4S1WA

Structure of a putative glutamine--fructose-6-phosphate aminotransferase from staphylococcus aureus subsp. aureus mu50
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
336
Chain Sequence
VYAHYMLKEIHEQPAVMRRIIQEYQDAEGNLKIDQDIINDVKEADRIYVIAAGTSYHAGLVGKEFLEKWAGVPTEVHVASEFVYNMPLLSEKPLFVYISQSGETADSRAVLVETNKLGHKSLTITNVAGSTLSREADHTLLLHAGPEIAVASTKAYTAQIAVLSILSQIVAKEHEADIDLLRELAKVTTAIEAIVDDAPIMEQIATDFLETTRNAFFIGRTIDYNVSLEGALKLKEISYIQAEGFAGGELKHGTIALIEDGTPVVALATQENVNLSIRGNVKEVVARGAHPCIISMEGLEKEGDTYVIPHVHELLTPLVSVVALQLISYYAALHRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a putative Glutamine--Fructose-6-Phosphate Aminotransferase from Staphylococcus aureus subsp. aureus Mu50
rcsb
molecule keywords Glutamine--fructose-6-phosphate aminotransferase [isomerizin
molecule tags Transferase
source organism Staphylococcus aureus subsp. aureus
total genus 129
structure length 336
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 4s1wA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 4s1wA02
4JI5B 2CB0A 2UXDB 4LF5B 1GZVA 2VF5X 4LF9B 3J81A 4LF7B 2UUAB 4DV0B 1U0EA 2VQFB 4B3TB 1N32B 1JEOA 1NRIA 3BCHA 1FJGB 1IRIA 3ETNA 4JI1B 4LFAB 1MOSA 2DF8A 1I94B 4GKKB 1B0ZA 1XMOB 1J5EB 1WIWA 2AMLA 2POCA 2CVPA 3SHOA 3Q7IA 5BY2A 4LZJA 3M5PA 4YY3B 1X92A 3JAMA 4YHHB 1JXAA 2UUCB 1VIMA 2I2WA 1XMQB 3C3JA 4DV5B 1ZZGA 4DV6B 4X62B 1N36B 1U0FA 1XTBA 2ZJ3A 5A2QA 4DV1B 4LF6B 2PGIA 4IVNA 2E5FA 4DR2B 2UUBB 3LJKA 1HR0B 4DUZB 1C7QA 4DUYB 2F4VB 1KOJA 3T1YB 3Q88A 1VIVA 5IT9A 3T1HB 2WU8A 3IFSA 1N33B 3KNZA 2Q8NA 4JYAB 4JI2B 2PUWA 1TK9A 2ZJ4A 2X3YA 4M0DA 4TOIA 3FKJA 4DR5B 4GKJB 1G98A 1HM5A 4DR3B 1X9HA 1HOXA 1HNXB 4S1WA 4NXMB 2XBLA 2CXQA 3CVJA 3TRJA 2CXUA 2XHZA 5LMNB 1HNZB 4LF4B 3TBFA 2I22A 4X64B 2DECA 5LL6P 4DV2B 2YVAA 3BJZA 3EUAA 4X65B 1Q50A 1VI5A 1NUHA 4DV4B 4LF8B 1IATA 1M3SA 2V4MA 1HNWB 4DR4B 4DR6B 4JI8B 2O2DA 4AMVA 1GZDA 4JI0B 4DR1B 4NXNB 1C7RA 1TZCA 4B3SB 1N8TA 3HJBA 2A3NA 5LMUB 2CXSA 3G68A 2UXCB 2CXTA 4B3MB 4AQYB 4DR7B 4DV3B 2J6HA 1JIQA 2CXPA 1T10A 5I01A 3J80A 3OTOB 1IBMB 2E5LB 2VF4X 2PUTA 1IBKB 3ODPA 1N34B 4LFBB 1JLHA 4JI7B 3I0ZA 4JI4B 4JV5B 4B3RB 3JX9A 4LFCB 4JI6B 2VQEB 1X9IA 1IBLB 1DQRA 1MOQA 3FXAA 3QKIA 2UU9B 3HBAA 4KHPB 4U6NA 4OX9B 2CXOA 1X94A 2HHHB 1XNRB 3FF1A 5BR8B 3OOJA 3FJ1A 4K0KB 1U0GA 2CXRA 1MORA 3NBUA 5FLXA 1XNQB 3UJHA 1J5XA 4S12A 4JI3B 3PR3A 5IWAB 1TZBA 2ZM6B 2UXBB 2O2CA 2CXNA 4DV7B 3J7AC 1VI6A 4X66B 2PUVA 4EM6A
chains in the Genus database with same CATH superfamily
4FW8A 5KHOC 4E7OA 4KMSA 2PLNA 2GM9A 2JBAA 5AOBA 1AZLA 3CXRA 1DARA 2JJMA 4ZU1X 4ALMA 3B1YA 1N2SA 1KEPA 4FE7A 5AM1A 3ABZA 3ENKA 3QX7A 2ILVA 4FQ5A 5DEOA 3T12A 1SN7A 1SIWA 3G5TA 5AI6A 4TS4A 2ASVA 5JR3A 2ZCJA 2F4NA 4MB2A 3GJ3A 1UBUS 2BEWA 2G09A 4YRJA 1XCJA 1ST3A 1V48A 1IJBA 5BQPA 3KQKA 5AESA 5CLFA 4FQ7A 4GWGA 4V0KA 3RSFA 4AZ0A 5EJGA 2ZUFA 3RK1A 4YC7A 5EIXA 4H27A 1M67A 3NT4A 1U7TA 4G5YA 5JAMA 1E1NA 1V4BA 5DASA 3T9CA 4OK6A 5EJ4A 2GI4A 3OEYA 1RWMA 2OC4A 3O0TA 4HEHA 1X74A 1SVLA 3HYSA 3OZSA 4I6JA 4BQIA 5A0TA 5LQRA 1LLCA 4LRWA 2I80A 3AVQA 3SOPA 1WF3A 3BTSA 5JT1A 3DF9A 5K3AA 4HFJA 3L7KA 1RPJA 5I4BA 4DJAA 3KK0A 5KSWB 2RHRA 3K0CA 3AHGA 2PFGA 2Z6AA 1NVAA 2JCSA 2BFDB 2QK4A 2ZWVA 3KTDA 3EB9A 1XC7A 4ZRNA 1N5KA 3ICVA 3QEKA 1RZRA 3C87A 4OH1A 4AUKA 4PZPA 4D02A 2FPIB 3QU4A 3BXEA 5EIBC 2NPFA 3ROTA 5AJWA 5I9IA 1Y3CE 5CDHA 1BXRA 2YYZA 3B48A 3DGEC 3GW8A 5BWCA 3BSSA 1YB6A 2WPDA 4ZO8A 4Q4CA 1Z6YA 3ODGA 4EJMA 3A31A 1U3FA 1UEXC 4ENQA 2A7XA 4J6EA 1NSTA 1O96B 4MP8A 1NI4B 2ZI7A 3LKBA 3WRWA 4BFCA 1JAHA 3DVSX 3WGYA 4IBOA 1K6XA 2UKDA 3UJ7A 3FOFC 1L4EA 4MKFA 3I3OA 4XD2A 1WE2A 1KMNA 1RI5A 4LZNA 1N4AA 3B5JA 4F5ZA 4AJJA 3NBKA 1E5VA 4DARA 3WIUA 1XKXA 2GWRA 2X2OA 3GVPA 5JJCA 5LSAA 4BX0A 1JDUA 1PFYA 3AG5A 3BERA 2A5JA 3PD7A 4URXR 2COUA 3R3UA 3IB6A 5B1DA 3NTVA 4NWIA 1N77A 4UUQA 1HG0A 3OM0A 5BYKA 3HWRA 2IYRA 3BXOA 5BO5A 3HXTA 4DIBA 1Q92A 1DO0A 5HK9A 1U7HA 1Z56C 1TJ5A 1R50A 1VBFA 3QF4B 4GNRA 4HYTA 1E6UA 3AOEA 4QYWA 4HFRA 3U31A 3IO3A 4AJ2A 3HYCA 4FWTA 5LQDA 1HYGA 3IUPA 3FFAA 1ML4A 3PQ4A 2QTTA 3NC1C 1N1EA 1R0SA 3PQ7A 2Q3EA 4WXPA 1AS0A 1PS8A 1T2UA 3OQPA 1SVSA 1X7YA 4US1R 3RIXA 4EVSA 3AF5A 1F4VA 4WOCA 4N5IX 3LT4A 3HADA 2CVFA 2OZVA 3DCYA 4KX3A 1R6AA 1U2DC 3HEMA 2J67A 1D4FA 4L5CA 3R7FA 1KTIA 4U2BA 1OA0A 2I6TA 1BIFA 3LLUA 1EK1A 2C83A 3FWYA 3NRBA 5LVAA 4RGYA 4ZT4A 1CQJB 5ALLA 5TARA 1NSYA 2CFRA 1VP3A 3L8GA 5IAGA 1Q19A 1N78A 1QONA 3LQ4A 16PKA 3K70B 5ILQA 3KJNA 1XQVA 1NF3A 1CT9A 5FI0B 1XPUA 1Q91A 2QX7A 1J56A 3F96A 1UL1X 4EJSC 1WMDA 1EZ1A 5ITZA 2G1KA 2TMYA 2ADMA 2ZAYA 1PJQA 1OXXK 4QDOA 5FORA 4F86A 2FG6C 5ETJA 2J9YB 3FMVA 5DBHX 4IGIA 1L9XA 3B38A 4BP3A 3TX2A 3TR0A 3HXPA 4XM2A 1P18A 1PYGA 3H7IA 4M8KA 2BJVA 1KI3A 5BP7A 2ZPAA 3COSA 5AK5A 6AT1A 3AONB 3RFCA 3ER9A 3LX8A 2X4LA 1LJUA 1UMBA 1QF7A 2Y0EA 2FN4A 2FXIA 4ARZB 1W47A 1U2TA 3VHXA 4B6FA 3RADC 4OUDA 3MJFA 3NIGB 3GLIA 1EI9A 2F8LA 1VJ1A 2ZJFA 4B45A 4H1WA 3N6VA 3ET4A 4DMKA 5BUZA 1SO8A 1JFLA 3NZEA 3GLKA 1CUYA 4E31A 3KRTA 4NV3A 3ZBQA 5HMMA 5HQ3A 1KEEB 4E22A 1CR2A 2IYUA 4OLFA 5HHTA 2J48A 4R8KA 4QSHA 2WNHA 1F6WA 1NBAA 5FBRB 4YQEA 5BMVA 3E1SA 3M3DA 5H9WA 4KQ6A 4KMOA 4Z7JA 3KKKA 4J2OA 4R3UC 4TT3D 2XITA 5H02A 3WGLA 1N3IA 4ZDJA 1IHPA 5DHFA 3RG8A 4PNEA 4PW0A 3T06B 1MJGA 5AFSA 3V46A 2QRHA 1E3TA 3QXGA 1UDAA 4PS1A 3C24A 1R0BA 3CX4A 1H0KA 3M1IA 3OX4A 2Y6UA 3Q3GE 4RL4A 4WZBE 4YFYA 1KXZA 3K1AB 4OJTA 1KMQA 3L6BA 2PV0A 3Q7RA 2AD1A 1PJTA 2PGJA 1BJRE 3D0OA 4XGNA 4YJKA 5JNTA 2IBTA 5J4VA 1E2DA 2HMSA 3H04A 4TLCA 3VUEA 3F4KA 1BHO1 1L5HB 3PENA 4QLBA 2HCRA 1EFCA 4JVMA 4Z4GA 5LQCA 3CO0S 3AR6A 5DRTA 4BUJA 3VC7A 1A2BA 1NUTA 1P3DA 4F8YA 4OQMA 1EVQA 5CM8B 1CULC 3E2PA 3DR3A 3QG1A 3MGGA 3ZHTA 3HHPA 1CUHA 1LVGA 4HAWA 4CR6A 1OGIA 3RIYA 5C8VA 3UXYA 4LHWA 5L4NA 4H0NA 1F12A 3H9QA 5EJ8A 5CT5A 2FFBA 3T3PB 2BMWA 4IINA 4TZKA 4Z9XA 5EUCA 4DXDA 1B41A 3V9PA 5CEFA 1XXHE 1VI2A 2VUHB 1SQGA 3D6HA 3UK1A 1M0TA 2CLKB 5E6RA 3TLZA 5BV2P 1Z07A 2QEQA 1VZ3A 2QNRA 4MGIR 4HUQB 3WJ2A 2I1LA 4DC1A 2YW2A 2V7WA 2FWNA 4Q3EA 2C2KA 2GJ9A 2CL0X 4KXXA 5C52B 4FYWA 1JL3A 2VL7A 3FPEA 3ZDXB 1FMTA 1YBFA 2RJNA 4X84A 1JVSA 2C03A 2H8KA 4N0MA 3UH1A 3W34A 2I8CA 1PUJA 3DQZA 4FD2A 5DM60 4D41A 4Z0NA 1QE3A 4XRGA 3WK7A 5EWJB 1OR8A 1NM5C 4IHJF 4QYIB 4BFXA 3GJ0A 3UQYS 2UZ4A 3OEEA 1ZBQA 2QAGC 2Y2UA 1EFRD 1R4NB 2A0WA 3AEZA 3TZQA 4FB4A 4YI5A 1IXKA 2EKQA 3JVUA 1ZRNA 4AG5A 5JPDA 2EV9A 5CCXA 4A36A 2WFAA 2RHOA 4UM5A 3R7WA 2VK1A 3FKSA 5T8KC 4ZYWA 1BHSA 1ACMA 1DAEA 3I6YA 3PP8A 3SBOA 4RDHA 1E5DA 4Q3CA 1BVYF 1P0PA 4X94A 5GM2A 1LI7A 2J32A 4P1ZA 5A0FA 4IF6A 3W78A 1OC2A 5CJJA 4S04A 3KZVA 3PRHA 4DJJA 1FS5A 3LHSA 2DR0A 1J8YF 3QA3E 3O26A 4KZKA 4KJZA 3MCTA 1T9GR 2YVUA 3ON5A 3QUTA 1OFIA 4Q34A 5B4VA 5JBQA 4JK3A 1FP4A 3GDOA 1ZR2A 2ZPTX 5EI5A 2GN4A 1M2OA 2AXQA 2ODAA 4J4BA 1YS4A 4MUHA 4EGCB 2C0PA 3IR5A 1XPOA 1ENPA 3IBYA 4J0CA 3JD1A 1M8JA 3AJEA 4Y9UA 3UFXB 2JD0A 4CM4A 5JAOA 4KTVE 3V8PA 2AG6A 3FGOA 1Q1ZA 4AICA 1VCOA 4N03A 4CEJA 2E4AA 3WX0A 3EWNA 4D4IA 1SIBE 4JJ8A 3VV2A 4MCIA 4OOFA 4FHCA 3D7KA 2YIJA 2YW9A 2CFCA 4PWYA 3G8CA 5AI9A 4L8FA 2XD9A 4OFZA 1ESCA 4WESB 4GPD1 2ORYA 3HP4A 4H59A 1CEXA 4R9NA 1ACJA 3JZAA 1RC1A 3CZPA 3EUWA 2AKYA 4AKIA 2FRDC 1J20A 2QT1A 3BMCA 3NBQA 4R41A 3UV7A 3E7WA 2OQ2A 2HQOA 2VF2A 1ZX1A 5MF6A 2FMIA 4PQFA 2R47A 5B5SA 1Y6JA 3DBHB 3EGCA 3UV6A 1WCIA 4TL8A 4TZTA 3DCIA 2GPNA 2WJWA 3R9IA 1TT5A 3WWYA 1RQPA 4E13A 5LZ9A 4Z4QA 3PC7A 2F1JA 4EYQA 1G98A 3KDPA 4EJSA 2MMCA 2HIMA 4PCLA 3IEUA 1E92A 2GHQA 2N47A 2PSDA 1UXKA 1U2PA 4JROA 4WNYA 5F78A 1ZJ4A 3AP3A 2RHBA 2CMDA 4G0QA 5DCWA 3BQMB 3DT6A 3ND9A 1XROA 5FRDA 4ZD6A 3U7JA 1A5TA 1DADA 1NW5A 2QAIA 1BSVA 4X64B 1TD9A 3V4RA 5DX8A 4JJ4A 3GLGA 3VR1A 2GPYA 4B3CA 2EBUA 4XTCS 3WXBA 4R1MA 3T35A 3AI2A 3D6MA 2FN9A 1JHYA 3OJEA 4O4JF 5AVYA 3TLYA 3UMRA 3STHA 4A6DA 1OGYA 4F9GA 1IM8A 3KQHA 1QSGA 3ZZNA 4IDOA 3TSZA 4KXMA 2DEUA 1LXCA 3VVCA 4EF5A 3N75A 5DGHA 3HDGA 1LDMA 2WDPA 3NKVA 4LZLA 4Q48A 3WLRA 1GL3A 4R1QA 4RJ2A 1YMVA 4K87A 4AAYA 1SCAA 2UXCB 3M81A 4MVJE 2HO4A 4BXOB 1DUIA 3R3ZA 4JQYA 2EWVA 3G2PA 4J4TA 4UM9B 4QVKA 3PCRB 4CTNA 1SNYA 2O2YA 4HRAA 5HBGA 4LYAA 1G9XA 5DTQA 4EG1A 2YOFA 3LYAA 2Z56A 3WYFA 1JDBC 4NEHB 3VC2A 1B6RA 3HKEA 5FPKA 4UU0A 3AEYA 5C5DA 4TTQA 1UJCA 5FOTA 1UAYA 2CNWA 4XSHA 1E3SA 4OQQA 1D9ZA 3F0TA 1ZJYA 4GZMA 1FP2A 3CLUC 1FXWF 1QJ4A 1TCVA 3F5FA 2I2FA 4IGKA 3L79A 3CVOA 1VL1A 3CZ9A 3IYLW 4R8RA 3BWDD 2X8LA 1Z73A 2HLDD 3MCWA 5E1OA 5HGJA 3ESQA 4DSUA 3WIEA 4D7AA 2CXNA 1RMTA 4BVEA 1J0XO 1K8QA 2BL4A 1RHUA 1D4OA 1R10A 2NU6B 2RK6A 1VJGA 1L5NA 2F3TA 1CUAA 1E5TA 3LHDA 5JANA 1D9XA 4WHMA 2IYFA 3EMBA 2QRGA 3L4EA 2VF5X 4I36A 2J33A 5CTAA 2ZXFA 5EE1A 4XAQA 5GVSA 4ARBA 1XDUA 3ZXYA 4DC9A 3AK4A 1DX4A 1IDOA 2IYEA 1UZAA 1JLLB 4C6TB 3E4CA 2WILA 1QKIA 3O90A 2JLZA 3DXYA 2QQ0A 2NZ8A 1ISHA 1XK6A 2AWNA 2O8FA 3ESZA 3X2SA 1P3JA 3TW4A 3FF4A 1EBFA 2E6KA 2XOKD 4FFMA 1BWPA 1FNBA 2ZE8A 3DZCA 3OPXA 4GMKA 3T7AA 2VLBA 2ZRHA 3EXHB 2PNFA 4IEFB 4NZOA 1VGRA 3DNFA 2UUPA 3QPBA 1HE2A 1N0HA 2FDXA 3OLYA 1YUNA 2R7AA 4PQEA 3X2FA 5LFAA 3E1GA 5HIKA 1K63A 3B9RA 1NM5A 1DXOA 2OD9A 3FE2A 1WVMA 2P0EA 5LZ8A 5HF9A 4BNLA 3E15A 3NW9A 1VYUA 2FEXA 2I7DA 4NJMA 4BCBA 3TNJA 4CIWA 3OD1A 4L5IA 3TM4A 3TRDA 4B6JA 1COWA 1OROA 2ZPUA 4QAJA 1XAJA 3LVFO 1KYVA 4ACBA 3KQWA 1NP3A 2HJGA 1FMFA 4LQ4A 4WXHA 2GSWA 1ZUIA 4MICA 3UUWA 5KYYA 3DBOB 2QTHA 1KMIY 5I9MA 1GTRA 4QT4A 2V7EA 3LQQA 1AKQA 3K8QA 5FTNA 4NCBA 2R7NA 3BMNA 4RD1A 5DYYA 3FTNA 3RRNA 3IJPA 1D7OA 5TJ9A 3RYFA 5DU2A 5CNKA 3OBIA 3C6BA 4US0R 1FUIA 3DMTC 4JEHA 5G0UA 5DOZA 4ZWNA 4AZSA 1UBKS 1YI8A 4CF3A 4ZAFA 2PZJA 4TKVA 4G0UA 4EG3A 4JUDX 2OG2A 3ZJUA 3U4QB 3FHLA 4Q9DA 2R2GA 3M6IA 3GMSA 2A0KA 2GESA 2HCBA 2QVZX 3A1WA 3EE6A 3KQOA 2FY8A 3PFNA 5PNTA 4OXXA 3QXCA 4AJIA 4NRDA 1MB4A 3MS2A 3RVKA 2R0QC 1ZR4A 2Z1MA 3FZEA 4QPCA 4DVJA 5BNWA 1OXTA 1MRZA 2PKYX 3CUVA 2JBHA 1YE5A 5BSGA 3NNDA 621PA 4YAWA 3TTVA 1NHGA 4PLWA 1WRBA 4OXKA 4G8DA 5K0JA 4XWGA 5JD5A 2DB3A 4B40A 3FUTA 1FDOA 3QFRA 5TNXA 4NABA 2FRDA 3R3HA 1ESDA 2F64A 2YCLA 2WYHA 4OBBA 5LBUA 1IULA 3AHFA 4CEIA 2E49A 1H8EA 3MW8A 4LHSA 4EG6A 2FSVC 5IBCA 3U7IA 3ZCQA 5E2AA 3A8TA 3FSGD 4I14A 5HVNA 2XT6A 2HHAA 3VKGA 3GLFA 1Z4KA 3CUUA 4G67A 3WFIA 1WTAA 4M1ZA 1C1DB 4J0KA 4CF7A 4IOJA 3OPYI 2VVTA 2RB4A 1EVEA 3LXUX 2ZM6B 3LUJA 2J08A 5BV0A 7ADHA 1WMEA 3QBTA 5LLDA 2BFNA 1QU3A 4B7UA 1IM5A 1JR3E 3OHSX 4DRXA 3PQ3A 1SCUA 1ZW6A 5U4XA 2ZB2A 3MSXA 1G8KA 1Q12A 4B33A 4K86A 4BLOA 1E4EB 4GMDA 2BHLA 2CCGA 3C3DA 3CHYA 1BKDR 3KV3O 2MSCB 2GKGA 3I0NA 2Q45A 2AKAB 4XD7D 2BONA 3PIDA 1QGDA 3PGJA 2XTZA 4L8LA 4DCCA 5KQMA 2X0EA 2QVYX 2NNLD 3G0DA 4RZQA 4UM8B 3UANA 4YT8A 5FUQA 5LXTB 1FW8A 1I10A 1M2HA 2WP0A 1L5LA 5DLQC 1PQYA 3RE1A 4KOAA 1MZPA 2IEBA 4IFTA 4PSVA 5GOZA 5ICCA 2P6OA 2VYND 3SXPA 2PS1A 5D8DA 5THQA 2AXEA 2MCFA 3HY6A 3C6XA 1X77A 3PDIB 3GAMA 5GIPE 4OPMA 3A4MA 1YZTA 3TQIA 3X1WA 2AW5A 4IQ4A 4NJEA 3PLNA 2IZZA 4NL4H 2Q1XA 1I13A 3UOWA 5I3CA 3HM9A 2VJDA 4MI6A 4AW9A 3W7AA 4JNKA 3GEEA 4KYUA 3RVQA 2PMWB 2AJCA 4R69A 1NXQA 5L7YA 2PMDA 4KP7A 2WFZA 2BM8A 2OO5C 4V1CA 3I2HA 4U7JA 4J91A 1E9DA 4WOJA 3N2GB 1DRWA 1Z2NX 3P8ZA 3RF7A 1CE8A 5K3BA 3SF8A 1AKWA 4RJLA 1XYYA 1DDIA 1XDGA 4CN9A 2JVIA 2AFIA 1MXHA 1KDRA 1UQUA 4MA5A 4DWWA 4OP2A 3H18A 3EIWA 3FSEA 2CSUA 1J0BA 1HT3A 4B4KA 4JLUA 4CM3A 3ZDDA 5FO1A 5FLKA 3I76A 4KPUB 2H9YA 3W2TA 1I7SB 3AIIA 1Q0RA 2VZ0A 4QODA 4L74A 5JAHA 4CL2A 4LF4B 3N70A 2FQQA 4IMRA 3FTQA 2IHVA 2ATCA 1Q50A 2GJ8A 2QTBA 1FDTA 4B35A 1ZEJA 2IX9A 4KRXA 4DPMA 1W34A 1RM5A 3AZOA 4YCSA 2YOGA 3U0VA 3N3BC 4X20B 2QV0A 1FTYA 1Y0BA 4KQHA 4D9BA 2VDKB 1II0A 1MDFA 6ADHA 1SQSA 4K6CA 4Q02A 5FTWA 4O4LB 4BFYA 2IOQA 2H7XA 1NU6A 5NLLA 2E18A 3A7DA 3RAJA 1GL9B 1GUFA 1TU0A 5A7FA 4RXTA 1O9BA 2ZYWX 5K3FB 5A0VA 1WPXA 2Y66A 3L0SA 3MOSA 3B5EA 1JQBA 3NUGA 4ZV7A 2BHTA 3PWZA 3DHVA 4S1TA 2FRXA 3O1IC 2UU9B 1E59A 1HI9A 3NYIA 2Z58A 1YE8A 1APBA 2G4LA 3RG2A 1WP4A 4FGZA 3AIKA 2P6NA 2X8JB 1ZEMA 5A6SA 2O8CA 4IKOA 1Y89A 5G4KA 3CE9A 5IEBA 2ZSHA 3HNOA 3SBDA 1XLWA 3RWOA 3GVXA 2ZIFA 1Y98A 4KNWA 3L8YA 3G0GA 2KWIA 3BXXA 3CRZA 3DVQX 3L0OA 4GGMX 1YOVA 2EEZA 3X0DA 1WBBA 2P69A 4KC0A 5F5NA 3KT3A 1V6AA 1XZMA 2P4QA 3RQSA 4HMPA 4GDFA 2W2KB 1WNFA 2A4KA 1JR4A 4YROA 5ILGA 3C74A 3RKSA 3TW8B 1J25A 1SXJD 1QZTA 4GRIA 4HI0E 4YMSA 1U81A 2V9ZA 2ZVDA 1TIBA 1I4LD 3DMTA 3E1KA 3PBKA 4WCFA 5EKSA 4Q7QA 3NX4A 1EBBA 3DHWC 4I55A 1GN8A 5FBQB 4AJEA 1ZWLA 2BDTA 1XE3A 2HXSA 5ARDA 1XQ9A 1WXGA 2I0FA 1XDZA 3U7QA 3FYTA 3BCHA 2ENWA 4GI7A 5TMBA 5BR7A 2A33A 2IUFA 5F76A 3IDAA 2EFJA 1I3LA 2Q1SA 2ZRPA 2GKSA 2POCA 2B3DA 4JHXA 4YNBA 2IYTA 4CDRA 4CLRA 3E7DA 1V11B 2VCEA 1T8WA 1SBCA 2AI2A 4LA4A 2WWWA 3PX2A 2AG5A 4YJHA 4I81A 5J5CA 1NNSA 4IQ0A 1XMQB 4E1AA 3HY3A 1Y37A 4MWBA 2TS1A 1QLWA 4TT8A 3M5CA 1A9YA 4JBLA 3IOBA 4GU5A 1V16B 1ATZA 2YASA 3FUCA 3C3BA 4FE4A 1N5IA 4C05A 3KD2A 1LFDB 3ENVA 3JWHA 4QQFA 5F2NA 5F98A 2FSVA 3NNSA 4DA6A 1XQYA 3HA3A 3JQ8B 1TF5A 4P4TA 3U44A 1M6EX 4R1UA 2GHTA 3I9JA 2PKWA 2Z4RA 1OWOA 3N2IA 2DFLA 3PQCA 4QTTB 2PQ2A 4LTDA 2POQX 4OHZA 3JD3A 1JEQB 1LDYA 1VTKA 2PCJA 3DOJA 2ZULA 2BUCA 1SQ0A 1VDZA 3LP8A 3QJGA 2C59A 4BDSA 3KJFA 3G2KA 2Q4EA 4B74A 2UZ3A 4C5AA 2WT8A 4OHKA 1DAGA 2EP8A 2VPTA 1GRCA 4S1WA 1LLDA 1YS1X 3SG0A 5BYBA 3SZRA 3V8EA 4P3PA 2BKXA 3L8EA 3TTTA 4P7KA 1Z39A 3KAPA 2XVZA 2F3QA 3HXMA 1CRPA 4JC5A 2X9QA 1VCHA 2EKPA 4AI6A 2HR1A 3UVEA 4HZUB 5ALZA 1NMQA 2EBWA 4LHVA 1RQRA 2NXEA 4MQEB 4RY0A 1ABFA 4QASA 3ZZMA 1E8NA 4WN9B 2YJ4A 3PUYA 1CYDA 4LC1A 3S2YA 4TYWA 4C3UA 2FUKA 1NW9B 3ELUA 2J5RA 1INLA 2XYPA 1QQ7A 3R6LA 5IM5A 4ZCPA 1E1RD 1RBMA 2ZKLA 3MT0A 1WVIA 3RIMA 5J58A 2Q3BA 4I50A 1CQXA 4ZV9A 5JCXA 1YC5A 5KNBA 2E5LB 4C1NA 1DIAA 4ZPXA 4ZAYA 4I5EA 3P2YA 3BYZA 2IKQA 3OZCA 5B4TA 5EJ5A 2TECE 4GEKA 1NXSA 2G63A 1KI7A 3REGA 2HJ9A 3CA8A 1T9DA 1R6VA 2ZRNA 4RVSA 5DM2A 3ZBUA 3I5XA 4EMBA 3ZDAA 2PU7A 3LQ1A 1F17A 4KFCA 1P33A 2O23A 1C9KA 4KQXA 4QE3A 4WZBB 5JVDF 4ZEXA 3JQBC 4XDYA 4B3XA 1OH5A 1E8DA 3RU9A 5AMXA 4TYYA 1KZYC 4OYYA 4KXVA 3R9WA 1FDUA 4MR7B 5IJ0B 3DKRA 3UATA 5KINB 1SCJA 2CFIA 2DPLA 1G17A 3TFQA 3VR2D 1B26A 4MPJA 521PA 4QHYA 4MS1A 2XTMA 2A35A 3UJ3X 1LJLA 1A69A 4GAEA 3B3GA 2PV7A 3CLTD 4MAFA 4YWHA 2BHSA 9ABPA 4JI5B 1DBRA 4UQLA 2Q4BA 5F5XA 1SU8A 3V7UA 4Z51A 4XCXA 3A6JA 1S8FA 1TQHA 3AL3A 3ZUGA 2QJOA 4HWTA 4F1JA 1EVLA 2M98A 3DZGA 4ETMA 1C9JA 1FYEA 1XXHB 3AILA 2Z4TA 1P6UA 3KUKA 4LHXA 1QBGA 1V4NA 3B78A 1WB6A 3HI6A 1JHOA 3DTYA 4ZJPA 1VKRA 1TEHA 3BXZA 3CX8A 5ALJA 2AOXA 3WNCA 1E8MA 1YZHA 2O50A 4ALKA 4GOLD 2BGUA 1QO0D 1F6BA 4FKBA 2I67A 3OM1A 4NE2A 4QAQA 4IVNA 3NP7A 3UJ6A 1O4VA 5AW9A 1N2CE 3KKZA 4BWVA 1MD9A 2YV3A 1QPZA 1PT7A 1WS6A 5C3MA 2ZT5A 4DEYA 4RSRA 3SM3A 2PR2A 3EQ9A 1OWMA 3UT5A 3ZDZB 4ETIA 2I33A 1SGWA 4U2EA 4P53A 4E51A 2Y3IA 3KOUA 3VPSA 4DLBA 3A9CA 4LY0A 4NAHA 1EJ6A 1VRCA 3ITDA 1UT8A 5E6SA 4EECA 2C9CA 1RKQA 2R8BA 1LRKA 4XSGA 2OV8A 5CFMA 4B4DA 4M3NA 5DBIA 3VGJA 2JI9A 4A10A 3DR5A 1SH7A 1X80B 5FWXB 1Z38A 3BH0A 4TWJA 2VJPA 4B73A 4C0WA 4KDFA 1L2TA 1VKHA 2E21A 1M83A 1VB5A 3EIOA 4L22A 4Q00A 4ER6A 3DFFA 5EPOA 4MH0R 2K87A 4KR0A 3LCMA 4PX3A 2C3OA 3HFGA 4GQIA 4BJ6A 2ZJBA 4PSKA 1H1TA 2WIAA 1L4GA 5REQB 2PRSA 4JEIA 4N8DA 1HYEA 4DV4B 1PWEA 3ZWAA 5MN4A 3U4IA 1RWPA 4TMYA 2AN9A 3WBBA 3WNBA 5EPUA 5BSWA 1NNI1 4EZEA 4G9GA 5CIQA 1H0HA 4QTZA 4PICA 1JTFA 3ZLVA 4F8EA 1ISSA 2D3TA 2OFWA 3ZNOA 2GEFA 3ZJTA 1BA3A 2HY7A 3PT9A 4YUYA 4ZMSA 1RAIA 1SHZA 3V00A 4ASUD 2OZKA 2YMQA 3A6ZA 3UO8B 2G5PA 3QVWA 2GARA 3L41A 1MW9X 1X7DA 1EK2A 4EVQA 3EXEB 4BZXA 2PS9A 3ZWYA 3KT0A 5LP6F 3QE3A 2ZE6A 4IJWA 4LXGA 4DM3A 4EFNA 2CJFA 1MIOA 1PG5A 1NE7A 2QLTA 4KE6A 2CKDA 1T0HB 3WNDA 4HHEA 2Q4RA 1ELOA 2E85A 2R97A 4MLPA 4NCIA 2VBIA 5IDVA 4NQRA 4KEAA 4KE7A 3AUAA 5K99A 4H3KB 2I2CA 3ZWQA 3KOMA 1F2UA 1ZD1A 3MJVA 3N39C 4RV5A 1LNQA 4HDNA 3WLJA 4YA6A 1VMAA 4NLLA 1NJ8A 1PTJC 3AXTA 1FCJA 3M4JA 3R5FA 4XDHA 4RJKA 4CKWB 4L5JA 3GLIE 3QPAA 4PYMA 1GJRA 2CZCA 2R79A 3FMPB 4JLJA 2GR9A 3OF2A 3R6DA 2UXDB 3BIJA 1CNEA 2MINA 3PICA 3W7BA 3G2LA 3T7IA 1U1IA 2BCGY 5JU6A 5LD2B 3N8KA 2VTBB 1E79D 1FTQA 4A9AA 2ABWA 3L1JA 3U9LA 1VBNA 2YKGA 4AZ3A 4LFAB 2DF8A 1JR6A 5FPPA 2GERA 1E9SA 1R6DA 4FSXA 2G9RA 5DVZA 5FUVA 3RFUA 2BKEA 2IYPA 5C80A 3A3KA 4LBVA 1O0CA 4F2HA 4RS3A 4YUWA 1A98A 3FNBA 2JJQA 3MTAA 3L7BA 1CUBA 4PPFA 3ED1A 3S5JA 3TD9A 1RRCA 2PYIA 1RYYA 1QAQA 1YL7A 5C4GB 5A1TA 4ZEVA 2H9AA 4I8XA 3ZV6A 3VA7A 1UM9A 5EWLB 4IV8A 2YJZA 2QX8A 2XUFA 2CMKA 2I3DA 3JQBA 4X7RA 4KUHA 1W0KD 4XUCA 3G0CA 2XMDA 2GVNA 2P9JA 3VYVA 2FPKA 4ZHQF 10MHA 1TZMA 1MGOA 4F4HA 4F3TA 1UWKA 4H9GA 4Z54A 1J22A 3MMNA 2FZGA 3LQKA 4UFOA 5ECGC 4B6PA 5EWMA 4E5UA 4Y2YA 4ZVRA 2O3QA 3RFFA 3G1TA 3HK2A 2IIVA 3EAQA 1Z4IA 3CSSA 4M21A 1OPXA 1N2JA 2L18A 3GT3A 3P9XA 3B6KA 3WMWA 3L6CA 4GBED 1AH2A 4G41A 2P9FA 4NONA 3T5CA 4LI3X 3U81A 4BQQA 4QFBA 1H5NA 1QFMA 2ZSDA 1JR2A 4UAGA 1C9NA 3OQBA 5IPFA 5JFOA 1RTKA 1U0TA 2IGBA 1RJGA 2NTYC 2VEDA 1U65A 4XYGA 3N86A 3IRVA 3QEAZ 2QR5A 5TPZA 1JJ7A 3UBTA 1RLJA 1CB0A 3ADDA 2QQEA 1SBQA 4PANA 3K0AB 3PUXA 4UHEA 2PKQP 2W2OA 2HU2A 1G3UA 1NNEA 1E89A 2RGBA 3STXA 3DZKA 3VZBA 1NVDA 2Q6VA 3GUHA 3I83A 1R4MA 2EBHX 4LC0A 4NCHA 1LV7A 4BNGA 2HK8A 3BD6A 2GAJA 1W48A 2PRKA 2VQDA 1EFLA 3FDZA 3G9ZA 1ZNZA 4UJ3A 1MJ5A 3ZY5A 4QTXA 4BMZA 2FGJA 3W9UA 3SIPA 1FMJA 3ONFA 3SM9A 2JA1A 3VKUA 4Z49A 5K7SA 5CYOA 4GSYA 2C5FA 3KXKA 4L07A 2Z2IA 2PAAA 3GPBA 1L7OA 2V96A 2VHYA 4ZAZA 1LWOA 4QYSA 5EQFA 2QU8A 4NOJA 3UJPA 4IJ6A 1E69A 2W70A 2V7VA 4DWOA 4B3RB 3QU5A 2PA0A 4A3SA 1OTXA 2ZBPA 3HEBA 4RETA 5BN4A 1X39A 2R5NA 4IH4A 1NY6A 5JS1A 2HZBA 5K0CA 3LUDA 1M2JA 4OBEA 3O0DA 1F8UA 2GEBA 1WUJS 1A8PA 1J8MF 3F4BA 1NQUA 1ID1A 3SC2A 1LTHR 1GN9A 2X4GA 4MP3A 2RHWA 1XIVA 3MGCA 4BJ1A 1KS9A 5GAJA 3KSRA 3UPDA 3VKFA 4TQGA 3ZQUA 4AJLA 4DDTA 1KWKA 1DO8A 4W5HA 2WSYB 4RTKA 4R9UC 4WXYB 2BI4A 3QYPA 2IPMA 1RYHA 2O9JA 2I4OA 1JFSA 1AXRA 2Q29A 2DAPA 2J9RA 4C1BA 3GLVA 4M6WB 3EEIA 1UJNA 1W96A 1XHLA 2WABA 5E7JA 5SZHB 4NI5A 3WC4A 4YFVA 1DGQA 4EY7A 4LW8A 1YZFA 1S2GA 4PINA 2CV0A 2WJ3A 1N32B 5FBWB 4CF6A 2GF9A 2EX4A 3C3WA 3CPJB 3S8YA 5JQGA 5E4JA 1YZGA 3NWBA 3NTRA 3VXKA 1U1GA 4PCAA 4BEWA 2IYNA 2PVCA 2X14A 3DUFA 2D2IA 4FFSA 3KJXA 1O6FA 4FMCB 1KVRA 4H1VA 5A05A 1O58A 3KUXA 3GVIA 2Z43A 1X86B 5E4TA 5LOVA 3N8NA 4XH9B 4DRZA 4WFJA 3RAEC 2UVQA 1LSOA 2VQ3A 2O0MA 3CSDA 1YZUA 1W1UA 4W7HA 3ZYCA 3AETA 3A3NA 1QP0A 1QP4A 4MKRA 1AKUA 2C20A 4QVGA 1EJ2A 4DSTA 5K20A 1DQZA 5KSZA 2XUOA 2NUTB 1UP4A 3H2BA 4Q47A 2CJWB 2LW7A 4HV4A 5B12A 4D4KA 1JG3A 1M2NA 4WRRA 5JC8A 3GLGE 5DF1A 3P9RA 4AG6A 1NX6A 2OAEA 1PG2A 1U94A 3I28A 3TTYA 1PQPA 4M98A 2W2PA 3VDXA 4Y7CA 1FPQA 5HOEA 1PTJA 1WUKS 1II8B 4ZI7F 5TB5A 2W42A 2W6QA 4BVBA 2XLBA 2WUGA 4X45A 3GUZA 4LZPA 2XTJA 3IJ5A 1Z8FA 5DCYA 1TYBE 5BN3B 1Q7EA 1UQTA 2OILA 3QV1A 4QU5A 4E12A 2XODA 1E5QA 2R1UA 3B3QA 3MQ4A 5EKXA 1HTBA 3ROKA 4YJGB 4JU8A 3WYAA 5T4HA 3ADOA 1A9QA 3UMMA 2J07A 2IY9A 2QLJA 3F5QA 1EVZA 2XSZA 1EK5A 4YMGA 5CYPA 4GZLA 4F97A 5KVCA 3AZPA 4CQMB 3PWSA 3HKBB 1QLJA 3EVNA 3GN2A 3JZDA 4S1PA 3OA2A 3GF4A 4P4UA 1SA0A 1DE0A 3VNRA 1XALA 4E7PA 4CBVA 3CF2A 2PX4A 1X1DA 3K5WA 3OEHD 4MUIA 4YWJA 2G0AA 3WGNA 1DUVG 1GPDG 1H2WA 4BMPB 3ILSA 1VMDA 1P5HA 3D2LA 2RFLA 3QEMB 2LPMA 4G4SP 2DERA 1Y5MA 2P9HA 1RXIA 1QH9A 2Q5QA 1PYDA 3FR8A 3BE6A 4GPTA 2J6BA 4XJSA 5DWDA 5AHWA 1BDIA 3WLPA 3K4HA 2H29A 1VL8A 2JH8A 2Q2OA 2W71A 1K3UB 1KZ1A 1OMOA 4OA8A 1U3TA 3HU1A 2DZDA 1MA0A 4DDKA 3GP5A 2G71A 3K3PA 4ABYA 1CZRA 3KVOA 3JALA 4FOSA 1KVQA 4P22A 4ERXA 1Z37A 2BTOA 2R6R1 1C14A 4IUYA 5EE9A 2BFBB 4A5OA 3HLYA 3SSMA 1QE5A 1ZH4A 3A1SA 1SBHA 3F2VA 3ENWA 5KWEA 4BB9A 2NO1A 1TZBA 1WD5A 1OVGA 5I9BA 2A67A 1JFRA 2PH3A 1A8SA 2HLDA 4O08A 1SUDA 1ZESA 2ZR0A 1KYWA 3A9WA 3G82C 3N3AC 4XW2A 3IODA 1JECA 1M54A 3DE4X 3K0FA 1W94A 4ZVVA 1JSZA 3CF6R 4MPRA 1U8XX 3KSUA 4R7GA 4AC9A 1RPNA 1XQ6A 1SELA 1IUOA 4ZOLF 2OCIA 1PJAA 5LB4A 4EZIA 2VJQA 1EFPB 2O8VA 1U28A 1G8SA 2VPQA 2QX6A 1RJ9A 5DT2A 4JBIA 3P27A 2NO7A 1RRVA 1QZUA 2WSLA 3OZXA 1MU0A 3PJFA 4KQGA 2FGKA 3AYZB 3BQ9A 1T2EA 2G5TA 3EOAI 3QVTA 5JO0A 2PQ6A 1RDFA 4LHYA 5LWQA 2OQIA 4JSRA 4Q4AA 3KXIA 5KOIA 1J33A 2Q07A 5A3VA 4PLHA 1HTTA 2I78A 3F7OA 5J40A 1KO8A 1M6HA 2IOYA 4W99A 3A3YA 3PGMA 1E2IA 4CMCA 3W1VA 3KELA 2OBYA 2XOKA 4RZXA 3V7NA 1ZVJA 3NOOA 5AVOA 2IU6A 2QS9A 2C96A 2PH5A 3IEKA 3L1VA 4B4OA 1KHTA 1KVSA 4PZYA 1CDZA 1XZJA 1JHRA 4I99A 3MRVA 2JFBA 4QJ4A 1ZZEA 2YV1A 3O92A 4JL5A 1EJ0A 2ZT7A 1F2VA 3FLEA 4GOOD 4JXKA 4QO8A 3TD2A 4EF4A 2FR8C 3DJFA 4S2EA 5K5EA 4CIXA 1KORA 5E7QA 4BQSA 4D6XA 2Z9BA 4S24A 4FOOA 3CRMA 2GZDA 1OJLA 4C0AC 4ZHSA 2YRWA 3EFOA 1BS1A 4FKZA 5EJMA 3O7WA 4GF5A 3X1ZA 2AOUA 3P4XA 2BFOA 2AN3A 2O14A 3TQOA 3WZLA 2P1RA 4TXNA 4I8IA 1M5RA 1H4QA 2XCOA 2P2SA 3AV0B 3BGOS 3I58A 3FCYA 2FN7A 3EC2A 3MJRA 1CWUA 1SG6A 4FEYA 1YASA 1F06A 3DYBA 1PV1A 4IL5A 2GXAA 3RQIA 3SZMA 3ONEA 1NOIA 3UMVA 5AKJA 2EEPA 2WBLC 4PC2A 3GARA 1SXJC 5KEIA 2W2TA 4MYDA 5D7NA 4BO4A 2F1RA 4P54A 5F7JA 3RDPA 3SU8A 4G23A 5HE8A 2AQ8A 4IDBA 3OG9A 5HA5A 1NQOA 3OF3A 3OCJA 1GZDA 2E4YA 4V3CA 5A4IS 1NLYA 4YMWA 5IC5A 1OT5A 1N6KA 1A8QA 1MDBA 3EGXA 4PAMA 4QQRA 4Y2XA 5KREA 3L9WA 1Z5OA 4LRSB 2DWUA 1XB2A 3ZCXA 2J4CA 3TMKA 1FA9A 4ZYXA 4RE6A 1HDCA 3SEZA 1EVJA 1SFRA 4MRPA 1Z4JA 3GNTA 3AHDA 4UBLA 3B9BA 4FEEA 4B5LA 3N8IA 3T7EA 4YJ2A 2FJPA 4PHGA 4DA9A 2JLCA 3REOA 3I9V6 4M2LA 2NVOA 3CU5A 1N25A 1GPH1 2ZUTA 3GCDA 1F5NA 3BA1A 4CMAA 1V3VA 3QKIA 4D0NA 3L43A 3Q8KA 2NXWA 3VPAA 3KTAA 4O25A 1YKFA 1W2GA 2GZAA 3KU4A 1QK4A 1X1TA 2XVXA 3SR4A 4TSFD 2CZQA 3CCCA 3WL4A 3OOJA 2R4TA 3RTAA 3IQXA 3C8UA 5KI6A 1WQ1R 3ENNA 3Q3CA 1LJ8A 5EMMA 1G5RA 4LDQA 3K7EA 3KJGA 5ESDA 4ZVKA 3U6KA 3IDQA 2GN6A 4XDGA 3UB2A 1UJMA 1X7ZB 3RTGA 1ABBA 2OV2A 3KSAC 2I8AA 1E6WA 1C50A 1MEEA 3NV9A 1H85A 1NYQA 2YWDA 1IEXA 3DW3X 4RNDB 1QGUA 4OHWA 3UJDA 4YYEA 1UKCA 1C80A 3WBKA 4BVJA 4D9MA 3C1AA 3I0MA 3ABRB 1RLIA 1UKVY 1PJ3A 5IP5A 2VQ6A 4IHJB 3PE4A 5I7FA 4EW1A 1AC5A 4CN8A 1C3JA 4S35A 2O5CA 3IHKA 3AERA 3FPHA 1NXTA 5CM2Z 2AX3A 2XZPA 4G85A 4YRSA 5ICEA 3J81A 1RQLA 1AB5A 2VUUA 4E3WA 4DC0A 5C1PA 1XVLA 1GZUA 4OGLA 4UXIA 5IH3A 1KPIA 3VPBA 2IHTA 2QENA 4KQJA 1X13A 3IAUA 4NV1A 3WGJA 4E4YA 4LMBA 1QIHA 1KI8A 1ZMOA 2R1TA 4RQAA 2UVPB 1PDOA 1C1HA 1CVLA 2YWFA 4ZAWA 1DBVO 1LFAA 1KA9H 1RW4A 2EXXA 2ONKA 3VOSA 4WXRA 2UUCB 4FN5A 1ZVKA 2VYNA 4B7ZA 4L9RA 2I71A 2BGJA 4H3VA 4O8CA 4PYKA 3V8RA 3I52A 4MB0A 2XDWA 2AFIE 5ALEA 1HDZA 3UMSA 5FOXA 3VR5D 5BN1A 2EDCA 3I32A 1IK6A 1EGHA 4WERA 2HSGA 1O4WA 2JCYA 3A9VA 3ICOA 3RSHA 4F11A 4B83A 2O6HA 3LLMA 1UOPA 2IY7A 4JYCA 2JBAB 1RI2A 1Z8DA 3VR4A 2JEOA 2EZUA 3IEXA 2WNIA 1OREA 4EP1A 4YT2A 1X7GA 2C97A 2AJTA 2P0YA 3IQEA 4Z1MA 3RLIA 4D5GA 4F92B 1CW2B 3MXTA 1CJUC 1T1GA 3BTOA 4HDKB 1T4DA 4K9SA 3ER8A 1MO6A 2QVCA 1R9NA 3GGOA 3KWLA 3TOSA 3F73A 1FRQA 4TX1A 1KEKA 3UKOA 2OXTA 4GDMA 3ZCSA 2BEWB 2JFZA 3HVIA 3K1YA 1VE7A 2JFQA 2ZRAA 5IN4A 2BR4A 4DABA 3WWOA 4QGHA 4J1QA 1DZ3A 1IY0A 3CZAA 4D26A 5JC1A 1VE6A 3KOWA 4AL4A 5KVAA 4RACA 1ZK1A 4DS3A 1WUIS 4FLMA 4LDZA 2QT9A 4C3VA 3GFRA 2KE5A 4YASA 4KXNA 3AEQA 5DB4A 3D1JA 3UHPA 5ILOA 2BFMA 1I2MA 1AU9A 1M6YA 3IMFA 3CLTC 3M70A 4KQIA 4W8HA 1M6WA 4ZT7A 3P0HA 1Z22A 2W6PA 1VPTA 4EMTA 5LKAA 2PRZA 4XFDA 3MOGA 5L8VA 4AYXA 4BMDA 4X1IA 3EZNA 2GM4A 1SHJA 1BX3A 4F3CA 4K5QA 1VB3A 3HY4A 3PTAA 4QDUA 1D2HA 3IUJA 3E9CA 1Y48E 2RBEA 2DH5A 1UC9A 1VLVA 2FUG1 5GGYA 3AB7A 3MWLA 1IBMB 3BJMA 3ZV4A 5ALPA 1CY8A 3RCBA 2Q2VA 2Z3ZA 2NSYA 1BXRB 5EXEA 1N2CB 2XGJA 1IN7A 1WKCA 3QLEA 4G0WA 2OENG 2SKEA 1GPWB 1YDHA 3SKXA 1PN3A 5CVEA 3T7CA 1TKRA 4P08A 1SUSA 2F3RA 2OBBA 2Z8YM 3D0RA 1L4YA 2PMBA 2VAXA 3OJXA 1XPRA 1DFIA 1SUBA 1M7HA 4J90A 5IBPA 4BLWA 4EIWA 4X8MA 3LLVA 3QKSB 2FPWA 3ACBA 3ETGA 3RUCA 2RH5A 4DSNA 1NWHA 3UJHA 1G21A 1T0PA 5FPQA 4WY2A 5THXA 3WMGA 2HF2A 1GPNA 1NVVQ 5A3RA 2XX3A 2GZ2A 1V4VA 1V5FA 1PFUA 4KV9A 3OMLA 3ZJ5A 3ETEA 1D6JA 3H2SA 5E3HA 4D9JA 4OA5A 5AVUA 3H5VA 3T7SA 3MD0A 1UXJA 1YZKA 1QNFA 2GEDA 5J4HA 1QIFA 3VMFA 4B32A 5KDOA 3UAWA 4D4GA 4P9NA 3N6RA 4Y6LA 5BOSA 3GJ6A 3E5HA 3C15C 3OLQA 4KKXB 2XWQA 1TCCA 1V8DA 4LJRA 2DFNA 4WBNF 1ZIDA 4IIXA 1X7YB 2QSUA 4K9OA 5G2OA 2BY4A 3Q8MA 1W35A 3V3TA 1DBIA 1Z75A 4AWXA 1DWPA 3NHZA 2J59A 2N75A 1IRXA 1NXXA 2Q9BA 4F8JA 4X60A 1K86A 1GOTA 4PYOA 3T41A 4YUAA 1CBUA 1KVUA 4ZMRA 4A4DA 3UNXA 4KPEC 3AR7A 3ROMA 2WF5A 1UJBA 2WG2A 2GEJA 4Q12A 5JYDA 4MQFA 3SQDA 3VAYA 3AVYA 1BS2A 1LDGA 3SOZA 2MSLA 4R5HA 1R6TA 2PX8A 4FE3A 4PYJA 5D51S 1RAGA 4Y2SA 2B5VA 3AR5A 1YUBA 4FDUA 4WK4B 3O4FA 1YL5A 1YT5A 1XEWY 1BWQA 2AKEA 1TKCA 2OSVA 1AGNA 1H2BA 2Y1KA 3DCNA 2AHRA 1X1QA 1ZP6A 1AGXA 2XUAA 2XZTA 3C7KA 3PQDA 1UMBB 4OXIA 1Y1TA 3CH6A 3CLSD 5D01A 3VHXB 2EW8A 4P86A 1Z2OX 5HMLA 5LYJA 3IT3A 1L3CA 4R2LA 2C9BA 1Z0IA 4ZJZA 4XI9A 2MJLA 1JSRA 4S0XA 5HQ3B 4C03A 1K8RA 4RKQA 3A28A 3H3FA 5FCDA 1E61A 4CWAA 4EI9A 1GLVA 4FGJA 2XB4A 1CIJA 1LQ2A 2QN8A 4UHHA 3H2KA 4L3VA 4WX2B 4ITRC 4F84A 2C5BA 2QMZA 4ZVTA 5BMVB 3IVGA 5GZ1A 3D64A 4EJ0A 1KY3A 5CA1A 1PEKE 1H2RS 5GIOE 1P2TA 4MWDA 3TDMA 1FU4A 1DMRA 2WF9A 4ZQBA 3UUEA 1OH6A 1F4LA 1CYEA 3DPIA 3ZHXA 1RRKA 4IIGA 3E9QA 1W5BA 4G0NA 2RARA 3IAEA 2JLAA 2HIAA 2O7NA 4Z8XA 2ZSFA 3QOXA 4U7FA 1CUGA 5AVRA 1E1RA 3G17A 5D3QA 3DDHA 4YPFA 2HWWA 3R3YA 3ZZ0A 2PXCA 2VKQA 4ZGGA 1IDN1 4JLWA 2XNJA 4R68A 4GC5A 4A8JC 2W0SA 3NHRA 2HNAA 3H5AA 4PLCA 4Z4EA 3N2KA 3F4LA 3EYAA 1TF7A 3H4MA 3C3PA 3SJCA 5AHXA 2I29A 3FVVA 4L76A 3AEKA 3IBSA 4IIBA 1LS6A 2C4KA 3PDHA 5ALKA 2V7BA 4L0MA 3NGMA 3OE7A 1KOGA 1SOVA 1Y8CA 3PYMA 4EVIA 4RCVA 3U3JA 1NI3A 5CGQB 5MDHA 1U2GC 2JG3A 5F7XA 1Z7WA 2JD2A 5K8UA 3G7NA 2CJYA 2X76A 3VR2A 1J1IA 4ZCRA 1NSFA 4NY1A 1I1NA 4Q05A 3K05A 3K2BA 1CDOA 3QIVA 5E6RB 5IVDA 4B9AA 1ZJJA 3JYOA 1Q1GA 3W5UA 4BP1A 3QYFA 2IXGA 3Q87B 5EOVA 3O4IA 2CV1A 1JAIA 1IJFA 5SYMA 3LX5A 2K2QB 1EH5A 3JTMA 2CNOA 2PUAA 1ESMA 1DRVA 2WUEA 4FFVA 3L40A 1FX0A 1TUBA 3WIBA 5CXXA 1VLJA 1FB5A 2I99A 4C0XA 3DHNA 1CQPA 5CA0A 3UHFA 1QNLA 3KJEA 5HG0A 3GEMA 3G85A 3IOYA 5TX7A 4DQUA 1JDSA 4IZIA 4QUBA 1ST2A 3EZ6A 2GPSA 4B6RA 1O94D 4UBNA 3CZ4A 1KAGA 1PGNA 4JB2A 1ZMRA 1DTEA 2ZQZA 5KAPA 1EDZA 3R7WB 2JJ2A 5HJ2A 4BNDA 5MFPA 1E2FA 4DV1B 2YN4A 2DUNA 4D56A 5FO0A 3RR2A 1DQYA 1H2HA 3E3AA 1HQDA 4LVUA 2V7PA 1W4ZA 2DY1A 5DBEX 4E32A 2ZUBA 4NF2A 1GAXA 2G9QA 1RLMA 1L5ZA 4M0CA 3VPGA 4LJSA 2QMQA 1Z82A 2D2EA 4PQRA 4RTJA 3KB2A 4PGGA 3RSGA 3WL6A 4CFYA 5GQSA 4DNOA 1M2OB 3BIOA 1ODIA 4LYEA 1YMUA 3JASA 1NQXA 3EMKA 3S2FA 4CM4B 2HNBA 3TNLA 5FOWA 3RYCA 1WETA 2HHCA 1DPGA 4MRNA 4M9UA 1T4BA 8ADHA 2FOIA 2P5TB 3GT0A 1KE2A 2J30A 4E5DA 4MEBA 4GVPA 1QQ5A 5KX5F 1Y5IA 2HJVA 3SD7A 4NOKA 2WV7A 5AVJA 5L9AA 1FDRA 1XA3A 5AJZA 3OZTA 1XP8A 2REQA 4ZVNA 3TXAA 1HDXA 4ZAXA 2IS6A 3GP3A 3KPWA 3NP9A 4FFBA 3KJHA 2R85A 1W8DA 3WA6A 1M34E 4M1TA 4TVBA 3BMCB 2XDYA 4BWGA 1V95A 4GRDA 1O9GA 4NH4A 4EUNA 4RTPA 4C08A 4B6GA 4PR0A 2DUWA 2IBMA 3AUUA 4FMBB 1CTQA 3EW7A 3T0IA 4HEJA 4PBRA 1L4KA 4EQZA 4DOMA 1WCIB 4DA0A 4NFHA 4URUR 1TT5B 4YDHB 5IT5A 3RUPA 4EG8A 4DREA 3ZIDA 1KYXA 4K28A 4ASUA 4FB5A 1SRQA 3GT7A 2AHOA 5HWSA 3ABSB 4Y2HA 1NN1A 4BV3A 4K9QA 3C2QA 3WXMA 1XTSA 2B7CA 2AUTA 1ZCZA 3NORA 4R0VA 1T6NA 4ZQHA 3GLGB 5CLGA 1OFTA 3DLCA 1ZIOA 4O3FA 3JATA 1VKNA 4E03A 3ZVLA 2HYDA 3FJOA 1AQYA 1USUA 3LA6A 1KAQA 1S3GA 2EYQA 3GEHA 1Z28A 5DLPA 1CR6A 1ZK0A 2K5UA 3LMKA 4X6LA 1FK8A 2IHUA 4UMDA 2IWRA 2R2AA 1ZHOA 2CL6X 5C5CA 2PSFA 2RONA 2Q1WA 1TX4B 1K8XB 3PU6A 4RZ3A 1VSQA 4Q3DA 3T8YA 3A4TA 4W6ZA 4Q7MB 1XAHA 2BFAA 1Q3KA 5F23A 1ENZA 3NQ41 5CBKA 3FNQA 4Q9HA 3U6BA 2IUSA 2QMOA 1MJHA 2ZITA 3HKEB 5CCEA 3AM1A 1E79A 1V0JA 3LGSA 4MMYB 4TWBA 5CAEA 1YHNA 2VI5A 2ZCVA 1JU3A 4NHOA 3RC9A 3FB4A 2PWPA 1H9BA 1G18A 3Q7IA 4HAYA 3FBTA 1QTRA 1Z4NA 3MWGA 1P61B 2WTEA 1XRMA 5LZ7A 3TW0A 4A8JA 4C22A 1YKSA 1KO7A 3E0XA 2DYKA 3FPFA 3EVTA 1CCWA 1EDOA 3K9GA 4GLOA 1ODTC 4IMIB 3T7DA 1ZUWA 2NP6A 3T38A 3CNOA 4TS1A 4Z9AA 4P35A 4HAOA 1R6XA 1Z5GA 2CF6A 2H5IA 4QSMA 3OQMA 3TBKA 2DQYA 3LWDA 1NDQA 4L5AA 4P3YA 3ZWBA 4RTOA 1JEAA 1WD7A 1OXBB 5E2IA 3C5VA 2QI9C 2VAPA 3OQHA 3FZQA 1W0KA 2VKTA 3L01A 2RBKA 2CJPA 5LWHA 4WOKA 5T3YA 3N53A 3P1JA 2VYFA 1EGAA 4MMXB 1E0SA 3EDQA 1U2GA 2YS7A 4AZVA 3LUKA 3IBTA 5DXFA 2Y71A 2ZE5A 5EUMA 2YY6A 3ZOZA 2ZW9A 4MARA 4RHCA 1F2DA 4E2ZA 1ONBA 3GMTA 4NENA 5ALFA 3H1PA 1JPUA 3IIEA 2CLFB 2A0FA 1P4RA 4AJOA 3QSYA 2FSPA 4X8HA 1IXYA 2YXDA 1Z5VA 4GYKA 2NN3C 2V8OA 4CMIA 4IFEA 1MCZA 5AKKA 3H84A 1ZISA 3DA8A 1IVSA 2MMGA 2GRUA 3BWCA 3HCCA 4DJDC 1B3BA 1USVA 2IYQA 1UP7A 2LWIA 2AJLI 4DT1A 2QD3A 3NWJA 1O5IA 1YWGO 2XLCA 3QHQA 5FA6A 1GAWA 1SUEA 5HILA 2PFKA 4QOEA 1EE2A 3AVOA 3EHEA 3WRYC 2ZUEA 1VJ0A 3DL7A 4EENA 1I2BA 3ORRA 1YD7A 5D7BA 2ESRA 4JJEA 4KVAA 3BILA 2A9RA 1P5ZB 4DGQA 4I5DA 1U2QA 4Z2AA 4GOKA 4NJMB 1R16A 4LZWA 1ODKA 5FL7D 5LA6F 4HLUC 3I37X 3C39A 4MWOA 3BH7A 1RQXA 1O6ZA 4PLYA 2P40A 1GIAA 3OKAA 2GFHA 2JAHA 3C7DB 1AF4A 3FLMA 4GP6A 4R98A 5LP6C 4D57A 3S1SA 1MG0A 5KYYB 4A6PA 5BW5A 5ULLA 1KQ3A 1SBIA 4LNHA 2W22A 4HAVA 5FQOA 3IESA 1PNQA 4FC7A 4ROTA 5MN6A 4H4CA 5LP1A 4KLRA 1V47A 2G1UA 2IYAA 3HBAA 1TU3A 3IV9A 4U6NA 4L4SA 1YR9A 4DLNA 4FYMA 5CB0A 3BMNB 1IZ9A 1RBYA 2WK1A 4FOLA 4NYIR 1O5OA 1U0LA 4WBSA 2EQBA 3LK6A 3RYFB 5DHAA 1MIHA 2BKAA 4GUAA 4CKBA 2I7XA 4BQEA 5JXJA 1E1MA 4IDAA 3DD1A 2BGMA 4H17A 1TF2A 1QIKA 3L82B 2JAWA 3PTZA 2PQ0A 4TKVB 1KY2A 3DPSA 2B8TA 1KC1A 4XQEA 3T1OA 1LBQA 4UUOA 3THWA 1AZWA 3WLMA 3GD7A 2D74A 4I66A 4UZSA 4L9SA 5UKDA 4EG0A 3TQSA 1L5GB 4NS1A 2H0RA 2HPAA 4MV0A 1NBHA 2BPOA 1JHMA 4JJKA 4WNAA 3STVA 1E1DA 3FWKA 1S3SA 2XMCA 4CV3A 4OLBA 4PCVA 5DGXA 4KRYA 3TAHA 1VPWA 1NJ1A 5T5QA 1ONOA 2ODBA 2BSXA 4DCTA 1YHZA 5C8XA 3PEWA 4JKYA 2LBPA 1ZVMA 3FUXA 2EZ9A 4CEIB 1CS4C 1Q3TA 1B2LA 3QQPA 4KPFC 2QRJA 3GMIA 2IP2A 2XI4A 1SZJG 2OORC 2HA4A 4EQ6A 1CQIA 1SCKA 5DIZA 4NJOA 2VDRB 2ZWIA 3QQ5A 2FMFA 1P8AA 3TGWA 3CE6A 2EHJA 2OQVA 1N0WA 3OPYA 2BEUA 1IZZA 1SHKA 4DV6B 4ENTA 4GM1A 2OBMA 2E1RA 4Y1EA 4RVHA 3CN7A 2Q6IA 4RVOA 3RV3A 4RANA 1IBCA 1D6SA 1XTVA 2FFHA 3V4VB 2BMDA 2GJKA 1U02A 3TXXA 4DRXB 1SCUB 4MRMA 3KEGA 1DEAA 2TMKA 3SLRA 3TJMA 4B09A 3BRSA 1ODFA 3IPAA 1FUKA 1XVAA 3NFYA 2WEKA 2ZSKA 3PPVA 4EKNB 2ZIZA 5A5FA 2HDHA 3DVAA 3THRA 1Z2EA 1KI6A 4ODIA 1GTG1 3RH0A 4KR6A 3BXPA 3FKJA 2I4TA 4FHEA 2C92A 3K0KA 3O8QA 4OSPA 4C7BA 4HQKA 5ICFA 3P4YA 4DIEA 4XIGS 4L0DA 1SMKA 4PXAA 4RKFA 2H1RA 5K0FA 4L4UA 2Q3CA 1JDBB 1NBMD 1K2WA 1QF9A 3CO5A 4LBYA 1XD9A 2XXJA 4WZZA 2INGX 1P5JA 5CIWA 3V7YA 2IZ7A 2OSBA 1IK4A 3FY4A 1Q1NA 4UDYX 1WMFA 4KB5A 1JU9A 4YGYA 4D96A 3CRW1 3LF1A 3OBBA 4OTZA 2W58A 4NZ9A 1S2LA 1FUEA 2GVDC 4MS4A 1A9PA 4WA7A 4CT0A 4D9GA 1F0PA 1E3WA 1FFAA 2Y68A 1GV1A 1BWRA 3AUYA 3L1HA 4DIDA 1L8QA 2BT4A 1YJCA 2CVOA 4Z99A 5LUBA 4V1CB 1WKBA 1G7TA 3M6LA 1YA4A 4G56A 3DNPA 3NWEA 1CE8B 2ZVPX 3SF8B 3OEHA 1J0CA 1I5EA 3GJ7A 1X1CA 2A1UB 4MUKA 5D3ZA 2AFIB 2B83A 4O8ZA 4R1LA 3PVZA 4DLVA 5BYAA 2PZAA 2WFLB 3F6PA 4DNQA 3TL3A 5ELMA 3DFIA 4YQYA 2C5SA 4BLUA 6PFKA 3KYIB 3ICEA 1ADFA 2VHQA 3HL4A 4XFKA 1JWLA 3W8RA 4DY6A 3LH5A 2BFEB 3DAGA 1J0DA 2BMFA 2VWHA 3MUFA 4OP3A 1C81A 4Y2GA 3F7TA 5ALTA 3RTDA 1AMOA 1H2FA 4MDYA 5FPTA 2Z4SA 3BCUA 5DEIA 4DHWA 4CLXA 2AC4A 4L4ZA 4FT2A 4PG6A 1SCIA 1Z34A 5CLQA 5AK6A 5AW2A 5IAEA 4A91A 4B6SA 4EW3A 3LK7A 2K4MA 5CH5A 4CKYA 5IZ4A 1OY1A 1EWRA 1UODA 2GN2A 4JLOA 2WB2A 1JW9B 2G7MC 4KUGA 1A8HA 2AL7A 4PQYA 1JQAA 5GMOA 1RCTE 4FYXA 3RVBA 4C5BA 1JGTA 4DV7B 1Q0TA 5K2MA 4UEWA 6YASA 2ZRDA 1TE2A 2CB0A 2R6CA 1OXMA 3AJ9A 3ORHA 1KP3A 2GN0A 3WRYA 5KUTA 5FUMA 5IDXA 3DEFA 1GYRA 1ADCA 1NC3A 3TCKA 2NZXA 3R0XA 1MQ9A 2IL1A 5LQNA 2B99A 3DBVO 4WDQA 5A6SB 4YONB 4NBLA 3NUZA 4HLUA 3RSQA 2O8CB 5G4KB 4QIHA 3WK9A 2PWYA 2K7FA 2NPIA 4IVRA 3II6X 3MIZA 3IP5A 3PDJA 4TTSA 1X1EA 2HSEA 1HLPA 3QU2A 5AW7A 4FW9A 4FTWA 4Y3UA 1E9BA 1GFSA 5AK3A 2A88A 2C2BA 4GKVA 1YOVB 2HUPA 5H82A 1QZXA 3ZEIA 2ZLBA 5DJ5A 1SB8A 5HXAA 2ZJOA 5C1IA 2OAP1 1ZSYA 4Z53A 3EGIA 1BE1A 1P7WA 3B6JA 4LGCA 5JISA 2V45A 3JQFC 3KM0A 3H86A 1QYWA 4FCWA 4YLEA 4OHCA 1D6MA 2LIVA 2X6RA 1XO1A 5K0LA 1LVUA 1GZ7A 2DBZA 2J3QA 4WCFB 4BC0A 4HVAA 5CB4A 3OU6A 1JKMA 5IZCC 2ZVQX 4XSVA 1KJ8A 2FNAA 1XJ5A 2SECE 3EC1A 1RI3A 2PGDA 4Q01A 4CW7A 5JUWA 1ZH6A 3U7QB 2DJIA 3A06A 4I6EA 3ROEA 1U9CA 3QSGA 2W7TA 3R7AA 3QE4A 3AESA 1EQUA 1N5DA 3FD8A 4MP6A 3VBCA 3VZPA 4CJXA 4GKJB 2RHTA 4Q16A 4CLRB 2M9MA 4IDEA 2NUAA 3K6RA 3SXUA 2GDJA 1PNRA 4NEQA 2L17A 2A58A 2YQZA 1YDFA 4CKXA 2AN4A 2GAOA 2UV8A 2QUKA 2GDZA 4DJ5X 2ZS9A 1K7SN 3KQMA 3LI2A 4RPLA 5CP8A 5JSZA 3LP5A 3GHYA 3K94A 2VJCA 1WULS 2DECA 2ID4A 2JLRA 3ZDEA 3CUYA 3F5MA 3LA8A 3LWBA 2M2IA 2QP4A 2I66A 3H5NA 3JPYA 2FMKA 4GPIB 5AI4A 5FNVA 1JB9A 3UCFA 5KC8A 3NB0A 4FGUA 5LDHA 1MX9A 2HPZA 5LLTA 3MTDA 1RKUA 5CDSA 3T7RA 1PV4A 4N12A 2IZOA 4Y0NA 1A5ZA 1D0IA 4D9CA 1O08A 3ZIAD 3MMZA 3U44B 4B3SB 3N74A 4RCYA 1HYQA 2XDAA 3HR7A 1FDVA 2P4EA 5FA8A 1YJAA 3SPXA 4CU2A 3DO5A 5HUQA 4BNHA 2ZTLA 4RSHA 1MB2A 5M7EA 1DTWB 3EIHA 3QOWA 2OZEA 1E4YA 1NVFA 2HWKA 4PRYA 2EVWX 4CR7A 5EG5A 4A1FA 5AM0A 2TMGA 5DNDA 3UT0A 1SKYE 2NQTA 3LF2A 1V5EA 2AEMA 2BBSA 4MWSA 1YIAA 3L0CA 5EL0A 1LPAB 1IUPA 3V1KA 5JBIA 1UK7A 1ZA2A 3VNSA 1XTQA 3ZIUA 6GPBA 4DMHA 3FRHA 1WZIA 5HNKA 1POXA 2HQSA 5AT1A 3GEIA 4X0EA 3RTEA 2QM8A 1TYAE 4BS9A 1VE1A 1AUPA 3L8MA 3RREA 4DLZA 3L02A 4ZK6A 2ZJYA 4QQNA 4TSRA 3H9GA 1YDWA 4OHPA 4UATA 5JJIA 1AT1A 1DCKA 2NQ8A 4DA7A 2I76A 1RM4A 2DR3A 4MW0A 5CT9A 4QFMA 1CUVA 2VHCA 3LVBA 1NF9A 3R3WA 1AMUA 5IKOA 3OP1A 3BFVA 4NMWA 1EPUA 1T24A 1ZU5A 2ZAIA 1YGYA 4I50B 5H68A 1E0DA 1KDOA 2RJ3A 3CLSC 3OZAA 2FSIA 3KFVA 2M6KA 5BV1A 2RI6A 3I6IA 5A03A 3QHPA 4WLFA 1BO6A 1HRKA 2XQKA 1NOKA 2RHDA 3ENQA 3TAUA 1OFGA 1RAAA 2F1IA 4Y6RA 4PX2A 3HO8A 1Q84A 2OCDA 3FFWA 3GJQA 3ETNA 4JOSA 2H31A 2BZGA 1YBHA 3OP4A 1IBSA 4TS9A 4ZDIA 4GKKB 4GICA 1PL6A 2AMLA 2GO7A 1YONA 4G36A 4FZ3A 4EW2A 3A2LA 3H5OA 3OE4A 1M5TA 2VT2A 3QTBA 4MV7A 4GEGA 4F4UA 1G6Q1 4DLRA 3DE2X 3FGPA 2I2WA 1SXQA 4R2MA 4YP0A 2IYSA 4TXHA 1E77A 2JLUA 5G40A 4E2WA 1KZ7B 3I2IA 5LLSA 4DLSA 4CTMA 4IO1A 4YRDA 4EUKA 4PTYA 3TUZC 1RAFA 4MS1B 3QFHA 1Y42X 1P6XA 3VR5A 2COEA 4LRUA 4G5FA 2R8ZA 3SQWA 1Y3HA 3T1YB 3NJ8A 1VLMA 2B7LA 4M7WA 4X3OA 2CHGA 5E3IA 2ZBUA 1Z7GA 2WU0A 4BZQA 4CDMA 5J5AA 4AJHA 2X9VA 3OJLA 4GLFA 5B3JC 1JVNA 1M1NA 4NU5A 5KKAA 4YCAA 4MHTA 4B3GA 3CF0A 3W9YA 2F8SA 2XBMA 2R8PA 5LM3A 4EB6A 5A4AA 4U7GA 4V0OA 1W85A 4X1KA 3MILA 3ZNNA 4RTRA 1BDMA 1S8OA 3JQPA 1Q57A 3MPOA 3V80A 3CPEA 2DTXA 4D0SA 4C0KA 1P0IA 3AEUA 4PFJA 2XTAA 4UDNA 1IUKA 1LBIA 4B9EA 2JCXA 5HFJA 4TV8F 4GLLA 4J7XA 2A9PA 4CL0A 4ZI7B 1QGAA 1OXKB 4OYLA 2E2WA 3RS7A 1W5SA 1U8CB 3DLIA 4EEZA 2EF0A 5KOYA 4NC9A 4Z5XA 4GLBA 1YCDA 3U60B 2H4XA 3NAGA 4FXOA 5KWIA 3AP1A 3UT5B 2AQIA 4BYGA 4GP7A 1FYWA 3FYUB 4II3A 1WDLA 5E6SB 2DPYA 3PJRA 5BWNA 4WXMA 5DH9A 4LSMA 2MSNA 3IXMA 1OE0A 3QE2A 1GL6A 2P65A 4HQOA 4NX2A 1G21E 4M1MA 1GQSA 5K4GA 2NSDA 1DAOA 1N3YA 2IDJA 2VWPA 2V4ZA 4HZGA 1O94C 4G97A 5IC6A 3H5TA 1IVNA 4L4YA 5A9SA 3ZHCA 5EMNA 5IZCA 1J1ZA 4X1YB 3RNOA 3H16A 1DELA 3AFNA 3V7FA 2QZ9A 3Q9SA 4JX8A 3I8OA 5K6AC 5LJLA 4EPRA 1G41A 2OGZA 2Y9PB 2ZU0C 1IHOA 5B37A 1WEHA 3SEQA 1UAAA 1PCXA 2BWJA 3FG9A 4UEQA 4BVFA 1UDWA 1ND6A 2J0UA 1P9NA 3CLRD 3ZWMA 1UAGA 5LKRA 5JY6A 1A0OA 3FHTA 1CF4A 3I5MA 3OQIA 5EJFA 3VI4B 2WU1A 3U4CA 2JCGA 3VO1A 1ZUNA 1BXGA 4TXLA 1RM0A 2CBGA 3FCOA 1T36A 1SEPA 3IXLA 4DTCA 5D3MA 4BV9A 3EH2A 4RQUA 4UBMA 1YR8A 1ETUA 3LIPA 3PNLA 4HLQB 4CNQA 4H3SA 5FTKA 5JNUA 4S1OA 1R1DA 3HB5X 1QH1A 1GY8A 5DYNA 5TY0A 3G2IA 4Y2UA 5ALGA 4L75A 5H83A 4O2BF 3UGQA 3BE4A 4PWZA 3WHKA 4BO7A 2CSXA 1M34B 3E2IA 1NLFA 3WOHA 1MIOB 3H2GA 2ZE7A 3NHJA 2FWMX 3T9AA 4YPOA 3C3YA 2WMOB 2ZP1A 4CMBA 3D4BA 4L4RA 5AVZA 2D06A 5IHXA 4F2WA 3EULA 3HWWA 2B4TO 5AM2A 2GB4A 4C76A 5JSFA 4X7PA 3RK4A 1JHDA 1SC4A 1GU1A 2C58A 2GETA 3BUSA 1IONA 1SWWA 5B30A 2DFTA 4CCAA 2ECQA 4LJKA 4NMHA 1OD6A 2J9GA 1IY9A 4LPKA 2Z5VA 2XJ4A 3NAZA 3O4HA 5DM1A 3T94A 3A2KA 1B0UA 1ZLXA 3OMXA 2B1QA 3KYCA 2MINB 4AVYA 1E2PA 4QXAA 3B3AA 2IZ0A 1N33B 2QYTA 1JS1X 3ZTYA 2C7RA 1YA6A 4ZOAA 4NH0A 3ID6C 3P97A 2REOA 3IAM1 4UFPA 4UTRA 3Q3HA 1H2YA 3WLEA 5EXPA 4AZ3B 1X42A 2GK6A 1RYMA 4DQ0A 1D04A 1HK7A 4PHTA 2JLXA 4DB2A 2V8BA 1R4AA 1RE0A 4ND7A 1B74A 4FJ0A 3P71T 4FGKA 1PFKA 3UV3A 1EB8A 3SYKA 3D8UA 2XGSA 3GEDA 1TL7C 2IYWA 1MRSA 4WCVA 2L2QA 1D0SA 4JAVC 4TV9A 2L0XA 1V5IA 1TTHA 2R6FA 3JSAA 1PJ4A 4GZ6A 4BUCA 1UM9B 3PQ6A 1MTOA 3AQIA 3DV0A 4UTOA 3M1YA 1JG2A 5AM5A 1KEZA 2BDUA 4FOTA 1RXCA 1UPFA 5BURA 1IN1A 2AOVA 2F3UA 3KLMX 2ZUDA 3OOWA 3O82A 7GPBA 3H5RA 2FVYA 4OV6B 1J7KA 1DKQA 3AJDA 3O84A 5EWMB 4A23A 3K6KA 1VJRA 3E61A 1DJQA 4RHEA 1I24A 2X7HA 2WUVA 3ENZA 3TKYA 3L4SO 4UDXX 5H81A 4E2FA 3U16A 5J4KA 4I4TF 1BOFA 2O0KA 4LXQA 4L02A 4YUXA 4JI7B 4R7TA 4QRHA 1D1TA 2QLFA 5C46F 4MHSA 1Y6QA 3K2EA 2DCMA 4FZRA 1DS6A 5I9LA 4EL5A 4AECA 1V5GA 4BMNA 3FGNA 1KP9A 1B1AA 4UMVA 2W8BB 5D86A 3U56A 1Z7BA 1X7HA 5B3JA 5KWSA 2HHHB 2Q4DA 1KK0A 3KWFA 3WKAA 1GNPA 4FP9A 3GJ8A 5C0OE 1NI5A 2IYZA 2P62A 4QYTA 1L4HA 1YBAA 2BGNA 2XB8A 1YQXA 4UHKA 2EZ4A 4L2IA 2IV7A 1Z0AA 2Q21A 1NMYA 1R4MB 1VA4A 1Z5WA 4ZO9A 3FYSA 3D2AA 1DINA 3FDZB 3JQAD 1ZM3A 3PJEA 2C2GA 2FEAA 3AWIA 3KAJA 2IYOA 3LUAA 2UXBB 1FLAA 4A15A 3X1MA 3L7LA 2AF3C 3MT8A 4ALLA 3V32A 2ZI9A 2OESA 3R7LA 4C4PA 1M73E 4UTVA 3I4CA 4C7XA 2B4YA 3HN7A 5LL6P 1W0JD 3UQZA 1MUUA 1G6OA 4AF8A 4KDRA 1PFGA 1NQWA 3P9PA 4WKBA 1UINA 3CR8A 3HR8A 5GWXA 1OYOA 2HRZA 2AZTA 5BN4B 3TZLA 5LQJA 3QJYA 4FDAA 3M4YA 4DCNA 4S05A 4EKDA 3OLCX 1CC1S 3DNMA 3PHLA 5BXYA 1YR1A 1Z3CA 4KCGA 4Y2VA 1P2DA 1C4KA 2C00A 1LNSA 1QCZA 3K9QO 3OTQA 4KRGA 1UKYA 2GUGA 4P2BA 3SC2B 3SHOA 3V42A 4A5SA 4BCCA 1E4VA 3WGUA 3T0FA 5BYJA 3IAXA 2JF0A 2YZGA 1P29A 2YS6A 3M6WA 2CY0A 1VRVA 3DE5X 1D2NA 4KAXA 3E0QA 1IEWA 1G2OA 3E3MA 3SE0A 3UGTA 1X1BA 1B42A 5H16A 4E5MA 5JIBA 4HB4A 2WHQA 5KYWA 1Q14A 2XT9A 5FAXA 5HYVA 4BMSA 3HSSA 4JWTA 1D2AA 3MGBA 4GI3A 1GQYA 4XA8A 3U37A 1TCUA 3DE1X 3GOQA 4X41A 4FWIB 1Z8NA 3FZYA 4YQZA 5KMGA 4O0LA 4RGBA 3E8SA 3MK31 4JYAB 4G5SA 1G1MA 2VK4A 4JCOA 4UBKA 1TO6A 2A9JA 2ASEA 2D5CA 1NR7A 1FTSA 4HEA1 5IARA 5IMBA 1Z08A 4DA4A 3OWHA 2PSEA 3O73A 5JQGB 1RR6A 4EHAA 3O8DA 3H8VA 3RYIA 2KX7A 1OI4A 2QLLA 3KVRA 4JEUA 2QY9A 5JZSA 3RRJA 1ADJA 2FVXA 3VYWA 4G01B 4NATA 5CPBA 3LNTA 3QUQA 1CSEE 5TF0A 4F4FA 1R37A 4NU0A 1UXGA 2H11A 4L16A 4MITA 4MUFA 4UASA 4ERNA 4ZCSA 2SBTA 3CZRA 4QUIA 1GCIA 3T5GA 1ZXXA 2HRRA 3CZMA 3C85A 1J6UA 5ITVA 3AETB 1L4FA 1L4BA 3GZNA 1TEXA 3IQDB 1IVYA 1XZIA 3BC1A 3GVCA 3PNSA 4RWZA 1LC3A 4MRVA 3KR9A 2QR2A 2R8YA 3BZWA 4FIZA 3KOYA 2C8LA 4NXNB 1KO1A 3KSDO 4NZZA 1T3ZA 1AQNA 3ICQB 3ZU5A 1VPLA 3EG9A 1PKEA 2BM0A 3H42B 4LRXA 4YCLA 4OMCA 1BTOA 1ZCJA 4MV3A 3DOEA 1F8FA 5I6DA 1TT7A 1L7EA 1MQAA 3DOIA 4FN4A 5LQMA 1OB2A 2Q5OA 2Q3HA 1OILA 3T4XA 4WKOA 4K46A 1Z0DA 1GRRA 1KIMA 2ZYVX 1YR7A 2NZUG 3EK2A 4LXYA 4RVGA 1MB9A 3LG2A 1RYBA 1UWCA 2KBFA 3RYHA 4U2GA 4X85A 6NULA 5JZOA 5K8TA 2CJXA 1L7VC 3QHAA 4RADA 3U1BA 3NPMA 4IJVA 3ST7A 2HA7A 1BVUA 1FZQA 3H1TA 2F17A 3LDUA 5CIYA 1VZ2A 2FW6A 2P3OA 1L7XA 1S9HA 4X9XA 1L1FA 3SYRA 3NHKA 4Z7QB 2ZYIA 1MFZA 1X3LA 2GA8A 5DM4A 5BT8A 5J2TB 1NPYA 3ZHQA 3ZBTA 2C4UA 3PYLA 5HTKA 3U5TA 1PT9A 1IPEA 1O1YA 4OL9A 4CMGA 5F9HA 3M2PA 1RFGE 1A2KC 1SA0B 4C7MA 2QLNA 2BSQA 4PGFA 5BRAA 1J0AA 4KRFA 2HCJB 3CVXA 1GTMA 1QX3A 4YALA 4QJIA 4J43A 3HPRA 4LOAA 4YV7A 5L53A 3OUTA 1OZ0A 3RWBA 3FHCB 3OJFA 4MLDA 3ZWKA 2CUTA 3D0QA 3HDQA 1W36B 5TLSA 3BN3A 3RW9A 4ES6A 4N54A 2WJHA 2FDRA 1CNMA 2Z98A 4IQ8A 4JH0A 1EA5A 4KO8A 2HDOA 3RRFA 1WL8A 5NULA 3MCVA 1Q0ZA 2A7QA 2UZAA 1NC1A 5AR1A 3UMJA 2FZ4A 5FWAA 4PM4A 4OXQA 1G2IA 1GL7A 2PS3A 5F1OA 3LGAA 3HJHA 4GI2A 4X00A 1JFFA 3JALB 1H6BA 4H7KA 3TDNA 1L7DA 3EA0A 4Q5IA 3WGQA 2BEVA 3FBGA 1TQDA 3C3JA 1OZFA 3L6RA 3ZPXA 2OUIA 2C2HA 4L3OA 3TG2A 2ORWA 4J7AA 2QY6A 4Q37A 1K4KA 4QGBA 3ECSA 1QU2A 2BEKA 2SNIE 4OU4A 2WM8A 5DM70 4LF6B 1Z2AA 2G08A 3N5KA 1PVDA 2HREA 3FNRA 4PLPA 2OD2A 2NYRA 1GPKA 4ZVUA 3D7RA 4I4CA 4FZVA 4N5MA 5JQGF 5LIRA 4KI7A 3TFWA 1QC5A 3WMXA 2XNCA 1QYRA 1Z16A 2YICA 4HDOB 3CUKA 4JJ7A 1RJ9B 1HFEL 4GBJA 4AWAA 3IL2A 1CJBA 3RGWS 1VOTA 1EKXA 2JPDA 1WXXA 1JXQA 1Y3IA 3C8DA 5HCIA 1NFRA 2A0UA 2XVAA 3IQFA 3OZEA 4PTLA 4E4TA 3MWDB 4FINA 1RYNA 4LJ7A 5A7HA 5TV2A 4E2YA 1JHPA 1AUOA 2WIJA 1NVGA 1ZOSA 3DBRA 3A6HA 1UH5A 3G8AA 4Q4AB 3ZWXA 2X8AA 2RHCA 2PUBA 5CLHA 1WBJB 2X5KO 4WDRA 2Y1DA 4YBZA 3GDFA 3CIFA 1PJZA 3JZMA 1OA1A 4CV1A 2AZDA 4GYJA 1WB9A 3QZUA 2YTZA 2Y1XA 3H9EO 4ZCIA 2DHRA 4R81A 4YRBA 2UYCA 2RGNA 1I2ZA 4Z7OB 4JZYA 1Q44A 4UHBA 5AUOB 4BNNA 3L5KA 1T4CB 1YV9A 1ZD9A 1Y7PA 2AV6A 1DC5A 2VDMB 3L7NA 3R5XA 2HA6A 1RZUA 3EFEA 1E2MA 1NN3A 3PXDA 4LXIA 1PSWA 3DZHA 3MAAC 2VHUA 3TQRA 1VFNA 2G67A 4WCDA 2ZRIA 1NMZA 3MBIA 1HMYA 4AKTA 3DKVA 5HGXA 5KQRA 3EFOB 3AI3A 3RVMA 3UMBA 3KZ1E 3D59A 3OUZA 2X4DA 3LU1A 2AOUB 5EEGA 1THMA 2AYXA 2GNPA 2RAVA 4V3BA 1O3YA 2EP5A 3F9CA 1QPBA 4N6GA 1X9IA 4K6FA 3ZK8A 5DN9A 2FEPA 1S02A 2IXFA 2HIHA 3R4CA 4W63A 4AJKA 2FLVA 4F4JA 1ZBDA 5AICA 2Q27A 2O19A 2E4XA 3BJEA 4J0QA 1RXVA 2QNBA 3QBVA 1PJ2A 4FLEA 4FWBA 1IWBB 1IZYA 3OIWA 1V3QE 5A3JA 4WFKA 3QE0A 4FLFA 4M1KA 4KXQA 4PU0A 1A50B 2HT6A 2Q0QA 3C5EA 3EGXB 4LPSA 4RORA 5HIIA 3UAGA 4A2WA 1Q2XA 2ATIA 4MW4A 3RUIA 4DCSA 2WTMA 2ZYHA 1ENYA 1SBZA 5HJEA 1XLVA 4C2TA 3MELA 1U8UA 1EG2A 5K3SA 4B34A 2H2HA 1HDGO 4C3OB 1XTUA 3KYDA 3W6PA 3AFHA 3D6JA 4CCYA 1LLFA 4LYGA 5JYBA 5DSZA 4PX5A 3DWFA 1PGPA 4Q82A 3GRKA 4QUKA 3FNHA 4R2XA 4GM4A 3D1VA 5SZKB 1RXUA 1P1RA 1VL2A 2ROQA 2GD0A 3NV7A 4UXHA 1X1RA 1PUXA 4PC1A 3KTAB 3VU0A 4AUEA 4Z7NB 4AJ4A 2PXHA 5IJZA 3BRWD 3WISA 4QBTA 1D2RA 3FWHA 3LTNC 3TZCA 5IG2A 4WW0A 3KQTA 3M5PA 4UBOA 1T3GA 1UBOS 2O3UA 3N7UA 3LC7O 3VSDA 3KLNA 1LK7A 3BSFA 3P5SA 4WN3A 1PUIA 4BQFA 2C31A 4M9SA 2QDXA 2VP5A 3E7PA 3ZHBA 1IQ0A 4KGVA 3KLBA 1SKYB 3IEIA 3AL2A 3K30A 5FJJA 1QGUB 2B4RO 1XRRA 2VIIA 2WVHA 3GAZA 4PF1A 4U9HS 3RYTC 3T95A 3PC6A 1HV8A 3E22A 1L5OA 2Z6VA 5FA5A 4DIUA 1YQ9A 2V55B 1O9HA 1V35A 2CFOA 3LYHA 2Q41A 3MT7A