4S23A

Structure of the gcpe-hmbpp complex from thermus thermophilius
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
405
structure length
405
Chain Sequence
EGMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the GcpE-HMBPP complex from Thermus thermophilius.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 133
structure length 405
sequence length 405
chains with identical sequence B
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s23A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s23A02
3VM0A 4D8ZA 3BOFA 4DJFC 4DJDC 3MM7B 1Q7MA 3H2OA 2E7FA 2V4JA 1ZJ9A 2VEFA 4G39A 3VKTA 3NOYA 4DAFA 3AOPA 4MWAA 2YCJA 4MWAD 1TWZA 4PZVA 3TYZA 8GEPA 3TYBA 2AKJA 1TX2A 3H2FA 2DZBA 3MCMA 3B0JA 3H26A 2OGYA 3TR9A 2Y5SA 1Q7QA 4AOPA 4D8AA 3TYAA 3MM8B 4NL1A 3B0MA 4S3EA 3MMCB 1TWWA 4S3CA 1Q8AA 1TX0A 4G38A 4MWAE 3B0LA 3MM5B 3MM9A 2GEPA 2V4JB 4MWAB 1AD4A 1Q8JA 3TZFA 3MCOA 3VLZA 3MM6B 3K13A 4O1FA 4DJDA 4HTRA 2Y0FA 4DJDD 3VKSA 2YCIX 4C1NA 4C1NB 3OR2A 2VEGA 3TYEA 4DAIA 4GEPA 3MM6A 4S39A 3VM1A 4MWAC 3MCNA 4NILA 2YCKX 3OR2B 3MMAA 4CCZA 4S23A 3MMBA 1Q7ZA 5JQ9A 3OR1A 1AOPA 3H23A 4O1EA 4HB7A 3VLXA 2DZAA 4DJEC 3MMCA 1TWSA 2XSJA 4DJEA 3VKPA 1EYEA 2YCLA 1AJZA 3H22A 3H2CA 3B0NA 5GEPA 3MM9B 2VP8A 3MM8A 3MM5A 3TZNA 4NHVA 5AOPA 4DJED 3H21A 1AD1A 2YCLB 1Q85A 1F6YA 4O0QA 1ZJ8A 3VKQA 2DQWA 3TYDA 3H24A 6GEPA 4S3AA 3H2MA 3VKRA 3GEOA 3BOLA 7GEPA 1AJ0A 4S3FA 4S38A 3B0GA 4D9PA 3TYCA 3MMBB 3TYUA 4DJFD 4DB7A 2Y5JA 4S3DA 4DJFA 3H2NA 4NIRA 2AOPA 3H2AA 2XSJB 3B0HA 2H9AA 3OR1B 2BMBA 3V5OA 3MM7A 3VLYA 4S3BA 4G9PA 2H9AB 3MMAB 1AJ2A 3H2EA
chains in the Genus database with same CATH superfamily
3C86A 2GVJA 4F79A 1DJQA 3NL6A 2RH9A 6CGTA 2HNEA 1E3XA 5E09A 4B90A 4IPPA 2ZUSA 2IXVA 1NJJA 3LHUA 1JD7A 3FKRA 1GOXA 1LWJA 3W24A 3KBJA 4QTGA 3ZMRA 4KERA 5JBFA 3VIFA 3NZPA 1CLVA 3GIPA 3SIZA 4O8AA 1YADA 3CUHA 2XJ7A 3NZ1A 3NO3A 1JI2A 1E4NA 4KIEA 3HBLA 1FWTA 4EPDC 2IXUA 2CBVA 3TIMA 1XXXA 3QPEA 1EUNA 4B2DA 3K8LA 2XHYA 2EPLX 3ZFHA 1OIFA 1SVDA 1VLWA 5E1QA 5BWAA 1F8IA 3VFLA 3P8JA 3FX4A 2HK0A 3MM8A 3QHNA 1UOZA 4XQ6A 4X60A 1XLAA 4PCFA 4GC3A 1WKYA 2XN0A 3HV8A 3PUOA 4O13A 2Z24A 5AY7A 4IMCA 3GEOA 2PP0A 3IGHX 3TJ4A 2VX4A 1JD9A 1VFLA 3WF1A 1JCXA 2XISA 4KRUA 1DOSA 2XG9A 4JN7A 1O1HA 5A2AA 4S3GA 3KDNA 4HHHA 2ZTJA 2XVGA 4D8ZA 1BF2A 1CLKA 1JCNA 4HKPA 3BK0A 3VKKA 1AQ0A 1J4EA 3V7PA 1E0VA 4DWSA 2XIQA 2A7RA 4KF1A 3VNLA 5CPOA 4FAMA 4Q8PA 3N4AA 1IEQA 2DT3A 2DW6A 2CWXA 2CZEA 1TTIA 5BXSA 5A8GA 3E0FA 4GO8A 4WLCA 3UXIA 3MM8B 1BHGA 4OOUA 3GKFA 1QCWA 3CWNA 4EPKA 3RUBL 1WYIA 2HCVA 3RG6A 3M0LA 1BVNP 3B9OA 5D32A 4QG8A 3BTNA 1T0OA 1GQNA 1OG0A 3WSUA 1XH0A 3WF3A 4HA3A 2C1GA 3MDWA 1UIPA 3FVDA 3QC3A 3PULA 1JPHA 4N2YA 3U9IA 3RF9A 4HJFA 4KQNA 5DELA 1FH8A 2OEJA 2BHZA 2FZ8A 3NGFA 1AFSA 5CXPA 5A3HA 3SGUA 4K7VA 3K1DA 3LG3A 4HNUA 3RPTA 3GIYA 1M53A 3KCJA 1R85A 3MY9A 3ANYA 2X40A 1QWGA 3PB0A 3PFRA 3PPCA 4AZIA 4NY2A 1A5SA 1VKFA 2E6AA 4NIRA 3PNZA 3NVDA 2WHMA 4IIEA 3EWZA 1LTDA 4ALDA 2O7SA 3GTIA 1HKIA 5LIWX 1E6RA 1U5VA 2W61A 3K8MA 3THQA 1ZBCA 3L12A 3T78A 3KTCA 1PKMA 1V3HA 1FDZA 1FWHC 4XV0A 4FLRA 2Z7GA 3EOEA 4MFDA 1E6XM 3CPRA 4GIEA 9RUBA 3B8VA 3DC0A 2JQXA 1BD0A 4MWAE 3LHYA 4NJHA 1KKOA 2ZUWA 3UR5A 2NX1A 1ZCOA 3LHZA 4DXXA 2FZBA 3KLLA 3TVAA 1OK6A 2P3EA 1B0IA 1O66A 4UOQA 3GHUA 1EHAA 4TV5A 3GYCA 3EZ4A 2VUNA 2EF9A 5D02A 2JKPA 4XISA 2JIEA 2BGNE 4FX7A 1FCUA 3P3BA 1IZCA 1ONWA 1QR7A 3W6MA 4F8XA 3WH5A 3ORWA 1CXFA 1P6WA 3GTXA 3GTNA 4JXCA 5HXMA 4D9PA 1T40A 3AOFA 3IV3A 3T44A 1LP6A 3FSUA 2O9TA 3AU2A 3OOQA 1W2VA 3E2QA 4PUMA 2PDUA 2VENA 2Z7KA 2Z6IA 4A8IA 3CIWA 4DBEA 4LUTA 3AI0A 5CCZA 1CYGA 4P8VA 4L6HA 5AZ1A 4ECLA 3TYZA 4GJ1A 3FV9A 3STGA 4MZ1A 4BI6A 3NWRA 4V28A 3T2OA 2FVMA 4LF1A 2REQB 1L6GA 2W66A 3IGSA 4PYSA 3NFUA 3UEQA 2PDYA 2Z00A 1YXYA 1H2JA 2W91A 3PZUA 1QBBA 3GVWA 3IPWA 1KM3A 3MZNA 3CL6A 4AX6A 1TMQA 4AHPA 3NQ7A 3G1DA 2WSKA 3T0BA 4I5RA 5EMMA 1I1XA 3M7WA 3GH5A 4KWOA 4O10A 4X9SA 4U5KA 5F2IA 2TODA 5JUVA 2EPNA 5CPLA 2VR4A 4Q6JA 3AIBA 1AD1A 3SEPA 1I45A 1Y0EA 1L2QA 5HQLA 2X1TA 1OZQA 3LLXA 5E0KA 4LAZA 2B31A 4HNNA 2Q8XA 1BQGA 4WKFA 4W7UA 4GFSA 3UG8A 4TX9A 3M0VA 3OB8A 3B8IA 4LCRA 2WWDA 1ZTVA 4NAFA 5ABFB 3UU0A 3RIKA 2P1FA 2OX4A 1R9ZA 3C6CA 3GIQA 2VI0A 3WF2A 1H60A 2O92A 4JQ1A 3L66A 1XIMA 1F4AA 3N9RA 3H6OA 3SRHA 4CCDA 1UR3M 4NF7A 2EPKX 4N42A 1KFEA 4FNUA 2ACRA 4NP7A 5DANA 3SRDA 3KVMA 1SJAA 3S9ZA 4PB4A 1R3RA 3G0UA 3ELFA 4N9CA 3GVRA 5DBUA 4DNMA 2JBMA 1PZ1A 3MM9A 4ZTYA 1QNPA 4F0HA 3RJXA 3EDKA 3VFCA 4EPBC 4HMCA 1WQ5A 1HKKA 4GZ7A 3B0UX 4XSLA 2A79A 1Q2RA 3GS6A 1DE5A 5C55A 3DHDA 3FDKA 3PP7A 3P62A 2VZUA 4R34A 3C2YA 4Z2IA 2X2YA 3LBOA 2D2HA 4H6KA 3VKPA 2WMIA 4I9TA 1QWKA 2XH2A 1W1B1 2R82A 1DKWA 2HEJA 3O6DA 1QJWA 3MM5A 5A2CA 1OG6A 1XYLA 1NF0A 2ALDA 3RCYA 1GQJA 4CCEA 3LYEA 3GAKA 3VOIA 4QAIA 4PR4A 5G4WA 1H41A 1XIFA 3WQGA 1UR8A 3NQFA 3YPIA 1JZ7A 2QUNA 3VE7A 4IGMA 4UOZA 5DY3A 1K4HA 3TAKA 1ECEA 3TE9A 1KLYA 3S2CA 5CBJA 5DEZA 4RR4A 1AQFA 2FH8A 2RKXA 3TTSA 1OX4A 4LS0A 2Y63A 5BOOA 1JQXA 1KWKA 4AIEA 4EKJA 2DW7A 4LAUA 2OZ8A 1I75A 2DQXA 2GL5A 2FGBA 3MMCB 4JFTA 3GTHA 4YHGA 1XGZA 1UR1A 2FFIA 1BQCA 4EXQA 1JRCA 1J12A 2DZSA 2QULA 5ABTA 2DV0A 5F1VA 3BOXA 3F4VA 4UQAA 4AZHA 4JYEA 1FWRA 1NWUA 3G1XA 1O12A 3T07A 3ZLFA 4DF1A 1EX5A 2V2DA 3CB8A 3JZEA 1UKSA 3ARZA 2HRWA 1XYBA 1XICA 2OMAA 4UTHA 4EAYA 5J04A 2OZ0A 3S6OA 4K37A 4Z0JA 4PC8A 3WL1A 2NLYA 3JZUA 5AOPA 3GDTA 1ZAHA 3NPWA 3F5KA 1ESWA 1F7BA 1H61A 4OUIA 4F0RA 3LK6A 4XD4A 3AXXA 5EMJA 2Y8VA 4H8UA 5FF7A 3CU2A 5I23A 4FI4A 4ZXOA 3B0GA 3N34A 5FJTA 3IEBA 5D33A 4B5SA 3GDKA 4M5PA 3W81A 3S3GA 1VAHA 1JNDA 1MW3A 2Z0IA 2ZUUA 4DNHA 4AC1X 3XINA 1SJBA 1P43A 2DGAA 3BMWA 3WF4A 4B3LA 1PHWA 3E6EA 3WD1A 5FJOA 5AVHA 2D24A 4MNJA 2PSNA 4G6CA 4JTLA 4M6QA 2DJLA 1UD2A 3QM3A 2VGBA 5D9PA 3N11A 4K8GA 2YW4A 2E67A 4LS2A 3AAMA 3UG4A 3EDDA 4LXFA 1IXQA 3VNDA 3OP2A 4H8NA 1U33A 4NJKA 5LIUX 3UA4A 3S1WA 3USBA 3FGCA 2QJMA 2QKFA 3EDEA 5GNYA 3WBXA 3RPMA 2H8XA 1VFMA 4DUWA 3BGAA 2NQJA 2OFJA 1JCMP 3S6DA 3L4ZA 2UY2A 4NXSA 2G95A 2OELA 2QGYA 1LDCA 1Y5XA 3PPFA 4ZQCA 1PIGA 4GXWA 2D0FA 4F4RA 1KTBA 3GZ3A 3P7YA 4DUVA 1ZL1A 5EMLA 1YPXA 3REQA 3UWWA 4HYVA 2D0GA 1XCXA 2PE4A 3Q58A 1OYBA 4Q3MA 3QJAA 2NV2A 1U2YA 3CMJA 1ISWA 1P0NA 3QLDA 3UZJA 4EE9A 4ACZB 3LN3A 3ZJ7A 5CJ5A 4R88A 2OO6A 1GOWA 4DI9A 1IEWA 1MQQA 2ESCA 4LF2A 4Y8FA 3VKDA 4AD4A 2CBIA 5I3KA 3QR1A 4Q22A 4G39A 2XFYA 4JL1A 1J01A 3RCMA 3Q4DA 1U83A 2J77A 1TPH1 3EBVA 1K9TA 3DFTA 4GY0A 5EFFA 3SB0A 2OZTA 1L9WA 3ITOA 2VOTA 4R9OA 2Z25A 3JU2A 1JXKA 1XLFA 4REQB 3WELA 7REQA 1W3NA 3D47A 2IPFA 1JZ8A 4C65A 1NFPA 2FZ9A 4TV6A 4JTFA 4PL1A 5AZ0A 2NV9A 4PUNA 3ITTA 5A6LA 4ICMA 3FYPA 2X0SA 4L4MA 3TSBA 3DFOA 5M3WA 3O8AA 2IQ0A 6REQB 1U22A 4GQBA 1K8CA 3KZSA 2L5HA 4N6EA 4ONVA 3VE9A 4W93A 2FPVA 4X0NA 1O4UA 3DFSA 4JEQA 5EMKA 3UCQA 3MMDA 3LTPA 3WK1A 3WO8A 4GRSA 1UD8A 1BKHA 2W0UA 1EXPA 4O28A 1O7AA 4E5TA 3T42A 4H9UA 4F66A 1PIFA 1LLWA 1M01A 4J7RA 4Q8NA 2V67A 3LV6A 1YX1A 4RW3A 3I7QA 1ISZA 1A4LA 1QOPA 1XLEA 1CGUA 5C71A 1GYLA 3W27A 5I77A 5D30A 5FA5A 3HPZA 3EWBX 4JTQA 5G5IA 3KP0A 4Y9NA 3WH8A 3GC2A 1FCQA 2C7FA 4IXXA 3UWYA 4O8RA 2XINA 1RCOB 2PU0A 4WCJA 4Z2GA 1MI3A 1CB2A 4AH7A 2LLEA 4AXKA 2WHJA 3S5SA 3VKTA 1W3KA 2WVVB 5TIMA 1V02A 3TKFA 2UY5A 5I5RA 1RVKA 1M3UA 1G94A 4HPHA 4PSPA 1XFCA 1TR9A 1JYWA 2J13A 4KFPA 1V6WA 1V6XA 3IARA 3NDZA 3P5YA 2PLKA 3UWEA 4H2CA 4Q8QA 3F2DA 4JBRA 1VFOA 1TV5A 3TQKA 1P0EA 4J28A 2WCSA 3HFYA 1R2RA 5DXXA 2PBOA 2XM2A 4GE8A 1DPMA 2JIWA 4H1ZA 1HJQA 2WHKA 3R7MA 5I78A 5IDIA 1OIMA 4AMCA 3S2NA 3MM9B 2Y7FA 5F4SA 1XG3A 3BSHA 2XFRA 3FYYA 4J35A 3DBNA 4DBDA 2Z1VA 3RU6A 1XLKA 3LV5A 5HUPA 2GVYA 1B9ZA 3LPFA 4E8CA 2QUUA 5A2BA 3UJSA 3H2MA 4A2SA 3BAYA 3L0GA 3V5FA 5C2CA 1WUFA 3WQWA 1G4PA 4F48A 1VEMA 1VJZA 1K9FA 1TV7A 2ISWA 2Y6ZA 3L2MA 1LT8A 1S2AA 2YFNA 4B5UA 1GOMA 1LQ2A 2OSXA 3W6YA 2KZHA 2PRHA 1X6NA 3WNPA 1IIGA 1Q7MA 1YBQB 3PF3A 4NI3A 2BVWA 3S5YA 4LX4A 1RV8A 3WLTA 2Q3OA 1O5KA 4HD5A 4CQCA 3W1QA 5DFAA 2XU2A 4UQ9A 1Q2SA 1EC8A 1TFVA 3GVVA 1XRFA 2ZRXA 1X97A 4PFHA 2Y5SA 3IJQA 1ZP3A 3TYAA 3SO7A 3WIJA 2GJLA 2YIHA 4G38A 4LC8A 4XX6A 3WJSA 4Y9OA 4QITA 1AZ2A 2Y7GA 1E73M 3KL0A 2E6YA 3R0DA 2IW0A 4H8HA 3P60A 2VZTA 3P0XA 4PUWA 2GUYA 1V03A 3RLVA 4DPPA 3BLIA 4LYPA 3NSXA 1GGOA 5DMMA 4XZNX 1VJSA 4UBPC 4ZE5A 1J0YA 2WANA 2YX0A 5I79A 3W87A 1NP0A 1P4CA 2ICSA 4URIA 1BTMA 2PBGA 1J2WA 4PMYA 2J9ZA 3PZGA 1XH1A 4P2VA 2BWGA 2E9MA 4PUDA 4PTXA 2CC0A 1QNOA 2C1HA 3BLFA 3KWXA 1XBVA 2J8TA 4H9YA 2WJEA 2R1LA 3B3DA 2Y8KA 5CG7A 1UD5A 4JNYA 4AF0A 2IS7A 1QHOA 1EJTC 4ROPA 5D2VA 3KP1A 3LRMA 1BVZA 4L56A 3LCLA 1RD6A 3BC9A 3GDMA 4IPIA 1QO2A 3TH6A 3W2LA 1YDVA 3IRSA 2A2IA 1FWGC 1GVQA 4GYKA 1BWVA 2V5BA 1W1PA 2PTWA 3BUVA 1KB3A 2ABBA 3O0KA 1J0IA 4FO4A 3N2MA 3AOPA 2YL6A 1RA5A 3TYBA 1IR1A 1QRQA 1KXTA 1X1NA 4ERIA 2AOSA 2XYLA 3QOMA 4ZVJA 3W7LA 4IIGA 4IUGA 4ML4A 4J4KA 3VZYA 3EPMA 2XVPA 3GXTA 3DG6A 4GI6A 3VOGA 1L6WA 3SCVA 4DJDD 3RM4A 2Z2BA 1OFAA 2WQDA 3DHPA 2DIEA 7PTDA 2QJNA 4WQ6A 1F9CA 2PDHA 4DO7A 3GH4A 5LA1A 2QCEA 1JR1A 3B8WA 4M6UA 2VX5A 4KMQA 3H2CA 1UZDA 2X8RA 3MSGA 4GMEA 4Q8WA 1CXKA 1NSJA 1BWKA 3KHDA 3SUVA 4WKAA 5AB3A 1KBBA 4R7OA 1S2VA 2C14A 1H3GA 4QS5A 3MBDA 5CC5A 1DQUA 2SFPA 4GI9A 4WGXA 2QV4A 1B3ZA 1OFBA 3UYCA 1J93A 1M6JA 4JFVA 2OYKA 1OFEA 4XTDA 1UP3A 4AWUA 1W2PA 3A5FA 1W3IA 3SN1A 3VGFA 3NYZA 3QMTA 1RP9A 3QBUA 4RX0A 5CPNA 1C92A 3UG3A 3O1NA 1M65A 1TX2A 2OO0A 3EA2A 3CH9A 1S5MA 4JQ4A 5BRPA 1GW1A 5FJRA 3MUAA 1QXLA 4YIWA 3CPGA 1H1YA 1EBHA 4MKSA 1JZ4A 3HFTA 3NVTA 3S2MA 1UW9A 5ENLA 2VFEA 2Z2AA 4JIRA 3TTQA 3M64A 3QSTA 3QQWA 3TYEA 1KR0A 3QGKC 4HNLA 3M0IA 1JXJA 1R3WA 1UP0A 2FZDA 3G6MA 3RRXA 6A3HA 5TQLA 3WEZA 5AC6A 2I56A 1N2VA 1A5AA 1UC4A 1EC7A 4FNPA 1HF6A 2EJAA 4PUUA 2DSWA 4A4AA 3IK4A 2BY2A 3RLGA 2G3NA 4QE1A 1KGWA 3SUWA 4H6RA 3NEHA 4RE4A 1ELSA 1AJ0A 4RE3A 5D05A 1QK0A 3WNOA 1T8QA 5CSYA 1E0WA 1GORA 2TPSA 4R9XA 1NFGA 1RD5A 1X98A 2B0MA 2GJRA 1RCXB 4UTWA 1Q6EA 4DX3A 1FH7A 2VQUA 1CDGA 5I3JA 4W5ZA 5I03A 3ARTA 3RM8A 2ZRYA 4KCWA 3HGOA 3I68A 4W85A 2CHOA 4IGSA 3MTWA 4HP5A 4C5ZA 1P1XA 3NZQA 3ITLA 3SBFA 3NZGA 4WKHA 1UKQA 4UFJA 4PZVA 2UWFA 4GK8A 4GUIA 1NQ6A 1R3SA 3NJ3A 1A80A 1ML1A 4UCGA 2GQ8A 1LG2A 4JD4A 4WSHA 3RU8X 5HPOA 3W1RA 4DPQA 1JAEA 3W1UA 1M7XA 2XTKA 4UFIA 4G5DA 1I2NA 2HPMA 2J8FA 2V5JA 2F9RA 3NQ2A 3ALGA 4INFA 4LYRA 5LHEA 3B9EA 4GGBA 3G6LA 3RN6A 4ADSA 3NDYA 3GXNA 4BI5A 3FEMA 3W6LA 1R30A 1HKJA 3OGRA 3VGHA 4QLLA 3P67A 4K39A 2BZNA 1QVBA 3AYRA 1L8PA 3QF0A 2HWGA 3LHWA 1DWIM 2XH7A 1M9HA 4JIQA 4M8UA 2Z1WA 3KOYA 5EGRA 1U5HA 3EWXA 5B7ZA 1XBZA 4BF5A 2Y61A 2QUTA 1CENA 5I07A 4I6KA 1MQRA 4Y90A 1P6BA 2Y5JA 3VKAA 5ABHA 1W17A 1OB0A 3BAXA 4XAPA 4O17A 5DQPA 5HNRA 1J96A 4LB4A 2ZC8A 3UPBA 7REQB 4AEOA 1Y5VA 4LAMA 4CD5A 2YCEA 3CV7A 1LORA 2REQA 3DGRA 1RJQA 3TQ0A 3I6RA 3UY8A 2ALRA 3A12A 3G1FA 1DTUA 4KETA 2D69A 2WJFA 3UJRA 3K8KA 2OYMA 4MB3A 2E5CA 2RJHA 3QZEA 3QV9A 4FX8A 4J3TA 4AD3A 4Y8EA 3ARRA 4GJIA 1H7PA 2NT0A 3E2SA 4GKLA 1R0MA 3TWBA 3CHEA 4AVNA 1LUCB 3OO2A 1K6WA 4IIHA 1POJA 2YYUA 4GYPA 3LRKA 3NSMA 1XUUA 2QXWA 1PHQA 1ZAJA 4LY8A 4IIBA 2YR1A 4G8TA 4L5ZA 1MW0A 4R7JA 2B7QA 1SFJA 4GY1A 2QCGA 4LNYA 4NYYA 3KVJA 4US5A 5FKYA 5AYXA 1S39A 3AQUA 4NG3A 4F3HA 1G4SA 3UNDA 1R3VA 5M5DA 2BGQA 4ML9A 1UR2A 1ZLPA 3TLQA 1DV7A 4PUKA 4QDWA 2R1NA 5C7VA 2V63A 2CLPA 1JFHA 4DJFA 2QDDA 1RJRA 2FQIA 3FIGA 1XC4A 4MJ4A 3WCZA 1X1OA 3U57A 4EXBA 4KRTA 1E51A 1FUYA 1CXEA 5E0CA 1PXGA 1TMLA 2XN1A 1LJYA 3TC3A 6PTDA 4TXEA 4L9ZA 1SO3A 1ME7A 3M5XA 4AY7A 2INZA 1JPMA 1A5KC 1CB7B 3PZ9A 4UZUA 1Q6RA 1A3WA 2W63A 3OU8A 5C54A 1UR4A 3LRLA 3UWUA 5BOEA 1UJQA 4PBEA 4KEMA 4Q4QA 1H0IA 2VX7A 1YQ2A 3KBWA 4IQLA 3B0VC 1Q8AA 2HV5A 1MXGA 2O7QA 3PZQA 4RXGA 1UBSA 3T08A 4C6EA 4BHYA 1Y7VA 3SY5A 2POTA 2QEZA 3TTOA 4HPGA 4D6GA 4I7VA 4JTDA 3FXGA 4DBSA 5FAGA 1QUMA 1QOQA 3K5XA 3SI9A 4CGTA 1FP8A 4JCLA 1OK4A 1F5ZA 4ZFMA 4WSJA 3ZSSA 3R79A 3C56A 4UQCA 4DWDA 1TJPA 4YLWA 1S2TA 6XIAA 7A3HA 1DYSA 1ZJHA 4WHBA 1J5SA 4DF0A 4EWND 5AKQA 1TPEA 3NQAA 3QZ6A 5F7UA 3K2GA 3NYDA 3OLEA 1TRDA 3UESA 5DCBA 3DECA 5FSDC 4JIHA 3C3UA 1RY8A 2W79A 3OVPA 3HPXA 5BRQA 4UTWC 3R58A 4U10A 5F2GA 2E1WA 3MUXA 4HCDA 4UNLA 3NR0A 2P8CA 1AJ2A 3G1RA 4FALA 4ZBCA 4KEVA 2VCAA 1PTGA 3GD6A 2EKGA 3N4EA 1EF3A 4WVXA 4HQVA 3POHA 1QATA 3SCSA 3GQYA 3TTEA 3WQVA 1DIEA 5ABGA 2VX6A 3O6AA 1EJUC 3H26A 2DT2A 2DVUA 5HWJA 4NZJA 3LU2A 3LY0A 3BXWA 2PWGA 3BANA 4WOQA 4DWSB 3NAVA 5BCAA 1L0PA 1E9LA 2GJXB 4PBFA 5KZEA 3EWCA 3ABZA 2P5NA 1K8XA 1A4MA 1ONXA 2WBGA 2OLAA 2FGLA 2NQHA 3SZ8A 1ODUA 4NT0A 1RALA 2QYGA 3N6JA 4W7VA 1GYMA 4M24A 3E0WA 3BV4A 5AC8A 2GGHA 4B9YA 4XO6A 2WKLA 3MJYA 1Z6KA 3RLHA 3PAOA 2DDXA 1GEHA 3WQPA 3E02A 5K4ZA 1S5TA 2OEKA 3H8AA 4D71A 3R89A 1PO9A 3URNA 1VBGA 4L9YA 1ZJ8A 3P93A 3XISA 2E5DA 3ABRA 1K8ZA 4DLFA 2EG8A 3I3BA 1J0KA 2H6RA 1T96A 2ZUTA 1R87A 2PUZA 5KZDA 3L9CA 4BKNA 1EJ7L 1VEPA 4U2ZA 3QFWA 1RZMA 3A9IA 3THDA 2Z6JA 3ARVA 4MFEA 3FA4A 3PN8A 3UG5A 1E1EA 1XIEA 4X61A 3SRFA 1NDYA 3EX4A 4H04A 1EJXC 2V81A 1JULA 4A3RA 1UKOA 4HU0A 4BF9A 4PRRA 3WQOA 3S1XA 3EB4A 3IV8A 3ES8A 3P81A 1NIUA 4YTSA 4GA8A 4OIFA 5D8WA 4GVFA 4X0VA 3UP8A 1YRRA 1JGIA 4O57A 3MHGA 3STEA 3O06A 3UR7A 3TW6A 4HA1A 3EX6A 1EGZA 4KBXA 2E68A 1MWOA 3WJXA 3CM4A 1OYAA 1TV8A 5HPCA 3ZT5A 1S2CA 3DZ1A 2QMJA 1N55A 3U5YA 3LCFA 1XL9A 3D0CA 4XWUA 2PWDA 1MO0A 2ZUMA 3P5ZA 4GABA 2DZAA 1Q4WA 4O4VA 1ZUAX 3L4TA 4Q8VA 4B16A 4MDPA 2IKJA 3N4FA 1HT6A 5FD0A 2AMGA 3W1TA 1TE1A 1T41A 3GNRA 4R27A 1Z32X 2PDIA 2XZ7A 3TW9A 1HJVA 3NQGA 2PAJA 4UR7A 2CCRA 1Q4NX 4DI8A 1VYRA 4QGCA 4ZSUA 4WJ8A 3W7QA 3W01A 3MMBB 4YJ5A 1J5TA 5G2IA 4AD1A 1TG7A 4N02A 4LAOA 1X8CA 2YGYA 3ZLHA 1CXLA 2FB3A 4GQQA 3W07A 1SO5A 1XP3A 4Q4OA 1TWDA 3W7EA 2J8GA 1SJDA 1KWGA 3VDAA 1HJWA 4HNCA 4MY9A 2X30A 1EX1A 1YDNA 3SR7A 1GQKA 1W9PA 4JFUA 1B2YA 4LUTB 4WDUA 4X3ZA 3OVRA 2YKKA 2GQ9A 3OBEA 4J27A 3VC6A 5KITA 3WH9A 1G6CA 1NF7A 2ZA1A 4UNIA 3W7MA 3VKSA 1JPIA 4CD4A 1A5MC 4LB3A 3GO2A 4XKYA 3GG7A 1JPDX 4LW7A 3VM1A 1HVXA 1H63A 2VNCA 5JQ9A 3W26A 4Z1AA 1E9YB 4Y9PA 3MMCA 4G1NA 2E6DA 4RL3A 5FF0A 3KOXA 4GYJA 1F6PA 2O56A 1SSDA 5H1WA 4BFAA 4D1JA 3FOKA 1SPQA 4N4QA 1R47A 2QDEA 4P5UA 2ZCGA 2V5KA 4G7EA 5DF0A 1EH9A 1G0CA 4HHPA 3M43A 3G3DA 1JUBA 1FDJA 1D7FA 2H8ZA 3ID7A 1V0LA 2GSEA 3H2AA 3ZR6A 1BXNA 1X7IA 5IFPA 1UH4A 1GPFA 3DIPA 2UZ9A 3MS8A 2DUZA 1LRNA 3FN9A 4MAVA 3DU0A 2XSBA 4QBXA 1E3ZA 1MXDA 3BJSA 5LNSA 2J7HA 1LL4A 3WN6A 1H4PA 1R86A 1A3HA 1E71M 1C7SA 1AW2A 3C52A 3ZJKA 2WSYA 1VFUA 2NSXA 4IQDA 3MUCA 3AIUA 2BTMA 1QT1A 1KRBC 1FKXA 1YTKA 2Z26A 4OUEA 3GR8A 1VF8A 1OM0A 4ZMGA 4C6FA 4PBGA 1NOWA 4MIMA 2DSVA 3BW3A 1KM4A 1F8MA 1GPWA 1S5NA 2AGTA 1UOKA 3U4AA 1W91A 4GZEA 5C7HA 4CCZA 3GDRA 1YE4A 4REQA 4FNQA 1GUVA 3QQ1A 3GUWA 1EIXA 1VENA 2V9DA 3WLIA 4PE8A 3W70A 3GK0A 4I5UA 5C9RA 1E15A 1VBRA 4WDXA 2NLIA 3M5VA 1VFSA 2W92A 2VRJA 4Y6GA 5M03A 1BYCA 4KS0A 3WK2A 4EX4A 1W8SA 3LTYA 1V3JA 1RJPA 1JPKA 4QLKA 1ENUA 1W1VA 1O1ZA 2OZ3A 1EDTA 3TN5A 4GBDA 1E40A 1GZ1A 2VTFA 4W8AA 2X09A 2DUXA 2D20A 3AC0A 3MUZ1 4RE2A 1EA9C 4J3XA 1XV8A 2NUYA 2EQDA 3CO4A 3M41A 1V5XA 4K68A 1J8VA 1I2RA 1Z9AA 4O53A 3WY1A 4US5D 2AQOA 1NH6A 2IKHA 3W1XA 2RHGA 5I00A 1WPCA 3TSDA 1KM2A 4HBKA 4WK9A 5CC7A 1CEOA 1X96A 1US3A 1VS1A 1X7FA 3MO4A 1OFOA 3LENA 2QPUA 5CZKA 1KBLA 4O1FA 4H19A 2A6NA 4LVDA 4M1RA 1TVNA 1J9YA 4IPLA 2QUMA 5HANA 2PGFA 1FP9A 2CBJA 3VOHA 5GPRA 5G1TA 1OT1A 2GSJA 4AEEA 4O0ZA 1HJSA 3KW3A 3GXMA 3ARSA 3F1QA 3W2KA 4KESA 3H53A 4TVCA 2GGEA 4BWLC 3F2BA 4O0KA 2XM1A 4GJJA 2WMGA 1S5WA 4RNJA 3IS4A 1UA3A 5A6SA 3F5LA 2B7OA 3C61A 1FHVA 3WLJA 5D2YA 3ZO9A 3AJ7A 3PBYA 2WZTA 4PTVA 1KD0A 3B04A 2R14A 1Q6FA 1UZHA 1H50A 4GNKB 5HMDA 1W37A 3FKKA 4E38A 4IX2A 3W85A 5EYWA 5A6JA 2QCLA 1KRCC 4ZL1A 1CCWB 2BY1A 3ABSA 3ARQA 2G3IA 3I6EA 3LD5A 1HG3A 1N8FA 1FHUA 2XN2A 2EXOA 2ZZ6A 1PUDA 2X42A 4HOZA 3D3FA 2GGJA 4PTWA 4W4QA 3APGA 1JDAA 2RFGA 3MP4A 4UQEA 4AZCA 2AQWA 3WQ8A 4QEEA 1C29A 3G5EA 1DWFM 4GOAA 3H70A 1ADSA 1NY1A 4DWSD 4GZIA 3GW0A 4BWLA 1TV2A 2D2OA 4LALA 3EDJA 4HNVA 3RXZA 5K9XA 3RRAA 1YPIA 1FWWA 3C2EA 3KCLA 2GDQA 4ERGA 1REQA 1SO6A 4IP5A 1MYRA 1XLGA 2X41A 1W9XA 2HS8A 4KIRA 3GX9A 2DZUA 1DVJA 2FJKA 1ISXA 3FJ6A 5J5DA 2A3LA 4KEZA 3VMPA 2HROA 3TTYA 3OHMB 2QS8A 1PYMA 2PWEA 4RPPA 4XZIA 1BF6A 2YOCA 4OTKA 3VABA 1F6KA 4N6FA 1TUXA 1LLZA 1CXHA 1BKSA 3WLHA 2C0AA 1P7TB 3S0CA 1HNYA 4PGLA 1JVNA 3BCFA 1KCZA 4BEUA 3ZT6A 3TA9A 3TYCA 5AHNA 4HMDA 3CNYA 4PH6A 3T2PA 2X7WA 4LRSA 4AWEA 1N8WA 4JS3A 5AYYA 1H49A 3KOWA 3WEOA 1H7NA 1ZHAA 4XZ9A 1E1CB 1UWIA 4AXNA 4J2PA 4HMNA 5E9XA 3MM7B 4PMJA 4RZ4A 3S2LA 4IGNA 1MEWA 3UZ5A 4JQ3A 2V3DA 4ILSA 3E74A 3CJPA 2QAPA 4WY0B 1EOKA 3TP4A 1QNVA 4LGXA 3TQPA 1IEVA 4PMDA 1YXDA 2W67A 4LV9A 1JUKA 3A3XA 4PCTA 4S3CA 3KZPA 2PCEA 1KCLA 2J78A 3T9PA 1AG1O 3WEMA 4FZIA 1QHZA 4DBWA 1NDZA 2CXGA 3M0JA 5HNTA 3T09A 2O4MA 4UQBA 1OCNA 1G01A 3LI0A 5E5CA 3DI1A 1UD4A 3ITXA 1MW1A 1KNWA 4AISA 2EEXA 1W56A 4KPLA 4NJGA 4RK8A 3SAZA 4GUJA 4UTUA 4LNCA 3E5BA 2GJXA 4XZHA 4C6KA 3VD9A 3GSMA 4B5VA 1SZFA 4A3YA 5JVLA 1V3LA 2DFAA 1SZGA 1JG9A 4FLOA 1BXCA 1V6VA 1E70M 2X1SA 1AW5A 4QQUA 2ANUA 2WPBA 2QUVA 3DHFA 3ZWTA 1A5BA 2CWNA 5T9CE 2PF0A 1FA2A 3MMWA 4KWVA 1A0EA 4JTAA 3C0LA 1BEUA 2BOFX 5LIXX 1OCJA 5MKGB 4G9PA 3QPZA 1ZQ5A 3G8EA 1XLBA 3CAKA 1S2UA 3R11A 3DI0A 3K46A 1OABA 3W72A 2GSHA 3OZPA 3NO5A 3A4XA 3VI2A 4GUFA 4G1KA 2OYLA 1KFLA 4KCVA 3VU2A 4B4FA 4F9DA 1DJXA 3RAOA 1L6YA 3SY8A 4CU8A 2P50A 2DZBA 2KAUC 1FWDC 4C6DA 2HDJA 2DZPA 3P0WA 4P7RA 1HJXA 3DAQA 1XI3A 4JQ2A 3ZLGA 1FBAA 3V5CA 4W88A 3BPWA 4GPNA 3TK7A 3NEVA 4M80A 1BGAA 1RBAA 3WMLA 1LBMA 1KXHA 2BHYA 1IV8A 1OFQA 1RY0A 1Z69A 3M46A 4MUPA 4DAIA 1IZJA 1XKJA 3EOOA 1E4MM 2OWCA 4JDBA 1Q7ZA 2J74A 1EPVA 3QMRA 1ZCCA 3VNJA 1XLHA 1C7TA 2VP8A 3ZR4A 4Q32A 3V18A 1WXZA 3SY1A 2UBPC 1UMYA 1UUMA 2YSWA 1Q3NA 4EP8C 1JAKA 1WZMA 5F4WA 4M6VA 5C2XA 2OT0A 4LCSA 4UMCA 1HZYA 3GKAA 2DT0A 2PD9A 4W5UA 5HR7A 4U33A 1JYXA 1X6UA 2J79A 1W9VA 1EGVA 1MRQA 3WUEA 3CT7A 2HVMA 2WM0A 5GJPA 3N29A 3T8LA 1JCYA 3IUDA 4U3AA 2NQ9A 4FMVA 3QTGA 4JOMA 5FI8A 1KM1A 4HNOA 4RDZA 4V27A 3EB3A 1CXIA 1EIBA 3ENLA 2OKOA 2AMXA 1QAPA 4Z2KA 4GYPC 2IKGA 5FL1A 3U6WA 1TWWA 4AY8A 2DY3A 2EAWA 4BQ3A 3UF9A 2PF8A 4HPNA 4NZ1A 2JF6A 2V5DA 4ADUA 3DGBA 4DJDA 2X2GA 2FMNA 3INPA 5FF2A 5FACA 5G4EA 4S39A 3WLKX 1K7FA 3JRKA 4C60A 2ZRVA 4HTBA 1Q45A 3IJIA 2ATMA 1BRLA 3AWNA 3L7RA 1XBXA 2Y89A 1FVPA 3S46A 4BS0A 3VO0A 1B4KA 2GJNA 4FSAA 2V69A 4B5XA 2VT0A 3V0UA 3GR4A 1TPFA 1R7OA 4AD0A 2UY4A 2CLMA 4HNTA 3TFCA 3BLOA 5LYRA 1IWPA 2Y5EA 1PB0A 4QJ4B 1S1RA 3MWAA 2QNEA 1MNSA 1YPFA 3E38A 3L23A 1QW7A 6TIMA 3MM7A 3MBFA 1PE1A 1S3TC 3FJNA 2DZWA 1Q6QA 3FFSA 4JY9A 3UXLA 3OGSA 1Z3NA 2FZNA 3BAKA 4AZBA 2VRKA 4LVAA 3PBGA 2PS2A 3NL5A 3CZJA 3SUUA 2D73A 4HZ8A 3IVSA 2DZVA 2DJXA 2V6AA 3SFWA 4KH2A 2WVVA 2OGYA 1ME9A 4K38A 2ZTKA 3IJ9A 3I3EA 3EPNA 1DXEA 4XAYA 2WBKA 5K4XA 5D4YA 5ECVA 5H8UA 1WNOA 4QG6A 4X63A 2VGFA 4C6OA 1YLVA 1MEIA 3HTWA 4K36A 2XGZA 2XPKA 4WXZA 4B3KA 4H2HA 1JZ2A 1R9YA 3MCNA 5I3FA 1R38A 4WXYA 5D8ZA 4S23A 3M0HA 2E9LA 4TTUA 3SFKA 2DU2A 2OSWA 3U2CA 3N9SA 5HNNA 4TVUA 4AIOA 1UP2A 1CGYA 1JGMA 3USZA 2I17A 2PTZA 3LCXA 2GOUA 4L64A 3LERA 2WKJA 5FL0A 3SUTA 2JFEX 4UUIA 3WLQA 2RDUA 4FOKA 2OLSA 1DWHM 3GG1A 3GXDA 4IQJA 3QLLA 4BY3A 2JGYA 2E77A 4ZTXA 4ZOBA 1OT2A 4B5WA 2B7NA 3L67A 2WZMA 4D6JA 3N25A 1EFZA 3WMCA 3WL0A 3TNOA 1DWAM 1K7XA 3M5YA 4GD0A 1V7YA 3URBA 5E93A 1CT5A 4PL2A 4L6DA 1XGDA 3AIWA 1XLLA 2FPYA 1ZAIA 1W9UA 5EU9A 3B0JA 4H9TA 1DWJM 1Q7QA 1J79A 2FTPA 3CAQA 4I8DA 3SECA 1K70A 2BODX 5XIMA 4MUZA 2P53A 1TPUA 1SQ7A 1IXPA 3N3TA 2NQ5A 5I3GA 3BL3A 3UW6A 2Q3RA 4P8UA 2PDMA 3G1AA 1QI2A 1YKWA 2A21A 4XIAA 3C3NA 2DSUA 1WDSA 4CNNA 1DJYA 1O5XA 1YDOA 1XFBA 1A0CA 3NUKA 2P0IA 1ZGDA 3ARUA 4QNWA 3IUIA 5CH9A 5GNZA 4MB4A 2A3BA 2XGBA 2GDUA 1SFTA 2XDFA 4I5XA 1MDLA 3KRZA 2J7FA 1V0NA 1B3VA 2BDQA 3MC5A 2XWDA 3BAWA 2ACUA 2QAFA 5CEWA 3RYSA 4NKCA 1L6SA 3M5ZA 4UFLA 3WX7A 3GWQA 2ZVIA 3G1HA 3R5EA 4WJXA 1XW8A 3D3AA 3IIVA 3CV2A 4OBSA 1WOAA 5I02A 2X7VA 1CGVA 2O4QA 1GEQA 2XFFA 4GQ0A 2WAGA 2E4TA 3EPOA 4HU3A 1TE6A 3C8FA 3VUSA 2YXOA 3RR4A 1O6IA 5DMNA 1FDYA 1W5NA 3IJDA 4CU6A 4NU7A 5I3HA 3MMTA 3LMZA 3W7IA 1CBGA 3CH0A 1QI5A 3W1PA 1SSGA 1WXYA 4KCTA 1TKKA 4LS1A 1JCLA 1H7XA 2NT1A 3TJXA 4MZ8A 2ODOA 5KETA 4XO7A 5IM51 4MY8A 3DKLA 3ZIZA 4DM1A 1RPKA 2VEIA 4XD6A 3APTA 2ZADA 3VOFA 2XH0A 2NSOA 1DIOA 3Q94A 4NAFB 5ABFA 4KEUA 1B1YA 3B0NA 4HYRA 3PTKA 4XZLX 2CXEA 1X38A 5FJIA 4AZ7A 1SZNA 3PZNA 5AN7A 4CVWA 1CZ1A 1V3MA 3N17A 5FESA 3SJ3A 4ATLA 3U4FA 3LLDA 4JDYA 3LCWA 3ABXA 1U30A 1UWUA 4KWWA 4OU1A 4JHOA 5AHMA 4FF5A 3VDBA 2BSLA 5FAJA 3N2BA 4XAZA 3PAJA 3LHTA 2P76A 3WQCA 4W8BA 2RUSA 3H2OA 1E6NA 2NUXA 3JUGA 2CKRA 4BK9A 2GQAA 1TJRA 2YCJA 3ITCA 2QCCA 3HMCA 2G41A 3QPYA 4FXSA 5H91A 4WEVX 2AKJA 5A6KA 3STPA 1HKVA 4A3UA 3I65A 1VBHA 4JTIA 3I4EA 6REQA 2QJHA 4A8RA 1OX4B 1P1MA 2OU4A 4GIAA 2IQDA 4F2BA 3SSZA 4L80A 3UT0A 3T55A 4LUYA 4EXAA 4JZ5A 3R94A 3OR2A 5E6ZA 4TIMA 2ZE0A 3CUFA 2BXYA 4JX4A 4C6LA 2FJUB 2QF8A 4QE4A 3BICA 2Q8ZA 1IEXA 2FLIA 4F2TA 1LROA 2WMJA 1T99A 2OKTA 1DJGA 1Z8AA 4PCPA 3LI1A 4PSRA 2VXNA 1WB0A 4B15A 2DVXA 1NARA 4JKLA 2HPIA 4LEFA 3OIHA 4H8VA 3V75A 5EPDA 1V0KA 1DXFA 4ORIA 5BU6A 4A22A 1W3LA 2OXNA 1EDQA 4A2RA 4C6JA 4S2CA 4RZBA 5A6MA 4AIUA 1MVYA 4C1LA 3OVQA 4XBSA 2P0OA 4JL2A 5T26A 1HUVA 4RV3A 4I90A 3UYIA 3NOYA 4NSBA 1GONA 3W28A 1OX5A 3IIZA 4XG1A 3LOTA 4MOZA 1ODZA 2E0PA 4U5IA 3CUIA 4KWSA 1FWBC 2E28A 1NP2A 4DM2A 1EJRC 4O1CA 2CZ5A 2D3NA 2O0TA 2WZHA 2ZA2A 4QSFA 6XIMA 3THUA 3EOLA 4O4WA 2RDWA 4MDOA 1CECA 3E96A 3TZFA 1OD0A 5DMYA 4GXMA 3EEZA 4MY1A 3A24A 3CIXA 3TV8A 3GU9A 1W1YA 1HL9A 2E25A 1CX9A 5LNUA 4BQ4A 4PCNA 2NXIA 3KTXA 4EAMA 2FHCA 1UCWA 1KXQA 2WNQA 3QGAC 1Y65A 4F0KA 1VRXA 1UIOA 1TZ9A 4EANA 2V2CA 1IYXA 1HKWA 4IJRA 2BFGA 3MZ2A 4C6CA 3TYDA 2NW0A 3E0LA 4TO8A 2QHAA 3CWHA 3A4AA 1RBOB 3VIKA 2O9PA 3LMYA 3V0TA 2ZZ1A 2Q6ZA 2BB0A 4GX9A 2HJPA 3AXKA 3BO9A 3M07A 3BJTA 1M7PA 3CQJA 3KVLA 3KBMA 3KLKA 4C91A 3BCJA 1KCKA 5I24A 5C6MA 1S38A 4BI7A 1B4EA 3LPGA 7TIMA 2JE8A 2BVYA 4U3CA 3V16A 3LB0A 2FKPA 4MJZA 1K7EA 3MMUA 1W3JA 3QOKA 3NQBA 1JZ6A 4BR1A 2J7EA 4S2BA 3W1MA 3CK5A 1TZZA 3HQOA 4M19A 4YU1A 2PMQA 1R3TA 3MYOA 1HW6A 1C8XA 3S8HA 4H83A 2WNZA 1SMAA 4I9MA 3GLCA 3UWQA 3HF3A 1GQLA 3NA8A 3BAJA 3UA3A 3WQ6A 4LBSA 2F6KA 7ENLA 2OWWA 5MKGA 1W5OA 3LCHA 4FP1A 1LM1A 3LZ5A 3VIMA 4FEZA 1XWYA 5DT5A 3WMSA 5EY5A 3EWWA 3BE7A 4N9BA 4YYCA 3VA8A 5GEPA 1JCTA 4L65A 4OFCA 2G97A 4IOTA 4YWIA 1AUSL 4F0LA 2HNHA 1LF1A 4GFIA 3K1GA 3VCRA 1YNQA 1NTHA 3PJXA 4HOXA 3UPMA 3VKRA 1I8JA 5HWMA 3UZYA 7GEPA 3T40A 1V4YA 1OJXA 1KBKA 3AFBA 1UKTA 3B0XA 4JPGA 2QPXA 1GNXA 2JK2A 3SCUA 1XF0A 1TR1A 4AMAA 4YTRA 3GYEA 4C6PA 3APYA 3IJ8A 1KM6A 3W2NA 3WQ4A 3WF0A 1H5YA 3G22A 1WO2A 2QJIA 1TRIA 4V33A 4D72A 4LQ1A 1XKYA 3L0NA 3OTRA 1PPIA 5GQBA 4JIEA 4NYUA 3CO8A 4WOZA 3RGTA 4W84A 1OC6A 1SFLA 2XH4A 4UTJA 2OCZA 4AB4A 3QW4B 4X22A 2R1MA 5LNRA 4Q4SA 2CW6A 4JAWA 3TN6A 3EWYA 1ZRQA 5J5RA 2WV8A 3QXBA 5BXTA 3LNMA 4UTTC 3BG5A 4AD2A 5K9DA 3ZZ1A 1OADA 2WYSA 3COTA 3NPUA 2NQLA 1AJZA 3OIXA 2VR5A 2FDSA 2BOEX 4G2DA 3VNMA 3CMGA 1MNZA 1P7TA 1ZBWA 1KC7A 4CD7A 1F6YA 1OINA 3VNZA 4JTSA 2BP1A 5C2GA 1HGWA 4IL0A 3HIJA 3N2OA 4UMBA 4S3FA 4OOZA 2O9RA 1FWCC 1EOMA 1IT8A 1PKNA 5CPMA 4ZQMA 1QU4A 3QY7A 1CWYA 2WC4A 1IEIA 2BMBA 4YCPA 1GZJA 1I2PA 2EJ1A 1OYCA 2RJGA 4A35A 3WNMA 5HOSA 5E0FA 3MI3A 1O60A 1SW3A 3CZLA 3NGJA 4DY1A 3IANA 4MWAD 1R9XA 2J7CA 2MANA 4JKMA 3OJGA 1W8GA 3QC0A 1ICQA 4IFKA 5HINA 3NSNA 4NVTA 3HO8A 3R8RA 1PWMA 5C9ZA 1OGSA 3W25A 3PBUA 2J9YA 2YDQA 3VIOA 2IKIA 1NWSA 3NL3A 4E8DA 4R7WA 4LCQA 5HQEA 3PS7A 4O16A 4QP0A 1QOXA 3QFEA 1M03A 1UA7A 3NTYA 3VD7A 1V51A 5I06A 5XIAA 3AXMA 3HA1A 1I2OA 3B8UA 2JF7A 1BWLA 3CPUA 4U4MA 3EA1A 3UZZA 3HB9A 2FFCA 4HCHA 4LBRA 1XLIA 3RHGA 2YLAA 3AIRA 3U2OA 2A1YA 3WG6A 4IG2B 3VTRA 5CPQA 3H24A 1DORA 2FDMA 1B3WA 3GU2A 3BGGA 4AIBA 1OSEA 2OB3A 2AKZA 2PWVA 5AC4A 1KTCA 4NRRA 1OX6A 1F61A 4QSHA 4UOJA 4GLEA 5AFDA 1XH2A 1PBGA 4J2MA 2YJQA 3NQEA 1EXBA 4HZ7A 3E9AA 4ORMA 3LTSA 1VB9A 4IMDA 4AHOA 8RUCA 1XDJA 4HMEA 5AC7A 1KFJA 1W5QA 3W02A 2G3FA 1UZ1A 3SQSA 4K1GA 4RKAA 1UQYA 3T4WA 1XLMA 3B03A 3MW7A 4DF2A 1B90A 4H6EA 3MM5B 1JDEA 4GVIA 2Y88A 3XIMA 4WDTA 2C6QA 2YPIA 3SIMA 2PC4A 3ZS4A 2EHHA 1M41A 4P8XA 3QY8A 4OHQA 4Z2LA 1WAUA 8TIMA 5DXYA 4IUOA 4AFYA 1XSJA 3RPDA 4DELA 1QW8A 3DCPA 1TJ2A 4HB7A 4IZGA 5FF4A 1LYXA 3TNBA 2NVDA 3AROA 3W7DA 1A5CA 5IBXA 4GHRA 3EDFA 1JF6A 3L68A 3SQMA 3KVKA 4K1WA 1MUWA 1GG1A 3NM3A 2NVAA 4WY0A 3KRBA 3TX9A 2GVGA 1GVIA 2EPHA 1ITQA 3TYUA 4DJFD 1LCOA 4X2RA 3IACA 3RX3A 4C7FA 3RMJA 3RX4A 3PG8A 1JCJA 3GFZA 2RGMA 3ATZA 3GC4A 1XDMA 4DVOA 2WHLA 2GUBA 4XUYA 1MW2A 2WJZA 3W7JA 4AWSA 4NAEA 3U8GA 4DZ5A 1H7WA 1TO3A 2I1OA 5I7GA 4ZB5A 4Q4MA 1NAL1 3RFAA 1RVGA 3CUGA 4HN8A 2BBFA 4LT9A 1VCFA 2CLLA 1KGXA 4HN4A 1IF2A 2W9MA 3GHSA 3M16A 4WY0F 1AD4A 1AH3A 1JUEA 4KWUA 2DP3A 4R33A 1PZ2A 1PZ3A 5KTLA 3OBAA 4S3JA 5KZ6A 1KRAC 1YDYA 4OJYA 2ZBTA 1LOSA 3VGEA 2XVNA 2J7BA 3RJYA 2POZA 2CHRA 3GNPA 3LCIA 5CZTA 2ZRZA 4W7WA 4HK7A 3HMJG 3P82A 3WBEA 2W62A 4CUCA 2XSJA 4QQ3A 1WDRA 1WDQA 4L1XA 1UH2A 3MI2A 3H22A 3PBVA 3MSYA 1UWTA 3WD4A 5G2HA 3CZ8A 3WH7A 4OQVA 1ZZMA 3H4XA 4I6VA 1YNYA 4YVXA 4JEJA 4JTKA 2EO7A 1UKPA 4N9EA 1GW9A 1SR0A 4K8HA 2PODA 1POKA 5IHSA 3M6DA 4H9VA 4US6A 4OWGA 4KCUA 3QHOA 5JH2A 4S3BA 2I7GA 4MZYA 3TR2A 1RK6A 2I14A 3T0AA 3H7RA 1UPMB 3H4WA 4FR6A 2F7FA 3FLUA 4GINA 1P0BA 1JFXA 4YXGA 4J1OA 1LRQA 4DAFA 3AXHA 3WK3A 3AZSA 3C2VA 1QI0A 2ZX6A 3DERA 3ZVIA 4E4PA 5FCZA 1WDWA 1PSCA 1ISVA 1O94A 3IWPA 5A6AA 4IP7A 1C91A 2Q8LA 4ATDA 2VUYA 1H09A 1N8IA 4A3QA 2I16A 3VUPA 4P7QA 3TXVA 1Q6DA 2YCIX 4NI8A 4ZR8A 3AJXA 3LXBA 3VDHA 2CLKA 3VDGA 1YTDA 3SW6A 5JH1A 2EPOA 3ES7A 4RNIA 2CETA 3N13A 1KV5A 4F40A 3UR8A 4IFKB 2WVSA 2MUCA 3QQ0A 3LQGA 5EL1A 3WDRA 4Y96A 1KXVA 3OODA 1T5AA 3UCCA 3BW2A 4HCLA 1KRMA 1XIGA 4XD3A 4M1BA 3HGRA 3AWOA 3WQDA 5D9MA 5CBBA 2WMIB 4P7NA 3KAOA 2OQLA 1O68A 2KX9A 1F05A 4CKQA 4D6HA 1KV8A 2GOKA 3MT1A 1IT0A 2QV5A 1S5VA 3DYPA 4UMAA 4MPQA 1KFBA 4M51A 1NDVA 4CQBA 5LIKX 2VWTA 2VCBA 1LRTA 3WDHA 1ZFJA 4YN5A 3AUOA 4H9MA 5CZSA 2ACSA 3C0JA 4AF0B 1GVSA 2H3DA 3H55A 1F3EA 3L5LA 3U7VA 1B5TA 1X6LA 3SCPA 3WNLA 9XIAA 5BOFA 3OLDA 2QF7A 2W4XA 3M6YA 3U3HA 4D1IA 2QLYA 4AUBA 3L2IA 3EGJA 3W53A 2DVTA 2WJDA 3KFTA 5BROA 3MV01 3VZZA 4DQWA 4C6BA 4RCXA 4Q6XA 4HTRA 3R1ZA 4RDYA 5BU9A 2ZX7A 3OVGA 3QGVA 1MDRA 3CGTA 1XIDA 4Q4RA 4NILA 5D04C 3URAA 1MXSA 1CTNA 3U5UA 3VLXA 4LVGA 4Y7EA 1HL8A 1FH9A 3QVQA 1AMKA 5CPSA 4GG9A 4EWJA 3BLDA 4AWTA 3KHJA 3SM0A 1I0DA 3VIGA 5CC3A 1PCKA 3PSWA 2G37A 3QV6A 2DQWA 2WQPA 3O63A 3KRUA 4GNVA 1TVLA 3NQCA 4K8EA 4Q8TA 2PA6A 2OJPA 5DY2A 3ARWA 3CWOX 2CLHA 3HJEA 3E1F1 3WFZA 2VVSA 3AO0A 1QNQA 4N9DA 1TPC1 1TCMA 3C2RA 3V5OA 3VLYA 3MKCA 5M17A 3PTDA 2W3ZA 2X05A 4DJDC 3HGJA 2WCAA 1EJWC 4IHCA 3GXPA 1V79A 2WVUA 5FJUA 3LZ3A 4IFRA 3K4AA 1G67A 1UWAA 1K6AA 3TOYA 4GUHA 4JIPA 4HSNA 2VO5A 2YZRA 3GFYA 5AOUA 2QCNA 2BASA 3GNDA 1FWIC 3H4GA 1CGTA 2GUUA 3DYOA 2OODA 2OOFA 2Y85A 4UC5A 1KQYA 5DX7A 1TUFA 1W5MA 4YVVA 4GI8A 4D8LA 3PM6A 1KO0A 2VC6A 3IIOA 4FF7A 1IGSA 4WSKA 3M9YA 1Q13A 3EWDA 3B9AA 5GVJA 1V3IA 1B54A 5KEZA 5HNUA 5E6YA 2TMDA 3AMDA 1TQJA 1OHLA 4H00A 3VD4A 4L61A 3GNXA 4CCCA 3RK8A 1Q85A 4YHEA 2PTYA 4NASA 1FWAC 3W23A 4HU4A 2PD5A 3SUSA 3UXAA 1VCVA 4MG4A 1GCYA 4Y9MA 2C18A 5H6HA 2V30A 4OECA 2E6FA 5XINA 3LGDA 5AC5A 3ANVA 3ICJA 2XSJB 4ZE4A 1R3YA 2WMKA 1E9ZB 1K03A 4XZWA 1EQCA 4E3TA 2O55A 1NOUA 3TLLA 4M3PA 4NZCA 3WLRA 1EJSC 3LA4A 3DDMA 2FHBA 1N7KA 1E0XA 2PPGA 4LSBA 3WJWA 2ZXQA 2PDQA 4LRTA 2BY3A 4DLMA 4XTIA 1F2JA 3SCWA 3CL7A 3W00A 2A6LA 4D2JA 4ZO6A 2R1KA 1EB3A 3FY1A 3FSTA 3W37A 1ZS2A 1HL2A 4NZFA 1US0A 1FY6A 3HM7A 2W6RA 1GT8A 1RQEA 3U7BA 4G56A 3VMOA 4LH8A 1PJ9A 1RLCL 1WAWA 2Q09A 3VC5A 4JY8A 1GVYA 2XIIA 5JIPA 4WUIA 3PJWA 3HQNA 4LUSB 3VD5A 5I2UA 2ZXDA 1OWQA 3TUUA 2UY3A 5DT7A 3DG3A 3S6TA 4LOCA 3BW4A 1ICPA 1PZ0A 5FIPA 1TELA 3TU9A 1UR9A 1XRTA 3PK7A 3W73A 5EFDA 5HMEA 2NX9A 4M0XA 1J10A 5DMLA 4JTJA 1BG9A 2E8YA 2G8ZA 3BCDA 1R8LA 4OE7A 2RDXA 2F6UA 3IGXA 1XM3A 5HQMA 1RBLA 1LUCA 3GM8A 4K7YA 4HSHA 4PMOA 1AL8A 3OA5A 3GU1A 1HGYA 2E40A 3B4UA 1UHVA 1GKQA 1REQB 2PB1A 3ALFA 2VQTA 3BWWA 3EXTA 3ZT7A 3JR2A 1E6ZA 4GI4A 5CBIA 3AMCA 2XVLA 5I3IA 1TX0A 3PBMA 3GHTA 3UVIA 1QDSA 2JEQA 1HP5A 3VX0A 1ZALA 3M47A 3MM6B 1CW2A 3WQFA 2NX3A 3ARXA 1EF2A 2Q02A 3LS9A 4FLSA 4E4FA 5D9OA 1M7OA 2YB1A 4J9JA 4C6NA 2CERA 3I10A 2J62A 3K4DA 1IXNA 2F2KA 4A05A 3LUTA 1TREA 4CNUA 1C9WA 2YA0A 3RO6A 3FAWA 4C7GA 3PC0A 1PEZA 3U2EA 2TSYA 3TZNA 5CC6A 1F3TA 4LYQA 5RUBA 4M6PA 2AL2B 1UD3A 2WMHA 1XLCA 2FIQA 1V08A 2G4FA 3WNNA 4AW7A 2P8BA 2QIWA 1J11A 1IE7C 3OQEA 1AL7A 4NJJA 1Q6LA 3A13A 3OLGA 2YXXA 4O54A 2J47A 4K3ZA 4QAWA 3C5QA 1VFHA 5A8PA 4X9YA 1PKLA 5D09A 1UR0A 3QRHA 1US2A 1JZ5A 1GOOA 3MYPA 2OGJA 2XFWA 2VEFA 3EXRA 3W0KA 4AEFA 3N12A 3W22A 2PDPA 3NQ6A 1SZRA 3KUMA 3VAVA 1YXCA 2OSYA 2PDGA 2WNWA 3RMEA 2WW5A 3G1YA 4MNKA 4FHAA 1LT7A 5A5WA 4O50A 4HOWA 2ZRUA 3AYSA 3CZEA 4E4UA 1OC7A 1OEPA 3KS6A 3NOEA 3WLPA 1XIHA 3KDOA 5CGTA 4GISA 4PMQA 4F2UA 2V0TA 1HKMA 5A8NA 5JBDA 3T7VA 3EKLA 1P0DA 1XINA 3KL3A 1U5JA 1G9HA 2J66A 3O07A 1I4NA 1PIIA 3H7UA 3V36A 3EWUA 4I3GA 3HG5A 1TMHA 3M0MA 5AVNA 1H0GA 2Z29A 1AODA 1E0TA 1RAKA 1EO7A 1WOBA 4UCFA 4Y9AA 1W1ZA 1EP2A 3LPOA 3J7HA 3DFHA 1KBJA 3L0KA 3TONA 2QPSA 1IR2A 1VBJA 2VKZG 3ITGA 5BW6A 2WNNA 3MP5A 3IIXA 1O5RA 1TB3A 3GG8A 3EKGA 1ONEA 3NNTA 3AHVA 4U31A 3BG3A 2ISSA 1DXIA 4HGXA 1UQZA 3PWAA 3W7GA 4I8YA 4FB7A 4WGHA 3REQB 3IRDA 2OLHA 4JTUA 4AAJA 2V5LA 1Q6GA 2GWNA 8XIMA 5G2WA 3QY6A 5HATA 4LUSA 2HSAA 2WLZA 3AMKA 4HA0A 2ZIDA 4BCEA 4LWWA 4JFSA 3TMLA 1JQVA 2D22A 3B40A 2FH6A 3BLEA 3R43A 1GJWA 3PWGA 2PDNA 1DE6A 3V3WA 2BV9A 2P88A 2AL1A 1R46A 3QH2A 4O15A 4DXVA 4DO4A 1QPKA 1XYCA 1I60A 3IJLA 3VOCA 2JKEA 1EP1A 5DN1A 4D6DA 2HVOA 2VEGA 1VFFA 4JGDA 3CUZA 1FRBA 4JYDA 5CPTA 3HPFA 3OG3A 4P7OA 2X1IA 4JYFA 2Y7DA 3VGBA 3EOSA 3CHCA 4UB9A 5EMUA 2ADAA 1E43A 1H62A 3B0PA 4LV4A 4L6OA 4HSOA 1ADOA 1UWRA 3N19B 3N04A 3UY7A 1Z42A 4IMGA 4C90A 3ITVA 1P6CA 3E0VA 3CAWA 1I6NA 1QHPA 3GDBA 3P80A 1JJKA 3LM7A 3CMFA 1R2TA 2A4AA 1GWJA 4DZHA 4DHGA 4PN2A 3G77A 1UUQA 3HOJA 3IGUA 1GOIA 1KLZA 4ZA0A 3H7VA 2IUZA 3AU6A 5H8PA 4HVXA 1H51A 2EGZA 3AS2A 1JIBA 1MUCA 1E55A 3BARA 1H7OA 3B05A 5K3VA 3B0MA 1XD0A 3PTMA 1PYFA 4PMRA 2PU1A 2Y4SA 3IUHA 1EWEA 1V77A 3SCRA 4WZHA 2C15A 4PMUA 5A6BA 3W7KA 1C90A 4BQ5A 4I7UA 4NZ3A 3GXIA 1A5LC 2DZXA 1VPQA 3CIVA 1VEOA 2YL5A 1Q63A 9XIMA 4AY1A 2PGRA 3EMQA 1XIIA 3K30A 4IXHA 4Z1DA 2CKSA 5A8QA 4DO6A 5C9XA 3E12A 5CGMA 1HP4A 3QMSA 1LL6A 1R3QA 3ANUA 4NHVA 4NX0A 3PZMA 4RDVA 3S5OA 3W2MA 4ZQOA 4P61A 3FDGA 1K3UA 3CQIA 3PPGA 3P8IA 4MPKA 1K9EA 1SW0A 2J6XA 5CJMA 2QCFA 2OPJA 3SCOA 1PDZA 1BTCA 3E2RA 3ZXWA 3HZ3A 3OGVA 3BV7A 4IM4A 3TJIA 1ZPTA 1FQ0A 5CSRA 2G5WA 3CYJA 1VYSX 3PNUA 4AZ5A 2C13A 1QK2A 5HBFA 2PP1A 2D2GA 4ACZA 5DO8A 3FHQA 3M0KA 1ZBVA 3WDIA 4FOUA 1EA0A 2MNRA 1PTAA 3PZVA 2R6OA 1RCQA 1IXOA 3M7SA 1FKWA 4TOQA 1EL3A 2QVNA 2WSPA 4ACYA 3CB3A 3O16A 3CZKA 5HJXA 4ZQNA 3GVGA 1OBAA 4Q7NA 2WSQA 3OEXA 1MFVA 5F2MA 1EKOA 3C4UA 3AS3A 1FXPA 3CHDA 4JKKA 1F74A 3WD2A 2WPGA 3W7HA 1R7AA 3DENA 4HK5A 2CITA 2V8ZA 5BMWA 1V02E 4MLJA 4QR6A 3GG0A 1TA3B 2ZFAA 1R6WA 3MPGA 3MKVA 3VGGA 3QR0A 2D23A 3ZR5A 1EZ2A 1NOFA 1BSIA 4CQAA 3PJUA 4FIQA 5LGZA 1VIWA 2CNCA 4OBTA 3VILA 3DBPA 1EC9A 2HVNA 1VC4A 1H7RA 3BOLA 1S1PA 2G96A 3AISA 3TFXA 3W83A 2ZOXA 3OR1B 3UJEA 4IJBA 4JTRA 3LNPA 4EK7A 4AQLA 3CXOA 2J75A 4OBRA 1FCBA 4GY7A 1EUAA 2QGHA 3T8QA 4I7WA 4LVBA 2VEKA 1XX1A 3N14A 1WDPA 3U2ZA 2J4GA 4IFOA 4JTTA 4M7SA 4Y2WA 3VYLA 1J6PA 4IX0A 3MCMA 1UYQA 3TOPA 1JDCA 4J3VA 2FYMA 3RNDA 4M81A 4S3EA 1CPUA 1SM9A 1WBJA 1THFD 3GAYA 3SN4A 2E1DA 3MCOA 2HXUA 1E6PA 3B9NA 3BURA 1MZHA 2OWXA 1AH4A 3S1UA 3N2TA 3B8SA 1VIZA 3NIYA 2FVKA 1J18A 4Q4KA 3E5PA 4XB3A 5IRPA 4MVAA 5LKYA 1E5NA 2ZZ5A 4GVGA 5I3DA 1TWSA 1VLIA 3U0HA 2GZXA 3HN3A 1S3HA 3PJTA 1PKYA 1PX8A 5B7YA 3MI6A 3P61A 2I5QA 4J5NA 2GVLA 3HG2A 5AECA 3W7RA 3C0SA 2PURA 2VURA 2VDGA 3L4WA 1Y5WA 5PTDA 1XISA 2Z27A 2R91A 4QG9A 2PDLA 3HQPA 1UUOA 3WBWA 4GH1A 1SW7A 1QPNA 6TAAA 5IOBA 3W4RA 4GACA 1A47A 4TTGA 3MJMA 3W71A 4JTCA 4DJFC 5T91A 2V5CA 4PRTA 2A3HA 2YBVA 3PZTA 2C3ZA 1XC6A 4QJ3B 4P8WA 3PG9A 1X1ZA 1RQHA 2VDIA 3UZWA 1W1TA 4E6MA 3VVGA 1CGWA 3B97A 1RHCA 2OTDA 2BHUA 3OZMA 3VGDA 4LUIA 1XRSA 3ABOA 3THCA 1TIWA 4O1BA 3CYVA 1V8EA 1DEDA 3AYTA 3P84A 4H9ZA 3DUGA 2XSAA 2A7PA 1K1DA 3FJLA 5JXQA 3MSRA 5F4XA 4TVDA 1TYGA 4MAZA 2R1PA 3WYZA 4LC6A 4B5TA 2YA2A 1WKEA 1LOLA 3FW6A 1BAGA 4OGZA 3FVMA 2VZOA 1ECQA 3W9ZA 2IPGA 2VJXA 2C19A 4ICCX 4WIWA 5TBOA 1E6QM 1GQIA 1SO4A 1UWQA 2V2HA 2OQYA 4QX4A 4L1WA 3EMZA 1JDFA 3FEQA 1GVFA 1DL3A 4KFNA 4YTUA 3TSMA 2CFFA 2TRSA 3M1ZA 4NAEB 1PX3A 1C9DA 1WBHA 3O6CA 3ECQA 2CIPA 2YZ5A 4TMCA 2NXHA 4BZYA 3QW3A 4B92A 2WMFA 3HURA 1PVNA 1XYMA 3G1SA 3RITA 4FS9A 4UTLA 3N9KA 3O6YX 1J6OA 2PTXA 5HUOA 4NNAA 1QTWA 2X16A 8CGTA 3MKKA 1D9EA 2IPJA 4CNOA 1RXOB 2VEPA 5HMSA 5MHBA 3W7NA 3WQ5A 2X0YA 4ZQPA 2D3LA 3PY2A 5E9AA 5DRCA 3SCQA 4NJIA 4QCFA 5KZMA 3KX6A 3WMBA 3AMLA 2Z1SA 3TDFA 4Z2HA 4TX8A 5FEPA 1ZENA 4FXJA 1M7JA 2FTYA 1XSKA 4UIOA 3ATYA 4LEQA 1A49A 1EWDA 3FXYA 4A6GA 5IDZA 1QPQA 4O14A 1GVRA 1XRVA 3TROA 4GH3A 1CI1A 3GNNA 1NELA 4XIMA 2ZUVA 1XQLA 2VD9A 4OVXA 4QCEA 2CPUA 1TWIA 4XSMA 4ERAA 3VKQA 3RR1A 2R9RA 1K77A 4IL2A 1K4GA 1FOBA 1Q6OA 3WH6A 2GPTA 4M82A 4MGGA 1ZSXA 2I9EA 3KOFA 3VPLA 3CQKA 4EACA 1HO4A 3LBCA 3EB2A 4ICNA 2PRLA 4TQTA 3W74A 3LCGA 5CKSA 3MO7A 4BF7A 2A0NA 2VZSA 1A50A 4JX5A 3D5HA 4IH3A 1XCFA 3KM8A 1J0ZA 5K9CA 3E0IA 3UXDA 1OCBA 3V35A 4U2YA 1PV8A 1AK5A 4L7ZA 1AQMA 1DP0A 2AL2A 3T0CA 1OGBA 4HA4A 2BLEA 2WWCA 3KEHA 3UJFA 2YFOA 3QR3A 1GVOA 1E6SM 3W2UA 1OFRA 1O95A 4K2SA 2ISDA 2DEPA 4HZMA 3GVQA 1C8YA 1SMDA 3ZWSA 1EPXA 4DJEC 2E9BA 3W84A 2YCLA 1EGMA 2ZUNA 3O3RA 3ISIX 4E2BA 2J88A 1B3YA 3EA3A 2OR2A 2PLCA 1D2KA 2C1IA 5HA7A 1D8WA 2PDJA 3K4WA 2GLKA 4L4OA 1KGUA 2DIJA 4ASTA 4ZOAA 3NDOA 4RE0A 3GY1A 3CTTA 5FJJA 1KCXA 1NQKA 3BLPX 1XPYA 2WC3A 1WCGA 4ZFCA 3QHMA 4H7ZA 2Z4GA 2D1ZA 3NURA 1QFEA 2RAGA 2F2HA 3II1A 4GX8A 4IF2A 3EMCA 3NPVA 2WVTA 3IJ7A 3S1VA 3UD6A 2VR2A 1M5WA 4AVOA 4E2OA 4DN1A 3E2VA 3WLOA 4TX6A 2PGEA 3NZRA 1GVEA 4QROA 1ONRA 3BGJA 3UGRA 5LNVA 4UFHA 1E0UA 3HV9A 1W54A 1I1WA 1A53A 2C91A 2CBUA 1FTXA 2W27A 4XVDA 2A3CA 1WE5A 2ACQA 5AYZA 2XVKA 4CD6A 2WO5A 3ZJ6A 3TWAA 3KS5A 3PFMA 2DORA 4XK2A 3B0YA 3BG9A 4V2XA 4Z1BA 3I3DA 5CAHA 3BH4A 1H1ZA 3RILA 5C70A 2ON3A 3MHUA 4XZMX 4F0MA 3ABQA 1W3TA 3JS3A 4QEHA 4GBUA 5HK4A 4LAKA 1VR6A 2BXZA 3BAIA 4HU8A 3VM5A 5BXRA 2UV8G 2VDHA 4S38A 3W2JA 2W5FA 2AQVA 2QR6A 3DFPA 4WJEA 2JKAA 4ZODA 1DJNA 1BSLA 1DIKA 1H11A 3EOUA 3DC8A 3L4UA 1W1A1 4GC4A 5A6BD 3UQNA 2P3ZA 4BEQA 3S83A 3W38A 5HWNA 1BGGA 3T0DA 1LBLA 1UG6A 3UWVA 4LY4A 2HMCA 1FWNA 2QIIA 4IISA 2XGIA 1VD6A 3KL5A 2CESA 1PWLA 2X1RA 5LIYX 3CEPA 2PLJA 5CSSA 2EG6A 1JYVA 1AH0A 4QXIA 4XBJA 1MFUA 3N6QA 2HBVA 2ZYFA 3F03K 2HBXA 3F4WA 1W31A 1BLIA 3UJ2A 3FS2A 1R2SA 4LU0A 1E4LA 1A0DA 3SRKA 1C3FA 1GK8A 3R13A 3LQLA 5DCDA 1GOQA 1HQTA 3CBWA 3C2FA 5T8GA 3OR1A 3NM1A 4RV8A 1AOPA 5F1UA 4ZCWA 4DJEA 4I9AA 4YWSA 1B31A 4S3KA 1Z7AA 4KGLA 3UBPC 4L1GA 4QE5A 1KA9F 4B4HA 4GNJA 3G0SA 3QYQA 5CSUA 4S3AA 1XYAA 1RK5A 2ZWYA 4R3UA 2PDKA 2ZQ0A 2V82A 4PEEA 2GWGA 1V3KA 5GJNA 1G5AA 2V68A 2DIKA 1S46A 4H7CA 5D9NA 4Z08A 3ONCA 5EA9A 2ZXAA 4ZO7A 2V38A 1FX6A 2QZRA 1ZP4A 4MNMA 2CYGA 3FK4A 4UTFA 3AUJA 4ZB0A 3DYMA 4Z2JA 5ABEA 5AHFA 4V1YA 3NXLA 1RLDA 4YTQA 3G8RA 5LA0A 2HXTA 3OW1A 3MP3A 4HIBA 3H54A 4XVEA 3VM7A 1BG4A 1KFWA 3WFAA 5G4HC 1G7VA 1LG1A 1RH9A 1VRDA 4F0SA 1G4EA 4Z1CA 2VMFA 4TMBA 4UFMA 4QDPA 2YB4A 2WK2A 3GE7A 3KBNA 1ZJAA 4IT1A 4J3ZA 1ME8A 2VC5A 3AIVA 3ARYA 3OR2B 4UZSA 2PWHA 4LFYA 3CASA 2R94A 3TAOA 3PPHA 2J27A 5EBAA 5C0QA 1OY0A 4HPJA 2BNJA 4NNCA 2G3JA 3STCA 1CGXA 4YVPA 4XUGA 4RNFA 4CNSA 1Q6CA 3BVJA 3EEGA 3WJZA 2YCLB 1XCWA 1TIMA 2ZVRA 2JGQA 3GH7A 2DT1A 3GRIA 4AZ6A 3S5ZA 3W88A 4M7TA 3AIEA 5TNVA 2TAAA 4V15A 4ZXLA 4JX6A 4A29A 4MM1A 4Q8OA 2C8NA 3WDJA 3FA3A 2R8WA 1C8VA 1U1JA 1JL8A 3PVFA 2WB5A 5FOOA 2ZKMX 3W76A 1L8NA 5EBUA 3F7JA 3DX5A 4QJ5B 3R8GA 3WENA 2NXGA 1UWSA 2VEMA 4WDWA 5DRIA 1TWZA 2ZC1A 3A4JA 1E5JA 4CN4A 1AMYA 3CS2A 2A3AA 3PR2A 1A5OC 2XIOA 2ABAA 3QEZA 3AHXA 2V4JB 1TVPA 3A3WA 3VKCA 3WJYA 3VLZA 2DZTA 4CD8A 3UGVA 1UD6A 4PEKA 3L2LA 4DZIA 1WP6A 3KTSA 5H8MA 4AG0A 5HMFA 5K2ZA 5LSMA 2VFFA 1OVDA 2YA1A 4YS1A 3MA8A 1G69A 1PX4A 1UBPC 3B4YA 5D2WA 1CIUA 1OF8A 3DHUA 1GHSA 1VHCA 5BRBA 4FNSA 4MB5A 1N82A 1Q66A 5HULA 2CEQA 2ZRWA 4A8LA 2HQAA 3MU7A 2ASHA 1KTNA 3LHVA 2ZDRA 3MQTA 2ZE3A 9CGTA 3GW3A 4ZENA 4G7FA 1JRBA 3QYSA 2ZZ2A 1GTHA 4H41A 1UC5A 1LWHA 3SCNA 2BG5A 1JNEA 1YHTA 1VJIA 2CHNA 4GQRA 4PMNA 4NNBA 3VDCA 4PRWA 4AD5A 2FVLA 1J0JA 1LWIA 1UPPA 3DFYA 2J25A 3HU7A 1FCVA 5KMYA 4IMAA 3EX3A 2F8QA 2NWSA 4MWAA 2DH3A 5L9FA 2GK1A 1W1IE 3R0KA 1KM5A 4LJ3A 4FXFA 2QVHA 2A85A 2A7NA 1WDDA 1AW1A 3GBDA 4EOUA 3L4VA 1YYAA 5A8MA 3Q67A 2Z1BA 3CLWA 3P6LA 3K13A 4H9XA 1QNRA 1GTEA 1DIDA 3IK2A 1QASA 2PWFA 1OGGA 4RUBA 1EO5A 1LOQA 1DHPA 4B2DD 4LBUA 1LL7A 4QHRA 4BJHA 5K7JA 3LXAA 3L21A 4DRSA 4CEXC 3D46A 4YPJA 3VINA 1F76A 3I7RA 3R6IA 3H21A 1M68A 3PUDA 1HX0A 2YYTA 4UXDA 4D6EA 1W6TA 1UJPA 3WDQA 3OA3A 3OQ8A 3HPAA 1VHNA 1SYTA 3UXKA 2ZX5A 4AX7A 3GNOA 2OOGA 5AYBA 2EG7A 2PFHA 3M0ZA 3PZIA 4O19A 3WNKA 2QDGA 1JYNA 3IAPA 1KM0A 3S5NA 3NPXA 2B4GA 2BX7A 1JEZA 2F84A 2ATSA 4GYFA 3GFXA 3P74A 2A3EA 2VYOA 3ZVHA 1NFBA 1XUZA 4PTMA 1HIZA 5TAOA 2QDHA 1ZBKA 2O9OA 2NVCA 4JIIX 4UNKA 3WLNA 4IQEA 5SWUA 3E49A 1W3HA 2Q71A 2GK1B 4MWAB 1FFRA 4IPJA 2HE5A 1IWBA 1YE6A 1E72M 4BQ2A 2CLFA 1ADDA 1OCQA 3KWSA 3AZRA 1ZB5A 4FR1A 2Y8UA 3CHVA 2FPTA 1GHRA 1MUMA 1ZJBA 3C8NA 2VM8A 1NDWA 2JEPA 3WUBA 2NZLA 3CAVA 4UTIA 4KFOA 3AYVA 1KR1A 3BDKA 4GIRA 4IMEA 3WBAA 3LLFA 5LXXA 4NZ4A 1XD1A 2J24A 2PDWA 3G24A 4EF8A 3PUGA 3DOPA 3Q45A 4KGJA 1DJHA 4K6AA 3ZSTA 4C5YA 4H01A 1W9BM 3N73A 4E8GA 2HTMA 3MWCA 4IMFA 4N0RA 3E3HA 5M1TA 1FHDA 1TJ1A 4JN6A 2BS9A 1SFSA 2HE8A 4UTKA 2ZX8A 4IWWA 3DESA 1DTNA 2G50A 3F2CA 4O1DA 3N6HA 4Q4PA 4MMWA 4L9XA 4IIDA 2YLLA 8GEPA 2BOGX 2GDVA 3VIIA 4AOPA 4D8AA 3B06A 4M56A 3I7SA 1FWFC 3LDVA 1VBUA 3AS1A 3OG2A 1WV2A 4LYKA 3LPPA 4HHLA 2QMKA 4B9ZA 1LZOA 2BXVA 6ENLA 5JU6A 3VCNA 3A5VA 2YCKX 2EKCA 1I2QA 3EAUA 5LXEA 1W0MA 2JALA 2PDBA 3TC7A 5LGXA 2GYIA 4JHZA 2Z1KA 3R12A 1QO5A 1JI1A 5HAOA 3VOJA 4MJ2A 5F2LA 4Z17A 3CV1A 3V1HA 8XIAA 4RZ6A 4KKXA 3DN5A 1F07A 4HK6A 4AVFA 1MRAA 1K02A 4Z1YA 3A47A 2VOMA 5A8OA 4O0QA 4MTVA 3DFQA 3R2GA 4Q7IA 4IICA 5FEWA 1I9CB 5CLWA 4ADTA 4C6MA 1OD8A 3W86A 2XUCA 4FPSA 2VELA 3C0QA 1Z48A 1VZWA 3SJNA 2WSRA 3TN3A 1FXQA 1TTJA 1XG4A 4HT3A 2PZNA 2Z1XA 4UTMA 4X2PA 2NV1A 1HVQA 3UFYA 1RA0A 4GZJA 2V4JA 4O1AA 2WLYA 3CT2A 5HR6A 3LBMA 4JN8A 3F5JA 3O15A 2HS6A 2X0HA 1BVWA 1TPB1 4CLMA 1LQ0A 4Q7BA 3FJ4A 3KOZA 1QI3A 4MHBA 3LEPA 3BLKA 3ZM8A 1KBIA 4DXKA 1XIBA 2R24A 2QCDB 3B0LA 3WUGA 2F38A 1VPXA 2XIBA 4H3DA 3GTFA 3IVUA 2V3EA 3W3OA 1V7AA 4ZOCA 2AGKA 4FA3A 1JZ3A 4TR9A 4U28A 5MF5A 1A5UA 3HJZA 3DH7A 5CJNA 4PULA 5CZJA 1TJ0A 1NVMA 4LPCA 1WZLA 5FJPA 3VIJA 4CN6A 7XIMA 1IT7A 1B9BA 1GYNA 4CU7A 3QZAA 4B91A 3VZXA 4FX6M 4ZZ9A 1WKFA 4PMVA 4XAFA 3PWIA 3O2LA 4O52A 2OEMA 3VMNA 4PMXA 2PEVA 1PAMA 3BSGA 3ITYA 3LGGA 4XZBA 3AMGA 2INEA 1GOKA 5A69A 2TYSA 1XS2A 2VC7A 3MVTA 4XKYB 2CLIA 4S3DA 2QJJA 4BA0A 1KW1A 4E0CA 1CLXA 5M2FX 1O5QA 2NWRA 3R10A 1SUXA 4IIFA 4A3HA 1QBAA 3MB9A 2EPMX 3UWZA 1D3HA 1HJUA 1G4TA 3AS0A 3H2EA 4QJ1A 3VM0A 4MLRA 3L65A 3R8HA 2ZZ4A 5D38A 4RPQA 1XQKA 1QPOA 7TAAA 1MQPA 1P0KA 2DH2A 2AAAA 2VGGA 4QIUA 4NXKA 5JBEA 3VK5A 2GQ3A 4NL1A 4M29A 4MB1A 4PFMA 1KKRA 4YMZA 1SZEA 1HFBA 3NQ8A 4JTEA 1WXJA 1AVAA 3ZQ9A 4IJCA 5C5YA 4PB3A 4C1KA 1OFPA 4DYEA 1NM9A 2Y0FA 3SGZA 1IGWA 3B8TA 3BSMA 4PMZA 4GCXA 3CZGA 2PP3A 1HXJA 5U4NA 3GHRA 5H2ZA 1BXBA 1UH3A 1EP3A 3VNIA 2VD8A 4MKVA 1KFKA 3GB6A 3EYPA 3CUJA 4QM1A 1YW1A 1YEYA 2ZZ3A 3WLLA 1W9DM 2PLMA 3HG4A 3UERA 5BNKA 6ALDA 3DXIA 1IWAA 2E3ZA 1ICSA 4AYGA 2VVNA 3S47A 6GEPA 3FYOA 1QPRA 3OZYA 3IIPA 1UMLA 1Z89A 5AHEA 1YTEA 3VX1A 1TV4A 2BVTA 3QN3A 2YW3A 2C16A 1XIJA 2H9AA 4C6QA 4MJMA 2A5HA 4C6IA 5AHIA 1B3XA 4IGHA 3STFA 3AHTA 2VFDA 2Z2UA 2GJPA 2RDTA 2VFHA 2V3FA 3BZGA 2WCGA 3V1PA 5JIWA 3LM3A 4RJEA 1RSCA 2FZMA 4UQDA 3LGEA 3HQ1A 1V6YA 3AHYA 3BQ6A 3CTLA 4HHMA 2WC7A 4YL2A 5I0DA 1KFCA 1XDLA 4FLQA 1BFNA 3W1LA 1ZJIA 4ZB2A 1HTIA 3TCEA 1OFDA 3KCOA 3M0XA 3T2QA 1JDDA 3KE0A 5TF0A 3F4NA 4J3WA 4PB5A 3V4BA 5IHRA 5J8LA 3A4WA 4RW5A 4PTNA 4DZAA 4AHQA 4JICA 1Y8BA 4JTHA 4DUOA 4DYJA 1EBGA 1L2UA 3T1GA 4GIYA 3S1GA 4FIRA 3LXCA 2ZDSA 1XBYA 3VXGA 2ISFA 3VNYA 5A95A 4W9TA 4WR3A 5LHFA 2VWSA 1TSIA 2VFIA 2I9UA 4NUWA 3QTPA 1Q5MA 1BYAA 4TU1A 3QV8A 5EMYA 3VKBA 1RPXA 3CLMA 4MYXA 2VHLA 4Q8MA 1T7LA 4GCAA 3GDLA 2J9XA 2WOQA 3VKJA 4LUJA 4IP4A 4ROQA 4F9JA 3BMXA 5E70A 2H90A 3AHZA 1C93A 3A6OA 2ZX9A 1IQ8A 1H5VA 1V93A 2ZWZA 3MV11 4FOJA 2QCMA 4EVZA 3S2JA 1ITCA 4W8LA 5L6UA 1VGAA 3LSBA 2VC9A 1U1UA 5B80A 4ZQRA 3KBVA 5A1AA 3AIQA 1T8XA 2GFTA 2VZVA 4R5EA 1BYDA 4D6CA 4I9JA 3NG3A 1DHKA 4OKDA 1E9IA 4JNZA 2GVEA 4W86A 1D3GA 1BYBA 4JNMA 3UR2A 3UVAA 5IBXC 3F4DA 2GEPA 4GXPA 1SR9A 3UETA 4P7LA 4DO5A 1VYPX 2CZFA 5KINA 2Q01A 1B3OA 3DFNA 1TV3A 4CN1A 1IHIA 3MVIA 4L4LA 1EQPA 5LA2A 3T4CA 4E3VA 2INFA 3R4IA 3MSDA