4S23A

Structure of the gcpe-hmbpp complex from thermus thermophilius
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
405
structure length
405
Chain Sequence
EGMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Structure of the GcpE-HMBPP complex from Thermus thermophilius.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 133
structure length 405
sequence length 405
chains with identical sequence B
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s23A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s23A02
4MWAA 2YCLB 3H2AA 3MM8A 1TWSA 1Q7MA 3H2OA 3MM6B 4O1FA 2GEPA 3VLYA 3MMBA 4DJEC 3H22A 2AOPA 3H2CA 3MCOA 4PZVA 3B0NA 2DZAA 4DJFC 3B0GA 2YCLA 3MCMA 5GEPA 2V4JB 4S3CA 3V5OA 4DJED 4DJDC 3H23A 4MWAE 3MM7B 3MMAA 4DAIA 3B0JA 3MM9B 4DJEA 4DJFD 1TX2A 3VKRA 2E7FA 4G38A 2DZBA 3BOFA 5JQ9A 2OGYA 2XSJB 4DJFA 3H24A 3H2FA 4C1NB 2V4JA 3MMCB 1AJ2A 4S3EA 3MM5B 4DJDA 3MM7A 3H2NA 3OR1A 3MCNA 3H2EA 4GEPA 1TX0A 4HB7A 3TYEA 1F6YA 4O1EA 4DB7A 3H21A 3TZNA 3AOPA 4C1NA 3MMCA 3TR9A 4HTRA 2Y5JA 3MM6A 3TYUA 1ZJ8A 4AOPA 1AJZA 1AOPA 3MM5A 1TWWA 3NOYA 3OR2B 2VP8A 3TYCA 4S39A 3GEOA 1Q85A 3VKTA 4S38A 4S3AA 4DJDD 3VKPA 2H9AB 3VLZA 2DQWA 1AJ0A 1Q7ZA 2VEGA 2AKJA 3VKSA 4MWAB 1TWZA 3MM9A 3BOLA 2Y5SA 3H2MA 3MM8B 3OR2A 7GEPA 2YCJA 4S3FA 2YCIX 3VM0A 2XSJA 1Q8AA 4O0QA 1Q8JA 4NHVA 2YCKX 5AOPA 3TZFA 1AD4A 4G39A 1EYEA 4D8ZA 3TYBA 3TYAA 3VLXA 3H26A 3MMAB 3TYZA 2VEFA 3B0HA 2BMBA 2Y0FA 4CCZA 1ZJ9A 4MWAC 3VKQA 3K13A 4NILA 4DAFA 4D8AA 4G9PA 4S3DA 4NL1A 8GEPA 1AD1A 3MMBB 3TYDA 3B0MA 3B0LA 3VM1A 4MWAD 4D9PA 2H9AA 6GEPA 1Q7QA 4NIRA 4S3BA 3OR1B 4S23A
chains in the Genus database with same CATH superfamily
1S39A 3F5KA 2VZTA 3LGGA 4ZQPA 4C6JA 3LTPA 4JFSA 2GJXB 3W7CA 4PC8A 1ML1A 2A3HA 4DJEC 1DP0A 1YBQA 2ZDRA 4LFYA 4DYEA 1RZMA 5I00A 4LBSA 4LBUA 5DCBA 2E5BA 5LIYX 2CBJA 2D0GA 2NUYA 2GVEA 5CSUA 3WLRA 2A3BA 3BAXA 1G4TA 3CXOA 2OVLA 1JCLA 4HGXA 3B8DA 4UQ9A 1BQCA 4PCNA 1TE6A 3GC4A 1QNQA 4GUGA 3UWYA 1Q6OA 3OJGA 1CXIA 3LPFA 2B4GA 1FWBC 1YYAA 1BG9A 4PA8A 1E4MM 2V69A 3E1F1 4KEMA 3GO2A 3VC5A 5EMKA 2FHBA 3N9KA 1FVPA 2FZ8A 3URQA 4GO8A 3VGGA 3BQ6A 1IF2A 1XLIA 1DKWA 4MKNA 5K4XA 4X22A 1QHOA 1VBHA 4ML4A 1GHRA 4W7WA 3LS9A 3BH4A 2DH2A 3VCNA 1J8VA 1E51A 1SJAA 2J7BA 3K8LA 3TAKA 4IISA 3TZFA 1AD4A 4XQ6A 4L6OA 1F5ZA 3C0QA 4LRTA 3BW3A 2OO0A 4GUHA 1PX4A 3GNOA 5CG0A 2FH8A 2EG7A 4ZFMA 2AKZA 3UG8A 4DAFA 2Q01A 3UU0A 2DIKA 2WVUA 1VEOA 4DM1A 3E3HA 5DXYA 3TJLA 3G0SA 3KBMA 1PKLA 4WIWA 4LYQA 5A8PA 4HMEA 4GBUA 3HU7A 1NDWA 4DUWA 1ZHAA 1G5AA 3H22A 3EOLA 4J27A 5EMLA 3B8SA 5B80A 3HMJG 3GDTA 4Z2JA 1NM9A 3HB9A 4FR1A 3R43A 1W1YA 4C1KA 4JCMA 4Q4PA 2G4JA 1EC9A 2GQ9A 4UCFA 4DJEA 3PAOA 4QLLA 2J6XA 3RCYA 2X1IA 4PUKA 4R7WA 5AVHA 2QUNA 3CUJA 3H12A 3VUPA 2RJGA 1WDPA 3ALGA 3WFLA 1W3TA 3M64A 2Z2UA 1XYMA 1PX3A 2D22A 4YTSA 3AOPA 3URBA 1QVBA 1B3ZA 2FYMA 4CNOA 2EG8A 2H8ZA 4HPJA 4JR5A 4KPLA 1J12A 3LRMA 1HZYA 3GVWA 3W6YA 1O12A 3BCJA 4DELA 5G5IA 3PG8A 4QAIA 1AH3A 1MSSA 1GGOA 3QW3A 3WENA 3PPCA 3ITYA 4AEFA 3QQWA 3WH7A 4MM1A 4XZBA 3CMFA 4TO8A 2WC4A 5T91A 1LLZA 4EP8C 1OGBA 1WB0A 4Z1CA 5FL0A 3DG7A 2QLYA 1K7FA 5HATA 4GKTA 1JYVA 3VKQA 2A3AA 1WX0A 3SN0A 4PGLA 3CIWA 4EK7A 3TW9A 3OA5A 3PWIA 3W72A 2YW3A 4MZ8A 4H7VA 3VMOA 1BPLB 3F7JA 1EXBA 5FJJA 3B0NA 2ZX8A 4B4FA 3WMCA 5FD0A 4FALA 1ZSXA 1EF2A 3UPWA 1E0WA 4PUWA 3VKRA 1W5PA 2CEQA 1XLBA 2IUZA 4F4RA 5HPCA 3BLEA 6ENLA 3BMVA 3VO0A 1IWPA 3CS2A 3VIGA 4EACA 5BU9A 3ONBA 3APGA 2RAGA 4P7RA 1VH7A 3O8AA 2I7GA 4LTSA 3LLXA 1NF7A 1TWWA 4A29A 3LHTA 3SW6A 2JEPA 1LLWA 4ZE4A 1DJYA 3AIWA 3B4YA 1M04A 5DCDA 4U33A 3KM8A 4J3UA 2G95A 3R7MA 3LBMA 1IZKA 1AW2A 2ZYFA 3KLKA 4WZHA 5L9FA 1A5AA 3WO8A 3QTGA 4GH1A 7ODCA 2JK2A 1H63A 3W81A 2ZZ7A 3N6HA 3KCJA 3B8TA 3IUDA 4B4HA 1J6PA 4I6KA 2PGWA 3AIEA 4R9OA 2O9OA 2FTWA 4GYPC 1LRTA 3W7HA 1JDAA 5FSEC 2WZMA 2EPKX 2WLYA 1W37A 3GXPA 3GDLA 3C8FA 3WBEA 3RLUA 2PDQA 2PWFA 1GYMA 4PBFA 3W7NA 4ILSA 4UZSA 1J01A 1RP8A 1F4AA 4BQ5A 1OFEA 1S5WA 1WXJA 3TLLA 3AI0A 3TN5A 3VD5A 3I10A 1ITXA 3PFMA 1ELSA 1OD8A 4JN8A 3TX9A 3LV5A 1BYAA 2HRWA 3LZ5A 3MVTA 4DUVA 1KXQA 3MM5B 3PJXA 1JPKA 2GGHA 4ZA0A 2ZICA 1OINA 2ISFA 1TX0A 3GXIA 4HB7A 1F6YA 2DIJA 5A2BA 4JTKA 4Q22A 4YTUA 5AC4A 2XIJA 4GZ7A 3TE9A 4O13A 2IKGA 3DFPA 2VEPA 2XU2A 1GQIA 3EMQA 1WXZA 1BKSA 2OEKA 4DJDD 2CLOA 3W28A 1UMYA 4J40A 2OQYA 4O8RA 2HPMA 2AQVA 3C52A 5G4HC 4UFLA 3WDJA 4RZ4A 1ZAIA 3T0CA 5LNSA 3N2MA 5FA5A 2E0PA 1I60A 3C0SA 4GVFA 3FAWA 1S46A 2BHZA 1G6CA 2ISVA 4MTVA 3W2UA 2GUUA 2QUTA 4CN1A 3MP3A 1K6WA 3A12A 1EQPA 6PTDA 4AISA 3GZ3A 5AVNA 3TMLA 2Y0FA 3DESA 1SFJA 3LEPA 4W89A 5B7YA 1BRLA 4G7EA 2Z25A 1Y7VA 3GNNA 2NXHA 5CQ1A 5SWUA 3LHWA 4U5IA 1OK6A 1XIHA 4LY8A 3UYCA 3EOOA 4XB3A 4G8TA 3B9AA 4AMAA 1KNWA 3NL6A 4GYPA 4UR8A 1UD6A 2YA2A 5HDRA 4F2TA 3QXBA 3TWAA 4EXQA 3ZMRA 5CGQA 4DI8A 1C8XA 5AC8A 1KV5A 1PHWA 2VEMA 2WMFA 4CD6A 3HF3A 1OX5A 4LGXA 1D8CA 4GYJA 2OGYA 3EDFA 1DJQA 1Q4NX 3CPRA 5HMDA 3G1AA 1VIZA 1FCUA 1KLYA 3NL3A 2TSYA 4KWUA 1J2BA 5HMSA 3HG5A 1UASA 2WNQA 2QF8A 3CV1A 1FA2A 3CV7A 1GQNA 3T6CA 1ZL1A 4RPQA 1Q3NA 5K9CA 1ME8A 4BQ2A 2WVVA 4RXGA 3T7VA 1Z42A 1KR1A 1XYLA 4Z08A 3P14A 3PSVA 2ZXAA 3CQKA 1KFEA 1Q8JA 2WKJA 2OELA 2POZA 4HU3A 5D8ZA 1CXLA 3L5LA 1J5TA 2PGEA 4LAZA 1EJSC 3B0HA 1ZJHA 4PUEA 2WSYA 4IIHA 1GZ1A 3M6YA 1S3TC 1UA3A 5CGMA 3CU2A 3UFYA 3WQWA 1TG7A 2GUBA 4FA3A 4X3ZA 1BKHA 4WUIA 3AHYA 2QUVA 5F1VA 1Q6EA 2G96A 2X1TA 1SFLA 3TN6A 4INFA 3IIPA 1LF1A 3GXNA 4MLRA 1M68A 3ARQA 3NGJA 4XIMA 3CM4A 3E2VA 1AG1O 1JULA 3TA9A 3KL5A 2KZHA 1VPQA 1BLIA 4Q3MA 2AL1A 4WSHA 1XDMA 1V7YA 1PS9A 2XPKA 3DHDA 5A69A 6XIMA 4R53A 3MCNA 1Z48A 3S1WA 3TYEA 4GG9A 4JIRA 4AWSA 3DC0A 3HQPA 4LAMA 1ZJ8A 2ZCGA 3ARXA 4RJEA 1J9YA 1O5RA 2NLYA 1G4EA 1HVXA 2Y7DA 1F74A 2ACUA 1Q63A 1RK5A 4UFKA 2WMKA 2XIOA 1CXHA 2A6NA 1JF6A 4F0LA 3ES7A 3CQIA 1VP5A 1ESWA 1BXBA 1DWAM 2Y5EA 4RPPA 4ATWA 1DVJA 3V75A 4NT0A 1H62A 3R0KA 1QATA 3QZ6A 1SJBA 5FIPA 3CO4A 3VIOA 3B05A 1PPIA 1OM0A 1TTJA 2VX4A 3RLVA 2G3JA 1PZ3A 4DBUA 1E0XA 5EPDA 2WKGA 4BKNA 1BF6A 4G9PA 4HNNA 4S3DA 1SPQA 3MV01 4LT9A 4JN7A 4AY8A 2GFTA 3A4WA 4ZQCA 3RHGA 4A6GA 4K3ZA 1LG1A 3PUGA 3SQLA 3I7SA 5J8LA 1DORA 3ARYA 4GLEA 2J66A 1R3SA 3G1FA 4GNVA 4TXEA 2GVYA 7A3HA 1A3XA 3LK6A 3FK4A 1QMLA 2V30A 3N2CA 1NFBA 3ARPA 5DBTA 4CU8A 4JIPA 5B7ZA 3U5YA 3FCPA 3NQ2A 4PB5A 5CH9A 2VOMA 2IPFA 3MBDA 2YL5A 3AIRA 3WQOA 3RO6A 3C0LA 4HNCA 3VNLA 1R9YA 5CKSA 1F6KA 1EF3A 3GZAA 1DQUA 3IAQA 5D05A 3CIXA 1GOWA 3KEHA 3BAYA 1VCFA 2NWSA 1WZAA 5D9NA 1IHIA 5D2VA 3KDOA 3VOJA 3WDQA 1W9PA 5FSDC 5M17A 2ICSA 2P0OA 3W7RA 3R5EA 3HPZA 1JYXA 4O0KA 4GIEA 3WEOA 4LC8A 1S38A 2OCZA 4XZMX 4F40A 2OGJA 4PB4A 1KCKA 4GMEA 5I3GA 1JCJA 1LBFA 3EKGA 1DL3A 1E9YB 1YDNA 1GPFA 4OUEA 2NSOA 2CCRA 2XFFA 4C5YA 1E3XA 3TCEA 1P1XA 1M53A 5EA9A 4XTDA 1UA7A 4RZ6A 3K30A 4AD4A 2H3DA 3IJ9A 5LA1A 2ZC8A 3G0UA 3V5OA 4H9TA 1V8EA 1BGAA 4JAWA 3EWCA 3MVIA 1CEOA 2VGIA 1T7LA 4U5KA 1EDTA 3NZPA 1TUXA 1FDYA 1R2TA 2OJPA 4IP4A 4C1NB 4GJ1A 4UTTC 1XSKA 5AY7A 2VTFA 3LGEA 4RV8A 4UQBA 4J28A 5LKYA 3HZ3A 2O7SA 3KZSA 2BASA 3UCQA 4UOZA 3RM8A 3MZ2A 4GK8A 2H90A 2YXXA 4K8HA 5MKGB 5FF2A 3BPWA 2QDDA 4XIAA 3R8HA 3SIMA 4EE9A 1PO9A 3LQLA 1T5AA 2Z24A 5D8WA 3UQNA 4R34A 2WKLA 1EJ7L 3JR2A 1OGSA 4O1DA 4QCEA 3GFXA 5C0QA 3M0JA 3H8AA 3UCDA 1V03A 3LCXA 3NPUA 3MHUA 1PZ1A 4YHEA 3KRSA 5DLCA 2CLEA 3AJ7A 3C2EA 5DT5A 4XD6A 1V6VA 2Z2AA 1U30A 4A35A 3SJNA 2XVPA 1HKKA 4L1WA 3DFYA 4HZ7A 2ZA1A 2PP0A 2CLHA 3MDWA 3R10A 1GCYA 5E9AA 4AY1A 3C86A 3WUFA 3H2CA 1UR9A 4Q4QA 4QG8A 2XGZA 4H01A 3D3FA 3TAOA 3FXYA 4L9YA 4R88A 3MZNA 3KCOA 4NYUA 4LXFA 1K1DA 2Y7GA 1LRNA 1VCVA 4W8BA 2XYLA 3W88A 1L2UA 2HE8A 2DU2A 2Q8LA 2DIEA 4ZFCA 1OT1A 2P10A 2OMAA 2PMQA 4GEPA 4HNOA 5FAJA 3QR0A 3CAVA 4UOJA 4FSAA 4UTTA 4IGHA 5EBUA 2QUMA 1AA1B 1SYTA 3UZ5A 1JYWA 4TV5A 3G1YA 2VRJA 2O4MA 3BG5A 5DO8A 1J93A 1E9IA 1TR1A 1Q5MA 3NAVA 3UJEA 2C7FA 1GONA 1RJRA 1XUUA 1P4CA 1J79A 4A3YA 1R3TA 2QMKA 2VENA 1PKNA 1SZFA 1X39A 3NQ6A 4JY8A 1NVMA 2DSUA 3IJDA 3F5LA 4PMOA 3KVJA 3OLIA 1H2JA 2VI0A 3G24A 4IMCA 2ZRZA 2NUWA 5DQPA 1S2AA 1UD4A 3WJSA 3VKJA 3AZRA 3NQAA 1IYXA 4DEFA 1Q7MA 2WHJA 3VCCA 3VLYA 2R1PA 4QE5A 3BZGA 3K4WA 4KWVA 3URAA 1VRDA 4L65A 3CLMA 4A21A 1TPUA 2DORA 4AZBA 1CENA 4MSSA 3QPZA 1OFOA 3AHVA 3S9YA 3WUGA 4PRRA 3PZMA 3RLGA 3C2FA 5EYWA 5HUOA 3ECQA 1DE5A 1GNXA 1R9ZA 4GPNA 2VUNA 3EGJA 5AC6A 4L6DA 4W87A 1X38A 3VDCA 2PDJA 3VXGA 1HKIA 3K1DA 3SUWA 1ADOA 3NZGA 1O1HA 5H8UA 2ZRXA 2HSAA 1I0BA 2FZMA 3ZZ1A 3CHDA 2X40A 4V27A 4ICNA 5AHLA 4J2PA 4U3AA 4RR4A 3M0VA 3VKTA 1TCMA 1GUVA 3AOFA 3EX6A 5I03A 5KZ6A 2PWGA 4JD4A 1V6XA 3GR4A 2JGQA 2VZVA 3ZYZA 1ZLPA 3N14A 3P0WA 4Y9NA 3NA8A 4Y90A 1CGWA 1FCVA 3OVGA 3U2EA 1Y5XA 2Z29A 1PIFA 3UZZA 2E6YA 4AWUA 3T8LA 3MS8A 2PTDA 1F3XA 1XIBA 1J0KA 1KM3A 3MJYA 4UTJA 3UY8A 1TA3B 3XISA 2C8NA 4J3VA 4MB1A 1CGYA 4CCDA 2VM8A 3UJFA 4I5RA 4E2OA 1TWSA 2WWCA 1IR2A 3RIKA 2R91A 3OZOA 2PURA 4AX6A 1EB3A 1ZTVA 2WJDA 3KOZA 4J3TA 2PGRA 4WLCA 3EDDA 4GFIA 2W79A 4C6EA 1TO3A 4XBKA 1KCLA 5F4WA 1AUSL 1CT5A 3U2CA 4W5ZA 2XDFA 2BGQA 5A8GA 3PPGA 1SR9A 4ATLA 4IXXA 3VD9A 5DANA 4LYPA 2C3ZA 3MMCA 5F2IA 2ODOA 3FYYA 1M7JA 1R6WA 2GWGA 2QJNA 3JVAA 2V3FA 3OO2A 2HQAA 4GWEA 4IFKA 4JKKA 3G1DA 4S3AA 1E6QM 2J7GA 2QJJA 4F0KA 1K4HA 3LD5A 7CGTA 3VKSA 2D0FA 2Z7KA 3A4AA 3PFRA 3NO1A 1E6PA 1SFSA 3RX4A 2VC5A 1X6NA 1NARA 3W7MA 3SB0A 2V0TA 2XM1A 1IEWA 1L6GA 1RA0A 1P1MA 1A5NC 4QHRA 2Y7FA 2VX7A 3CPUA 1B2YA 1M65A 4MPQA 5C6MA 3FS2A 3B0MA 5ABEA 3UXDA 1B3WA 4O11A 3IGHX 3SI9A 3KHJA 2V5CA 1R47A 2PU0A 4EIVA 1E0UA 3GD6A 3ABZA 2F84A 3DH7A 5TF0A 1PSCA 4DNMA 4IMFA 5FF4A 3VM5A 4CKQA 1YDYA 1K7EA 2YLLA 2QAPA 2P3ZA 1L0PA 3H23A 4O18A 5A94A 4C6FA 2GUYA 4EVZA 1KKRA 2WMJA 3FVMA 4GYKA 1YW1A 2DVTA 3S46A 1SZEA 3Q37A 3IVTA 1SVDA 3BL3A 3LLDA 1YDOA 2DZPA 3A64A 2QYGA 4HNLA 2RDTA 5K9DA 1RQEA 3CZGA 1RY0A 3OIXA 3B8IA 3FJLA 1KFLA 4EWND 4BZYA 3WD1A 2XH4A 3R6IA 2D2JA 4FP1A 5FF7A 1U83A 3EB4A 1KTNA 3B9OA 1HUVA 3DUGA 4GZEA 1AW5A 1ISVA 2R1LA 2BXVA 1IXPA 4F48A 3VGFA 4N9BA 5C9RA 2CKRA 1JNEA 2DT3A 3KL0A 2QVNA 1OD0A 4JTRA 2G41A 4URIA 4AHQA 3PB2A 3QLLA 2AQOA 3NXFA 1ZNNA 4UQEA 4GZJA 4V33A 2DSWA 5FEZA 4L7ZA 3N2TA 3S3GA 2Z00A 3AQUA 4QDMA 3ITTA 1I1XA 3EPMA 1IQ8A 3U4AA 3CB3A 2GJRA 1DJNA 3AMCA 3E49A 3F4NA 4PR4A 1T8XA 2OQHA 1PX8A 3QPYA 3ABRA 5BOOA 2Y70A 3SSJA 1FWSA 4MZYA 3A22A 2WHKA 1V02E 1QT1A 3TMQA 3W24A 3LTYA 3W7LA 3WD3A 4E5TA 4R33A 4N02A 1LLOA 3RJYA 1NIUA 5J04A 1P5BA 3HGOA 4B5XA 3N11A 4KERA 1EO5A 1P6CA 3RAOA 4BI7A 1AL8A 2QV5A 1K9TA 2XGIA 3NM1A 1W1PA 3LA4A 3KBVA 1FCQA 2PC8A 4ES4A 2JALA 2NLIA 1A0EA 4NXSA 1ZPTA 3OGVA 1ENUA 1V77A 3ZT6A 4HT3A 3ZQ9A 2NVAA 4PUUA 2PFHA 5CPOA 4WSJA 3QKEA 1DHKA 4O0ZA 4LS1A 4LEQA 4RW3A 3N9SA 4KFNA 1V6UA 2A5HA 3NURA 2OWWA 5CGTA 2PLKA 3E0WA 2PCEA 2ZC1A 3NUKA 4F9JA 2ISSA 2IKJA 1EZWA 4NNBA 1TSIA 1GOKA 3CL8A 3GU2A 2XINA 2WNZA 3B0PA 4WJEA 4IL2A 3E0VA 3PJWA 1RV8A 4RNFA 1I75A 3MDUA 1V6TA 4G5DA 3BLFA 3BV7A 2EEXA 3OZYA 3SCWA 5GEPA 4LUYA 3LLFA 3FN9A 2TYSA 1V3HA 3A4XA 2QCEA 4US6A 3CEPA 5IFPA 1PCKA 3ARWA 1LP6A 3L4WA 1XYCA 5D32A 3KVLA 4YWIA 4O12A 4UXDA 4XKMA 1SZRA 4UNKA 3TV8A 2W6RA 2X0YA 2DUZA 3H21A 1XYFA 4UTIA 3TOYA 5BW6A 1W56A 2CLIA 2QJHA 1MW3A 3QHOA 1FWCC 1Z9AA 1UQZA 1J0HA 1VFLA 4JDYA 1R7OA 3W07A 3ALFA 3TP4A 3VLZA 5D04C 1R3RA 4QDWA 3LCLA 2VO5A 2Z6JA 3T0BA 2Y85A 2NWRA 1GK8A 1LL4A 3KWSA 4PTDA 5FACA 1Q66A 2EJAA 2FQIA 2DUXA 3M0XA 4DO7A 4U3CA 2OSWA 4JTDA 2ZZ5A 3PTDA 3DGBA 2PWVA 2ZXBA 1GQLA 4D1JA 2RFGA 3GQYA 4LWWA 5CC6A 5D9PA 2J9YA 2UY5A 3IJLA 2WC7A 3QKZA 4QJ3B 4IPPA 2DZSA 1V02A 3CAKA 1TVLA 3WQDA 1JZ4A 5LNRA 2GQ8A 1A5LC 1JPHA 4YCPA 1C91A 3OA3A 2D69A 6REQA 2J4GA 3VINA 5BROA 3VIPA 1NEYA 3FXGA 3VNJA 1C29A 3BOFA 3NPXA 3O7UA 1JCTA 4WX2A 4Q8WA 5LA0A 1TA3A 5GNZA 3CMGA 2BFGA 1NQ6A 3H2NA 2W4XA 3PZTA 1O5XA 2G50A 2HCVA 4I3GA 3C6CA 5LYRA 4HNVA 3AU2A 4JQ1A 3WD4A 2GGIA 4NZ3A 5CEWA 3FY1A 1KFKA 1GYNA 1XGZA 2XZ9A 4S38A 3H55A 3FYPA 3K5XA 1TJ2A 1O68A 1C8QA 1PYFA 2G97A 3ZR6A 4E38A 4NZFA 1K9DA 4W86A 1B54A 4JX4A 4KRUA 2WPBA 3C2RA 1XBVA 4Z0JA 3L0NA 3RILA 4B5VA 1VBGA 4NRRA 5T9BG 2PPGA 3WUEA 4S3KA 3DKJA 3GB6A 1XIGA 2BBFA 2REQB 3WBXA 1W3KA 3E0LA 1RQBA 2C13A 4O57A 1HJUA 3BO9A 2CZEA 4FOKA 3B0LA 1KM4A 3AMKA 3TJXA 3LUTA 2OYKA 3KTCA 5LHEA 1QUMA 5KZEA 4O8AA 5CPSA 3W4RA 2Z7GA 5DELA 3ZIZA 5CSSA 3NTYA 5C9WA 1RA5A 1EDGA 2ZRYA 3VOHA 1CXEA 3VDAA 2HTMA 3WMLA 1EYWA 2F9RA 2FGZA 3AIQA 3W1UA 1CWYA 5HWNA 1VEPA 1VS1A 1VBRA 4QFUA 1QO2A 4W85A 1UR1A 3N4AA 1FHDA 3QM3A 4H6RA 2IPJA 3VILA 2OLHA 1C7TA 2E6AA 4IM4A 3W70A 3GS6A 4DB7A 2KAUC 5IXEA 3M4HA 4GNKB 4LAOA 4JX5A 3ORWA 3SECA 3MY9A 4HZ6A 3CIVA 1IWBA 4GJIA 4M7SA 5C9XA 4ZVJA 3FYOA 1K9EA 5EMYA 4H9XA 3KW3A 4GGHA 4OGZA 2J7EA 1G67A 1DHPA 1LL7A 4H8VA 1J96A 3A9IA 1W5MA 4Q4MA 2YGYA 4RDZA 3E38A 2RJHA 2GOKA 3IJQA 1YPFA 3RU8X 3NWRA 1PTAA 3V1PA 5F7UA 2I17A 3ITCA 3LI0A 1QNPA 2C1GA 3RMJA 3W7KA 3NDZA 5M3WA 3LDVA 1H1ZA 4ACZA 3TIMA 1M5WA 1UC5A 4K36A 1JJKA 2A21A 1LT8A 4NASA 3MMTA 4JTLA 2INFA 4LS2A 3V0TA 1NOUA 4UFMA 1OZQA 3BAJA 3WF3A 2ALDA 3QZAA 2E40A 2V4JB 3UJ2A 4XAPA 3TFCA 3AS1A 1EL3A 1EWDA 4GQRA 1PUDA 3PZ9A 4P61A 1H7NA 8XIMA 2O9RA 4FI4A 4XAZA 4Y7EA 5REQB 1HJSA 1F7BA 4H41A 2QCNA 1BWLA 4G1NA 4HYWA 3IGXA 2YZRA 3ARVA 2B7NA 3UETA 1SJDA 3NSMA 2YDSA 4Q4RA 1EC8A 4BA0A 3FA4A 5LNWA 1XHGA 1W8SA 4GXMA 1JCNA 1TPC1 4MB5A 3P93A 1K7XA 2G3MA 2R1KA 5EY5A 4MUZA 1S2TA 4AIUA 4E2VA 2Y61A 3PM6A 1JCYA 2HBVA 2X41A 4GQBA 4FO4A 1OZMA 2QKFA 1EYEA 2YBVA 1JUEA 3TYBA 5E6ZA 2B81A 4HQVA 1AQMA 4LCRA 4PMUA 1PKMA 3ARSA 3ZJ7A 2YJQA 1E6ZA 4HCLA 1KB3A 3TN3A 3Q67A 3NQVA 3GSMA 1KFBA 4QS6A 4X0VA 1Y5WA 3NZQA 3PBWA 3GX9A 3GY1A 3A3HA 2BOEX 2PDIA 3T0AA 2V3DA 1CLXA 2BG5A 1XIEA 3W22A 5F1UA 2A4AA 2ESCA 1UUMA 5I02A 4AW7A 1R46A 1WXYA 2C71A 2I5GA 3MW7A 3IV8A 3RR4A 4AZ7A 4QDPA 3TQPA 4K2SA 1KLZA 3M5VA 1B1YA 4KS0A 3VZYA 1E6SM 4ADSA 4ORIA 4B90A 2VCBA 4XZ9A 5HR7A 1S2VA 4LANA 4MGGA 2VGFA 4L1XA 1TWZA 3S2CA 1XLHA 3N29A 3WF4A 1FWGC 3I6RA 2YCIX 1NDYA 1NELA 4CN6A 2I9UA 2OR2A 5IHRA 3BLLA 3W53A 4FNPA 5HK4A 3ZOAA 1S5TA 3PC0A 4LV4A 3H26A 1VC4A 3WNLA 9XIAA 3EDEA 3NQGA 1D2KA 4AWEA 3A3XA 3UXKA 4MYAA 1JGIA 1UW9A 2PS2A 2XFYA 1R5YA 1XLEA 2J47A 2ZRVA 4NYYA 1FOBA 1PDYA 2FMNA 3KOWA 3R79A 1EHAA 2ZUNA 1NY1A 3OQEA 4I6VA 3MMBA 2VKZG 3CBWA 3DG3A 1UP0A 4IPIA 4XKYB 3WMBA 4XAYA 4RL3A 3FFSA 1LQAA 3EX3A 3TWBA 2BHYA 2D3NA 4U28A 3PPFA 4JS3A 4HYVA 3M41A 2CBUA 3RDKA 3KE0A 3WH9A 3JS3A 4K1WA 4GY1A 4CD4A 1QAPA 1ISXA 4C7GA 3SCPA 1B4KA 3XINA 1I9CB 4EAMA 3TROA 1O6IA 1OBAA 5BCAA 3W0KA 2FHCA 4WXZA 3OGRA 1FCBA 1MEIA 1GVSA 1VLIA 3S1XA 3SEPA 3DDMA 1FWNA 1SGJA 1QNRA 4LV9A 3W73A 3IJIA 4X63A 3IGUA 1C9WA 1IGWA 3N2BA 5A3HA 2NV9A 2CITA 3L23A 1GKRA 1TWIA 2QR6A 1KCXA 2FZNA 4GUJA 3P74A 4RDWA 1XSIA 3S4TA 1MQQA 4D8ZA 4PMNA 1UP2A 4H6KA 3UR7A 1H41A 4JCLA 3RRAA 3AHXA 2WC3A 4FMVA 2FVKA 1PAMA 4AXKA 2HISA 4QTGA 5HNUA 1JDEA 5AN7A 3R94A 4JZ5A 3USZA 4QCFA 3L21A 3TYDA 1VPYA 1UZHA 4WY0B 3W87A 4W8LA 1YEYA 3R2GA 3KWXA 4X0NA 2WM0A 1HJXA 1R7AA 3I7RA 4XD5A 1T0OA 3GG8A 3SIZA 1NWRA 4TMCA 2ZE0A 3DFNA 3AISA 1TJPA 3HPFA 3B04A 4M6VA 1XLKA 5LNUA 3DFTA 4X9SA 1BAGA 2WJFA 5HWMA 4O17A 4A3RA 4E3VA 5CLWA 4P7OA 1S5NA 4RZBA 4JDBA 4W93A 2REQA 1E72M 3HIJA 1OIMA 2FPVA 3RFAA 3VE9A 4JTEA 4AXNA 2J7DA 4Y9OA 4AIOA 1ECEA 1XCXA 1W9VA 3TFXA 3UG3A 2UY4A 3P8IA 3CQHA 4EPKA 2C0AA 3APYA 4C6QA 3WQ4A 2Q8XA 4IIEA 3GYEA 3G1VA 3TXVA 2NQZA 2RUSA 1A0CA 2B7PA 3U4FA 3D3AA 1WDQA 2QCCA 3OPSA 3WLJA 1XC6A 1KWGA 4PMXA 3ZLFA 1ZBKA 1SR0A 3EOSA 4AZGA 4Z2KA 3VZXA 4ICCX 1HT6A 2QEZA 1JQXA 4O52A 1B3VA 3V36A 2Q09A 9XIMA 3SY8A 5I0DA 2BVTA 1DOSA 3FHAA 2G37A 4AZCA 2HS6A 3UZXA 4GXWA 1BGGA 4PTXA 2O7QA 3P62A 2WNNA 5KEZA 1UOZA 1GKPA 4E2DA 2W0UA 3T07A 1WQ5A 3VK5A 3GKAA 3C3NA 5TIMA 3VIFA 1KBJA 3GTHA 4FAMA 2JBMA 3GLCA 1LWIA 1ZAHA 4IQLA 4D8LA 3VNZA 4XZLX 4JX6A 7XIMA 1WDDA 4NJIA 4CD8A 3OU8A 1BTCA 3W75A 4CU7A 2HVNA 1VYRA 3NDOA 5EFFA 1QXLA 1EIBA 2JE8A 2ZRWA 3T55A 3ZLGA 1MVYA 3KOFA 1QI3A 1VZWA 1HW6A 3SBFA 3HG3A 1IWAA 5CPLA 1JR1A 3MUZ1 3KAOA 3GDKA 2Y62A 1UB3A 3A5VA 4NSBA 2PC4A 1ZB5A 3QEZA 5D30A 3P5YA 3AALA 2C1IA 1YNYA 2C16A 4OV4A 4J2MA 2P8BA 2TODA 4RKAA 2WQPA 2PI6A 2V2DA 4CEXC 4NX5A 1ZRQA 2VURA 2GLKA 3QV6A 2MANA 1R3VA 3PG9A 3RUBL 1HVQA 2QJIA 1M03A 1W3HA 4FS9A 4UUIA 1S5MA 5F2LA 1H7XA 1UWIA 3OW1A 3A21A 3FVDA 1MW0A 4FLSA 1S1PA 4GO9A 1KGXA 4JL1A 1HL9A 1V08A 3WY1A 3LXBA 5BRQA 1FXQA 3VX1A 1FRBA 3DYOA 2ZXDA 2ZWYA 2DEPA 2P50A 4AD5A 2Q3RA 2D73A 1QW9A 2A85A 2DZVA 1B90A 1NDZA 2Z1KA 2VFGA 3MI3A 3VNMA 1E15A 3EDKA 3P7YA 2VVSA 1ZALA 3UWEA 3V0SA 3JW7A 2A3EA 4RV3A 4AWTA 1NTHA 3N19B 1FWJC 4KKXA 2QJGA 2OTDA 4XZNX 2G3IA 3WCZA 1SMDA 2V67A 4MKVA 2XSJB 2GWNA 4FHAA 3ABXA 1TIWA 5LXEA 3S5NA 1U1HA 4CEUC 4PBEA 3K4DA 5FJPA 3VU2A 1ZP3A 3PBMA 4HPGA 4F9DA 1MEWA 4JFWA 2JF6A 5CPQA 2QULA 3DFOA 3S5YA 1FTXA 3CPGA 5I3KA 2F2HA 2GGJA 3RRXA 4WY0F 2XSXA 3E9AA 3M16A 3UNDA 1EHNA 3MPGA 3VM0A 3KX6A 1PZ0A 1T6MA 2E28A 4L64A 4MNKA 5JUVA 5CPMA 2OXNA 3WG6A 1QWKA 5DT7A 3PULA 1PWLA 5FAGA 1U1JA 3ZR5A 4QG6A 1FHUA 2G4FA 3UR8A 4HK7A 4UFIA 2Z2BA 3K4AA 4L4LA 5EB8A 5T9CE 5A6AA 4W88A 5DY3A 3QY7A 1R3WA 4OBSA 3W7PA 5BWAA 3VNYA 1XQLA 2PDYA 3WF2A 4LVDA 3V0UA 4ASTA 3P61A 1TV5A 3QMRA 4UCGA 2O55A 3EWWA 4AY7A 5AHFA 3LI1A 4J9JA 2CLPA 1UKPA 4OUIA 1XI3A 3SM0A 2AGKA 1P6WA 1HKVA 1DJHA 4DJFD 3OGSA 1JZ3A 4ZQRA 2WPGA 3H7RA 3NIYA 4OECA 3WLSA 2ZUMA 2PTWA 1HN1A 4DWSB 2ZDSA 5AKQA 4D6IA 2VT0A 3RXZA 2Y1HA 3E5BA 8RUCA 1UWSA 1QPRA 1BYCA 1HJQA 1E9ZB 4W9TA 3BJTA 1LJYA 3IRDA 4B2DA 4ZE5A 4B15A 2PEVA 4IJBA 1VFFA 3M0KA 4XKYA 4F66A 3UGVA 3WH8A 5JMUA 3LHVA 2VZUA 1AZ1A 3VI2A 2CERA 2BXZA 2OX1A 3ZO9A 4N4PA 4YN5A 4JQ4A 3I4KA 2J9XA 3PSWA 1I2RA 5G4WA 1ZP4A 2OLAA 1E1CA 4AH7A 4FXRA 3WX7A 3BAWA 4A8RA 1I2NA 1LRQA 2X1SA 2ZVIA 1YHTA 4YS1A 3AWOA 3IVSA 1GJPA 3UESA 5DXXA 1GOXA 4EF8A 3QGAC 1AQFA 1AZ2A 2BTMA 2BY0A 4S1FA 4PMYA 4NIRA 3W83A 4CD5A 4ENLA 4Y9AA 1RXOB 3KZPA 4DN1A 6ALDA 1LOLA 5LGXA 1XKYA 4NF7A 3SSZA 3PZOA 4PBGA 1EGZA 1KM2A 1QPKA 1SJCA 5AYXA 1TFVA 3B97A 3I3EA 4XBSA 3WNNA 1DXFA 4EKJA 5A5WA 1H7RA 3H53A 3O6CA 4QQ3A 4U2YA 4Z2IA 3U3HA 3DECA 1IEVA 4X9YA 1OYBA 5CZ0A 4TOQA 4ZSUA 3NO5A 2RKXA 4GRSA 3MHFA 4WEVX 4F2UA 1WV2A 1GTEA 3VOIA 2VEKA 1UD3A 4WY0A 5G1TA 2CWNA 2V9DA 1EJTC 1CCWB 4MHBA 3W2LA 4LH8A 1TPVA 4WXYA 4AD0A 5E93A 1J2WA 1IR1A 3S42A 4Q8PA 2YSWA 2HNEA 4GA8A 4DYKA 3NQFA 4J35A 5A95A 4HPXA 1VYPX 4KEVA 1B9BA 1Q7ZA 3ARRA 2UY3A 3ABQA 1U22A 1X6LA 4NZ5A 2CHOA 3IJ8A 1MRAA 1AW1A 1Z8AA 2NQJA 4UZUA 3GRIA 4HN4A 3EDJA 2GYIA 1H5VA 4QXIA 5HPOA 1G4SA 5LIXX 1QU4A 2WANA 2EQDA 3RITA 3S1GA 1RP9A 1TPB1 4JNZA 3ANUA 3LCWA 3OBKA 1NSJA 3UERA 3GK0A 3W74A 3ZT7A 4O15A 2AL2A 3LQGA 1QCWA 2YXGA 5GPRA 4WDTA 1GVQA 4LOCA 4AVOA 1PTGA 2DZAA 5E5CA 4NJHA 5I78A 3REQB 3L5AA 4H9UA 2PUZA 2ABBA 1NWSA 6A3HA 3KXQA 3G6MA 5I3IA 3CH9A 2ZZ2A 1GTHA 1J0JA 4PSRA 4JQ3A 4DBDA 3H24A 5F4XA 1JG9A 1HIZA 1HF6A 2GGEA 4GBDA 3DXIA 5TBOA 1MUMA 4UTLA 2CPUA 3TZNA 2OSXA 4JKLA 1R87A 3CJPA 4XVEA 2PDMA 1T41A 5GNXA 4M1BA 1SQ7A 3TYCA 3ARUA 3UVIA 4JTHA 4B9ZA 2GVJA 2J7FA 1XRFA 3CHVA 3C2OA 3AXMA 1TIMA 4WD0A 1AODA 3WLLA 3BTNA 3GDRA 3IANA 5E9XA 4DX3A 3OLEA 1F05A 4NAFB 3B03A 2OB3A 5ABTA 2PF8A 3AXKA 1RSCA 4MPKA 3H7UA 1F9CA 1FWWA 5DMNA 3MMAB 2E1DA 2CHRA 3HQ1A 4PMRA 2QF7A 4MADA 1PXGA 6GEPA 4ZTYA 2CZFA 3UWWA 3SRHA 1VD6A 2GDQA 4TQTA 4FPSA 1L8NA 2EPMX 1T8QA 6CGTA 2DPEA 3L4UA 3V1HA 4UFJA 3O0KA 4O28A 2PDGA 1L6YA 3G1RA 1WDWA 1H0IA 4NAEB 4ZMGA 3WLQA 2XIIA 3TLQA 2WLZA 4A2RA 2MUCA 1HL8A 5IFTA 5AHIA 1R3QA 3KS5A 1FWIC 4NVTA 4M6PA 4GUIA 1TV7A 2EO7A 4H1ZA 4C6MA 3N12A 2EPOA 3B9NA 4AD1A 4C7FA 1J0IA 1OGGA 3IPWA 1DWHM 2Y7EA 2Y2WA 4AB4A 5F2GA 4MIMA 3B3DA 1BWVA 3GE7A 4ZOEA 3ME3A 1JDDA 2ACSA 5KSWA 1H7WA 5DCEA 4G1KA 5HNRA 3M5YA 2XSJA 3GXMA 1M1BA 2BLEA 4Q7NA 1Y65A 2PDXA 3T1GA 3K46A 1H4PA 3AYSA 3ZS4A 1G7VA 4IMAA 4ZR8A 1JD9A 3NDYA 1PIGA 1XIDA 2PDNA 3DZ1A 1DJZA 3V16A 1GEQA 3CTLA 1VHCA 4AEEA 4XO7A 4MUPA 2PZNA 1W31A 1AMKA 1A5BA 4CVUA 3PBVA 2HK0A 4MB4A 1X98A 3L12A 3I3BA 1WUEA 3FAXA 1E6XM 1GOIA 2QPUA 4HK5A 1BG4A 1IGSA 3N15A 1VQTA 4HU0A 1NDVA 4G56A 4WDUA 2DQXA 3FIGA 4ORMA 4O53A 2OU4A 4Z17A 4WR3A 4PTNA 5EGRA 1F73A 3FW6A 2I16A 1XCWA 1ME7A 3HBLA 3CUHA 3CV2A 1VFUA 3OYZA 2VX5A 5C55A 7REQA 4XAFA 4U2ZA 3GVVA 1A47A 3UF9A 5GJPA 3W85A 1XM3A 3GTNA 3WNKA 3OR2A 3W1QA 1O4UA 4QJ4B 5FEWA 4DBWA 1UCWA 4GNJA 2JGYA 3EPNA 2GL5A 4ADUA 3W2MA 3DEQA 3WDRA 2NV1A 1XYBA 4GIAA 4QG9A 3O6AA 1V0KA 2VCCA 4E6MA 3FX4A 3GNRA 1JPDX 3RR1A 5LSMA 2XWEA 3PUEA 4H3DA 3PBYA 4Z42C 3ARTA 1KO0A 1RUSA 3S2NA 4UNLA 1GVIA 2WBGA 3T81A 3QY6A 1B9ZA 2TAAA 4B3LA 2PP1A 3H2OA 4ZO7A 2DT1A 3TW6A 2WMGA 4H04A 4FX7A 1TMQA 5HJXA 4NQ1A 5ABGA 5ABHA 4D6CA 4JEQA 3WQCA 1M7OA 3ELFA 1UWTA 1ISZA 3STEA 3VNIA 4KCVA 1Z7AA 2F61A 5LXXA 3GHSA 5PTDA 1POJA 2DZBA 1K8ZA 3NJ3A 1L6WA 4MF4A 3QYSA 3S5OA 1PVNA 3URNA 5EBAA 3HG2A 2ZZ4A 2JEQA 1F61A 3T09A 1JIBA 4PYSA 1O60A 2CYGA 3G8RA 4DF0A 3L4TA 3DCPA 5D2XA 1EWEA 3O15A 3PAJA 3AXXA 4HU4A 3TQ0A 5DRIA 3K1GA 7PTDA 1R38A 5A8NA 3WN6A 2A2IA 2KX9A 4C90A 4LRSA 3LMZA 4FB7A 1CB2A 1QW8A 5C7VA 4N0RA 3DOPA 4C91A 3EX1A 4UMCA 3DC8A 3WK0A 4H9YA 2E3ZA 8A3HA 3LNMA 4JNMA 1TTQA 1GVFA 1MQPA 1M7PA 2D23A 2W67A 4QROA 3SQMA 1WBHA 1UBSA 3HPAA 2Z1VA 4AD3A 3CHEA 3YPIA 4JHOA 4PTVA 2J25A 1GVYA 1Z41A 4DWDA 1JAEA 4GVIA 3PTQA 2UWFA 2XVGA 1TJ0A 3BWWA 5FI8A 3EWUA 1TPFA 4XAGA 1BWKA 3EAUA 1LYXA 4H9VA 2J74A 3RYSA 4CCCA 5G2HA 4PCPA 3SURA 2FVMA 4N9DA 3GC5A 3AS3A 3EKLA 1UH2A 2NZLA 3MKCA 3M43A 1JXKA 1Q2RA 2BNJA 4NRSA 4DZ5A 2OOFA 4YTTA 2OZ0A 1RD5A 1G69A 3LPGA 3BSGA 3GHTA 4GFSA 3W37A 4WRHA 2E09A 3WK1A 3WBWA 3VKAA 1I1WA 3IEBA 4WVXA 1UKSA 2PSNA 4O19A 3NPWA 2X2GA 4MNJA 4B91A 3MO7A 4I9AA 4WF7A 3A4JA 3NG3A 5HUPA 1BXCA 1WP6A 3GH5A 2YYUA 4I7WA 1BYDA 3G2GA 1HL2A 4KWSA 3EKZA 3U0HA 1REQB 1UR0A 1IEQA 4XTIA 2OT0A 1QFEA 1ZS2A 5AB3A 2GJLA 1OX4A 3MQTA 4P8XA 1RLCL 3THQA 2WB5A 2BWGA 3ZVHA 4MWAD 3FEQA 2H6RA 4L4PA 3ITLA 3THAA 2FMOA 3DHUA 3QMSA 4K7VA 4NP7A 2PCQA 4BK9A 2PGFA 1BXNA 1F8MA 4KFOA 4F0HA 1JZ5A 3N6QA 5BWFA 5A6SA 1DXIA 5I2UA 2YCLA 1BQGA 3NQMA 3RLHA 3MU7A 1M7XA 2TPSA 4DYJA 4M6UA 3KBNA 4BR1A 3MMAA 5D03A 2HXTA 3N34A 3BXWA 3N25A 2DW7A 1I45A 1QJWA 1HGYA 5HXMA 3O1NA 3UWUA 3CO8A 1SM9A 2CETA 3U7VA 4BS0A 3TR9A 4Q4OA 4F2BA 4PEKA 5CG7A 5T8GA 2OO6A 1ICPA 4WKHA 5D09A 3PTKA 3RM9A 4I7VA 4GX8A 1XLCA 3QMTA 2VRQA 2CBIA 4OHQA 4H7CA 3HPSA 2VFIA 1T40A 2FFCA 4NAEA 3SUVA 2PB1A 1P0EA 2YX0A 1HP5A 3V5CA 3XIMA 2R6OA 1X7FA 3W2JA 4E2BA 3I68A 1TREA 4G2DA 4HA4A 2RDWA 2VHLA 1EPXA 1TPH1 3DI1A 3GG7A 4LNCA 3WL1A 4CNUA 1I8JA 3C61A 4NZ1A 5HINA 1KKOA 4H8HA 4PEEA 1IT8A 1JRCA 1A49A 1VGAA 2IXVA 1W5OA 4Q7BA 2L5HA 5FCZA 2HK1A 2W61A 5C8BB 4U31A 1JL8A 1OFAA 3GKFA 4KIRA 1QDSA 2X09A 1CLKA 3B8WA 1XH1A 1SO3A 2EPHA 1BVNP 2J13A 3WLHA 4RX0A 3CZJA 1QK0A 2I5QA 5HQMA 5CPTA 4ZQOA 4IMEA 4GI8A 2UZ9A 1BTMA 1FWRA 1YMYA 3KRUA 4QLJA 2PLCA 4Q8TA 1MUWA 1KBKA 3UGRA 3PUDA 4YHGA 1E70M 1ZBWA 4DWSD 4ZGYA 1OF6A 3THUA 3BK0A 5I7GA 3DHPA 3QYQA 2Y5JA 1U33A 2FIQA 2QJMA 4JIHA 4RLIA 1VJZA 1XCFA 3STPA 2DJLA 2C0HA 2DSKA 4TTUA 1TZ9A 4OZOA 3HQNA 4M29A 4BFAA 4GE8A 2CZVA 5T26A 3N2OA 4UQCA 1MO0A 4O10A 1ZJAA 4HMCA 3A24A 3QLDA 5M5DA 3AUOA 4D2JA 1JQVA 4CLMA 1DJXA 3L67A 1SMAA 2XUCA 2BOFX 5BXRA 4POCA 1FY6A 1VJIA 2W66A 5H8PA 3OQ8A 3MT1A 2YR1A 3NGFA 3SGGA 3B9EA 4E3TA 4LYKA 3RO8A 2VZSA 3VD4A 4O1FA 1SZNA 4LF2A 4LVFA 2XHYA 1OJXA 3PNZA 2NW0A 2PWDA 3VCRA 1CYGA 1MXSA 3ATYA 1E56A 1EP3A 1RBOB 3BMWA 2GJXA 1E4IA 4ZXLA 3MM7B 4DAIA 5CC3A 3LERA 1W3IA 1XG4A 1PDZA 1DTUA 1JD7A 4E4FA 3WBYA 1UR3M 1QHPA 4HHLA 1KFCA 1Z6KA 3QV7A 4PN2A 4QNEA 4PMDA 4JTUA 1Q6QA 5AYBA 2YXOA 4HHPA 1P7TB 3BG3A 3F4DA 4DXXA 3W25A 1W3NA 1YTDA 5A6MA 1OFPA 3WZ0E 1FWHC 2HJPA 1W1TA 1W91A 4NUWA 4HKPA 2I56A 1RR2A 5DY2A 4HSNA 1Q85A 1H49A 3B4UA 5A6KA 2ZX6A 4LYRA 3W71A 2P53A 3SDOA 3VKDA 5LNVA 2VJXA 4C6KA 5EMUA 1YPIA 4HPNA 3R13A 4MDPA 4XZIA 2I14A 1F76A 2R1MA 4BQ3A 3QC3A 2Q6ZA 4XX6A 1VB9A 3TC3A 3GDBA 1OC7A 3GUWA 1DJGA 1XLDA 2BMBA 3UWZA 4DF1A 2HVMA 2V5JA 4LUTB 5C2CA 1B3XA 2CLFA 4JXCA 1G9HA 2WCGA 2R1NA 1KRCC 2CNCA 2IKIA 4GHRA 3MB9A 4KH2A 5A2AA 5LHFA 3JZUA 1Q7QA 5JU6A 3GXDA 4H8UA 1H61A 4WOQA 4E4UA 1I6NA 3UG4A 4AF0B 3MTWA 1KM0A 4WCJA 1UP3A 4AD2A 2C19A 1VKFA 4YMZA 3W7JA 5E0CA 3VGBA 4G6CA 2POTA 2GZXA 1IIGA 1LORA 3W9ZA 1RY8A 1YNQA 2O4QA 1C3FA 1ITUA 4XVDA 3VYLA 2QUUA 1OCNA 3Q65A 3DGRA 4Q4KA 5IRPA 1F3WA 1NH6A 1QR7A 1FDJA 2E5CA 5DMLA 1FDZA 3LHZA 3NQBA 3EB2A 3SCOA 4Z2HA 1EJUC 4PULA 3GR7A 1XDJA 4TVUA 1LM1A 1ZZMA 3VKBA 4GINA 4B92A 3T78A 3IJ7A 3SCNA 4S2BA 5A6TC 2CIPA 1P48A 3WJYA 3VKKA 4XZHA 4OFCA 1HG3A 1OFDA 1WZLA 3VDBA 4F3HA 2Y88A 3LBCA 4PMVA 4P8WA 4LU0A 2CESA 3MWAA 3GHUA 1TMLA 1YBQB 5A6JA 4K6AA 1Z3NA 1EX1A 2P76A 4QE4A 1AMYA 3BGAA 3MI6A 1RVKA 4V2XA 2QIIA 3BAIA 2AAMA 2QV4A 1Q6FA 1TRIA 4HNTA 1CXFA 1DTNA 2PWUA 1D8WA 5CJ5A 1REQA 4H9ZA 3PK7A 1TJRA 2QHAA 5A6LA 4D6DA 1CGXA 3GG1A 1D7FA 3CAWA 1QBBA 3EWXA 4ALDA 4FNUA 2QCDB 5C7HA 5CAHA 1BHGA 3AHTA 3WLTA 3TCSA 3WJWA 4HTRA 3UZWA 3M0MA 1DJWA 1D3HA 3PJUA 5CSYA 5GVJA 4TIMA 5E70A 5I09A 2H9AB 3QOKA 2XJ7A 5H2ZA 3HN3A 2WVSA 2VDIA 5AZ1A 4HK6A 2YL9A 4UMBA 1XJBA 2WQDA 4UTWC 2FGLA 3RM4A 5JVLA 1OFQA 2BXYA 1EP2A 4LALA 1NFGA 4MAVA 3QRHA 4HA0A 3VAVA 3T2OA 4XO6A 1AD1A 4MFEA 1JRBA 1UR4A 1SSGA 1VR6A 5J5RA 1U2YA 3S8HA 5JH2A 2HEJA 3PZVA 4AUBA 1UPMB 4JTAA 1FP9A 5FOOA 4Q8NA 3EMZA 1LQ0A 2PAJA 3VVGA 4UBPC 1XIJA 3QHMA 4IJCA 3VPLA 2FTPA 4IIGA 4S3GA 2A79A 5LIWX 3AU6A 3WMSA 3B0YA 1NF0A 2Z1BA 2O9PA 4C6BA 4LBRA 3UXAA 4CCEA 2QGHA 4V1YA 3SFKA 2E6DA 3CK5A 2J77A 2FZDA 1S2UA 1SO5A 3B0UX 1DBTA 1XLAA 2IKHA 3MM5A 5DMYA 3U5UA 3F4WA 2UV8G 3DYPA 3CASA 3AHZA 4UTMA 4IGSA 4F0MA 3EBVA 2XVKA 4JIQA 3SCSA 2VEGA 3KTSA 1VJSA 4LS0A 1A5MC 3AROA 5AFDA 3EWBX 1QWGA 1UZDA 4OE7A 1N8IA 1VFSA 4UMAA 2P3EA 2ZRUA 2Z0IA 8TIMA 4IGNA 4IH3A 5BZAA 4B5UA 3AYRA 2R24A 5HANA 3C2YA 2XVNA 4JPGA 1PCWA 3KP0A 2V38A 1X7IA 3K8KA 1UD8A 3GVRA 3TW7A 2BX7A 3VOFA 1US0A 2AAAA 3W6MA 4ZOAA 4YTQA 4UTWA 1BSLA 3VM1A 3VDGA 1TV2A 4KCUA 4JTIA 2C18A 4GOAA 5H91A 3SGZA 4R9XA 2OYMA 2WMIB 1FX6A 3CYVA 3E0FA 3ZWSA 1EGMA 4IQJA 3BURA 2OEJA 2ZTKA 5D2YA 1IV8A 5A1AA 3B40A 4Z1DA 3DFQA 3SUUA 3PVFA 2Z6IA 4JKMA 1LBLA 1V3IA 4Q8VA 3W00A 3LCGA 2A3LA 1VCGA 4Q6JA 5CXPA 3CT7A 2OWCA 2GSJA 4PTWA 4AHPA 5CC7A 3WQPA 1QI5A 1OB0A 1ODUA 1XH2A 5D33A 2JKAA 3ZJ6A 3GW3A 4HOXA 1CPUA 3LX9A 4UWMA 1B4EA 3BLIA 5HR6A 4GI9A 4H2CA 2V82A 2J7CA 2NQHA 4M3PA 3PY2A 4X61A 3HGJA 4DO6A 2XIBA 4KT2A 4XD4A 3APTA 4YL2A 1LDCA 4MLJA 3NQDA 2F6KA 2Y8KA 4C60A 3UR5A 3T42A 5AOPA 3CMJA 3IUHA 4HA3A 2PWHA 4K1GA 1XWYA 1JVNA 4OV9A 4CGTA 3AUJA 1UYQA 3T9PA 1PE1A 3NSNA 3FSTA 3RJXA 3MUY1 3TSDA 1TQXA 1X8FA 1H11A 3QOMA 3VIMA 4JYDA 3H4GA 3GM8A 3U8GA 4CNNA 3UA4A 1WOAA 2WWDA 3V4BA 2QAFA 1PB0A 3W1LA 3QR3A 1FBAA 2Y24A 4IX2A 3IJ6A 4IIFA 5D2WA 1P0NA 3FNDA 3QFEA 4JTJA 1TB3A 2QT3A 1KXHA 1US2A 4GUFA 2YA1A 3R11A 2VNCA 3LB0A 4RW5A 4R7JA 3VNDA 1C92A 3WDPP 4ZSTA 3PJTA 4ZENA 3MMWA 1AJZA 2O56A 3GTXA 4NJKA 3WL0A 3EXSA 3W3OA 4IZGA 3VGEA 4LB3A 3EEGA 3RPTA 2J9ZA 1MWOA 4D1IA 2XGBA 2EGZA 3TN4A 3M0IA 4Y8EA 3VTRA 3BMXA 3L4VA 5DF0A 3DKLA 3ATZA 3GG0A 4G7EB 4JTSA 4N4QA 4UB9A 2R14A 1XD0A 1OFRA 2EG6A 3W01A 5F4SA 2B7QA 4JTFA 3IUIA 1TZZA 1LROA 1I4NA 3B06A 5CPNA 5AHMA 1UROA 3ZJKA 3VC6A 3RGTA 3WKZA 3Q4DA 1X1ZA 3A47A 1VAHA 4RE0A 2E8YA 3F2DA 1MZRA 1MW1A 4LVBA 4C65A 2VRKA 3UD6A 3H2AA 1MYRA 4ACYA 3ZVIA 3WLPA 4I8DA 2IS7A 4K39A 4QBXA 1DIDA 2YL6A 1KFWA 2QDGA 2XFRA 5TNVA 2QDEA 1UZ4A 3FEMA 3MHGA 2FDMA 3CYJA 3QZEA 4QEHA 1QBAA 5K3VA 1KRMA 1ZBCA 4UTHA 3KRBA 2PLJA 5KZDA 1KW1A 3V3WA 4LNYA 1N8FA 3W7QA 2V8ZA 3MP5A 4Q8MA 2BVWA 3FGCB 1MDLA 1US3A 4EOUA 3UPMA 2QW5A 5I06A 4M19A 1WCGA 3DENA 4B9YA 2YIHA 3O05A 5HQLA 3A3WA 3WLNA 1RALA 5I3FA 4C6DA 2WVVB 1XUZA 4RCXA 4XG1A 4JICA 3QJAA 1QI0A 4NNAA 2E6FA 1EUNA 1UBPC 4ML9A 4R3UA 2BDQA 2DQWA 2YA0A 1LG2A 4CQDA 2W62A 4V15A 1OSEA 1MZHA 5DRCA 4MJMA 5G4EA 5A8OA 1SO6A 4GQGA 3W1NA 2WOQA 2QCDA 2OKTA 1FP8A 2CU0A 1UIPA 5HA7A 2BHUA 1VFOA 4C6OA 2NVDA 1ZJ9A 1DIOA 1MNZA 1AVAA 3D47A 3OBEA 4GC3A 4R7OA 4B5TA 2GK1B 4ERAA 1YTEA 4N42A 3T08A 3UZJA 3AMLA 2H9AA 2EKGA 4P8UA 3ZLHA 2YDAA 2V6AA 3B0XA 1FKWA 2EBNA 2VCAA 2WK2A 5FJTA 3EX4A 4AQLA 3EWZA 3WJXA 1XBZA 2NQ9A 2HVOA 4MKSA 3WELA 1TRDA 4ZCWA 1AK5A 1JI1A 5I23A 4PL2A 5HJLA 5HWJA 1LWHA 1K03A 3AS2A 3BGGA 2VOTA 4KCWA 3LSCA 2X0SA 4C1NA 4XWUA 4QE1A 4AVNA 4TV6A 1J0ZA 2AKMA 4W5UA 2QCGA 3I65A 4OWGA 4HIBA 3E0IA 2PDLA 3LZ3A 4K37A 3M9YA 1AJ0A 3MUXA 1VEMA 1X6UA 5DBUA 3LRLA 1W1B1 3UG5A 5I07A 5MKGA 1PZ2A 7GEPA 3E12A 1EOMA 1S3HA 1QI2A 1O95A 1JZ2A 1ALDA 4AMCA 2ZUSA 4DI9A 3VFLA 3BZJA 4P8VA 4EPDC 4R27A 3B0VC 3MANA 2C91A 3ZT5A 1ONEA 2V2CA 1EOKA 3M0LA 4YIWA 2PDCA 4DXKA 1IE7C 3S2JA 4KEZA 4J5NA 4FK9A 1CNVA 4ADTA 3AIUA 3W1XA 4IIDA 1V0MA 1IT7A 1BYBA 4Q8QA 4IICA 9CGTA 5I3DA 1H1NA 1E0TA 3WH6A 1POKA 3BVJA 4FNRA 4PMJA 2EF9A 2XM2A 4AZHA 5LIUX 3WLIA 3R89A 2V3EA 3M7WA 5HMEA 1OG6A 3NPVA 1ICQA 3QTPA 3GU9A 2WBKA 3F2BA 2H3BA 3PTMA 5MHBA 1LOQA 4FZIA 4HMNA 3F2CA 2WSQA 4EPEC 1H7PA 4IF2A 1OG0A 4YVPA 3TA6A 1W9XA 1K8YA 3RMEA 2AOSA 1Q6RA 2VD8A 2WMIA 4IMGA 1UWUA 2Y8VA 3WNPA 4DZHA 4Z1BA 2QCLA 2HXUA 3HQOA 3PZGA 3HFYA 4A3QA 4LPCA 3AXIA 3H70A 3ISIX 2YB1A 1OVDA 4C6IA 1KA9F 1OCBA 3MO4A 1JZ7A 3N4EA 3L0KA 1QOXA 3QVQA 1JDCA 1TELA 2WZEA 1YXYA 3N13A 2IXUA 3ZM8A 3KBSA 1HFBA 3NQ8A 2PTZA 2YCEA 4OBTA 3V7PA 3NQEA 1V51A 2WHLA 1P0DA 1MEHA 5HOSA 1PJ9A 2XTKA 1JCMP 2PTXA 5JBEA 4GKLA 3W6LA 4Q6XA 2OZ8A 3L68A 4C5ZA 1RD6A 1TPWA 1XG3A 2BP1A 4M7TA 1MUCA 3WFZA 4BI5A 1OHLA 4ICMA 1F3EA 3L4ZA 4HSHA 1KCZA 4Y8FA 2WHMA 4BF7A 7ENLA 4UTKA 5EL1A 4DBSA 5I77A 1X96A 2FPTA 1UZ1A 4MFDA 4TTGA 3MMUA 1WZKA 2XZ7A 3GIQA 4CQ9A 4AZIA 3A13A 3P0XA 3VMPA 6XIAA 1UMLA 1JNDA 3OP2A 3TC7A 3WLMA 2HROA 2D2OA 4Y6GA 1HKMA 3GTIA 3ANVA 1BD0A 2IMRA 1MXDA 3MBFA 5H6HA 3DBNA 4CNTA 1KFJA 1A50A 3LM3A 3N73A 3NOEA 1TJ1A 5I3HA 2PDKA 1FKXA 4X60A 1PBGA 3VMNA 3IIOA 4QIUA 3BJFA 3M5XA 2FKPA 4M6QA 4LJ3A 2O9TA 3RK8A 1OYCA 2B0MA 4IT1A 2PF0A 2PU1A 1CXKA 4F8XA 5C71A 4IUGA 3VM7A 4TX6A 2ZX7A 4L9XA 1JZ8A 4M82A 3M0ZA 4PL1A 4NZJA 4YJ5A 2DSVA 3I7QA 3UXIA 3NSXA 4HN8A 4B3ZA 1R85A 2JIEA 4L80A 2IQDA 1SU5A 2OYLA 3PBUA 3U2ZA 2GPTA 3OODA 3O9NA 3CUIA 2F38A 3N3TA 1P43A 5AHNA 4DPQA 3CAQA 1EP1A 3K2GA 3KOXA 5D38A 5HNNA 4GD0A 3SCRA 3LTSA 1O94A 1XYZA 2OQLA 1K8CA 4ZODA 5LA2A 1EA0A 2J8TA 1NOWA 4N6EA 3CUGA 3GIYA 4JOMA 3EPOA 4G38A 1TR9A 3H2FA 4ZL1A 4JNYA 3VUSA 4ZB5A 4DHGA 5C5YA 3NM3A 4JIEA 4BQ4A 2WMHA 2XIMA 4LCQA 4FLRA 3TUUA 3GFYA 4NJJA 4GXPA 3WJZA 1W6TA 3WNMA 3T0DA 4M1RA 1YE4A 1RAKA 1L6SA 4HNUA 1NOFA 1VRXA 1GW9A 5G2WA 1K8XA 4WHBA 3U2OA 2AMXA 5HBFA 3UWQA 1W9BM 1V79A 4WQ6A 3TNOA 1Q45A 2DVUA 1OCQA 2F2KA 1N55A 4N2YA 3FGCA 4BJHA 1QPNA 1RH9A 2QPSA 5CAKA 4G39A 2PDHA 2OZ3A 3O16A 1F6PA 3P2VA 4UNIA 3HJEA 4Q7IA 4GI6A 3KFTA 5CZTA 1ADSA 2WCSA 3STFA 3EOUA 5JBDA 3L2LA 2EKCA 1W2VA 3W7EA 1D3CA 4NL1A 3C2VA 2DY3A 3RNDA 3TQVA 1TWDA 4G7FA 1YTKA 1YDVA 3OR1B 2X7VA 1LT7A 1CLVA 5BOFA 2HZGA 4ZQMA 1OABA 5CJMA 2CLLA 1XRSA 4HA1A 3PBGA 2Z1XA 1A4MA 4DJED 2NQ5A 1W17A 3CQJA 2RHGA 2E5DA 2DV0A 5EKYA 1WKDA 4D6EA 3TTOA 3U48A 4EAYA 2GK1A 1AJ2A 4EPBC 3B9DA 4IL0A 3NCOA 3VZZA 4M5PA 4CQAA 3MUCA 4JTQA 3IS4A 4LQ1A 4RNJA 3N04A 1KQZA 1W8GA 3W76A 1FWFC 3BAKA 5D9OA 4QP0A 3GYCA 1CIUA 2ZX5A 2J6VA 3BV4A 1CB7B 3LHYA 4OJYA 4B16A 4XUYA 3ABOA 2VDGA 5J5DA 1XW8A 4LAKA 3GH7A 3OG3A 1QK2A 4A8IA 2J75A 1A4LA 4C6LA 3ZJ8A 4O4VA 1CECA 4V1XA 4NI3A 3G1SA 3R0DA 2XH0A 1WAUA 3G0XA 3MP4A 3T2PA 4DZIA 2J88A 3CT2A 2DJXA 2QVHA 3P6LA 2HE5A 2BVDA 3AZSA 4LVGA 3LM7A 2PP3A 3AWNA 1GVRA 5KZMA 4LF1A 2VR2A 2JF7A 2FTYA 3LXCA 4MYXA 2AOPA 3P84A 1GZGA 3HGSA 1WE5A 1K77A 2V5BA 2BGSA 1V4YA 4DO5A 3EOEA 1KTCA 3R12A 3TOPA 3MMCB 1OADA 2YDRA 5DX7A 3KVMA 4GVHA 3I3DA 2W9MA 4U10A 2ABAA 1SW0A 4KWWA 6TIMA 3DFSA 3FJNA 3HV9A 4BY3A 4IFKB 2WYSA 5AZ0A 4PUDA 4KCTA 1ICSA 3R8GA 3UBPC 2FJKA 2VD9A 1V5XA 1XIFA 4FXSA 4MOZA 4EX4A 3IGSA 4EF9A 2YDQA 4IG2B 3D46A 4BHYA 5GJNA 3FOKA 1EDQA 2XWDA 2Y5SA 4WK9A 2Q3OA 1VBUA 2OLSA 2A6LA 2RGLA 3II1A 5CZKA 1DQXA 2NX9A 2DZUA 1IXOA 4HJWA 4W4QA 1Q6CA 3FJ6A 3E2QA 2V5LA 2G0WA 1V0NA 1K9FA 3KOYA 4HYRA 2ZX9A 3PWAA 4NILA 3ANYA 2VDHA 2O92A 1EEXA 1E4LA 1B5TA 1H51A 2NXIA 2GVLA 4QM1A 2NV2A 2WM1A 1VFMA 4L4MA 1JXJA 3SN4A 1E40A 1B3OA 4IQDA 5TQLA 4DJFC 5GNYA 3AYTA 4YWSA 1XBYA 4I9TA 4LUSB 3J7HA 5C9UA 1SW3A 3G1XA 2E7FA 5D37A 2J62A 1OIFA 5AC5A 2ZQ0A 4OTKA 3W1AA 1QHZA 1QRQA 1EA9C 4S3EA 3W7DA 3M7SA 1DQWA 4K8GA 4CUCA 4PMQA 4XSLA 5G1YA 1ZJBA 2P0IA 3SJ3A 1E3ZA 1GOMA 5FF0A 4NX0A 1B31A 1AH4A 2VGGA 1A5CA 3MKKA 4O54A 4C6NA 2JFEX 3POHA 1LTDA 4GVGA 1GEHA 3KUMA 3QW4B 5FJUA 4IX0A 3UT0A 1JI2A 4FOUA 3FSUA 4Z2LA 1R9XA 3O6DA 2YLAA 3QFWA 4S3FA 4GABA 1S2WA 5HAOA 1OC6A 1YQ2A 4MNMA 2XVLA 1HJWA 1NWTA 1P6BA 2XN0A 4FX6M 1IEXA 5CBBA 2TRSA 1YXCA 2BGNE 3QC0A 4IGMA 4M56A 3SADA 2ALRA 3JUGA 1VPXA 4P7QA 4ZQNA 7TAAA 1VYSX 4GJJA 4LEFA 1RBAA 1QI4A 3CZEA 2OEMA 2YL8A 4HHMA 2JKEA 3OLGA 2DP3A 5DN1A 1Q6LA 3EB3A 1GHSA 2X30A 3CEUA 4AVFA 1PHQA 3BQ5A 3ONCA 5CBIA 4Y9PA 2BVYA 1W3JA 4Z2GA 4ZZ9A 3W7OA 5K9XA 1AQ0A 3DFHA 4PCSA 2ZA3A 3CZKA 4JHMA 2YB4A 1OFBA 1EX5A 1IXNA 4Q32A 3CWOX 3L9CA 5IOBA 4DJFA 3RF9A 3GTFA 4QSHA 3VGHA 1PL9A 2GGGA 4ZXOA 2DT2A 3WDHA 3W27A 3A23A 3F4CA 4YVVA 3M1ZA 3TQKA 1QNSA 5BRPA 1V6YA 5E0FA 3GW0A 1QTWA 4OU1A 3SFWA 3WEMA 4XUGA 3PZUA 5CSRA 3NFUA 3RCMA 4WDWA 5CCZA 2VGBA 5FJIA 3GR8A 5BMXA 2VFFA 1ECQA 1ZY9A 5E1QA 2WW5A 1KXTA 3GFZA 3WLKX 3SUSA 3VX0A 4ZOBA 1X1NA 3OIHA 3WQFA 1W32A 4UR9A 1W54A 4IFRA 3TYZA 2CBVA 3UVAA 3GAYA 4V28A 3K13A 2DW6A 2CXGA 4A4AA 2VC9A 4MNLA 3QGKC 1XISA 3AC0A 1H5YA 3R1ZA 1KBIA 5JIWA 2QQ6A 4HZ8A 4MY1A 3LYEA 5CBJA 4L61A 1WO2A 2VEIA 1HKJA 4YYCA 2ZWZA 1TE1A 1JF5A 5I24A 4UTFA 3N18A 1J5SA 4PFMA 3A6OA 4PE8A 4N9CA 4JTCA 4E8CA 4TX9A 1DIEA 4KRTA 3TNBA 1ISWA 3OR1A 4AIEA 1WDSA 3BCFA 3BC9A 1MI3A 3FHQA 5AHEA 1FHVA 2B31A 1ZGDA 5KETA 3WQ6A 2Y4SA 4M81A 4TVDA 5C2GA 1SUXA 3NR0A 3N9RA 4MAZA 2QDHA 3EXTA 3MSRA 4JL2A 4HPHA 5FJRA 5D4YA 1EGVA 1CGUA 1ODZA 1VFHA 1UOKA 3SY1A 1QPQA 5AOUA 1B3YA 4H9MA 5AYZA 3I4EA 1E55A 1NU5A 4QRNA 1K02A 4MMWA 1YADA 5KITA 2QCHA 2ZUUA 4CCZA 3GHRA 3Q58A 4FIQA 2NT1A 1I0DA 2HWGA 3M07A 2DZWA 2XSBA 2NT0A 1BF2A 1VHNA 5FESA 6REQB 4PRTA 2NX3A 4N6FA 2ZUTA 2BY3A 3W1PA 4QNWA 2HV5A 3GC2A 1U5JA 2BY2A 4P7NA 4Q33A 3U7BA 1UWRA 4QLKA 2G5WA 4LB4A 3CNYA 3MCMA 3E74A 1TUFA 2QCMA 3VIKA 1XGDA 4L1GA 1E6NA 2X42A 1SW7A 3R58A 2NXGA 2I9EA 3BOXA 3S47A 1XX1A 2V4JA 2BB0A 4IWWA 2BSLA 3RN6A 5ECVA 3D6NA 5BNKA 5KTLA 1MXGA 5D9MA 4AIBA 1R8LA 5I79A 5REQA 5A6BA 1X97A 1HX0A 1TTIA 3USBA 4O1BA 2VP8A 2EXOA 1AFSA 4QISA 2VZOA 1U1UA 2P1FA 3EX2A 3ZSSA 4MWAB 4XV0A 6TAAA 3HMCA 1C8YA 3GXTA 3QY8A 3WQ8A 1W5QA 4XK2A 4J3SA 3CHFA 1X8CA 1JPIA 3P80A 3L4XA 4NG3A 5D02A 2CXEA 3SRDA 1HNYA 2I1OA 5EFDA 1LOSA 3V35A 3JZEA 3HURA 4DQWA 2X16A 4UIOA 3FKKA 3UPBA 3VABA 3P3BA 4K7YA 4HVXA 4IG2A 4I90A 2FZBA 2D24A 5BXPA 3BDKA 3FV9A 2FGBA 3W29A 1EIXA 3E02A 3MM6B 1ZUAX 3MSGA 4DIAA 4PZVA 1OWQA 2ZKMX 3S5ZA 4O16A 1CDGA 1EJXC 3T05A 4ZO9A 1XLMA 1XLLA 2VWSA 1MMFA 3C0JA 1UKOA 4ATDA 1CX9A 4Y9MA 4ZBCA 4BCEA 3INPA 3UYIA 2PWEA 1ZCCA 2DGAA 1UR2A 2PRHA 4TUFA 5K7JA 3QH2A 4MJ4A 2VWTA 1HXJA 3WH5A 3L5MA 3HV8A 2ZUVA 4NXKA 4O1EA 4WSKA 3S2MA 3EYPA 3TYUA 9RUBA 5CZSA 1TV3A 2ACQA 3GIPA 4JQ2A 1QASA 3AZTA 4IIBA 4GH3A 1UJPA 1C9DA 4LUSA 3SQSA 2PBOA 2ZZ3A 2ANUA 1OF8A 3GVGA 1KWKA 1XYAA 1F07A 1HQTA 3WIJA 4XD3A 3NQCA 3N6JA 3G3DA 4NHVA 3W02A 3WF0A 4P5UA 4OIFA 2VYOA 2QZRA 1XV8A 4ACZB 1PIIA 3AFBA 4K38A 4UC5A 3GNPA 1H7OA 2ISWA 1WBJA 8GEPA 2V3GA 1ONRA 1E73M 4NZCA 1RJQA 4QEEA 1DPMA 1T99A 1HGWA 4QAWA 4REQB 1N8WA 4US5A 4LAUA 1JUKA 3RX3A 2BOGX 3SO7A 3LGDA 2OPJA 1RCQA 3E2RA 4DUXA 1KR0A 4RK8A 4BEUA 3GBEA 4X2PA 1RCXB 4HHHA 1YE6A 4GCAA 3BLDA 3BSHA 2QIWA 3RU6A 4ERGA 4HD5A 4DLFA 1M41A 1UIOA 3LN3A 4C1LA 3LSBA 3VDHA 1M6JA 1XFBA 2QPXA 4HTYA 2YFOA 4A2SA 3DIPA 2DZXA 4PCTA 2ISDA 1FFRA 1ME9A 4H6QA 3H54A 3HTWA 3RCNA 1VIWA 4PCFA 1WKFA 5JH1A 1J4EA 4J3ZA 3QF0A 3KLLA 1G01A 3F5JA 3M46A 3T4CA 1VBJA 2X8RA 3JRKA 3WQVA 1P0BA 2Y63A 1YNPA 5BRBA 3H7VA 4PODA 2VXNA 1UKQA 3R0UA 1OC5A 4LCSA 4A8LA 5AC7A 1EH9A 4D8AA 2QS8A 1Q6DA 2E25A 3HOJA 3QBUA 3ITGA 1E5NA 1J11A 2ATMA 2IPWA 4ZB0A 1UC4A 4WKAA 1HKWA 2PA6A 1AQHA 2YW4A 3HM7A 4KGLA 1U5HA 2NSXA 1WNOA 1EUAA 5KINA 1OY0A 1OYAA 3BANA 3Q2DA 1DYSA 4MWAE 4NY2A 1GW1A 1EO7A 1QOPA 2YOCA 1EJVC 3E96A 5AECA 5AYYA 1XS2A 4OOZA 4LW7A 3R4IA 5EMMA 2WNWA 3EZ4A 2ACRA 3AO0A 4GC4A 1PTDA 1PWMA 2BV9A 1FXPA 2H8XA 4JTGA 3UNTA 4GQQA 4B3KA 1UPPA 4YNGA 5LIKX 3KL3A 3QGVA 2E67A 5LGZA 1NFPA 1A0DA 2XIQA 3HGRA 4BWLC 3U9IA 4JHZA 1H3GA 1TTPA 1TYGA 3EA1A 3Q45A 5FKYA 3C56A 4A05A 4AZ5A 1UWAA 3O0FA 4QITA 3ITOA 4TU1A 4LUIA 4H7ZA 3OHMB 2D20A 3KHDA 4B5NA 1WA3A 5XINA 3BW4A 1E1EA 4MJZA 4JIIX 3TVAA 2GVGA 4XSMA 3OEXA 1ONXA 1NP0A 2R94A 5ECUA 4EANA 4N7QA 2J7HA 1IEIA 3GNXA 3BLOA 3CV6A 5IBXC 1N82A 4MWAC 3G6LA 3PZQA 4DM2A 2NUXA 2WV8A 4I8YA 1WYIA 1FWEC 3B8VA 4JYEA 1JFXA 3W1TA 3MMBB 3ICJA 1TV8A 1HO4A 3MI2A 2DVXA 5IDIA 2E1WA 4O50A 5CLTA 2HS8A 4OQVA 3OZMA 3TSMA 5DFAA 3DHFA 3G18A 2XFWA 4BF5A 1W1VA 4RNHA 1TVPA 2X7WA 2ONEA 3AAMA 3MM9B 3NVDA 1LQ2A 2HMCA 3N3MA 3T2QA 3DX5A 3MMDA 1GOOA 3NZRA 3O06A 1C93A 3OVRA 3TH6A 2QNEA 4GCXA 4RE3A 2ZXQA 1XRVA 2YKKA 3NVTA 1U5VA 3GEOA 4QJ1A 4FLQA 3LPPA 4YU1A 1PKYA 1QOQA 3LENA 1X1OA 1XQKA 3AIBA 3UWVA 4M80A 3MM8B 1V3KA 4BWLA 1CGTA 1WKEA 5C9ZA 1CZ1A 1GORA 2GDVA 4KGJA 3THCA 1EC7A 3GU1A 3TONA 3CB8A 3WQEA 2GJPA 2VELA 4XBJA 4LX4A 1ZQ5A 4IXHA 1XIIA 1RPKA 4CNSA 2QMJA 1TPEA 1QNVA 4AEOA 3H6OA 5ENLA 2F6UA 3OB8A 3LCFA 3LMYA 3POCA 4C6CA 4S23A 2Z28A 5IBXA 4MWAA 2OFJA 1MQRA 4GI4A 1KM5A 4E0CA 5CZJA 5G1MA 3RPMA 3WSUA 4HTBA 5A2CA 3KBJA 3W86A 3W26A 3P82A 1K6AA 1A3WA 1W2PA 2A7RA 4K8EA 3JU2A 5ABFB 1VLWA 4DJDC 3SY5A 1UD2A 2J8GA 3L65A 2PE4A 4DWSC 3IRSA 1E1FA 1HO1A 3VD7A 3T0TA 4HJFA 4JFVA 1DWJM 1TKKA 4AYGA 1DIKA 3CUZA 3MM6A 2EPNA 3A5FA 1XKJA 3STCA 3I6EA 4J4KA 5LZLA 1KBLA 3N17A 2C6QA 2D0HA 1XH0A 2UBPC 5C70A 2I5IA 1THFD 4ZTXA 2DFAA 2Y6ZA 4YLWA 4DZAA 1DEDA 3H2MA 4MY8A 4H00A 2W63A 4EXAA 2Y8UA 3IARA 3O2LA 1Q13A 5E09A 3FA3A 4AZCB 1XL9A 5JXQA 4B5SA 2VMFA 1FWDC 3V5FA 1JFHA 3ERPA 5M1TA 3KP1A 4RE4A 4BF9A 3LG3A 1JUBA 1ZJIA 2X2YA 3EA2A 3TJ4A 3MSYA 1JPMA 4PUJA 4IQEA 1UWQA 3HO8A 2FB3A 2FJUB 3L2MA 4FIRA 2G3NA 2HDJA 1F2JA 4EXBA 1UD5A 1WDRA 3VOCA 3EMCA 1Z44A 1J0YA 3O3RA 4LY4A 3OOQA 3AS0A 4NU7A 2PDBA 5BU6A 3LV6A 3WK3A 1XPYA 2D2GA 4MG4A 4W7VA 4LC6A 1A5UA 1I2PA 2PLMA 1OK4A 3QQ1A 3VOGA 2D1ZA 3GAKA 3AXHA 3PS7A 3WNOA 2AQWA 4DJDA 4O1AA 1GG1A 1CI1A 4P2VA 1W9UA 1C7SA 4DWSA 2JIWA 3ZSTA 4REQA 1RPXA 3IK4A 1D3GA 3COTA 4O14A 1H60A 3TSBA 3NOYA 3NXLA 4OOUA 1WOBA 2V2HA 3GXFA 3S1VA 1F4HA 1GJWA 1G4PA 1GPWA 2MNRA 3TR2A 2VR4A 2INEA 1YLVA 2ZFAA 1RBLA 4I7UA 4FNTA 4GX9A 3OLDA 4ONVA 4L56A 4J7RA 3AMDA 2ON3A 2AMGA 5EU9A 3W23A 1JEZA 1O5QA 4YYFA 2VEFA 1Q2SA 1GVEA 1FH8A 2PD9A 4W8AA 2XN1A 3W2KA 1O1ZA 5C2XA 3A9BA 4ZO8A 1J6OA 1TZ7A 3CHCA 4ZEPA 4IJRA 1ZCOA 3IIVA 2WO5A 4NNCA 3NEHA 4A22A 1A80A 1RQHA 3KCLA 4LUJA 4GQ0A 1NJJA 1M3UA 2ZADA 3CH0A 3EEZA 3MCOA 4FF7A 1PEZA 1G94A 2ZOXA 2FHFA 1KRAC 3R8RA 3DBPA 3GVQA 1R86A 3TK7A 1XLJA 3B0JA 3ABSA 3UJRA 2A1YA 3FJ4A 2W27A 4HSOA 3NO3A 1ADDA 4P7LA 5I6SA 4N9EA 2PDWA 1ZBVA 2J79A 1VENA 2E9BA 2WSRA 3UCCA 5H1WA 2Z1SA 4TVCA 2XH7A 1H1YA 3L2IA 1XSJA 3OYXA 3IAPA 1UUQA 1TPDA 5JBFA 1W5NA 2RH9A 4UQDA 4JEJA 1XRTA 3UXLA 2CZ5A 3BOLA 2YPIA 4HCDA 4D6FA 4KQNA 1WPCA 3E5PA 1OEPA 4M8UA 3DYMA 4IMDA 2YCKX 1E4NA 5HMFA 2V81A 1UG6A 1XF0A 2JKPA 5BMWA 4ZO6A 4GY7A 5A8MA 4YXGA 3VIIA 1VF8A 4FX8A 4J3XA 1W1ZA 3WD2A 1SZGA 3WUBA 3VIJA 3P5ZA 4NJGA 3OVPA 2TMDA 1XR2A 4ZB2A 2Q8ZA 1J10A 1XFCA 1K4GA 3OVQA 2OODA 3LPOA 2OWXA 1XLFA 3G77A 3IWPA 3BJSA 1AH0A 2V68A 4WGXA 1BVZA 1OX6A 5AYIA 3L0GA 4GGBA 3THDA 4UOQA 3PANA 4YTRA 1NP2A 4CD7A 3G1HA 1V3JA 2PDFA 4IUOA 1GZJA 3S0CA 1XGEA 2ADAA 3DI0A 4H4IA 3F4VA 5D2TA 4PFHA 1JGMA 3SZ8A 2FFIA 5CJNA 3REQA 3CUFA 4L6HA 1EKOA 3IACA 1E71M 3O63A 3GUGA 3CLWA 2R9RA 1ITQA 1ITCA 2WJZA 3QPEA 1D7KA 2CFFA 2D3LA 2QCFA 1IIHA 2VR5A 4KBXA 1Z32X 4S39A 1EPVA 2A7PA 1W0MA 4I5XA 2DSZA 3VKPA 4A3UA 3MSDA 3KS6A 2WZHA 4PTMA 1E1CB 3MM9A 4DPPA 5BXSA 2CLKA 3M5ZA 3S6OA 2W3ZA 2Z27A 4O0QA 3MUAA 1HJVA 1FQ0A 4H19A 2F6XA 3HPXA 3T40A 2CKSA 2V5KA 2X05A 3TYAA 2PTYA 3GH4A 2J8FA 3LCHA 3W82A 4NAFA 1ISYA 3G22A 1ZAJA 1CGVA 3MV11 2CW6A 2Q71A 2DZTA 3WQGA 3VE7A 2EJ1A 1IXQA 3S5SA 3ID7A 1UQYA 3CTTA 4DBEA 2XH2A 3SRFA 3MM8A 3FA5A 1R0MA 5FJOA 4D6GA 1EZ2A 3NQ7A 4K68A 3N2XA 1YIXA 1JCXA 5EMJA 4IP5A 3B0GA 2Z26A 4E8GA 2BS9A 4AC1X 3EWYA 4YCOA 1HTIA 2WSPA 3NYDA 1T96A 3QSTA 3TXZA 2GQAA 1RK6A 4R5EA 1A5OC 2OSYA 4FNSA 3MYPA 4QQUA 3DG6A 1F3TA 3PF3A 5GQBA 3VA8A 3LXAA 2E9MA 1G1YA 3M0YA 1GQKA 3NL5A 1Y0EA 4O1CA 4PRWA 5FEXA 1DWGM 2VQUA 2E68A 1TCDA 3ZXWA 5ABFA 3P67A 1XICA 3FDGA 2P88A 3LHUA 1QPOA 1I2OA 3IK2A 4CNPA 3NNTA 4MY9A 5HQEA 3V18A 5FF3A 2X0HA 1XC4A 4TMBA 2YBUA 4KESA 4QR6A 4GIRA 2AL2B 4QSFA 4JY9A 1MNSA 1LUCB 4GISA 4AAJA 2J27A 2A7NA 3STGA 1FWTA 3WYZA 2V5DA 3SCUA 3W1RA 2FH6A 3BSMA 4I5UA 4DXVA 4ZOCA 2GSEA 2ZVRA 4GIYA 2ZZ1A 3GBDA 3C4UA 3LBOA 2YBTA 3LRKA 4PMZA 1GWJA 2GSHA 2YFNA 4GY0A 2YZ5A 1KXVA 1XDLA 4FF5A 2OZTA 1YXDA 2CC0A 1DXEA 4HP5A 4NKCA 4D6HA 1BVWA 1VFTA 4HCHA 1B30A 1B57A 3HA1A 3MC5A 4WJ8A 4Z1YA 1CTNA 3WLOA 1RVGA 1ONWA 1XD1A 2VVNA 1TVNA 2INZA 1LL6A 1C8VA 1GVOA 3LU2A 3QSRA 4F0SA 4HBKA 3H4WA 4D71A 1OCJA 4TR9A 3QHNA 1EJRC 3S83A 4JYFA