 1WO8A 4HFJA 4P0TA 3A1NA 4ZRNA 2B78A 4E2XA 2AXPA 3PNBA 5REQB 4JP8A 1QIIA 3DV0B 4P98A 5CG2A 1L5RA 1AY0A 2OUIA 5KQMA 1RP7A 3G9UA 5EJFA 3R6DA 5CGQB 5HM8A 2WSYB 3K72B 4AN0A 4JLMA 4ZVOA 3BMCA 4E33A 4J7CA 4XIJA 1IM5A 1Z29A 1O6GA 5DW3A 2G40A 1ZRMA 1MX3A 4US1R 5LOVB 3K1YA 3PICA 3C3KA 1F12A 1HY3A 1U8UA 1ZCFA 1UK7A 4F2HA 3H6HA 3L4SO 1EGAA 5SZJA 4O4IB 2Z6AA 3NIFB 1WXIA 5EOVA 2PQ6A 2Q3LA 4H6XA 3RU2A 3W90A 4P4SB 3IDQA 5TR9A 2VS1A 3WGOA 5CCBA 5BMOA 2IBTA 1U8ZA 4PZDA 2WD7B 1PD0A 3OJFA 2XVYA 2Y68A 2MMCA 1CR2A 4BZZA 3GY0A 4OB7A 1CUXA 3GLKA 4HLCA 1MAWA 1NUQA 5E1BA 3LUCA 1EMDA 2OHFA 3ZK8A 2WM3A 4NYMR 4RFVA 4Q1VA 5GJCA 5I3ZA 2H1RA 1J2UA 1NW8A 4MAFA 4O2BA 1OJ7A 4IJ6A 1LS6A 4KR3A 2CZCA 3FZGA 4Z51A 1MXHA 4M7PA 3CEAA 3M34A 2Y67A 3SHTA 2A9KA 2EERA 4HDNB 1T5IA 3KT6A 2PTHA 3KUUA 3MCVA 1J33A 2QL9A 4GPD1 4IIHA 2Q3JA 4HPWA 1Z07A 4JKOA 4WX2B 3QBVA 3VOAA 3I9NA 1E5TA 4AF7A 1JG2A 3GLTA 2ACEA 3CO5A 1RP1A 1SUDA 4QZVA 3VR5H 4YBZA 1JWBB 1O6FA 1UODA 2FWMX 2IOFK 2W0SA 3A27A 4HQNA 1YR7A 3LS2A 4GICA 4YHBA 4EHLA 1M1UA 2UXCB 4TUYB 3K8OE 2DH6A 1DEAA 2ZDHA 4HQOA 4U0JA 1KEEA 1ZCJA 2H1IA 5BW8A 5JNUA 4PNHA 3UAOA 3CKLA 1U04A 2GRAA 3WBBA 5LJIA 1UZMA 1K2WA 3ANYB 3LOQA 4IFTA 4JP5A 4OG2A 4RVHA 4XSVA 3MM4A 4MKGA 4G1UC 4QNNA 1R6BX 2SICE 3E3MA 5HCUA 2ZSHA 3GFVA 4BVAA 2BGIA 1P44A 3DOJA 3MJTA 3OC6A 4C7XA 1KL7A 3NC4A 3PPWA 2EG5A 3IOCA 4Z7NB 4LHXA 1GUAA 1GZHB 3HJRA 5FEUA 1S2GA 4OHPA 3PDCA 1F1JA 1J8QA 2J5RA 2ZIXB 1X0XA 4HGNA 3KTFA 1A04A 3IELA 4N5IX 2P6UA 5J47A 2ZXUA 3U09A 3GD7A 4J29A 4P7JA 3MD9A 2Q5EA 5AOCA 3T9EA 1FXWF 1NMYA 3EIEA 4TS1A 3UB3A 1IHPA 4BO1A 3D0QA 3ZD7A 3DLPX 5K0JA 1HE8B 1MORA 3D8BA 1GPBA 4F3KA 1YQUA 4RETA 3IT1A 2FSHA 4HMPA 1GEEA 5SYAA 5CA1B 3QXXA 3HCFA 3IA7A 3MC1A 5KYUA 1G41A 3CZPA 4JCCA 1D9ZA 1ECBA 4EHBA 2E37A 2C4NA 2A1IA 4TTPA 2QHXA 3KC2A 3HJGA 1I13A 1AZSC 1NVXQ 4EITA 5JAMA 3KJNA 4KG7A 1XU4A 3R5XA 3S7ZA 1DKUA 2Y0DA 5JZBA 1U5BA 2HAEA 5J4YA 2V54A 2QL7A 3KIPA 1YA8A 2VDOB 3PTAA 3EXEA 1G8KA 3OQ6A 4KX3A 4EFDA 5FYQA 3VX3A 3T35A 1IEWA 1UBEA 4Y30A 5D51S 4WADA 3V1UA 4A73A 2R44A 1RI5A 2I65A 2ZROA 3BD9A 5JSZA 1JVNA 3EIQA 2O0LA 4URYR 1E5DA 3TXYA 1EWKA 2FSGA 3RVMA 3DPIA 3NRBA 2P9TA 2OO5A 3D0RA 4QPDA 4TYQA 5AKIA 3WGHA 3G2JA 1DC3A 1WXHA 4A8PA 4O59O 1PUJA 4KW7A 1CUAA 2N9UA 1UK9A 4C88A 1LDMA 3LAWA 3JYHA 3N86A 2GO1A 4P5EA 4XB2A 5F73A 3SZUA 4DV6B 1OLUB 4ZXFA 2H1HA 4EYSA 3VV2A 5CXUA 2ECPA 1KI6A 1WRBA 2ZRNA 3SR4A 3EHEA 3E05A 3UCEA 2O05A 4PR0A 4RZSA 5HF8A 3ZDDA 2EGGA 3ZBUA 1YVRA 1RM4A 1ML4A 1ZUHA 1P1IA 2BGTA 4PRYA 1S3IA 1XRLA 4QSMA 4TKZA 3O82A 4EHFA 1N25A 1QLHA 1BMTA 1RAFA 3LIPA 4QIHA 4YRJA 2NYUA 3TVTA 1LZLA 2R8EA 4IR7A 3GVPA 2WAYA 5KTOA 5AVOA 1SUAA 4H6PA 4YONB 3LXXA 4W1QA 5CLQA 2HC9A 3FIUA 1A0OA 4KGDA 4MRMA 2LIVA 1TMYA 1PVOA 3RAFC 1WCWA 4U6QA 3T0FA 4BCBA 3I9MA 2LR0A 4HAYA 1BH2A 5AKLA 4O2RA 3G2MA 2OGZA 1WXQA 5DXAA 2IPXA 3A8TA 5G41A 2BGGA 2VJQA 3UJ6A 2WOJA 2DBZA 2MYNA 2QPAA 3KWMA 4DZZA 1P7ZA 1A8IA 3ISVA 2GEJA 2GF2A 1GPAA 2C3MA 3HR4A 4EGCB 1W0CA 4GOND 1XNRB 5HUJA 2XNHA 1QIGA 4J91A 2CVOA 5EMKA 4D43A 5DTMA 1DKQA 1Q0RA 3PLAE 5K3AA 3T7TA 4Q66C 4U6NA 5TXGA 1EFLA 4X6XA 1DOZA 5J4LA 3WK6A 4O2AB 1U63A 5GIPE 2V6JA 2XIQA 1QG4A 2IH5A 2HDWA 4IM7A 5D5PA 4GW3A 1TT7A 4ZHQA 4YJDA 4R6XA 5B12A 4ATNA 1RBQA 2FW9A 2Q0SA 2YINC 3GZNA 3JS5A 1PSWA 2WB2A 2PRSA 1K7CA 1OOEA 4D02A 2D5IA 5HWSA 3MTDA 2O2EA 4C4OA 3IURA 3DW1X 5ITWA 3KU1A 1DTWB 3NHSA 1JH9A 1US8B 1Z6XA 2VSQA 3AOGA 4PPNA 3OLWA 1RW4A 4PHTA 4WE3A 2A5YB 1SXGA 4MTCA 5EKDA 5DTEA 1WPQA 4KQHA 3PC6A 2EFHB 5C9ZA 1PD1A 3S70A 1EP9A 1IBCA 3KBBA 3QGMA 4X7RA 2HYIC 1KNXA 4Q4JA 4OKNA 4CM4A 4RFLA 1CY6A 4LRWA 4LRQA 4MGHA 3FPJA 1YR2A 2G5GX 1ZL2A 5EYPB 4PG4A 1KXZA 5IWCA 1N8SA 4C5BA 1CUJA 4FYVA 2JAWA 1G16A 2PPVA 1XFAA 1YFJA 3DUFA 1IE3A 4E31A 3SVZA 4ARBA 1U8EA 4HH4A 2JBHA 3KLPX 4YH1A 2RH5A 5I3CA 2BEUB 2DHRA 4MV0A 2RC6A 5F2OA 5JMTA 4O02B 1Z36A 2ECFA 5C7OO 1VG8A 4LA4A 1P60A 1U7XA 4XPZA 4Y9RA 5L6LB 4J6EA 1EFCA 3Q0IA 1BDHA 1E4VA 2FUG1 3FFAA 3NXSA 3VAYA 5K99A 4J07A 4PFSA 4QA9A 1N5RA 1U0NA 1GGHA 4XWAA 3WDKA 4EKDA 2PUGA 3VKFA 4NE2A 4HWSA 4EHAA 1TM3E 2QTAA 3C3EA 3DYIA 3FYUB 4MKRA 4X61A 4P35A 1VLHA 1USIA 5FO0A 4UQLA 4LBVA 1OXSC 5TARA 3IDAA 1ZS9A 3L8GA 4IJKA 4B0OA 4BP3A 4DEXA 1OTYA 2IJGX 3D8HA 1YULA 4TTAA 3G2HA 1WMSA 1XEXB 4YB8A 3L46A 1D1SA 3NTVA 4RA9A 3WHPA 2VDQB 3GPIA 4MW2A 2I55A 4ND4A 4F38A 4TQGA 1WKVA 3V8MA 4F5EA 2OXFA 3UMFA 4TOIA 1REQB 1NYRA 2CHQA 4J1QA 5CLIA 4OIFA 1MO2A 5K8UA 3KT3A 4GSLA 4N82A 5F9HA 1N8TA 1AQLA 1C0LA 2WICA 4M36A 1ZLXA 3BXGA 4PGMA 4RNCA 5BUSA 2VYCA 4GQIA 3A7DA 1HDXA 2L17A 2PX0A 1J7JA 1DAOA 3EEFA 1K88A 5IXSA 4NI5A 1QHIA 4MULA 3U1TA 4EYGA 3KVVA 1NWCA 3L1JA 4GKVA 3JPYA 5YASA 1G9TA 3WVNA 3TRIA 5BN5A 4L8YA 4HDRB 4KFUA 4XDZA 3UKDA 5CAEB 2GILA 1LJ8A 3CE6A 3GLIA 2YVAA 4YRDA 4DVGA 4ZVQA 1X13A 1XEFA 5F5LA 1DCMA 2ZRMA 4K8RB 5F3RA 3E27A 5BVGB 2HRRA 1XTIA 1I1NA 2PO7A 3NHBA 1BOFA 4RSRA 4B09A 1SXQA 1DT5A 3HJTA 3CLKA 3HSYA 1X7WB 3WQRA 5BNIA 4JX9A 4LJ6A 1BGXT 3D6NB 5SYMA 4TV8F 5ALMA 2O8CB 3DTVA 3K8QA 1PJ2A 1O8CA 2X5XA 3LA8A 1UANA 3N8DA 1QIJA 1XU9A 1XZNA 4G9BA 3ZWQA 5IASA 1WY7A 4RZXA 3IVXA 1QF9A 4P84A 4J03A 3DDZX 4F5WA 5KTMA 1FFCA 1BMFA 2P0EA 3VH4A 1GU1A 1XZQA 1T6XA 3ZHBA 5E6SB 2R0QC 2TMKA 1XTBA 3RTCA 4ZI2A 3FZEA 4UNNA 4Q7LA 1I7QB 1G6KA 3EVZA 2RB4A 1OD6A 1Y42X 3DOOA 5SZIA 4N4AA 1YS2X 4F85A 5CEJA 1L7EA 1T6BY 1N57A 1PI3A 3K1ZA 1XDSA 2A1TS 3AZQA 2AXQA 4PG5A 5BUQA 1X87A 1H65A 2COEA 2Q99A 1NW5A 1XB2A 2RKWA 5EIHA 3H9BA 4I19A 3WLIA 1XHFA 3CBQA 3FN4A 3P9PA 3AETB 1Y81A 1WUYA 2QN6A 4ESOA 1GUBA 1U8AA 3RVKA 4CEJA 5FA5A 3KQKA 1R15A 4CODB 1NN3A 4EPTA 4OLJA 2E0IA 1KI1A 4FOSA 4GL4A 5AHKA 2EVWX 5AJHA 2Q1SA 1Q57A 4R5HA 5LXTB 4BVKA 2AV6A 3LDHA 4YBRA 4YT2A 1L7QA 1UM8A 2D4HA 4RAOA 5F64A 1DQYA 3RIMA 1QRUA 3KLMX 1SHJA 3C6YA 4JD5A 4B7XA 3HY6A 2ZBPA 4X20A 3FYUC 3I2HA 4FSDA 1P1BA 2DPXA 2ZJFA 3CNBA 1YJ5A 5E95A 3H19A 5CHEA 5FO1A 3SJUA 1B74A 2XMZA 2JVIA 6LDHA 2O1XA 3PT5A 3BCSA 1XMVA 3ZHUA 5G02A 3ZXSA 1VRVA 2WWXA 2ZVDA 4HDQB 2IZ5A 3M3HA 2QKYA 5CDFE 1Z0ZA 1FXUA 2W2PA 3GLUA 5TQJA 1OAKA 2VA8A 2YJGA 3OZGA 3C48A 4JP1A 2MINA 3RLIA 4IG4A 2OHHA 1FTWA 4X44A 1AKUA 3BWDD 3O0TA 1SD2A 2EKBA 3AEYA 4UXJA 4GE0A 3H7IA 2GVDC 3F96A 3NATA 4HSEA 2GAOA 1A2BA 3QPBA 4R71A 2P1ZA 3HJBA 5KZMB 5CLFA 1N78A 2F64A 4PFKA 2X0DA 1LPSA 1YNSA 2E49A 2JATA 3AW8A 3VPXA 4XVCA 1LI7A 4DNPA 5K8TA 4FYKA 3STUA 1RI1A 5DFAA 3TMKA 1TW2A 3WXMA 5LP6F 3P4XA 4O2BB 3ZE0B 1GHTA 3SVLA 2DEUA 2VF7A 4LS3A 2RK4A 3AF5A 1AB6A 4RM3A 1IY2A 4OCZA 1WOMA 4EJFA 1ZX1A 1LK7A 3DTNA 4LSWA 1I7DA 1GILA 2G83A 1E3MA 4XLTA 3JQAA 3PFKA 4R05A 1W44A 2IYOA 4U8HA 3SZLA 3WBJA 2UYCA 2VDKB 4B3MB 2VPTA 1V8PA 4P8RA 1NI4B 1X7YB 2WT9A 4OD0A 2HOQA 3ZWXA 1LFDB 4PLPA 4NEHB 1MEOA 2DB3A 4G5XA 3A1WA 4ZREA 2FWBA 2H9IA 3OOSA 4MPJA 1E61A 3QFRA 1C4OA 4WOKA 5MN4A 1DAGA 1GL3A 4G8BA 2P8JA 2ZJ0A 2IYVA 4OAPA 3D02A 1KEEB 1G18A 2V6GA 1GPWB 3PC4A 2OLKA 4N1AA 3OFVA 1VPLA 3K4HA 3RSHA 4CBVA 3QKTA 3NPMA 3HK2A 4HQFA 1N2CB 3GGPA 3EULA 4XW2A 1TE2A 2XGSA 2ZB7A 5H3HA 3IIIA 1P0IA 1MA0A 2O4CA 1DC8A 3DR5A 1YQQA 4HDMA 3DW3X 3ZWCA 1NMQA 5KNCA 3Q9NA 3BJEA 1XPJA 1E2LA 2Y3IA 3BHJA 1JIUA 2W6PA 1S3FA 3AY0A 3FBWA 3NALA 1R8QA 4UNQA 5JWOA 5H16A 4CQMA 3UC9A 3I9FA 3ZWYA 3KYDB 4WXMA 1S3GA 2OENG 2REOA 3LJKA 3ZW9A 1MJHA 1WMDA 2F6RA 3P94A 4K2AA 3NT2A 3H2JA 2YMQA 3SSOA 3AI7A 2PMFA 3O4HA 3QPAA 3HB9A 2WSSA 4OP2A 2MCFA 1K7YA 1ONSA 4JITA 3HXPA 3RC8A 4LJ9A 4BRSA 2NW6A 5KYUB 5B6PA 1AU9A 1K9VF 4GI5A 4U7HA 1U3DA 2I2AA 2GR9A 2IEBA 2ZYSA 4FFBA 1JV2B 4NCHA 4Y0AA 1SCDA 3QVGA 2BTEA 3I5UA 1UUFA 1YZQA 1XJ0A 4RIGA 4MICA 4AJKA 1THZA 2BM8A 2I34A 2M1ZA 1ORTA 1PV2A 1U5BB 2JC3A 2DUWA 2Y1LA 3OFNA 3ZLJA 3EXEB 4MQEA 4MV9A 4JJIA 3T5AA 3TD6A 3IC5A 1Z38A 3QOWA 4JL8A 4DV7B 3AEUB 2GS9A 5KBYA 5AI9A 4WNAA 5JAUA 3HI6A 2VUUA 4LZWA 2CLSA 2IPAB 3G2KA 3Q72A 2RGYA 2NZXA 2QD5A 1XCBA 1Q7TA 1YR9A 3RS9A 4EG6A 1BFUA 3R3UA 4YREA 5BQPA 3ROTA 4WLOA 3NKLA 4RJ2A 4E7PA 1A8SA 3FHLA 1O0CA 4OAQA 4BJ6A 1QH9A 1IL0A 1XDDA 2G3YA 3HCOA 5CA0A 4LMPA 3T0GA 4ZD6A 1B0ZA 4BUZA 4L73A 2FQ1A 5DCLA 1MRZA 1MW9X 1U9ZA 2UUCB 2EG9A 1LSUA 2Q5FA 3NYIA 2HL6A 1T5OA 1SD1A 3CV3A 4DBLC 4PYRA 3HXOA 1BEUB 3BGVA 3CNLA 4FMPA 2FWAA 2XZDA 4MIOA 3TVDA 1Z2OX 2B6HA 3NT5A 3RRJA 3GX1A 2XNJA 2WHRA 3DLCA 3WGVA 3B9PA 3A3YA 3H3XA 3B1XA 1E6MA 1OILA 3W5UA 3IYLW 4MS4A 3O2JA 3PJDA 3I1JA 4ZQHA 4DGSA 5IU6A 3N8HA 3RFCA 3RVPA 1RCUA 1JHAA 4P93A 3QHQA 5FBHA 1RYYA 3MWKA 3DAOA 1AS2A 3F6RA 4ZT6A 3VR5D 3WWOA 3NANA 3UWDA 1F51E 1FU7A 3LYLA 2AXNA 5DRYA 4C6HA 1FYWA 4R2MA 4PM4A 1GV0A 3GV0A 3OQHA 4ARIA 1U02A 1Q50A 2IPNA 2CZQA 3UGTA 3T7DA 3Q98A 3FWNA 3BWVA 3HV2A 3WG9A 3QW4B 5AJXA 1E96A 1AQYA 4H7IA 1RPNA 4ZYWA 3NBFA 4DIDA 4RLSA 1EP2B 2OBYA 4OSOA 4IGEA 2DVMA 5FB3A 1T8SA 4LCJA 3N7AA 3IQWA 2WWTA 4DXHA 3TUZC 2XF2A 3RIEA 3OEHD 1D2CA 1SZDA 3HDGA 1SCAA 1FNBA 3JRNA 4TXLA 1NW7A 3QPDA 4YAOA 1V4BA 3PLNA 4ZHQB 2UAGA 3A4IA 3IQHX 5EQTA 5J59A 4L5BA 5EE1A 5D1HA 2WJIA 1KMHA 1Z6QA 3OIDA 4NCIA 3TRDA 4C3UA 1ISHA 3WIUA 5CYOA 2FZWA 4RCYA 3S5JA 1A9OA 2ZRQA 3OLZA 4UDXX 4E4YA 3A4NA 4JI3B 5AICA 1XL1A 2C5HA 2H59A 1E0KA 3E15A 3CUVA 4GI3A 4MGEA 3ODPA 3U4IA 4G3XA 4RYLA 5EE0A 5J2TF 5K0BA 1X1EA 3SSAA 1T15A 4DQUA 1DAEA 4Q4JB 1PFQA 2HB6A 4RZ3A 5IBCA 2IHNA 4ND1A 2XRMA 2BF4A 1NA5A 4JBWA 4XUEA 1JR4A 2WYVA 5HW0A 3FYHA 2NSDA 1ZM3A 2I2CA 3IP8A 1NOKA 3OF2A 1SKAA 2A9VA 3IAAA 1VECA 4ND7A 5E3JA 2Q62A 5A0TA 1T4GA 1CDZA 2Z98A 3X2SA 1ORRA 1ATIA 4JOQA 5DLYA 1D1PA 4JR2A 3T7IA 2J48A 1LRLA 1S2LA 1A1VA 4DCNA 4YAUA 3AESA 4X97A 3GRPA 4YCAA 2OCBA 4XGQA 4EG5A 2GK7A 3ETNA 1G7CA 1ABBA 1N2HA 3UAYA 2GN2A 1OY1A 3P9RA 5EA2A 4BU0A 2RCYA 2YYYA 5B57C 1J1ZA 4QGGA 5JEDA 4M98A 3ZCQA 5H80A 4F71A 2NO7A 4TSKA 3ANLA 3MELA 1BEZA 3NOQA 1Y33E 4EGQA 3EG5A 4Q9AA 4RA9B 4G6ZA 1R8YA 5AP9A 2YWEA 4DR4B 4QYIA 3RW9A 3WGJA 1OXMA 3I45A 1JQJC 2ID7A 4HUQA 4IMPA 1QH1A 2IIQA 4ARZB 5JV5A 2XZPA 1VL2A 1V0JA 4RV5A 1EWRA 1UFOA 3GR6A 1IHDA 3TQCA 4CTNA 3VPSA 3M3PA 3ZTTA 5ALLA 5EWJA 1CRWG 1QCYA 2QVYX 1Q19A 2EAUA 4MO2A 4U9HS 3SNHA 2LIPA 1YR1A 2X8WA 1W85A 3DBLA 2AOTB 3L8MA 1TQHA 1UZNA 1J06A 2I1WA 2C0QA 1YQEA 4BN0A 1DQZA 1VC2A 1I4WA 5KNDH 1Y3AA 1TC1A 3DZKA 1XAJA 2VK8A 4LJ5A 1WSAA 1DRUA 1ISJA 1TT5A 3MS2A 1ZNXA 3Q1KA 4YUWA 2ERXA 2HXYA 4UE2A 4O6VA 3W6OA 2CVZA 1U8YA 2ZJ8A 1UINA 1W93A 5UKDA 2JI9A 3T1VA 3T7AA 4ETNA 4PN7A 1FJXA 5AVUA 1LW6E 1MAUA 1UJ6A 4JBXA 1SHZA 2P9BA 1N9GA 4JK3A 1W88A 1UIMA 2QGFA 3NWOA 5L6MB 4B4KA 1MD9A 2P2NA 1YE3A 2P75A 1GJRA 2YV1A 3L8CA 3WIOA 4BV9A 3F4BA 4A2WA 3C97A 4DIMA 2JPDA 3ZIDA 2WJ3A 4O4HA 1EBFA 1RBZA 3GFRA 3DWFA 3I92A 4QU5A 2P79A 1G42A 3OM0A 4OMDA 2W4MA 4WLFA 5B7QA 4CLRB 3IQZA 5CIWA 4MB0A 4JGBA 1G0NA 3DQQA 2NVUA 1A82A 4QVGA 1WTAA 1TUGA 3O4VA 3U5TA 5KVSA 2AOXA 4Q18A 3WMWA 5T5QA 3FOZA 3TPCA 4RDHA 3R0XA 3TMAA 4LXXA 4ALNA 4EEKA 2H5LA 2X9VA 4IDPA 1SUPA 2YX1A 4JBIA 1KS9A 5AXCA 5K0FA 2PQ2A 1RWXA 2P9YA 4UM5A 1Z6YA 2JJ2D 5KYGA 1ZVKA 3GXOA 1W52X 4HX2A 2H1VA 4BEVA 4M1QA 1ZL0A 2GJ4A 4P3KA 4AN1A 4ZVSA 2V3CC 2BCJQ 1R5OA 1R74A 5D6NA 5DX8A 2FXIA 5SZKB 1R4NB 3SZMA 2WIKA 3ZGVA 4ZAXA 4C0WA 5JS8A 4EHIA 3TW4A 2X0FA 1ZGZA 3QZUA 2O2GA 4JXKA 5GZ1A 4WZAB 1SOUA 1YRAA 2FRVA 2KSQA 3UQZA 3L4EA 3QYAA 4YYZA 4ETMA 1IJKA 1IUOA 3RIGA 1Q3HA 1VYUA 3OU7A 4AF8A 1CDDA 1GD1O 2QWXA 1T3LA 2C2YA 3D3JA 4M9SA 1I1HA 3U4CA 3P45A 4DA0A 2FPPB 1YR8A 3HKCB 3Q8LA 3Q3JB 5DHTA 1VBMA 4RZ2A 1M3SA 2Y71A 3H0CA 3PE6A 2AJDA 5HS6A 3ZNQA 3C7AA 1NZFA 1NI3A 1RJFA 1I7PA 5CBPB 4Q9IA 1QTNA 5BMVA 2Y1CA 3TZLA 3L4BA 4D8TA 1CJBA 3WHLA 4Y0NA 3T3GA 4ZV4A 2NV0A 2FQYA 3QXGA 3VNRA 3QVSA 2V58A 2CC2A 2XMCA 4P3PA 3UHJA 2RIPA 1EA7A 2MINB 5LNK6 4RUKA 3PYMA 4BB5A 2XE8A 1JG7A 4B3DA 3WK7A 4N7JA 1QYDA 3QXJA 2QI9F 1VDMA 1KJWA 2VTKA 5JROA 2FFHA 1BFDA 3BRSA 5FP0A 1EUYA 1EHYA 5FD8A 4DBZA 3B8HA 1XBTA 2W4IA 2JLVA 3TIGA 1OXBB 4FBGA 4HFNA 1SUIA 4IJMA 4Y2UA 4WZBA 5T3UA 3WKCA 1QF6A 1YE8A 4UC0A 3TX2A 1O6BA 3I9LA 3KOZA 3UO8B 3UOWA 1EH5A 4CV0A 1NJFA 1WXWA 2ENUA 3SLKA 1UJ4A 4B7CA 1DPFA 3P0FA 5ER6A 1BW9A 4B6FA 1F5SA 3QBJA 1NMSA 2CJFA 3KEOA 1M2JA 2I2DA 3K96A 5DK4A 3A9SA 4K9RA 5A4MS 5KSYA 1L4HA 2Y1DA 3T1OA 4OOEA 1G17A 4AZ0A 3BXXA 2XCRB 1C41A 5ALJA 2GUGA 2C9CA 4QU8A 5J2TB 2ADOA 1UXIA 3BA6A 4BAGA 5AK4A 2G0NA 2UZAA 3K70D 1XJQA 3DOUA 3HLYA 4CM7A 1PW7A 3GP3A 3OSUA 2BKUA 3GJZA 1HEYA 1CXZA 1DIGA 1SXIA 2J1LA 4I66A 5IRCD 3R8FA 4QGFA 1P0MA 1WMBA 4K6CA 5HM6A 3RYCB 2G9UA 2JASA 3P71T 4M1TA 4R8RA 4XWOA 2JEZA 3AT1A 1UBSB 1R1DA 1FFXB 3EEQA 5KOYA 4HDMB 3I4LA 4IIUA 4OX9Y 1JU9A 5ER9A 2WA2A 4TYPA 2EQAA 3EVAA 3G2IA 1G19A 4NJEB 5EZSA 4TTJA 2Q45A 1KBQA 3EA0A 3OJXA 5I7VA 1Z2NX 1GQYA 3B36A 3HMQA 2XQGA 4B6QA 3WA7A 3DMYA 2XT9A 4A0GA 2EKDA 1BA3A 3BPSA 4GT1A 1NF9A 4D81A 4OTZA 2LP4Y 1VI2A 1DKPA 1XROA 2Q49A 4JT8A 4CR6A 4J4TA 2QTWB 1YUBA 4RY0A 2FEOA 2E21A 3K5IA 4PCUA 4QX6A 3V32A 2J3KA 3B48A 1PGPA 3GZJA 2IYYA 2D4AA 4J3FA 3L3BA 1T9CA 1T0HB 2ZI6A 1NXOA 4K5QA 1I4TD 3HXLA 3DJFA 2EBWA 1D09A 4L08A 3RLFA 1XMQB 3THWB 3T1YB 3H2KA 5EJAA 2QPTA 2WQ7A 4E09A 1Z37A 1NUUA 4M1WA 1VE9A 3I3SR 2G72A 4OMFG 4HD8A 4PAQA 3TLEA 2VJKA 2YYSA 1SM4A 4E2WA 5K6AC 2OC4A 3MLBA 5KHAA 4RORA 3RFUA 4YCDA 5ED4A 4WNAB 5DSTA 2Y1XA 1EGHA 1NQOA 4UAJA 2PR2A 2D1TA 3AF4A 3GJQA 5GZ6A 5IABA 1NNEA 3LZ6A 2HWKA 1NR1A 2VJNA 4KIWA 3CLSD 1D04A 2CDRA 5KQLA 1F8YA 3DONA 1GTJ1 4IIEA 4IVQA 1SHKA 1GZ4A 3L7JA 3BTSA 4G23A 2Q46A 4IIDA 1NHGA 4BEWA 3EXHA 4HXYA 3HL4A 4K6KA 1MGPA 2PH5A 2XCSB 3QF4A 4L5YA 3N8NA 1W75A 1WSDA 1MDBA 1RWKA 2AE1A 1JDZA 4NBWA 4H0CA 2B20A 4ID9A 3USCS 2JLBA 5H9WA 5CA0B 4WECA 1PX0A 1IMOA 4KSYA 3W2TA 2VSOA 5DJ5A 4CG3A 4GH5A 3MWEA 2EIHA 2XUFA