4S23A

Structure of the gcpe-hmbpp complex from thermus thermophilius
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
405
structure length
405
Chain Sequence
b'EGMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Structure of the GcpE-HMBPP complex from Thermus thermophilius.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 133
structure length 405
sequence length 405
chains with identical sequence B
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s23A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s23A02
3MM7B 4DAIA 4G39A 3H2AA 2Y5SA 4GEPA 3H2FA 4HTRA 3MCNA 3BOFA 1Q85A 4NIRA 2Y0FA 3H24A 2YCLA 3H2MA 3MM9B 1AOPA 3MMBA 3OR1B 3VM1A 1TX2A 3TYAA 3MM7A 4NHVA 3B0NA 3VM0A 4CCZA 5JQ9A 1Q8JA 3NOYA 3K13A 2XSJB 3TYEA 3TZFA 6GEPA 3V5OA 3B0HA 4DJEC 3MCMA 1Q7MA 2OGYA 4S3AA 4S39A 3MM8B 3AOPA 3MM9A 3MMCB 4S3FA 3TYZA 5AOPA 4MWAB 3OR1A 2Y5JA 4O1EA 4S3EA 3OR2A 3VKPA 4G38A 4DJEA 4D8AA 2E7FA 4S3BA 2DZAA 1ZJ8A 3VKQA 3TYUA 1TWSA 1TX0A 3H2NA 3MMAB 1AJ2A 3H2CA 3MCOA 4C1NB 1AJ0A 2XSJA 2AOPA 3MM5B 3B0MA 2VP8A 2VEGA 4HB7A 3H26A 3MM8A 1TWWA 3MMCA 1EYEA 3H2OA 2H9AB 3GEOA 4MWAA 3VKSA 4G9PA 2DZBA 3MM6B 3H2EA 3VLZA 4DJFA 4DJDA 3VLXA 8GEPA 4D8ZA 4S38A 2BMBA 4S3CA 5GEPA 4PZVA 2V4JB 4C1NA 1AD4A 4DJED 3MM5A 4S3DA 3TZNA 3MMBB 3VLYA 4O0QA 4MWAE 3TYCA 4DAFA 4MWAC 1TWZA 1AJZA 2YCIX 2GEPA 4DJFC 4DB7A 2AKJA 4DJDC 2YCKX 3MM6A 3TR9A 2DQWA 3TYDA 1Q7QA 3BOLA 3H22A 3H23A 3H21A 4O1FA 2YCJA 4MWAD 3VKTA 2V4JA 1F6YA 3B0GA 4DJFD 1Q7ZA 2VEFA 4DJDD 3B0LA 3MMAA 3OR2B 2YCLB 7GEPA 1AD1A 4S23A 4NILA 3VKRA 1Q8AA 1ZJ9A 3TYBA 4D9PA 3B0JA 2H9AA 4NL1A 4AOPA
chains in the Genus database with same CATH superfamily
4LFYA 4CNNA 3NYDA 2JIEA 1E3ZA 4H83A 3O07A 4MHBA 3IS4A 3KS6A 4ZEPA 1VQTA 3ARYA 1GVIA 3ABRA 1MFUA 1EIXA 5D9NA 2QF8A 4MUZA 5A5WA 2LLEA 9RUBA 3SCOA 1EA9C 2ZUMA 3WLQA 1TPUA 4MNMA 1LWJA 3B40A 4I5UA 2HV5A 1BGGA 2ZBTA 4GOAA 3TYEA 3GWQA 2HCVA 2ZX5A 1QI2A 4XKYA 1QUMA 5DBUA 1V3LA 1QU4A 2VUNA 4GX8A 1YNYA 5FF2A 3STPA 1YADA 3WDHA 3MMAB 1UZHA 1VEPA 3CUZA 4R7JA 3QH2A 3QC3A 3M5VA 3W53A 2G8ZA 3CTLA 3MC5A 2FHFA 4P7OA 1KM2A 1RJPA 2X0YA 1M7JA 1G67A 1K4HA 1PDYA 3L0KA 3NAVA 3WDRA 3E0FA 4RNHA 4N4QA 4NSBA 2QMKA 3RU6A 4RZBA 3LHYA 1A5BA 1XSJA 3MMWA 3DAQA 3AYRA 5K9DA 5CGMA 1OFDA 4Z2JA 2NT0A 3TVAA 2Y8VA 2OB3A 3ZJ7A 1H09A 1L6WA 1GOQA 5H6HA 3URNA 3MVIA 5CJMA 4CN6A 5CZ0A 3WLIA 5A6BD 4FNUA 4LYRA 1LCOA 4D71A 4QCEA 3V1PA 5CPNA 1R9YA 4HJFA 4BS0A 3H8AA 7TAAA 4DN1A 1LQ2A 3MDUA 4FOJA 5JIWA 3KDNA 3PPCA 5BOFA 4M51A 3WX7A 3AXXA 2PGRA 2VC6A 5DELA 4C1LA 2D2OA 1JUEA 4LSBA 1EDGA 4FNRA 3IGHX 4LXFA 2Z7KA 4F2TA 2GJLA 4KWUA 4GBUA 3DC8A 5HR6A 4M8UA 1L2UA 1EBHA 1A5LC 4B5WA 3FA3A 2FB2A 5HK4A 3HPZA 2VJXA 1UIPA 1ZLPA 4HB7A 3MO7A 1OG0A 4DM1A 2P1FA 1UZ1A 3SR7A 3DBNA 3HV9A 4R34A 4AXKA 2Y7GA 3LBOA 1GOKA 3SCWA 2QDEA 3M0VA 2ZRVA 4Q8NA 4WHBA 3EB4A 1QWKA 3W2UA 4JIEA 2F2HA 1PYMA 3MY9A 2ZE0A 3MV11 1P0BA 1UR9A 1F73A 3FY1A 4MVAA 2D2JA 4QBXA 4UTTC 5KITA 3U3HA 3P2VA 1TE1A 1O68A 3GR8A 4GISA 4GJ1A 1KGUA 2XTKA 2XM2A 3M41A 5M1TA 5BZAA 5J8LA 2HK0A 1JEZA 1AQMA 3ZT5A 1UJPA 3MI2A 1US3A 1PKNA 1Y0EA 1UMYA 2I57A 3H2FA 1BLIA 1NAL1 2VFDA 2NQ5A 4AZIA 4MADA 4RNJA 1T5AA 5DXXA 3WDPP 3WJSA 2NX3A 4HK7A 4Q4SA 5KTLA 3PG8A 3OBAA 2QT3A 1VD6A 4ZE5A 1IR2A 1KFBA 2VL4A 1I0BA 4S39A 1GOWA 4LVAA 3I68A 2JEQA 1PV8A 1O5RA 4UQEA 1TIWA 1VPXA 3OVGA 2INFA 2DT0A 1C92A 5C7VA 2NSXA 1W5OA 4O14A 7XIMA 5KZ6A 3TX9A 3QKZA 4EPKA 3MCOA 3CUJA 4BI7A 1U2YA 4ZQCA 3UFYA 3UG8A 3AAMA 4ROPA 4YXGA 3QFEA 3NQAA 3H2EA 4BFAA 4DJDA 5CPOA 4PH6A 3CZLA 3LI0A 2G95A 3LHVA 5K9XA 3DCPA 5A8PA 3C56A 4GFSA 1AK5A 4WUIA 1VLIA 4Z2IA 8RUCA 1YNPA 1IXQA 3W38A 3ZOAA 1KFCA 2CLIA 1VBRA 5HWJA 4WX2A 1XBXA 3L4YA 4JTDA 1IHIA 4H3DA 2ZXBA 4A8LA 1W3HA 2WQPA 4MWAD 3CB8A 4PODA 5DF0A 2E5CA 4IQJA 2OYLA 5K2ZA 3CZ8A 1M3UA 2G3NA 4PBEA 4UR9A 2J9YA 3ZXWA 1QRQA 5A2AA 2XIOA 5FF4A 1DJZA 2O4QA 3ALGA 4PCTA 6REQA 1W8SA 2D3LA 1Q45A 3MI3A 1S2UA 3GW3A 2UY2A 3VYLA 1RPXA 1BEUA 4AZCB 4L9ZA 4NHVA 3MHGA 1JF6A 3KW3A 3TCSA 4QJ4B 1H60A 4O0KA 3AOPA 3AOFA 4X22A 2PWUA 1IEIA 4O28A 4IMAA 4DWSD 3QPYA 2W9MA 3UWUA 3T7VA 2GJXB 1JJKA 1RAKA 2PP0A 4NZJA 2Y63A 4P7QA 1DWAM 2ZQ0A 3M9YA 3O6AA 5LGXA 1BG9A 3N2OA 2ZZ1A 3W7EA 3C0QA 3TN4A 2DW7A 3L2IA 2ZRYA 2DVXA 1DIDA 3SCSA 2R1LA 2XSBA 3CHVA 2JQXA 5I6SA 2KZHA 4N9CA 3T4CA 3NPVA 1XGDA 2DPEA 3S9YA 2WJDA 1L6YA 4J7RA 4O1FA 4PA8A 3V75A 5AC4A 3BCFA 4O1DA 4QJ3B 1B90A 1EWEA 4MZ8A 4LT9A 2VX4A 3DI1A 3E0IA 4ZXLA 4FXRA 1CZ1A 3I4EA 1O66A 2CEQA 1QT1A 3MQTA 1E43A 3EA1A 2CBJA 3U48A 1FKWA 2QAPA 4OGZA 3DHUA 1E4LA 5D03A 4LV9A 3EWDA 2HPMA 1UHVA 4D6JA 1HQTA 3TEVA 1W1B1 2UZ9A 1EZ2A 4ZQRA 5C9RA 3STEA 4KH2A 3OGRA 5AHEA 1UBPC 3LYEA 2RAGA 4WZHA 3CYVA 3U2ZA 3AXKA 4JN7A 3MYOA 2J4GA 5ABFA 1CB2A 1W32A 5GQBA 3Q2DA 4DNHA 2R14A 1RSCA 5I3JA 3H6OA 4YPJA 3MV01 4GNKB 3ONBA 2YZRA 2VM8A 5FEXA 1O60A 3PTDA 3WCZA 2ZZ3A 1H5VA 3BXWA 1OD0A 3N2TA 3LHWA 3MMBB 4V27A 3AHZA 1IXNA 3P80A 4MY1A 4IG2B 4XISA 4XZMX 1MEHA 4WDXA 5FL1A 2O7SA 4OFCA 3CS2A 3FK4A 1OHLA 2BGSA 1W5NA 3K1GA 3ARXA 3ZT7A 2VO5A 3R4IA 2ZUNA 3UR7A 1IZJA 2QDHA 3ARPA 4JS3A 3FX4A 2XIIA 3G1RA 1EGMA 1J5TA 5I0DA 1SZRA 3RYSA 2WMIB 2FVLA 5A8OA 3SGUA 4LUTA 4XB3A 1VFHA 1VF8A 1KFLA 1S2VA 4UMBA 1BF2A 3H24A 3F4DA 4U4MA 4U2YA 4JFTA 4W4QA 1PXGA 1KR0A 2XPKA 1HO1A 4B90A 4MJMA 2AAAA 3KRUA 1CLKA 1QO5A 4I9JA 4D6DA 4LV4A 3UR2A 4HMDA 2BVWA 2GGEA 5FJPA 5C9UA 3MM9A 1O1ZA 4UFJA 3TK7A 4UZSA 3MMCB 4IF2A 3BLPX 3AHVA 3LCLA 3GH5A 1D3GA 5E09A 1GYLA 1PS9A 3WLJA 1C8QA 4LC8A 5CPTA 3WUFA 5IFTA 3POHA 2V9DA 5FEZA 4ZFCA 3PWGA 1OYAA 1FXPA 3C4UA 1DEDA 3LA4A 1QAPA 8TIMA 4Z08A 2R91A 2IKIA 1LOQA 3VLZA 1DJHA 4Q8MA 1IIGA 3EX4A 2J6VA 3LLDA 1Z42A 1KM3A 3EMQA 4WIWA 3AYSA 3WQEA 2KAUC 4TMBA 4Q8WA 1E9ZB 3ARVA 1UG6A 3THAA 1A53A 4ZOBA 2F6XA 1FDZA 1I45A 3W83A 1VYPX 4H9YA 3W7LA 1J4EA 3HN3A 4H41A 4XUGA 1P43A 1VBGA 4LAZA 2NV9A 2UBPC 4D9PA 1KWGA 3MP4A 2Y4SA 4AY1A 3GAKA 3AU6A 5E0FA 4PUUA 4J3TA 4UFKA 3UBPC 3PG9A 3BGGA 4I9AA 4DXKA 2YCLA 2RDTA 1EKOA 4JXCA 1R6WA 1WOBA 4QR6A 3GO2A 3PTKA 1VBJA 4DNMA 3UETA 1X1ZA 3HOJA 2A3AA 4O0ZA 1E1EA 4V33A 4JX4A 5BU6A 4PRWA 3FAWA 1Q6OA 3SIMA 1UZDA 4BQ4A 2TAAA 4GXPA 3S6OA 5C55A 4AD5A 1ZHAA 3WQFA 1B30A 2W3ZA 1UA7A 3ZSTA 1MFVA 2OO6A 4C6MA 1JUBA 3WD3A 4EAYA 1JGMA 2NQHA 1KM0A 4GX9A 3LM3A 3W02A 3NG3A 4X9YA 1Z89A 4J28A 3LTYA 5DXYA 2ZRZA 5CCZA 1XYBA 1TV8A 2PLJA 2FJKA 1XC6A 2G37A 4PCPA 3WJZA 4S1FA 4AVNA 2E8YA 2Y7FA 1XLCA 4P5UA 1UR3M 2Z25A 3G0UA 4UTUA 3U5YA 1V6VA 2W67A 4URIA 3PNUA 1F8IA 3BCDA 2R8WA 3IGUA 3H21A 3QHNA 4TMCA 1C93A 2UV8G 1B3OA 4F48A 3GTXA 2OX4A 3RUBL 1XLKA 4C6BA 3N18A 4HSOA 1AD1A 1ZAHA 2EPLX 3D6NA 3KCJA 1PJ9A 3S5SA 4JCLA 4E4UA 2VZSA 5DT7A 4Y7EA 3R58A 5D05A 1BTMA 1EF3A 3BQ5A 1ONWA 3AMGA 1RBOB 3LPFA 1NFGA 1RV8A 5CPQA 3V0SA 1EP3A 4XAFA 3LLFA 3CQ0A 3IJ7A 3T6CA 4GC4A 1TV2A 2AL2A 3SBFA 4UZUA 2XWEA 3GKFA 4XVEA 5MHBA 3GIYA 2JIWA 1R3QA 5FL0A 2EJAA 2JFEX 1GOIA 3GVGA 1AA1B 4ZOAA 2VFEA 1EQPA 4V1YA 4X2RA 2ZIDA 3WQVA 4FIRA 1ZB5A 4O50A 1CGWA 3BLOA 1XH1A 4CQDA 4PL2A 3E5PA 3AS3A 2QUMA 4PFHA 1WXYA 3GTIA 4FLQA 1ZAJA 4GINA 2G3JA 2BSLA 4PMRA 3CT7A 5A6SA 4EX4A 1WCGA 2OCZA 3BUVA 5DQPA 5D2YA 4N2YA 1VEOA 3OODA 4O0QA 4DAFA 3KX6A 3NIYA 4AD1A 2BOGX 2EO7A 3B97A 5BU9A 3T55A 3H4XA 2J13A 2GSHA 4RPPA 4JTHA 1Z9AA 2OPJA 1VHNA 5FJTA 3P84A 2VEMA 3U2OA 2PLKA 4EPDC 1I2PA 1YTDA 4NJGA 3RMJA 2QCDB 3LNPA 2B0MA 5FI8A 3SCRA 5AYZA 4GGHA 3TONA 2WMGA 1DXFA 1GHRA 4GNJA 3LPGA 4A3QA 3W7QA 5A6JA 4O15A 1J0YA 1FWSA 3NSMA 3NUKA 4HNVA 4GIYA 2QIIA 4O19A 3BG9A 4DEFA 5DT5A 1GKPA 1XGZA 3PZTA 3LQGA 4XZWA 3ID7A 4S3FA 3VIHA 1V6WA 2BHZA 4R53A 1IZCA 1KRBC 3WF2A 2GGGA 1FH9A 1KXHA 1W9XA 3WLLA 1WAUA 4HZ7A 3MM8A 4YU1A 1S39A 4IFKB 5G5IA 3LSBA 1RVGA 1MZHA 3GU1A 5FIPA 3MUCA 2D2HA 2AAMA 4AYGA 1A5CA 1LROA 3MM5A 1V5XA 2G3FA 1UR0A 3DFQA 1TV5A 3VM5A 2A79A 4ACYA 3A3XA 3AWNA 3BGJA 1P7TA 3GB6A 2BG5A 4QS5A 4L6DA 4BF5A 2P0IA 2ACSA 5F4XA 1OADA 3DYPA 3PBUA 1F4AA 1NJJA 3ZO9A 2CWXA 3GXTA 2D69A 2O9PA 1LG1A 2H3DA 2P50A 5LGZA 1KM5A 2J7EA 3O16A 3VD4A 1HF6A 3E96A 5AKQA 2A21A 3AIVA 2Y24A 3N19B 3BARA 1TIMA 1VH7A 4NZFA 2VX5A 2CLKA 2ZVRA 3OYZA 3DH7A 4PE8A 5G4HC 2PZ0A 3N6JA 2XH7A 3CUFA 2AMXA 3S5NA 2Q71A 4B5NA 2IUZA 4JIRA 2XIQA 1IT7A 2VVSA 3PZOA 2NX9A 2CPUA 2QV5A 1ZJBA 5I77A 5J04A 2INEA 4QDWA 3DXIA 4S3BA 2EGZA 4H01A 3OB8A 4BA0A 3O06A 3MMUA 1SJDA 2VP8A 1C7SA 2CHNA 3T0DA 3L66A 4I8YA 1KKOA 3REQB 3FEQA 3W74A 3I10A 4WKAA 3GXFA 4L80A 2ZRWA 4YLWA 1A5SA 4CEXC 1E4NA 2WZTA 4MY8A 2BXVA 5A6MA 3P8IA 1TPH1 4DJED 5A2BA 1MDRA 4RV3A 3VO0A 4G1KA 5AC6A 1Q7QA 1XR2A 3CZJA 2YFOA 3EWUA 2OKTA 2REQB 3QHOA 2GOKA 4ATWA 3POCA 2Z00A 3WNOA 4A3RA 3T0TA 3V4BA 1IZKA 5DCBA 3ATZA 3WNMA 4PYSA 1VZWA 1TTPA 3OHMB 1LL6A 2H3BA 2QVHA 1V8EA 3MDWA 4Q4OA 3DG6A 4WSJA 4JPGA 5AHIA 3T1GA 3G1VA 5I7GA 5F2IA 4KGJA 4JDYA 3ALFA 5D2VA 1W1A1 2QNEA 3B0PA 3TMQA 4CVWA 3MM7A 2GK1B 4LUIA 3G0XA 3FKKA 4E8DA 4BEUA 4K8HA 4OV4A 1EB3A 3QF0A 4WJ8A 1ZTVA 3VCRA 3B9DA 2OGYA 3OHIA 1GOMA 5DEZA 1KB3A 2V3FA 2A3HA 3OR1A 1DOSA 1UP0A 2ZA1A 2HXUA 2PDCA 3L65A 1PEZA 4JAWA 1TA3B 5HINA 2PDHA 3PANA 1JDCA 3KP1A 3UW6A 3M0JA 1K8YA 2XM1A 4NY2A 3WK3A 1KTBA 1ICSA 4HZ8A 3AS0A 2INZA 4HBKA 4TQTA 4K2SA 1VENA 4C1NA 4C6KA 2BP1A 5IDZA 4OOZA 4HPGA 4CQ8A 4NI3A 4L65A 3VU2A 4PCFA 1BVNP 1DQXA 3ANYA 4UCGA 3R43A 1K70A 2JKPA 2OWWA 1RH9A 2G96A 4W5ZA 4Q7BA 5K4XA 1PIFA 1PB0A 3GAYA 4M56A 4ZO7A 2X41A 1D8CA 2XN0A 1NVMA 3FSTA 3WZ0E 5DANA 3BLIA 1W0MA 3LHZA 2CXEA 4L4MA 4JICA 3TSBA 5CG0A 2Y0FA 5CZSA 4KFNA 1BVZA 3M0IA 4ORIA 4JTJA 4XWUA 1GVRA 3G18A 3P5YA 4I7UA 5REQB 1I60A 3RX3A 3M0YA 2CLPA 3MBFA 1X97A 4HNCA 1XCWA 2QDDA 4LAOA 3AS2A 4P61A 3BC9A 2QUTA 1NOFA 4QQUA 1RJQA 3B4YA 2VDHA 3HGJA 3N1AA 4O54A 1CXHA 2V2HA 2GDVA 1I2NA 2EPOA 2PDNA 4MYAA 2TSYA 3P93A 5KZEA 2C1HA 1XLFA 3M1ZA 1J8VA 3B9OA 5HWMA 5JIPA 1X8FA 4RDWA 4TUFA 3VI2A 1TRDA 4S3DA 3F4CA 4A2RA 1ZJIA 4C6QA 1QDSA 1GJPA 5I23A 1IQ8A 5LIKX 3UWWA 2GVEA 3W1LA 4FS9A 3RMEA 3MKKA 4W88A 5HNRA 3FEMA 1FWAC 1C8XA 3AUJA 2VEFA 4LS1A 3CQKA 1VPQA 4JHZA 1H7RA 3WBYA 1TJ0A 3TC3A 2V3GA 3SCNA 4UTTA 3MJMA 3WLHA 1GQJA 2Q8LA 5E9AA 1YDNA 5E1QA 1VAHA 3B8WA 3XISA 4QGCA 5DFAA 2QZRA 4LVGA 3HBLA 4EIVA 4G7EA 4GLEA 2VEIA 4DF1A 3AYTA 5FACA 1OT2A 2CW6A 4P7RA 2Y85A 1OB0A 3WDQA 3GFYA 2B7QA 1R2RA 1VGAA 3AHYA 2P5NA 3B8UA 2CNCA 3CHCA 1I1WA 3MUIA 4RZ5A 1H1NA 1TZ7A 3B0MA 2WSYA 4JTUA 3RN6A 3GTFA 5FJRA 2PLMA 3VLXA 8GEPA 1AL8A 1EJUC 2YW3A 1OGBA 3IV3A 4CN4A 2WB5A 1RCXB 2Z1BA 3GNNA 1D3CA 4LCQA 3M16A 4WY0A 1QNQA 3RJYA 1WKYA 3WNLA 3TR9A 1KM1A 3TSMA 3O6YX 1RBAA 4US5A 3GSMA 3ICJA 3DKJA 4IXXA 1LBLA 4BF9A 1H41A 3SIZA 4H9UA 3FNDA 2V69A 2ISWA 4GI4A 4HSNA 4IJRA 4GUHA 2YXXA 3MUXA 4MIMA 1HJUA 1FWFC 2BB0A 2EKGA 3GDTA 3RLHA 3OBEA 1WKEA 3P74A 1U5JA 3A5VA 4KS0A 1FBAA 5FF0A 3KOFA 3QOMA 4R85A 4YVPA 4PL1A 3AI0A 3NDZA 1JCLA 3D3FA 3VM0A 1QNVA 1B4KA 4B3LA 4JNYA 3P81A 5E6ZA 4PUKA 2P10A 3DHDA 3SUWA 2QVNA 1AVAA 3HPSA 3EMCA 3UP8A 3IARA 3SRFA 3N3MA 5KMYA 1GG1A 4E2BA 2WVTA 3LRKA 3P60A 3HJEA 4UFIA 2YSWA 5EMYA 4E0CA 5IOBA 3DFPA 4LANA 1P1MA 1SFSA 3QJAA 4MGGA 5JH1A 4UTFA 1CXEA 3VKBA 3W1TA 1RZMA 1KFWA 2JF6A 3QBUA 3W26A 2CETA 2GGIA 3I7RA 4IX2A 3QPZA 1YXDA 3QV8A 3RCNA 4FHAA 1GVYA 4MPQA 3TJ4A 4YWSA 1J0ZA 1D9EA 2YA0A 2VRKA 4NZ4A 5D2TA 2JALA 1PKYA 4HNNA 5KZDA 1YTEA 4JKMA 4Y90A 3WBWA 3NZPA 1G4TA 1CXIA 3FGCA 3QGAC 3NWRA 2BTMA 3RPMA 4O57A 3A4XA 1GW9A 3G3MA 3STCA 3ZVIA 1LOLA 4GYPC 1S3TC 2DU2A 3G1AA 4AZGA 1CGVA 5GNYA 3IRSA 4MLRA 1XLHA 2ZZ2A 3NGJA 4JTIA 3RILA 2PP1A 2QJIA 2GUUA 2DZAA 4ZQNA 2WMKA 2ZCGA 3W9ZA 3UGVA 3K8LA 3WLTA 1J2BA 5AHNA 2DFAA 4JIPA 3V35A 1DHKA 1TUXA 2X40A 4D6GA 2C15A 3NQFA 5GEPA 4LALA 1XD1A 2SFPA 3TZNA 3CO8A 3L12A 3LENA 3TYCA 4KMQA 1EHAA 4KWWA 1TZ9A 4I5XA 1W17A 3DFTA 1TE6A 3DC0A 4J2PA 4C6OA 4W5UA 5DBTA 1OF8A 2V3EA 2OELA 1TVPA 3CASA 5EFDA 4KESA 4ADSA 3MPGA 2RGLA 2YX0A 1NWSA 4S2CA 4N9DA 1KCKA 2XGIA 1OD8A 4ZCWA 1MXSA 3EPMA 2E3ZA 3VD9A 2VELA 1XYZA 5LXXA 3SZ8A 5C6MA 5M5DA 4GJJA 4AYSA 4UQAA 4QAIA 4E6MA 1WAWA 2OG9A 2Z6IA 4CQ9A 2X7VA 3CZGA 3ABZA 4L9YA 1FTXA 3C0JA 3QXBA 5EMMA 5ABTA 2OLHA 1TELA 1K1DA 3TP4A 4AUBA 2XSJB 1FKXA 3KXQA 3A3HA 1CYGA 2PDPA 5EMLA 4UQDA 2IKHA 1JZ8A 2Z0IA 2EBNA 4PTMA 1DP0A 3A21A 1V6TA 2TYSA 1EIBA 1KNWA 5EMUA 1QPRA 3VIGA 5A8NA 2WSPA 2FGZA 1ZU8A 4TTUA 1O7AA 4FO4A 3N25A 2FLIA 2C0HA 2QCHA 2A85A 4B9YA 3OBKA 4S38A 4DELA 2PU1A 3N6HA 2DJXA 1B9ZA 1N8WA 3NQ8A 2VT0A 1SR0A 2JKEA 4KEUA 2PS2A 1L2QA 4GFIA 1IGSA 1LT8A 2OEJA 5D4YA 3SQLA 5BNKA 1KFEA 3UY8A 3UPWA 3WEMA 4GPNA 3M47A 1E6PA 2X2YA 4O53A 2GVLA 1F7BA 4BWLC 4DWDA 2YCJA 4NJKA 1QPKA 4MJZA 4DLFA 1UKOA 3QEZA 2G5WA 1RBLA 4XZHA 3K8KA 2X2GA 3SGZA 4NILA 4MNKA 1HGYA 4PSRA 3AIWA 3VGBA 5IBXC 5CBIA 2WMJA 4U3CA 2FZ8A 1TQXA 2XH2A 3D47A 5C2XA 1CGTA 3AHTA 3LTSA 5HMEA 4W8LA 2ZX7A 1V3IA 3T44A 4MFDA 4RW5A 4FP1A 1F5ZA 3DHFA 4YS1A 4GHRA 4ONVA 1CIUA 2ALDA 3QSTA 5I00A 5AY7A 1RVKA 2NLYA 4RXGA 3IUHA 1X6LA 1WDRA 2O0TA 1BPLB 4HZ6A 3TOYA 1ICPA 3MSDA 4M3PA 3EWCA 4WGXA 4K3ZA 2DZPA 3S1WA 3R6IA 5EGRA 1E6QM 1DJYA 2GVYA 1M03A 1BSIA 1OJXA 4HJWA 4RV8A 4EXQA 3UXAA 2YYUA 3CAWA 3VILA 5IHSA 3W75A 1QASA 5CBBA 1TV3A 4GUIA 1PCWA 3WQDA 2PGFA 4YTUA 4DBWA 1EEXA 5CG7A 1XBYA 2Y7DA 3EA2A 1W31A 3JR2A 1F6KA 1H7XA 3GNXA 1PX4A 1SO3A 5CC7A 2WVVB 2I5IA 1LF1A 4LUSB 1PX3A 2OYKA 5HOSA 1VCVA 5SWUA 2W61A 2RUSA 5BXPA 3NL5A 2WMHA 1E4MM 2D1ZA 5H2ZA 4GWEA 1KBBA 1M5WA 4HHPA 3SW6A 1K9EA 3VABA 3VTRA 2IKJA 3W2MA 1K9FA 1OQFA 4C5ZA 4G39A 1FFQA 2R1KA 2WCSA 3ITLA 3T42A 3VA8A 3MVTA 1J0HA 4R3UA 3BDKA 4LQ1A 3N17A 2BY3A 3W72A 3P0XA 4F9JA 4HP5A 1XIMA 1F9CA 4XG1A 3ONCA 3VOCA 4H9ZA 3UERA 4IQLA 3V36A 4CQCA 4B2DA 1HVQA 3TUUA 2NSOA 4B4FA 4MWAB 2XN1A 1D8WA 2Y5JA 4KWSA 3V18A 1I2OA 3NQVA 2YOCA 3TROA 3WD4A 5E6YA 3BMXA 2QCLA 2PGEA 1JR1A 1SUXA 4ZB5A 3EZ4A 1UZ4A 2P76A 3WLRA 2EKCA 3OGSA 1SW3A 1VFLA 4LAMA 1PTDA 3GG7A 4NX0A 5M2FX 1GCYA 1OEPA 3EWWA 1J01A 3TJIA 3SADA 1GVOA 2A6NA 5HQLA 1LDCA 3AISA 4F79A 4ERIA 2O92A 3GDRA 5I5RA 3W7MA 2V5CA 3PPFA 1AL7A 1VKFA 4WCJA 4DWSB 3SGGA 3MSRA 1PPIA 1OM0A 4ATLA 1XKJA 1FWDC 3G8EA 4UTWC 1BHGA 3BSHA 4AZ5A 3HA1A 3N13A 3GRIA 2OJPA 1K9TA 5JXQA 3VZXA 4MG4A 4CNUA 2J6XA 3OLEA 3NQEA 1AZ1A 3T4WA 3VM7A 5H91A 4CUCA 3VX1A 1KCZA 1OSEA 3M07A 1TPEA 1X6NA 1VFFA 3R2GA 3GG1A 3SECA 4EF9A 1R85A 2H6RA 1A4MA 4AZCA 4DPPA 4AZ6A 3LB0A 4J9JA 3VKQA 3C2RA 3BLFA 3R8RA 1WUFA 3TAOA 3UYCA 3W71A 1BKSA 1TB3A 2R6OA 1SJCA 4FNSA 3P5ZA 3K5XA 4MB1A 1Q5MA 3APGA 2PB1A 2D2GA 4B5SA 3WJWA 1HJQA 3WF1A 4Z0SA 2POZA 2QCMA 3LS9A 4QEEA 2RH9A 3R1ZA 2GJXA 3JZUA 4UNKA 3WNNA 4DYEA 4BQ3A 4W8AA 3R10A 1J0JA 4UTIA 2ZZ4A 1FP8A 3DHPA 5IDIA 3QTPA 3C0SA 3PFRA 2WM1A 5FOOA 2IQDA 3TV8A 3TYDA 4D8LA 3WNKA 1YKWA 4C65A 5I2UA 3H22A 2FFCA 3OVPA 1AH4A 4ZTXA 4WEVX 1ZGDA 3WN6A 4IMCA 5H1WA 4RE2A 3W27A 1NF7A 1JPHA 1K8XA 3TNBA 2V68A 4KRZA 1SSDA 4KCWA 1QTWA 3XIMA 2VUYA 3G1SA 5FJIA 1F3EA 1A3HA 3T2QA 1VFOA 4FNPA 4OBRA 4OVXA 5GNZA 2VR5A 2O7QA 2E5DA 2DW6A 5ABGA 3LERA 2C3ZA 4V28A 1O5XA 1VYSX 2CKRA 2HS8A 4NJIA 1CGUA 4G8TA 3GXMA 4FR6A 4IQDA 5H8MA 3W86A 1IYXA 4Q8TA 5DO8A 1JDAA 2J9ZA 4QLJA 1HG3A 4L1GA 3R11A 1JCTA 2PBOA 4HPXA 1C7TA 3BW3A 2GQAA 2C6QA 3RU8X 3AMKA 1M6JA 3QMTA 4NASA 2F6KA 3H7UA 2OSWA 2R1MA 1ZL1A 4MAVA 1QHPA 3C0LA 1K7FA 1YW1A 3UZ5A 3UCQA 4G9PA 3W4RA 3UNDA 4GYFA 3LN3A 3W37A 3EOSA 3CAQA 2OLSA 4LU0A 1WDDA 1ZSXA 2Z7GA 4MUPA 1C90A 4YHEA 3WH8A 3CWNA 3W3OA 3AXMA 1ELSA 3ITTA 5T9CE 1KXVA 2BVYA 1KTCA 4ZQMA 3GD6A 4QM1A 2FQIA 3CL8A 4GY1A 3QVQA 2AGKA 1JXKA 1D2KA 3MJYA 1EH9A 3VKAA 5KZMA 2WPBA 4HHLA 1UWIA 1XYMA 1FWGC 4AZBA 5HPCA 4Q33A 4IMEA 3VXGA 1XX1A 3WSUA 1SO5A 4IG2A 1OCQA 2TMDA 1AW1A 2VZTA 3BQ6A 4LVDA 5D30A 3C8FA 1XYLA 2RHGA 1QOPA 1RQBA 1F3XA 4MJ2A 3C86A 1S2CA 5TNVA 5HUOA 3T40A 3RX2A 1QI4A 1EP1A 3JZEA 3ZWSA 2WMIA 3SQMA 1ISYA 4GZ7A 4QP0A 2WHMA 2PDYA 1UWUA 3NOYA 4WRHA 3I65A 1JAEA 3H4GA 4LOCA 3W22A 3S9ZA 4S3AA 4ICCX 3PZVA 1EGVA 3LRLA 1XV8A 3LPPA 2C8NA 6XIAA 4BI5A 1UOZA 5D2WA 2YB4A 2VRJA 3E1F1 5HAOA 4H04A 4BJHA 2RDUA 3MMCA 3UCDA 1XIBA 3EX2A 1Q6LA 1RP9A 3PS7A 3LBMA 4YN5A 1ZP4A 2XSAA 2A3BA 4KT2A 4DHGA 4QEHA 4CLMA 5HR7A 2FIQA 2Z2AA 4UQ9A 2OU4A 5DCEA 4WOQA 4YIWA 3ORWA 3CHFA 4Z2GA 1OZMA 4ACZB 1FWHC 2PMQA 5CGTA 5I79A 1ZQ5A 1HGWA 4GCXA 2WZIA 4O8AA 1F6YA 2FZMA 2E68A 4F0HA 5BW6A 2V67A 1E0UA 1VLWA 3IVTA 1OG6A 2WO5A 5A69A 3V5FA 4X0NA 3DU0A 1FCQA 3EPNA 3NR0A 3W87A 4W7VA 2QJMA 4IJBA 1H7PA 2XGZA 4DRSA 2YYTA 4B92A 1X98A 3ZR4A 1MVYA 4GZEA 2W6RA 3STFA 2DT2A 4LX4A 9XIAA 1SJBA 2VTFA 4H6RA 2QUVA 1QWGA 2EJ1A 3B0XA 2E67A 1E9LA 4LVBA 3WK2A 1W1IE 3FS2A 4DUXA 4LPCA 1Q6GA 3AJ7A 2FPTA 6GEPA 2WZHA 2VCCA 4UR7A 4J5NA 1ZBCA 5AYXA 5CQ1A 5T9BG 4DI8A 4RNIA 3SB0A 8CGTA 2YJQA 4PSPA 3N6QA 3II1A 2Y8UA 4FLSA 3SCTA 5L6UA 3PK7A 3HG2A 1TPVA 3FLUA 1VP5A 4ZVJA 5D2XA 1K02A 3RLUA 2AOPA 4RDZA 1UQZA 3CHDA 4P7NA 4O10A 1WA3A 1RLCL 3UXDA 4Q6JA 5CPLA 3UZZA 2QDGA 4P8UA 1W1YA 2V4JB 4KPLA 1LL4A 3W7CA 1MI3A 3KAOA 4B5VA 1JRBA 5CC6A 2Q3OA 3HPFA 2FFIA 3H70A 4H6QA 1JVNA 4W93A 5CLWA 4FPSA 4W85A 2GPTA 3LXBA 1N55A 1TKKA 4E8CA 5FAGA 1KRMA 3TC7A 2FTWA 4S23A 3LV6A 3A23A 4MKSA 4R9OA 3N2MA 1ISZA 4DX3A 4GXWA 4B4HA 3Q4DA 3ZSSA 2D73A 3CZEA 5EMJA 2O4MA 2E4TA 1GVFA 2V5KA 3IIZA 4TOQA 3MUY1 1YPIA 4JNZA 2NVCA 1X1OA 1ISWA 4QAWA 3BWWA 2W63A 1M04A 1JCJA 3GFXA 4Y8FA 5CSUA 2CESA 3TN6A 1CPUA 3T0BA 1E56A 3VKPA 2BWGA 4MB5A 2PPGA 4QDMA 3KBSA 5DMNA 2QEZA 2ABBA 3HG4A 1UP2A 2CITA 2PU0A 4YCPA 2Z6JA 1RALA 3W2LA 3PSWA 4FOKA 3M5XA 4LS0A 3GEOA 2EPNA 1IEVA 4H7VA 5CC3A 3ME3A 3S4TA 1TYGA 1JDFA 4D8ZA 4FX6M 2BMBA 1JQXA 1LUCA 4PZVA 3DDMA 3RGTA 5F7UA 3B3DA 3HMCA 3A9IA 2DQWA 3E12A 1GGOA 4F9DA 3WH6A 3N4EA 4PMNA 4OECA 1SU5A 2ZZ6A 3BOXA 3WLPA 3SQSA 2PODA 2ZZ7A 4LRTA 3T8LA 3M6DA 3ZS4A 2VC7A 5F2LA 1XICA 1K4GA 2YL9A 4J3XA 1EOKA 2OQYA 2QCDA 1ZENA 3LG3A 4OKDA 5EBAA 1LYXA 5AYIA 3R8GA 4JKLA 1ZCCA 4XK2A 3QLDA 4NAFB 3UD6A 5I78A 2ZUTA 4HA4A 1UH3A 2ZA3A 4LB3A 2HVNA 5FKYA 4ZA0A 5BXRA 4R5EA 5AVNA 2E7FA 4HA3A 1RP8A 1J11A 3WFLA 3M0ZA 4INFA 7TIMA 2OWCA 4ERGA 2FGBA 3UVAA 2J79A 2PDGA 3MO4A 1NDWA 1NM9A 5AFDA 1HKKA 3DERA 3CMJA 1UKQA 3NM3A 1KLZA 1AW2A 4AX6A 2XGBA 1NARA 4RK8A 2PAJA 1U1UA 4IFKA 1TWZA 4DJFC 3DOPA 2JK2A 1UWSA 4J27A 1W37A 1T8XA 1JL8A 3W84A 3ANUA 1DWGM 1GWJA 2ZE3A 4FR1A 1DV7A 4W87A 7ENLA 3RX4A 4AVFA 2X16A 4JTRA 1Q6EA 4NL1A 4DXXA 2XFWA 1GEHA 3PZ9A 3FIGA 3B8TA 3S46A 5D37A 4LY8A 2E9LA 5M03A 2W4XA 1G94A 3RDKA 1VPYA 4RXFA 3B9AA 3KUMA 1TRIA 4LY4A 6PTDA 4H6KA 4OBTA 3SFWA 4Q8OA 1XGEA 4IUOA 1JCNA 3M7WA 3B04A 4AD4A 2Z26A 3UJSA 3L23A 4M7SA 4DY1A 2A4AA 5EU9A 3MCMA 3M4HA 3E49A 4H8UA 2NWSA 3K8MA 4GYPA 3HO8A 4A3YA 4IPNB 2FZBA 3LOTA 4H2HA 3G6LA 1YBQB 4RL3A 1XUZA 2P8CA 1HX0A 2B7PA 3PUEA 1MO0A 2J9XA 1UH2A 1SQ7A 5JU6A 3BSMA 3NCOA 2QJGA 3KBJA 4NZ5A 3C2VA 3I3DA 1E6ZA 3GHTA 3LV5A 1NP2A 1R7OA 2VR4A 3HQOA 4M29A 5GPRA 4JBRA 1B0IA 2IPJA 4ZB2A 3S1VA 3REQA 3GUGA 2GEPA 2QCFA 2WVUA 3ATYA 1S3HA 5BMWA 3NO3A 2HEJA 3O15A 3ARWA 5LNVA 2VURA 4IQEA 3OO2A 1EO7A 1RJRA 5JVLA 3B0LA 2PWFA 1XLJA 2A2IA 2XUCA 2J78A 4CU6A 4FNTA 4JTAA 3UR5A 2OLAA 1SR9A 4KFOA 1Q6DA 3D0CA 4AD3A 2C71A 3TW6A 1KRAC 2OWXA 4ZQPA 3NZ1A 2X1IA 4RE3A 1FHVA 1U5HA 1BRLB 4DO7A 2JKAA 3SUUA 3B0UX 3QQWA 2BHUA 3XINA 4OIFA 5HBFA 4F40A 2PDQA 2RDXA 2PDIA 4W86A 1CXLA 2H8ZA 2VEPA 3M0HA 1W3IA 2DUAA 1LBMA 3UR8A 2BBFA 3KP0A 3PAJA 4HMEA 5I09A 3VMPA 4OBSA 1XLDA 3NO1A 3E0VA 3KWSA 3LLXA 2GK1A 4HCHA 1IXOA 4NU7A 4JHMA 3VNDA 1FY6A 4KETA 5BYWA 5TF0A 4U31A 4ERAA 3AUOA 1F74A 2H90A 4JX6A 4RW3A 1XXXA 3VKSA 1CENA 1QOQA 1DE5A 3LXAA 1SFTA 1YYAA 2PDUA 4NYUA 3VNZA 1V02E 3OEXA 1TA3A 3U7VA 4GE8A 3WF0A 3WJYA 4QE4A 2GJRA 2VDIA 3CXOA 5FF7A 1RD6A 2VGFA 1DE6A 3HGOA 1OFEA 4AY8A 2OX1A 2WWDA 1CBGA 2Y8KA 4PBFA 1EXBA 2BY2A 4E4FA 3E0LA 1MQQA 3IJIA 5DLCA 1GVQA 1S2AA 4PMDA 2Y89A 3MT1A 2OTDA 4KCVA 1G4PA 1D3HA 2PI6A 4N0RA 3DKLA 3VIMA 2NX1A 1EX1A 4Q8VA 4FAMA 2Y1HA 2YIHA 1MUCA 1FDYA 1H4PA 3QQ1A 2L5HA 3W7HA 4R7OA 3SUVA 1XPYA 3EB3A 2OYMA 1TR9A 1Q8JA 4GO8A 1GTEA 1QOXA 4S3KA 2DSZA 2XDFA 3OPSA 1Y65A 1BAGA 2DZXA 4RUBA 4LH8A 4RDVA 3U5UA 3UXKA 1X1NA 3R25A 4M82A 2PCEA 3HGSA 2E09A 1XHGA 4NI8A 2VCBA 2J8TA 2OT1A 4RE0A 1M53A 2WK2A 1OC5A 1XS2A 1F07A 4N9BA 3LD5A 1IT8A 3MYPA 1JZ2A 1V0KA 2V5JA 3AIBA 3LCIA 3O63A 2O9TA 4OUEA 3R7MA 1BWLA 5ECVA 1OVDA 4TXEA 3EWXA 2P88A 3OW1A 1A3WA 2WNZA 2GSEA 5F1UA 1SZFA 4FXSA 1B4EA 3ENLA 4ZENA 1PTGA 3QKEA 4NT0A 1JFHA 3ARQA 3NQCA 4WDWA 4DO4A 3PP7A 4X60A 5IRPA 3S9IA 4FK9A 1O5KA 3RNDA 1OYCA 1IE7C 2ZX8A 1HL9A 1TO3A 1BF6A 2A6LA 5T8GA 4K8GA 2PGWA 1CX9A 1XBVA 3VKCA 1TUFA 4WKHA 2VDGA 2FKPA 1E6NA 2DZVA 4CGTA 1HJVA 2J25A 4HD5A 3CEPA 1LLZA 4ZFMA 5TAOA 2POTA 1OGGA 2IKGA 1EL3A 1TMLA 3UPBA 5HMFA 3K4AA 3SN1A 4GKTA 4ML9A 4Q3MA 2WZMA 4ILSA 2UY3A 4AC7C 3C3NA 3H2OA 1Y8BA 5DY2A 3USZA 2YLLA 4GRSA 5D9MA 3B9EA 2PWDA 2J47A 2YDAA 1A5NC 3VGEA 2DT1A 1YMYA 1FWIC 3VLYA 1M9HA 4MWAE 3IANA 2ALRA 1DL3A 2EPHA 4M7TA 5BRQA 2YBTA 4HK5A 4ZMGA 4WSKA 1LWIA 5JBEA 2C13A 3G24A 4O17A 3ISIX 4GYJA 2CLHA 4HZMA 4PB4A 2BVDA 1RY8A 4E4PA 3NXFA 3B0GA 3ARTA 1EUNA 2ZTKA 4HN8A 1KWKA 4L7ZA 3KBWA 1MWOA 4QE5A 1EXPA 2E6YA 3WL1A 1O1HA 3VKRA 4FA3A 1NP0A 3K4WA 2H9AA 4LF2A 4H9XA 1LQ0A 2Z1VA 3S8HA 2VD9A 1CXKA 1IWAA 2PSNA 3TN3A 2XJ7A 4HSHA 2ISVA 5EKYA 2ZRXA 3HG3A 1V93A 1P6CA 1KQYA 3VZYA 3QMSA 3TQVA 3EKZA 3K13A 4IL2A 4NRSA 4G2DA 1NU5A 3B8SA 1BXBA 4IPJA 2G4JA 4O1EA 4G38A 3T8QA 3V7PA 1W8GA 3BLDA 3TLQA 1M01A 3DYMA 2Y61A 1Q13A 3WKZA 3FJ4A 1ME9A 1PVNA 3FA5A 1WKDA 4C6NA 2HE8A 3BAKA 2CLFA 3FAXA 2C91A 1EC9A 3OQ8A 2QPXA 4S2BA 3CV1A 3W1AA 3S2MA 5H8UA 2CHRA 4U3AA 3HGRA 3WUEA 4CNPA 2WHLA 3FDGA 3TKFA 4GYKA 1NOWA 2G97A 1TPDA 4Q6XA 1I0DA 4YCOA 1P5BA 1THFD 1OFQA 3NNTA 4JX5A 3NQ7A 3PTQA 1Q6RA 4ICMA 1PAMA 3TN5A 2PEVA 2BVTA 1G0CA 4O52A 2P3ZA 1RXOB 2PBGA 4QJ5B 2HDJA 2YL8A 1HKVA 4PMJA 2DUZA 3BV7A 4NKCA 4P8XA 1AH0A 3PJTA 2VVNA 1EOMA 3MW7A 4U2ZA 1GKRA 1TX2A 1UUQA 2GUBA 4XD4A 1L9WA 1MW2A 2QGHA 4MJ4A 1GYMA 2WNWA 4DJEC 4DO6A 2ZA2A 3ZZ1A 3DBPA 5AOPA 1SM9A 4FXFA 4CQBA 3FHAA 5EL1A 1OABA 2J77A 3CPRA 1J0IA 3CJPA 4PGLA 3TU9A 3PR2A 3H2NA 2PDKA 3H2CA 2QW5A 5D09A 4DPQA 1ZPTA 2YPIA 3QR1A 3VC6A 3IJQA 1PZ1A 1GQLA 3OU8A 4M1RA 1SFJA 2XG9A 3O0FA 3PZQA 3TW9A 2X1TA 2Z2UA 1UC5A 1A80A 1V3HA 3H55A 4DZIA 3T81A 4IZGA 4JTTA 4LEFA 3LCHA 3WQOA 4DJDC 2D24A 3HZ3A 2J74A 5DMYA 4M6UA 1V08A 4EWND 4H7CA 2FVMA 2F38A 2YXOA 3IGXA 4LEQA 6TAAA 3MHUA 5A1AA 3M6YA 1TPC1 3MKVA 3PBGA 2E6DA 1HIZA 3SJ3A 3V1HA 3UWEA 4ZSUA 1X96A 1MUMA 3CPGA 3NQGA 3KZSA 3RO8A 4XBKA 5F4WA 1LLOA 3LGGA 4Y9PA 4YMZA 2PURA 2HNEA 1QNPA 4CCDA 2D20A 1J9YA 2A7PA 3I3EA 1DIOA 1W91A 2VKZG 3L2LA 2IS7A 3GG0A 1WZKA 5KEZA 2B7OA 2F7FA 1FVPA 4EACA 1IEWA 2HBXA 4WD0A 1ZJ8A 2E9MA 1QNOA 1NFPA 5LNWA 1VJZA 1ZALA 4LGXA 2XSJA 1CI1A 3ITXA 3CUHA 3IGSA 4XQ6A 1KLYA 1XFCA 1VS1A 4UWMA 3SCQA 4Y6GA 5A6BA 2VZOA 3VMNA 1POKA 1BKHA 2ATSA 3GNRA 4HQVA 1PHWA 2GOUA 5MF5A 4PTNA 2YBVA 1QXLA 4ZODA 3GVRA 4AMCA 1KM6A 5I02A 3E2RA 4BEQA 2ANUA 2CLLA 2TPSA 4B9ZA 1XI3A 1A49A 4L5ZA 4W89A 3S5YA 4DJFD 2I1OA 3CC1A 4QFUA 1QCWA 1S5VA 2BASA 3P7YA 4LYPA 4A4AA 3FCPA 5DN1A 2WKJA 3TYBA 1UD8A 4LCSA 4US6A 1FRBA 3FHQA 1FA2A 2JF7A 2NUYA 4UOJA 4F0SA 1MYRA 1Q85A 4JTCA 3NL6A 1I9CB 1OX6A 1ZBVA 3A12A 3G2GA 3LGEA 4B5XA 3OZPA 3F4WA 4KCUA 2DORA 3ZQ9A 1TTQA 2WBKA 3VNLA 2Z24A 4OE7A 1JPDX 4E38A 4P7LA 5D02A 3T09A 4GQGA 3NQMA 4K38A 3RG6A 4HHHA 1V3KA 4NAEB 1BYAA 1JPIA 3WF3A 1GOOA 3QFWA 3W6MA 3BAWA 3TAKA 5HQMA 3L5LA 4GH3A 3GK0A 3R0DA 3H7RA 5AHLA 1EEPA 4YNGA 3DFOA 3E9AA 4OWGA 4GZJA 1E0TA 1J93A 3IJLA 1JGIA 1KCLA 4NNAA 1OFPA 5A3HA 3F5KA 4WXYA 2F9RA 3G6MA 4L6HA 1EA0A 2OEKA 7REQB 5F1VA 3WQ5A 3QV6A 4AWEA 1FWTA 1QR7A 3GXNA 4L1WA 4C6CA 3GUWA 4NUWA 2WAGA 1W5PA 2VC9A 4DBEA 1GQIA 1VHCA 2V6AA 1FHDA 1DJNA 5CAHA 5K3VA 3VKKA 1RHCA 1J96A 1CTNA 5T91A 1Q65A 5FF3A 1JZ5A 4KF1A 1N8FA 1HKMA 2XH4A 3VDBA 2WVVA 4MSSA 3VIIA 3O8AA 2DZTA 5EA9A 4HPJA 4LUSA 1XYFA 3VGGA 1VEMA 3OZOA 3VOHA 2J7BA 1XIGA 4RX0A 3VM1A 3F2DA 2DDXA 1HUVA 3PPHA 2J27A 2J7GA 3QY6A 4PUMA 1IT0A 3IAQA 2HSAA 1ME8A 3U0HA 1IXPA 3WNPA 4OOUA 2MNRA 4Z42C 5JH2A 5IHRA 4FOUA 3ZJKA 1BYCA 4GC3A 1BFNA 4JL1A 1PHQA 3RCMA 4M24A 2VEKA 4DQWA 5CPMA 4XTDA 4X9SA 4D1IA 4JFWA 4A8NA 1XBZA 6A3HA 5HNNA 5KINA 2VEGA 1UD4A 1MQPA 1TWWA 4OQVA 4MWAA 1F76A 4XO6A 3ZLFA 3IWPA 3CH9A 3OQEA 3RM4A 2NVAA 3LX9A 3TOPA 3PY2A 1GZ1A 2ZDRA 3GNOA 1REQB 1SO4A 3UG4A 3BANA 1QBAA 4N6EA 1EJRC 1RLDA 4XZIA 3WQ8A 4HCDA 4AXNA 4K8EA 1JG9A 3N73A 1UW9A 2JGYA 3VKTA 1ZBKA 3OJGA 3W1UA 2QLYA 4FNQA 3DGBA 2A3LA 1R46A 1W3NA 2H8XA 3B0JA 1O6IA 1UYQA 3W0KA 3CLMA 3N04A 1GVEA 1XRVA 4QS6A 4GEPA 4D72A 4OV9A 3NQDA 3VNMA 3QMRA 1SSGA 4DWSA 3S1UA 3GXDA 1ICQA 2HVOA 1PKMA 3WFZA 3AMDA 1JQVA 2PCQA 3TTSA 4U5IA 1VBUA 2EEXA 4HA1A 2VR2A 2YW4A 3W73A 3W81A 4GVIA 2XVLA 2Q09A 1F2JA 2OZ8A 1EYWA 2XYLA 1DTUA 4OTKA 4D1JA 3APYA 5BRBA 6XIMA 1V3JA 1UR8A 3BLLA 3GH4A 5A6LA 3UWQA 4TV6A 3Q45A 4IIGA 3GKAA 1XINA 4DF0A 4GVGA 3KCOA 5A95A 4F2BA 4HYVA 1F8MA 1P6BA 2X0HA 5EYWA 1DBTA 1H62A 2CYGA 3P62A 4JQ2A 1EC8A 2ABAA 4JTGA 1Q2RA 3EXTA 4I6VA 4XVDA 2VXNA 1VFSA 1LG2A 1X6UA 3GDMA 2QUUA 1YXCA 2AMGA 4G7FA 1FQ0A 2E9BA 3GXPA 3N15A 1POJA 3DGRA 3EX6A 3T07A 2PLCA 3DIPA 3N3TA 3I4KA 4MB3A 4AB4A 1GPWA 3KL3A 3TTQA 4EXBA 5FSEC 3EWYA 5LNRA 3PB0A 3SI9A 5I3HA 1QNRA 4LNYA 1WBJA 3EOEA 4HVXA 3CWOX 8XIAA 2EXOA 2NWRA 3IIXA 1WPCA 4BCEA 5GJPA 1R87A 1LUCB 4NVTA 3KTSA 4LYKA 1K03A 3ZM8A 3B8DA 3ES8A 1N7KA 3FJLA 3RRAA 3C3UA 3L4UA 1FCUA 4H6EA 3SCVA 3PWIA 4UC5A 3NM1A 4HOZA 1TFVA 1LRQA 1K77A 1AJ2A 4L64A 1MDLA 1DJWA 2PUZA 3FA4A 1EX5A 3UT0A 3W25A 2WXDM 4F66A 1OYBA 3O1NA 2V30A 3KVMA 4Q4PA 1UWAA 3BURA 1JI1A 3HTWA 1HT6A 1B3YA 1Z8AA 1WX0A 5DRCA 2G4FA 1ONRA 2F61A 4S3JA 2C1GA 4E8GA 2VCAA 1PIGA 3AWOA 2XFYA 4D2JA 1R7AA 2Z27A 4H8HA 3BK0A 1S5NA 1S38A 1T0OA 2Y7EA 4C6JA 1JDEA 3PBYA 5E93A 2PDJA 4BQ5A 3GVWA 1NFBA 2C1IA 2PTZA 3MWAA 1NWTA 1Z3NA 3L4TA 4R27A 3OLDA 4IM4A 1H0GA 4IMGA 3TR2A 1EJXC 2GZXA 2FMNA 4YYCA 2EAWA 3N29A 2QF7A 4YTSA 1TJRA 1DJGA 3T2OA 2BDQA 1KTNA 3TC6A 4ALDA 2C18A 4CNOA 1DQWA 2WV8A 3LBCA 1V0LA 1R3WA 4RKAA 3WUGA 3CK5A 1ZJAA 1XQLA 3FYOA 2PRLA 3PZUA 1MXDA 2F8QA 1PE1A 3THUA 2PRMA 3OP2A 2VQUA 1NWRA 2PTWA 2XHYA 3I6RA 4FMVA 4EP8C 3GDBA 3OG2A 2EQDA 4M0XA 3A64A 3PB2A 2OSXA 3H7VA 2EHHA 3ABXA 4AMAA 4S3CA 3ZR6A 2QJJA 1PSCA 3ZIZA 3MSYA 2BNJA 2FMOA 4MMWA 1A4LA 3INPA 4ORMA 1KD0A 3CWHA 3FDKA 4YVXA 4B16A 3HPAA 1DXEA 2BS9A 4CD5A 2OO0A 1XDLA 3NDOA 4IGMA 1UPMB 1XCFA 3AALA 2B81A 3Q37A 3BH4A 3L67A 3WD0A 5CSRA 2O9OA 4IIDA 2OFJA 3IIVA 1AMKA 1T6MA 2G3MA 2W66A 1TCDA 4ACZA 2EG8A 3GHRA 1E9IA 1QPNA 4AISA 2Y5SA 1X7IA 3Q67A 3P67A 3WBAA 3WLSA 3BO9A 5HNTA 3N34A 1H0IA 1C3FA 1OIMA 3TTEA 2QJHA 1LRTA 2DUXA 5K4ZA 2C79A 4B5TA 1U5VA 3B4UA 4U33A 2DSVA 2CZVA 1UR2A 4GD0A 3S2JA 1EUAA 1RQEA 2WC7A 1XF0A 1EBGA 2V38A 3C2YA 4DUWA 4PUEA 1G5AA 1G4EA 4NJHA 3FYYA 4V1XA 4ZOCA 2WPGA 4LW7A 4QXIA 1HXJA 3URBA 3BMWA 1LWHA 4NYYA 1A0CA 5FA5A 1AQHA 4EKJA 3NZGA 4DI9A 3A4AA 4GACA 5C70A 3HMJG 3C8NA 5TD4A 1P4CA 4Q32A 3JS3A 3SN0A 1R3SA 1X39A 2WC4A 3ZVHB 3M5ZA 3GXIA 3VOIA 3BG5A 3W6YA 3Q94A 2Q3RA 2V4JA 2F2KA 3M0XA 4DJDD 3A9BA 4QCFA 4PMXA 4Z1CA 2WC3A 3CBWA 3VUPA 3WK1A 4JCMA 4M81A 3LUTA 3K1DA 1EO5A 4XBJA 3S2CA 3GLCA 4LRSA 4D6IA 1O5QA 1VR6A 2YZ5A 3WQGA 3GM8A 3LRMA 6ENLA 2YDQA 3GW0A 2ESCA 1XQKA 3B0YA 3O05A 2DIKA 3G1HA 3LNMA 5BXSA 4HU8A 2OEMA 2FPYA 2PC8A 1QHOA 2C0AA 3UJFA 1A0DA 2NW0A 4AF0B 1SJAA 2OQHA 5EPDA 4KQNA 1V6YA 4A3HA 4JFUA 1ZY9A 2YXGA 1S5TA 1ZS2A 2A1YA 4REQB 3WD1A 3ZYZA 1FWRA 4HMNA 4UOQA 3U9IA 3GC2A 3WH5A 4D6HA 3HPXA 3MM6B 4O4VA 2DZWA 3KOWA 3PPGA 4RPQA 1F05A 3G1XA 1JPKA 4JIHA 3FJNA 1Y5XA 3BZJA 2V82A 3UESA 1J6PA 1GT8A 4U5KA 1BD0A 3MZ2A 4D6EA 2DVTA 1K6WA 2QV4A 1O95A 2CHOA 5G2IA 3CAVA 5AYBA 3A4WA 5HJYA 5FJOA 5E0KA 3WBEA 1DJQA 4AAJA 3CPUA 1P0DA 3UA4A 4PUWA 4FIQA 1GQNA 5A6TC 5AECA 1H7NA 5AZ1A 1OIFA 3AICA 3EX1A 1PWMA 1JAKA 1LZOA 3ZLGA 3OYXA 4HMCA 3VD5A 3H2MA 1B3ZA 1AOPA 4IP5A 2ZFAA 3EDKA 3ARUA 2FZNA 4PUDA 3TTYA 1LRNA 3DI0A 2IXVA 4IUGA 1N82A 3W00A 3TYAA 4GGBA 3W82A 1J79A 3L0NA 4Y9MA 4UTJA 4K37A 3VIJA 1ITUA 4MB4A 3KM8A 3WQWA 3KDOA 3OR2A 3L5MA 5HUPA 3WFAA 1H61A 4UUIA 1XIEA 2G50A 3QV7A 1GYNA 4NAFA 3IPWA 1L6FA 3SCUA 4DXVA 3VCNA 3GFZA 3ARZA 1KRCC 3KTXA 3D46A 1CCWB 4M19A 1DWJM 3BICA 3RLVA 3PM6A 1M41A 2X05A 2AQVA 2G0WA 4J35A 2W79A 4YHGA 1JZ7A 1W6TA 2I9UA 3SUTA 4NQ1A 1JULA 4Z1DA 3P61A 5EFFA 3URAA 4KRTA 3N9RA 1AJZA 4AEFA 2CZ5A 2OMAA 1V79A 3VGDA 9XIMA 4GABA 2Q6ZA 1DQUA 1PO9A 1P6WA 5LIUX 1Q7ZA 3IIPA 2GFTA 3V3WA 3IV8A 1DXIA 1XLEA 2PZNA 3W7OA 1OCBA 2C14A 4DF2A 1TWIA 3H2AA 1PCKA 3VVGA 3LXCA 4KEVA 2X30A 1XLGA 1ADDA 1KGXA 2OT0A 3HV8A 3WH7A 3LMYA 3VNKA 5JBDA 3FJ6A 4NG3A 1LBFA 5CZKA 3NGFA 2BFGA 1GUVA 4PC8A 3EYPA 3C61A 5CPSA 1AW5A 4ZZ9A 5EY5A 2P53A 1LM1A 4ZR8A 3TZFA 1PZ0A 1UPPA 3D5HA 5TBOA 3W07A 1NQKA 4B3ZA 5FESA 2AQWA 4DJEA 4NXSA 4YTRA 1QW9A 3GZAA 3AFBA 2JEPA 2PTDA 3SCPA 1XH2A 1MQRA 2CZEA 1UKPA 2ZRUA 1PTAA 2H9AB 3L5AA 1C8YA 2PDXA 2I9EA 1YBQA 5D33A 1SMDA 4R33A 3SURA 1RCQA 1EHNA 3TQKA 5D8ZA 3BCJA 5K9CA 2D0HA 5AC7A 2PC4A 4EWJA 3EXSA 3BL3A 1VFUA 3NURA 1W9DM 2B31A 2HMCA 2QIWA 4JTQA 4IIFA 1KFKA 4ZSTA 5HJXA 3B0VC 1R5YA 1BXCA 3NVDA 3NEHA 3B9NA 2W62A 4EPEC 2PD9A 3W1RA 3LDVA 4MZ1A 2PTXA 1V77A 1JUKA 1W54A 3BJFA 3BMVA 4GQ0A 2F6UA 4K1WA 2DSWA 4K7VA 1KFJA 3AXHA 1AH3A 1XKYA 3SO7A 1YDOA 4BK9A 4M6QA 3FXGA 3PWAA 5CC5A 4AOPA 4XBSA 1YIXA 1IV8A 2WSRA 3N2BA 3K4DA 3VOFA 1E1CA 3PVFA 1TTJA 3NVTA 4RE4A 3DEQA 4QNWA 1XIFA 3CIWA 3QHMA 3UCCA 5HDRA 4CVUA 2E6FA 3R8HA 3IRDA 4IICA 4IP4A 4A6GA 3FV9A 5IM51 3GBDA 5AC8A 4JFVA 2Y5EA 4L61A 1NF0A 4W84A 3ITCA 3DYOA 5JBFA 2WHJA 3W01A 1UWQA 2W91A 1XCXA 1JYNA 2XSXA 3VE7A 1BRLA 1I4NA 3TFCA 4LBRA 3MUZ1 1G01A 4GH1A 1MMFA 4IGNA 4YTQA 3DECA 3HIJA 4JYFA 1SZGA 1O4UA 1W56A 3QC0A 1T99A 3GDLA 4B15A 1OY0A 2HE5A 2V2CA 3WMSA 2B7NA 4DYJA 4ZO6A 4GJIA 3M44A 4IOTA 1PBGA 4O1CA 5CSYA 1TQJA 3HF3A 4C5YA 4J3VA 1H63A 2A0NA 2FB3A 1Z48A 2Y62A 3EDEA 5AOUA 3GC5A 5M3WA 5CBJA 5LYRA 1XW8A 1YPXA 5CKSA 1YE6A 1AQ0A 3C5QA 3QRHA 5EMKA 5G2WA 1Z41A 3R5EA 4P2VA 1L8PA 3NL2A 3FFSA 2ZOXA 3W7DA 1ZNNA 3LU2A 3LCWA 4EANA 3UG5A 2E8ZA 3Q65A 2HQAA 4RZ4A 3GTNA 2VD8A 3TWBA 2ISDA 3NQBA 5LIYX 1EGZA 4M6PA 2DZUA 1KV8A 3T08A 5GJNA 1E0VA 2DIEA 3EGJA 1H1ZA 3KLLA 1SYTA 5HANA 1LJYA 4B5UA 2Q8XA 4GIEA 3BGAA 5B7YA 2HISA 3NOEA 4JYEA 4D8AA 4YVVA 5A8MA 3S42A 1TVNA 1EJVC 4I9TA 4TVCA 2FGLA 3O2LA 2ZVIA 1OBAA 3FOKA 2I5GA 4QDPA 3S3GA 1D7KA 3ITVA 4UTLA 3ABOA 2OGJA 3HG5A 1A5MC 1WDSA 1KR1A 3UXIA 3M5YA 3KVLA 3B8VA 5C54A 2PTYA 3KLKA 1TTIA 4UFMA 1ODZA 4GCAA 4L1XA 1UQYA 2AL1A 2OR2A 1W1VA 4AWUA 1WUEA 3L4VA 4I5RA 3AZSA 1GPFA 4Y96A 4JTFA 3LMZA 3BE7A 1XIDA 3GVVA 3F5JA 2X1UA 3WYZA 1YE4A 2XFFA 1ZAIA 3BJSA 4IWWA 3O7UA 2XH0A 4IMFA 2D0GA 3WEOA 2E28A 1TVLA 3KHDA 3EOUA 5CJ5A 3VGHA 3BAXA 2GJPA 4NIRA 1TMHA 4QITA 1R3VA 3CU2A 4ZOEA 1TJPA 3VK5A 3RK8A 4K36A 1H11A 4NXKA 5HMSA 1QI3A 3RAOA 2XIMA 1L6GA 1BSLA 3HFTA 1UR1A 1JD7A 5KETA 2BY0A 5L9FA 2G41A 3QPEA 1KA9F 3EOOA 2P8BA 3BLKA 4G1NA 1FWNA 3EEGA 4JQ4A 3TJLA 2FDSA 4EXAA 5DMMA 1LL7A 1CW2A 2PWHA 3SAZA 1FWBC 1JYWA 2CZFA 3WQ6A 5I24A 8XIMA 2Z1XA 5A94A 3L9CA 3VD7A 1Q3NA 3JUGA 1S1PA 1VFMA 4RCXA 3MTWA 4Y2WA 2X42A 3WK0A 1WO2A 1RCOB 2J8FA 5LNUA 2XWDA 2DY3A 3W24A 4IHCA 2ONEA 5LIXX 1KGWA 5GNXA 2YA2A 3FSUA 2ZX9A 5AHMA 5CZJA 3UWYA 1IGWA 3KHJA 3IK4A 2R94A 5T26A 1E1FA 3IJ9A 3RFAA 2ZUWA 1I2QA 1PDZA 1W1PA 3HFYA 2I5QA 3QN3A 1U33A 4PUNA 4L9XA 1ENUA 3AC0A 4C6DA 2E40A 3ZT6A 4QQ3A 1PWLA 3LCXA 5KSWA 1OX4B 1UC4A 1TJ1A 1FFRA 4QTGA 1BXNA 1F4HA 1OZQA 3K30A 2QXWA 4AIUA 2FTYA 4XZLX 1QVBA 1FP9A 4J2MA 3R13A 1FH8A 4PULA 1GONA 4JFSA 4C6EA 1WBHA 1AFSA 4HA0A 3AO0A 1Y5VA 4JL2A 4BF7A 4WDUA 2O56A 3EDJA 2Z1SA 1NQ6A 1U22A 1Z44A 4RZ6A 3S0CA 1V03A 3NQ6A 3EEZA 3WLNA 1KXTA 3GIPA 1R3YA 3GHUA 2QCEA 1J18A 2A3EA 3E0WA 3O6CA 3SSJA 2EG7A 2IPFA 2XISA 3THQA 1BYBA 1SPQA 1H3GA 3HQ1A 1WOAA 1CEOA 3L4ZA 1G7VA 3SRDA 3FVMA 4KERA 1I1XA 4K6AA 1DIEA 4IFOA 3IACA 3TCEA 1TSIA 3CQIA 3HM7A 5G4EA 1UIOA 3LY0A 5ENLA 4ECLA 5GJMA 1FOBA 3V5CA 4XAZA 4WF7A 3W23A 3TFXA 2HK1A 2XIJA 3RHGA 2D0FA 4AVOA 4CU7A 4JQAA 3KOXA 7GEPA 2QCCA 4Q4RA 1EP2A 4C7DA 3QGKC 3FN9A 1ALDA 3TW7A 3GX9A 3N4FA 1YX1A 3HB9A 4I90A 1F3TA 1TPWA 4ML4A 1WE5A 2WMFA 3T9PA 4IJCA 4UMAA 3WY1A 2VC5A 2WM0A 3BOFA 1T7LA 3VIFA 2CC0A 1ISVA 1NEYA 1QI5A 1DHPA 3KS5A 2J7CA 2A5HA 2Q02A 2YL5A 3P0WA 2Z1WA 3NXLA 1F61A 4HT3A 4MOZA 3VOGA 3KRSA 2ZUUA 3PJUA 4WK9A 1E6XM 3LGDA 2V5LA 3TYZA 2HNHA 4C7FA 4ZQOA 4CD6A 2QJNA 1QPQA 2VGGA 1YHTA 1TX0A 1V4YA 1JYXA 1A3XA 2R9RA 3R79A 1DJIA 2VFIA 7A3HA 1B3VA 2ISSA 2WNNA 3LK6A 2DSKA 1ADOA 3N9KA 3VE9A 2RJHA 5M17A 4WJEA 5FAJA 2GGHA 3GE7A 4UCFA 5CH9A 4K39A 4OU1A 4XD5A 2HROA 5HNUA 4I3GA 2I7GA 4JR5A 1EDQA 4GG9A 4HNTA 4MLJA 2HTMA 3F4VA 4J40A 1VCFA 4J3ZA 1MUWA 3AIQA 4XZNX 1GHSA 3UY7A 5FJUA 3PJXA 2WYSA 4MNLA 1WQ5A 4C6PA 1R86A 4JN8A 2IPWA 1ITCA 5ECUA 3QZAA 3PSVA 4PRRA 2HBVA 5B7ZA 2Z29A 4QLKA 1US0A 1A5OC 4ROQA 1P0KA 1CGYA 3QV9A 1QNSA 2YBUA 4DBDA 3C2OA 4XZ9A 3UWVA 3NFUA 3VOJA 1OC6A 4JKKA 1I8JA 4AEOA 2BHYA 1MZRA 1N2VA 3FVDA 4HOWA 3GR4A 1XISA 4MM1A 2DT3A 2QULA 3G1YA 2CIPA 2PE4A 4PRTA 1YXYA 5JMUA 3SM0A 1SZEA 4ZGYA 3TYUA 1IWBA 1YTKA 1FH7A 4Z0JA 1ZUAX 1QATA 4AQLA 3RO6A 3L68A 2CWNA 1WDWA 4O1BA 3RR4A 5MKGB 1VC4A 3UJEA 3AIUA 3OA3A 1BQGA 4WXZA 4GUJA 1W9PA 4X63A 3ERPA 3VPLA 2FZ9A 4O16A 4FX7A 4HCLA 4RNFA 1XG4A 4QNEA 3GR7A 1TJ2A 3H23A 2ASHA 7CGTA 3N2CA 4ZL1A 2DJLA 4DIAA 1XIHA 2DQXA 4X2PA 2NT1A 1MW3A 4TIMA 1XM3A 1MSSA 2GLKA 2KX9A 4OHQA 4LTSA 4MAZA 2ZDSA 2Z2BA 1E0XA 2OOFA 5AVHA 2VFGA 1ECQA 3G77A 3C2EA 1U30A 6TIMA 4J3WA 2DZSA 3QSRA 1MRQA 5DY3A 3TXZA 1G1YA 4W7WA 1WKFA 4TX6A 2DV0A 1YNQA 5HMDA 4AHQA 1CGXA 4ZXOA 4CD7A 5BOEA 4RJEA 1ZZMA 4WDTA 1IIHA 3UG3A 4AHOA 2J24A 4R7WA 3B0HA 3LPOA 1XG3A 4M6VA 3NDYA 3O3RA 5G2HA 1A50A 4P8VA 1PKLA 3W7RA 3TJXA 3MP3A 2CCRA 4HHMA 2PF0A 1C29A 3ARRA 2VX7A 4HPHA 1WZMA 3VIOA 3E3HA 2WCAA 2W5FA 3DX5A 2GQ8A 1XYCA 3PFMA 4QG6A 1V7AA 4NAEA 2PDWA 2QUNA 1P0NA 1VIZA 1T96A 1Q4WA 4DBSA 2E0PA 4JOMA 1K7EA 2GL5A 2ON3A 1MXGA 2D23A 4KBXA 2YCKX 1Z69A 4GUGA 1XD0A 4KCTA 4Z17A 3LSCA 3UXLA 2NXHA 2AQOA 2VGBA 4TVUA 3CHEA 3AU2A 2ICSA 5BROA 1TMQA 3NO5A 2HZGA 2O55A 3DFHA 3E2QA 2CLMA 4N42A 7REQA 2F84A 1OWQA 4WGHA 3FYPA 3QZEA 2DH2A 3PF3A 1UD2A 1H51A 1GTHA 1R0MA 4G6CA 4XIMA 3IVUA 3UWZA 1IEXA 4Q8PA 2VHLA 1AQFA 4JHOA 4US5D 2OVLA 3M0KA 5BCAA 3ZJ8A 3ZJ6A 4MTVA 1JDDA 4X0VA 2G3IA 3LTPA 4IISA 5JUVA 4KIRA 4I8DA 4FI4A 4NZ1A 5C2GA 5RUBA 3QGVA 4UQCA 4GVFA 1VBHA 5CZTA 4AIOA 3IVSA 4GI8A 2X7WA 4EVZA 1A5KC 3AZTA 4IIBA 4OUIA 2V81A 5LZLA 4WLCA 3P6LA 1HVXA 4DYKA 1NDYA 1JNEA 1FWEC 3BTNA 4XZBA 1YEYA 4LAKA 2QHAA 2X0SA 3WBXA 2GQ9A 3QR3A 3L2MA 1ZCOA 4HN4A 4ZBCA 3W7IA 1OCNA 4ZTYA 4MY9A 4IPIA 4H7ZA 3NPWA 5TQLA 4Q8UA 3PUGA 5G1YA 3KRZA 1OFRA 4Z1AA 5LNSA 3LHUA 3MP5A 1W3KA 5G1MA 4NX5A 3KE0A 1NOUA 1EDTA 2DIJA 2ACRA 3S1XA 2WKLA 4L4OA 1JPMA 2CFFA 4ADTA 1REQA 1GNXA 3PULA 4JIIX 4E2DA 4X3ZA 5AZ0A 3M7SA 3VAVA 4CNTA 4UTHA 1X8CA 3TSDA 4JIQA 3I7QA 5DMLA 4Q8QA 2NVDA 3PAOA 3M0MA 4NZCA 2VYOA 3KOZA 4C6FA 2A3CA 3SJNA 6CGTA 1E40A 1R3TA 3NQ2A 3NZQA 3IIOA 4V15A 3E02A 5BXTA 3N9SA 3QY7A 3V5OA 3EMZA 3CNYA 4MF4A 1NIUA 1DKWA 1XPGA 1V3MA 4XD3A 5C2CA 3A3WA 3GNDA 4KEMA 1US2A 2XN2A 3TMLA 3PZGA 5I03A 1XSIA 4N7QA 1WXJA 1W3JA 3TQ0A 1FHLA 4XV0A 5AHFA 3JRKA 1I2RA 2GGJA 4A8IA 3DG3A 2OODA 2Y70A 2NQJA 2VZVA 3GHSA 1W3LA 4HU3A 3CV2A 1XWYA 3HU7A 2YDSA 5I06A 1GEQA 4HU0A 1HW6A 2W92A 4ES4A 3TIMA 3SY5A 3VD3A 2WW5A 3G1FA 4RLIA 2PA6A 3BOLA 3VDAA 1S1RA 5LXEA 4R9XA 1CLXA 1K8ZA 2B4GA 3F2CA 4JY8A 4XX6A 2WJFA 2E25A 3VFCA 3C2FA 2MANA 4QE1A 4YJ5A 4PR4A 4CNSA 2CZDA 2E1WA 3RJXA 9CGTA 3KVJA 2VZUA 4FB7A 3ZWTA 1UBSA 4OZOA 4XSMA 1GZGA 3WIJA 1GZJA 3ZLHA 3OA5A 3WQ4A 3LZ3A 3PN8A 4HYWA 3LCGA 3VDHA 1GORA 4XKYB 1UP3A 1OFAA 1UASA 3CZKA 1MRAA 1CNVA 3R0KA 4IPPA 3VGFA 4IGSA 3MU7A 2ZKMX 1KXQA 3MMTA 3N14A 1UD6A 1LORA 5H8PA 4YTTA 3DESA 4AX7A 4C6IA 1FCBA 5HXMA 1ONEA 1XC4A 5I3GA 3KBVA 2V5BA 3KWXA 1OINA 2VENA 3IUDA 2CLEA 3MWCA 3NL3A 3PZMA 4AIBA 1TREA 1UKSA 2NXGA 3BAJA 2PFHA 4WSHA 3FXYA 2WBGA 5XIMA 4QIUA 3WO8A 1XUUA 3WMLA 3TNOA 4NNBA 3EKGA 3GBEA 1B3WA 4AH7A 1WDQA 1JFXA 4XAGA 3M0LA 3R89A 4GIRA 4HNOA 1Q6CA 1CECA 2NLIA 1LLWA 3KL5A 4LBUA 3GIQA 3MBDA 3OR2B 2FTPA 1TCMA 5AYYA 2CXGA 3E2SA 3I6EA 4JZ5A 1UROA 3CGTA 3DG7A 5ABHA 5E9XA 1WYIA 4GO9A 3ES7A 4ADUA 4J1OA 2XINA 1K6AA 2Z1KA 3DFYA 1XIJA 3KCLA 1Q2SA 2JE8A 1E15A 1EPXA 3VNYA 4XTIA 3S5ZA 3A6OA 1W2VA 3N4AA 1JYVA 3TXVA 4XO7A 4G56A 1EC7A 4LWWA 4F0MA 4LF1A 1NELA 1HKWA 1W3TA 2QPUA 3J7HA 4FSAA 3MANA 1KO0A 5A8GA 4HU4A 3P14A 4S3GA 3N11A 1AJ0A 1MEWA 3F2BA 4MZYA 3R12A 1EWDA 4F0LA 1FUYA 3NZRA 4MKNA 1PL9A 3BV4A 1R47A 4UTMA 4JTKA 3YPIA 2R1NA 1PZ3A 2XZ7A 3UZXA 4Z1YA 1QMLA 3K2GA 3AQUA 1VRXA 3BG3A 4WY0F 1EF2A 3EB2A 1BGAA 1W1TA 3S2LA 4Z2LA 5HQEA 1AG1O 1P48A 4B91A 3KZPA 4UOZA 4CEUC 1RD5A 1GW1A 3WLKX 1O94A 2EG6A 3GC4A 3LI1A 1V6XA 2J66A 5BMXA 1WZLA 3UNTA 2FZDA 4UFHA 4A29A 5J5RA 4GQBA 2BV9A 4CCCA 1PX8A 3CUXA 3CQJA 3S47A 4B3KA 1BWVA 3WDIA 3P3BA 1HZYA 3V16A 2O9RA 2EPMX 5U7SA 2J8GA 3G3DA 2W27A 4F0RA 1KBJA 4J3UA 4JGDA 3WG6A 3SY8A 2FHBA 3E6EA 4IPLA 3UVIA 4AFYA 1E5NA 1I6NA 1V6UA 3RLGA 5JQ9A 3NEVA 1D7FA 4Q4KA 3UYIA 1QFEA 2PWGA 3G22A 2GQ3A 2P0OA 4GQRA 1UCWA 3E5BA 1XP3A 2CBUA 1IWPA 3O0KA 2I16A 4GI9A 2FH8A 1WP6A 3KVKA 3A13A 1GJUA 2Y2WA 3VIPA 2QYGA 4N9EA 1JCMP 3WMCA 4KWVA 5CXPA 4J3SA 4B2DD 2QKFA 4HNUA 2ZZ5A 1HL8A 4GXMA 4JDBA 3OTRA 3ZFHA 3JVAA 3KBMA 4C7GA 5A6KA 1E1CB 4JTSA 4ATDA 4AZHA 3HQNA 2FVKA 3A22A 3IK2A 5FEWA 6ALDA 2Y6ZA 2R1PA 2DVUA 3CTTA 3SUSA 1C8VA 2C16A 4ASTA 1NSJA 3ABSA 4L6OA 1HKJA 6REQB 1DWHM 1Q6FA 4AU0A 4GY0A 4U28A 4WJXA 3ZVHA 1KQZA 1XRTA 5FCZA 2JBMA 1MNSA 1VJSA 4JTLA 2NUXA 5J5DA 1J12A 2IXUA 3TTOA 4F0KA 2XVNA 5XINA 1M7OA 4HYRA 4H9TA 1KKRA 3W1QA 3EDDA 1S46A 3MUAA 5D9PA 2WQDA 4GY7A 1RQHA 4BHYA 4PB3A 3QOKA 3SRHA 4LB4A 3SDOA 4QSFA 5HPOA 2VMFA 1JZ4A 1SVDA 2J75A 2TODA 1B9BA 3TA6A 1Q7MA 3RCYA 4Y9AA 5C9ZA 1W5MA 3DFNA 1ADSA 1EJSC 2WLZA 1W2PA 2V2DA 4IX0A 3VDCA 1GKQA 3H26A 1H5YA 1XLBA 2BXZA 1HKIA 4AF0A 2D3NA 3BLEA 4GA8A 1P0EA 2YLAA 4BWLA 1BWKA 4REQA 1WZAA 4BQ2A 3LQLA 4H2CA 1B54A 2OKOA 1FCVA 2VRQA 5D38A 2WSKA 3EAUA 3MM6A 4IH3A 1XRFA 4U10A 2BZNA 5IBXA 2IQTA 1JCYA 3USBA 4UMCA 3KBNA 3LHTA 1XH0A 2GVJA 2BLEA 3MMAA 4MDOA 1IR1A 1MW1A 2BX7A 4IFRA 1ZJ9A 1J5SA 5C9XA 2EF9A 1VFTA 3WEZA 1ODUA 1U83A 2IW0A 1ZBWA 1QK0A 1Z32X 3F4NA 4O12A 5AB3A 4AW7A 1P1XA 3B06A 3VDGA 2X1SA 1PZ2A 3MB9A 2HVMA 2GWNA 4HOXA 1GK8A 4FLRA 5EB8A 3BZGA 1K9DA 4M5PA 5XIAA 1TZZA 3I3BA 1KW1A 5F2MA 1ONXA 7PTDA 4AIEA 5ABFB 4HK6A 4TR9A 4L4LA 1HP5A 2ZICA 1ZFJA 2QQ6A 1JZ3A 5CSSA 3E38A 1LQAA 1FDJA 4KFPA 1MW0A 1M65A 4IGHA 1UUOA 1EFZA 5LA1A 3N2XA 4Z2HA 5LHFA 1ZRQA 3E74A 4KRUA 3AMCA 5HWNA 3L4WA 3ZR5A 4LNCA 2WKGA 3A47A 3U4AA 3U6WA 2GJNA 1KBKA 3B05A 3NSNA 4FLOA 1AD4A 1NH6A 5LA0A 2ZUSA 1UD3A 2R24A 4M80A 1Z7AA 2YCIX 1E73M 1J10A 1X38A 4Z2KA 1HP4A 2GWGA 2CU0A 3QQ0A 2VFHA 2RDWA 2HRWA 3PUDA 2Z28A 1E0WA 4LUTB 4E5TA 1UUMA 1NDVA 4R88A 1UOKA 3JW7A 3VC5A 3OIXA 1ME7A 1M7PA 3WENA 2V5DA 8A3HA 3I6TA 2W0UA 3EA3A 2PF8A 4QSHA 4AHPA 4I7WA 1TPFA 4XD6A 3WLOA 4UQBA 3CV7A 3MM9B 3MKCA 4HNLA 4GIAA 4C90A 2PP3A 4UTKA 1ITXA 3W1XA 4JYDA 1Q63A 2WANA 3AIRA 2QMJA 4Y8EA 2E77A 2PWEA 3NYZA 3S5OA 4D6FA 3BVJA 1J0KA 4XAYA 3SN4A 4PEKA 3VFLA 1B2YA 1R8LA 1HTIA 2XFRA 3E2VA 4JNMA 2QGYA 1HJWA 3QM3A 4LBSA 3AIEA 1PYFA 2BY1A 4F3HA 4LUJA 1XSKA 1E71M 4H8NA 3LEPA 1C9WA 1H7WA 2J62A 2FDMA 3CT2A 5TIMA 4AZ7A 1V7YA 2BGQA 4K7YA 3S2NA 1F3WA 3KEHA 2ZX6A 3PHAA 5LA2A 1VJIA 1UWRA 4KEZA 3PZNA 4H00A 3VNJA 1H2JA 3T05A 2RGMA 4UTWA 4MDPA 4PCNA 4FXJA 4JQ1A 3SRKA 3M64A 3MS8A 3THCA 3LM7A 5CGQA 1SW0A 2YCLB 1H1YA 5CAKA 3CQHA 3VIKA 2VGIA 4XSLA 4MFEA 2A7RA 3RR1A 4GMEA 2PDBA 4EOUA 4JQ3A 1S2TA 1XLAA 3OIHA 4MPKA 4KIEA 5FEPA 5I3KA 1R3RA 3RRXA 3NJ3A 2V0TA 3MCNA 3DENA 4JY9A 4AD0A 1KCXA 4D6CA 3VZZA 3B03A 3CAKA 4QROA 1TPB1 2VOMA 5LHEA 4ZE4A 5GVJA 1RA5A 2GDQA 4CN1A 4LYQA 5HATA 3CUGA 3I7SA 3GG8A 3K46A 5C0QA 2WVSA 3TWAA 2GVGA 3U2CA 3WMBA 1T8QA 4PUJA 1AODA 2GDUA 2OZTA 1XJBA 3B8IA 2YFNA 1QO2A 3V0TA 2HS6A 4EAMA 2P3EA 2ZWYA 3MSGA 4KKXA 4Z1BA 1XYAA 4DZHA 4IP7A 1WV2A 1BQCA 2BGNE 1GVSA 1QPOA 4EE9A 3VCCA 2XVKA 4PCSA 5A2CA 2ZTJA 3AYVA 3QZ6A 1M1BA 1CDGA 1T40A 5D8WA 3PUOA 1SMAA 4C6LA 3W1MA 3SSZA 3GNPA 1V0MA 4FZIA 4LCRA 1SW7A 2FYMA 2X09A 4DBUA 1HJXA 4UB9A 4PFMA 5D32A 4QRNA 3N12A 1VCGA 1YDVA 2VQTA 1SGJA 4PMVA 1KBIA 4OT7A 4PMZA 3AXIA 1EPVA 3ITOA 1O12A 1B1YA 4DLMA 3UJ2A 5D9OA 1RY0A 1HN1A 2DP3A 3QR0A 1JZ6A 3QYSA 1TWDA 5F4SA 3GU2A 3O9NA 1XLMA 5A8QA 4WKFA 4HTBA 2AL2B 2DSUA 3HQPA 3EDFA 1X7FA 4WVXA 3BAYA 3GQYA 3KOYA 2HJPA 4X61A 2WSQA 1DPMA 2C19A 4JTEA 3B0NA 5LKYA 1G7UA 4JD4A 3IJ8A 3EX3A 1LTDA 3W88A 4IL0A 3UPMA 3OZMA 3U2EA 1BTCA 2RJGA 1JD9A 1QJWA 5C5YA 4LS2A 1JNDA 5I07A 2TRSA 1R2TA 4KGLA 5I3IA 3KRBA 1M68A 1W1ZA 3MA8A 4H4IA 4E3TA 4IIHA 1XDMA 2CLOA 1QI0A 1Q66A 2DZBA 3DZ1A 3OVQA 2YR1A 2NXIA 1QHZA 5HULA 5K7JA 4ZO9A 3S1GA 4DO5A 2XU2A 4PMQA 1PUDA 1Y7VA 3R0UA 4C91A 4EPBC 2AKMA 1OK6A 4NNCA 3LZ5A 3OOQA 1VB9A 3V0UA 2GSJA 3G8RA 4XIAA 3GTHA 3UF9A 4F2UA 1JF5A 2ZADA 3MI6A 1YRRA 4F8XA 3WLMA 2A7NA 4H19A 3GZ3A 2ZXQA 1UR4A 1E4IA 4K68A 1Q4NX 3H4WA 4DUOA 3MMBA 3LCFA 1IF2A 3GU9A 1LP6A 2DH3A 2AKZA 1V02A 2WWCA 4CQAA 4PTXA 1MEIA 3BW4A 1OK4A 4A22A 1LT7A 3MM8B 4W9TA 4XAPA 4J4KA 3DFSA 4EK7A 2JGQA 1KV5A 1OX5A 5G4WA 1FWWA 1W9BM 3W6LA 4Q7IA 3MM5B 3W70A 1S2WA 3WQCA 4L4PA 1H7OA