4S2HA

Joint x-ray/neutron structure of trichoderma reesei xylanase ii at ph 8.5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
190
structure length
190
Chain Sequence
b'ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4s2hA00
2JICA 3MFAA 3WX5A 4S2GA 2DCYA 3LGRA 1HV1A 3AKTA 2DFCA 3VGIA 2Z79A 3AMQA 1OA2A 1XNKA 3MF9A 2B46X 2NLRA 2NQYA 5HXVA 3VL8A 1UKRA 4H7MA 2D97A 4IXLA 3VLBB 3VZOA 3WQ1A 1XYNA 1H0BA 4XPVA 3VHNA 3WY6A 3WQ7A 3AKPA 4XQWA 1BK1A 4S2HA 1NLRA 3VL9A 2BVVA 2BWCA 3EXUA 1M4WA 3AMMA 3AMNA 3WP5A 4HKLA 2VG9A 1OLQA 2VGDA 5EJ3A 3WQ0A 1XNDA 3AMHA 3ZSEA 1XYOA 3AKRA 1OA3A 4S2DA 5K9YA 4HK8A 1KS5A 3WXPA 1REFA 1W2UA 2DCJA 1T6GC 4HK9A 3AKQA 1F5JA 3MF6A 4HKWA 1XYPA 3WR0A 2JEMA 2QZ2A 3O7OA 2BW8A 3LB9A 1QH7A 2QZ3A 3MFCA 1PVXA 1YNAA 1ENXA 2JENA 1OA4A 1HIXA 3VZKA 2DCZA 4S2FA 2B45X 1H4GA 1UU6A 3HD8B 2DCKA 3WP4A 2D98A 3WP3A 1HV0A 1BCXA 2DFBA 2VULA 3WT3A 1C5HA 5K7PA 1XNBA 4NPRA 3B7MA 3VZNA 3RI9A 1BVVA 1XXNA 3WP6A 1XNCA 2VUJA 3VZLA 3VZMA 4XQDA 3RI8A 1H4HA 2F6BA 1H8VA 4XQ4A 4HKOA 3M4FA 1TE1B 3B5LB 1AXKA 3VZJA 1H1AA 1OLRA 3AKSA 1REDA 2BWAA 3AMPA 1UU5A 1C5IA 1UU4A 3VHPA 2C1FA 1KS4A 1IGOA 1REEA 2B42B 3VHOA 1QH6A
chains in the Genus database with same CATH superfamily
2VZQA 4N53A 2O8QA 3VDDC 4GZ9A 2BPA2 3RJRA 1COV3 1FNYA 1KITA 1F31A 4BCUA 1OOPA 1ULPA 1OUSA 2DFCA 2WDBA 1S4CA 1JUHA 5F39A 5JAXA 1LNSA 3R0RA 5DZEA 4AR2A 5IAXA 2L9LA 1FNZA 4QQHA 4TXWA 2D6KA 5CYYA 4AQ6A 1FOD2 3CBNA 3H8UA 1GP5A 1V9U2 5C8CC 2XL9A 2O0OA 4LHLA 4R9AA 3K48A 3WQ7A 2JDPA 4MOAA 2G9GA 1TZOA 1NKGA 2UWAA 3MPBA 1G6NA 1YCIA 5C4WB 1DGLA 3KM5A 1FV3A 4YM0A 2BOIA 2R0FA 3B9IA 2ZHNA 4CCOA 1GANA 4P9GA 2PHTA 1O3TA 4Y22B 1G9BA 1S1AA 4MUVA 5GKAC 4ASLA 5FY4A 3ZYIB 1T6BX 2VQTA 5L9VA 5FYUA 5BNPC 1SLCA 3VBSA 1UXXX 5FIXA 3T4VA 2EAKA 3LIHA 5F3EA 3ZFFC 3T2OA 4M0NA 3WXPA 1KRIA 4Q0SA 1OURA 3B93A 3T1MA 2VNGA 5ERLA 5DG2A 4AI1A 3MBWA 1ND3B 3IDCB 1PNGA 5J7MA 1PM4A 4ONUA 2Y6GA 3GCXA 4TTGA 1QQP1 4NPLA 4AYUA 1YNAA 3DKWA 3VBOA 4OZOA 2BEOA 1FV2A 1D2SA 1H2MA 1LULA 1YJKA 3BALA 3UL2A 3NJXA 4META 1MS3A 3PVNA 3C8XA 3VN4A 3RZZA 3D0SA 3OUIA 4TSVA 5DAWA 1AJOA 1NCQC 3PU8A 4HG6B 3GZTB 2ZX4A 5HPOA 3WT3A 3IWZA 2G9FA 5K7PA 2PTMA 1IZ3A 1W9WA 4FPFA 4JGYA 4XDQA 2Q8CA 4BB3A 3U4XA 4E2QA 1PVC1 4N8MA 2HWF1 3R4UA 1X50A 2WFF3 4Y5Z0 1IG3A 4KWLA 2QQPA 5FYSA 3D4KA 2IXLA 1TMF3 5FZHA 1NAEA 5CFDA 1IS4A 2HWB1 1W6OB 4Q29A 3O1OA 1NQJA 1EUUA 3OUHA 3R6SA 3NNMA 4JDMA 3TEXA 3CU7A 3H7YA 1BKZA 4R9CA 2F6BA 1W8TA 2OX0A 4IL7A 4QX0A 1DGRN 2BNNA 4HKOA 4XQ4A 3T0BA 2IVJA 5C5TA 4FOYA 1WLDA 4TZDA 3KMHA 3VD7A 1UOJA 4NWWA 1H8TB 2RS11 4YYOA 1VMHA 1N1VA 4LBQA 4DIQA 4RGAA 4XEZA 5I0DA 1C5IA 4Y24A 1BJQA 1WW6A 5T50A 5KC6A 3HN3A 2YC2A 1GP4A 1VAVA 1W6MB 2WNOA 4GULA 2DBIA 1UAIA 1XNTA 2W2IA 3KZ4C 2XXZA 4IGQA 1V9U1 3RPQA 3SH3A 3MFAA 4AXOA 1QOTA 4CDXA 4CP9A 1OLME 4D7TA 5BNOC 1OUXA 1QJY1 3LGRA 4AEDA 5BNQA 4RS5C 3WNLA 3TEWA 4UW4A 5CFCC 4BU2A 3KV9A 2RDSA 2JE7A 5KBFA 2ZX2A 1YQ8A 2JG9A 3RG0A 1GQPA 3PUSA 4ORFA 1JH5A 4W50A 4RL7A 5FQ0A 4P5HA 5JCTA 3E6CC 3JZVA 4JRAA 1F4AA 3FHIB 3RZHA 3KWVA 5F1RA 2WNVC 5FBZA 2VC9A 1AR92 2RS32 1IS5A 3TNQA 3TOJA 1QNYA 2ZX0A 1J83A 4MGQA 4OI0A 1V6IA 5FUPA 1CR7A 5FYHA 5IHRA 3AL5A 4MHRA 2DDUA 3KF3A 4GB32 1X7NA 4DPNA 5C70A 1ND2C 2IFWA 3AMMA 3B69A 3WF1A 1S0GA 3L2YA 1CAWB 1VLNA 1ZZ9A 5JWPA 2UWCA 1VMJA 1MQTC 1R1A1 3MW4A 3QOPA 3K4AA 3WV6A 1R091 3TN92 1O3RA 3ZSEA 1CJPA 4Q4X2 3J7MA 1JZ7A 5C9AC 4WM7A 4PBOA 5EPAA 5DAQA 4DUXA 1POV3 2CGOA 1UZ0A 4TLGA 3ZN5A 5FXZA 5F9TA 3QH6A 2WBKA 2E9QA 5A6XA 1BEV1 1HRI1 2XJPA 4UOJA 4DS0A 3J7LA 3ZR5A 1JXNA 3HQUA 4Q4V2 4P9JA 4CU8A 5GZEA 3CNAA 3BUCA 4KBZA 1GQHA 1N3OA 1Q8PA 4ES8A 1COV2 3QACA 3OGGA 3VD5A 5FOJB 4CU7A 1MPXA 1WW4A 5KHJA 1LOAA 1RHI1 1C8M1 3N35A 4UYBA 5BY5A 4RR3C 5FK7A 4BQ5A 3OBRA 4URTA 3HJRA 3KCCA 3LQCA 4JQTA 4X6QB 5FMDA 1GNZA 5EXOA 1UZVA 4AG4A 4B1MA 4JX0A 2D98A 4AWDA 1NUKA 3JXSA 4OULA 1N1YA 3B9CA 3V64A 3BI3A 3LKJA 3ST7A 2RMU3 4I0AA 4YW2A 1UY0A 1YFUA 3MIBA 3LSEA 1AR72 1ALYA 4YG0A 1PO12 2ORXA 3CEWA 2BNMA 1RB8G 2EIBA 4Q4W3 1N3QA 1NE4A 2VZ3A 4XTPA 3H0OA 4M3CB 3U10A 2D3RA 3I3DA 3CZUA 2ZGKA 1MZ5A 3NNLA 3A22A 4GQ7A 3AC0A 3RYPA 5KHGA 3MLKA 1UMIA 1VBE3 2DCTA 1MZEA 2FZ2A 1UMZA 2WZEA 4QX5A 1RXFA 4N43B 5FY8A 5FCCA 2CHHA 2F4LA 2UYAA 3ALQA 2PAKA 2VVFA 1PGL2 3AKSA 3G7DA 3WW3A 1LODA 4EN0A 4YARA 3AMPA 4MHUA 2WT2A 3L2HA 5T54A 5FZOB 4CCEA 2D44A 1ZRIA 1ONAA 2XHNA 2A1XA 5CG8A 3HT1A 5DABA 1OLMA 3CL1A 2HYXA 3SEPA 4DY5A 4AGGA 4FAGA 1OHFA 1LU2A 1US3A 1VMFA 1D4M3 2VQUA 2HWC3 3ZXEA 2B5HA 1DU3D 4P5YA 4LLFA 3ZYFA 1SLBA 3MIHA 3PVOA 4KWJA 5A70A 5KXEA 2EIGA 3BGAA 1VR3A 5DUUA 1S2BA 3ZM8A 1PK6C 3SXWA 2DYCA 1PZ9A 3CO2A 1Q56A 2HWE3 1QU0A 5JZGA 4GB31 4AQTA 3RZLA 1YFXA 5FXXA 4XFGA 4AFDA 3VL8A 2J1RA 2ZX3A 2E53A 3VBFB 4Y3OA 3B3QE 4HL0A 4JGZA 5IW0A 3TN91 2P1BA 1QMJA 4HVQA 3Q8FA 5FMOL 4CCLA 1YYNA 4LTAA 4FFGA 2KA3A 4L0PA 2Q8DA 4W6XA 2WFF2 3WD5A 4XZPA 1ZRFA 1TMF2 1O8SA 4GH4A 2EXJA 2X8KA 2GNTA 3AL6A 3POJA 4KGQA 3WLUA 3DV8A 4DOUA 4Q8LA 2JG8B 2VG9A 1WA6X 4KU7A 4URAA 3O1RA 3JUUA 4A3ZA 4Y20A 4QX3A 1H9PA 4DY3A 2PMWB 4CCJA 1WLTA 4F83A 1UO9A 2PAMA 1LKNA 4CDQA 1G9AA 3VHRA 4QX2A 1NCRB 4Z2AA 3N9OA 4MSVA 1W2OA 4IEVA 2GNMA 5LEKA 2EICA 1GOHA 2DCJA 1O59A 1RUE2 2VUDA 4XF3A 2Z5WA 5FPVA 4CCCA 1IPJA 5B4NA 3JU9A 3FHAA 3HPNA 4CA9A 4BQ2A 3FWEA 4COVA 1RUC2 3T4HB 2VZOA 4XMIA 5FP8A 2ZEXA 5DUXA 4DUWA 1KDKA 2PLV1 1J1TA 3URFA 3O1VA 4CVUA 4AFMA 2XBO3 4IV1C 1GZWB 1ASJ2 3NKGA 4NN0A 5C3QA 5HV4A 4LK7A 2YFZA 5EWSA 4G3YC 1APNA 1DQ1A 5CKNA 2DFBA 2OQ7A 1DFQA 2A7AA 3IKWA 3VDDA 1AVBA 4FPLA 5AVPA 3T3YA 3PTRB 4CUBA 1CZVA 3BODA 3T30A 2RJLA 4E27A 1GSLA 2XOMA 1KD7A 4LMFA 4MADA 3N9QA 3ZYGA 4EWDA 2WWJA 2W0XA 3RYRA 1RUNA 2WS91 1U5YA 4YLZA 4FTEA 1POV0 3DKQA 4N43A 3RZJA 4LBMA 1JZ4A 5J96B 5C8CA 2W39A 4DEQA 2P34A 3VZJA 3E5XA 4JKKA 1BMV2 1UZYA 3HNMA 2HJIA 2E7AA 2Y0OA 3DYPA 4AI2A 1Z7S1 3LFMA 2FMYA 3OYWA 3VKOA 5C3RA 3K3OA 4JC1A 1Q5OA 2X5IC 5E89A 5CA6A 1OPMA 4QMAA 3R4DB 1ENQA 2ZBJA 4HPKA 1NY71 2WO7A 3BTXA 3ACHA 1JYNA 4I02A 4YVSC 4M00A 5FPUA 2FCUA 1PZ8A 1VALA 2LROA 1RUI1 4K20A 4AAPA 4CEYC 2AZ5A 2XVGA 4UWDA 5BNPA 1G9DA 2AH2A 1EY2A 1ZBA1 1RINA 5FYYA 2IFRA 3ZMOA 3ZFFA 1UL9A 3U14A 2NLRA 2W1WA 4MGIE 1XSRA 3AP9A 1JW6A 3J7HA 3E6BA 3BYWA 4OUSA 1AX1A 2RM21 1DYOA 5FREA 4QGLA 1SPPB 3WF4A 4XAEA 1G9CA 2GALA 2XGXA 2XLAA 5A6ZA 1N1SA 3P5BA 4NRPA 1I5PA 1DQ2A 4AGVA 3OD0A 3VL9A 5HCAA 1QGLA 1W3VA 2J1TA 4QKNA 2BVVA 4LHNA 1JYXA 2WT1A 1O3QA 4YG6A 2MHFA 4HMZA 5A7WA 1NCQA 1W6PB 2Y34A 3ZPOA 2DF7A 1RUC1 1XNDA 1RIRA 2ADEA 4OMDA 5EIYB 3MLLA 2OPKA 3I8TA 1GYKA 3C7EA 3T08A 1NE6A 5IVCA 4M3CF 2WLPA 3F2ZA 4WM8B 1KS5A 1YRZA 2PHLA 2BFUL 4Z82A 4YGBA 5A7OA 3O1UA 4E2SA 3ABZA 1ASJ1 1QIQA 3EQEA 4IUGA 1ZRRA 3KF5A 4JVAA 5EYYA 3K3NA 2N7GA 4KI5M 5FOBB 4HSLA 1WD4A 1H6YA 1HJGA 1HXS1 2EXKA 2HWC2 3WR0A 4FOQA 2E31A 3CJIB 2CU5A 2XR4A 4AI9A 4CCMA 5ISLA 3EJKA 1OI6A 3MFCA 3OEAA 4GXLA 4LUKA 2QQWA 3HT2A 2C0ZA 5A33B 5HCHA 3VZKA 3NNJA 2HWE2 2DCZA 2BU9A 3NNFA 3LPFA 1GFF2 1YC61 3OCPA 3WCSA 5FXWA 4NIGA 1GMMA 3WUDA 5JPNB 2VCAA 5K4LA 1E5SA 3W59A 1LHUA 2DCKA 2FMDA 4GJZA 2LALA 5LZ6A 1PVC3 3E97A 1DG6A 4XOGA 2HWF3 2XJRA 1BCXA 2WA3A 3VBFC 4M01A 4DINB 3GYDA 2FD8A 5BNOA 3FZ3A 3LCPA 2GC3A 2IXKA 4RS5A 2HWB3 4OFGA 4CDWB 2RDNA 3CLPA 5DZFA 5C71A 3LIGA 2QQUA 3TEYA 4RD7A 4NHXA 5FPLA 5CFCA 1Q8QA 4NHYA 3WQBA 5LBFA 1H30A 4XJUA 2ARBA 1LGBA 4OLLA 1WCQA 5DDJ1 3VZMA 1QJZA 1VBC1 4AFAA 5JDBA 1Y3TA 1CAVB 3ZSMA 1CN1A 5BYNA 4MGSA 2RS13 4EQVA 3M4FA 1TE1B 4YPJA 1VJ2A 2WNVA 1ZX5A 4FCAA 3UYJA 3CIHA 1WMDA 1IQAA 2JIGA 2VMEA 3JD71 2YBKA 1FT9A 1AX2A 3AZXA 4OHVA 3KV6A 5ACA1 1KFUL 1LOFC 1V9U3 4EYUA 1ND2A 4XXAA 5L7OC 3BKZA 4Q1PA 3LAGA 2AUYA 1QJY3 2ZOEB 1SBEA 3HNYM 3AYDA 4Y4YA 5SV5A 2D3SA 1SHWB 4CDUC 1A8MA 4CEWC 2XHKA 1MQTA 1JU4A 3FX3A 4WZCA 4FOVA 3M2MA 4PI0A 5C9AA 2UWBA 4QU1A 3AKTA 3JBG1 2J22A 1OF4A 1JYTA 3JQXA 3WHTA 2XJQA 2XBO2 5CEHA 2B46X 2RR11 2A6WA 2LS6A 5LY2A 1UPIA 3LDKA 2G9ZA 1SBDA 3AZYA 3VZOA 2E32A 1WGPA 4ZU7A 5JMCA 5EV7A 5JSOA 4N90A 2ZGTA 2MEV1 4XPVA 5J37A 3U37A 1S2EA 3O1MA 5FY1A 3W9AA 3N9LA 3S30A 1RVF1 1K5MC 3ACFA 4ASMB 1BQPA 3HAGA 4L2NA 4RR3A 4XUPA 1W03A 3VBHC 5E16A 2VMDA 4FTSA 1R1A3 3ASIA 1R093 1JZ6A 4L92A 1DGWA 5GZGA 3LEMA 3TYJA 2Q4SA 3IDAA 3ITQA 1O4YA 2ZAHA 5T52A 4HXCA 3U75A 2VQ0A 3FC0A 2VCBA 4CCKA 4BK4A 2GC1A 5H9SA 5K0UC 2BGPA 1BEV3 1HRI3 4QDQA 2GNBA 3APBA 1V70A 4QWNA 5F7UA 3EHKA 3C2UA 2ZKLA 1YFYA 2V73A 3VB9A 4QXHA 4YG3A 2B8MA 5IFTA 5A3WA 4YVWB 3VV1A 1PHMA 4Y1YA 3O7OA 1RHI3 2QQLA 1C8M3 1J1LA 3LOIA 3OF1A 3LA2A 4IGOA 1HJFA 4LO5B 5I8SA 4XILA 3THPA 1VBB1 3IDBB 2DTYA 3I54A 1O5UA 3D0JA 3EMRA 4KL1A 3ZFGC 2VXRA 5IK8A 4X6RB 5CZKA 3T2PA 3NJZA 1YHFA 1LJ7A 4L8QA 3I2HA 5F3IA 4D6SA 4UBHA 5FV3A 4I3GA 4LBOA 5FLJA 3SLIA 4OHYA 3BU7A 4AVVA 4EROA 3C7OA 4ZS2A 1X36A 4O61A 4CTEA 4UXAA 1ZRCA 2X09A 4OI4A 5FYZA 4BQXA 3PVBB 4Q5OA 1PK6A 3S5AA 1W6NA 4YFWA 2XPJA 4F8AA 5FMBA 3H8XA 1VBD1 4MLOA 4XDOA 1NXD1 5D2AA 4PCRA 1F15A 1WCKA 1UYZA 5JOZA 1U5XA 2VOWA 3U78A 3USUB 3HIFA 3F95A 4A7ZA 1H8VA 4GH4C 4HLTA 3RQ0A 2B4KA 4ARYA 1R081 1SFNA 1AX0A 3S57A 4W6WA 1X9PA 2GDFA 1JZ3A 2W5FA 1B35B 1QEXA 2JDZA 5CAZA 2XQXA 3M3OA 2TEPA 1UW8A 2OVUA 4JAAA 2QQMA 1UU5A 1DDLA 1W9FA 4C0BA 4QXCA 3IZOA 2ET7A 3P6BA 2ZGUA 1SLIA 2Y0IA 3HEIA 4IE6A 3RS6A 3UGFA 1REEA 1QQP2 4J1XA 3GBFA 1BHGA 3N9PA 2VUCA 3JB8A 3OUJA 3OGSA 3J4UH 4GB33 1FXZA 3KGZA 3IPVB 3ATGA 1X8MA 2ARCA 4Z07A 4QB2A 5EFUA 3O1TA 4MYEA 1NA1B 1XE7A 4JTNA 3VBRB 1UF2C 2VM9A 1W0PA 2HBUA 2B39A 1FX5A 3G6JB 2D93A 3NV1A 2JKXA 3TN93 5A32A 2D40A 1W6MA 1AR61 3I2FA 3WDUA 4K6BA 2A73B 1PVC2 2WO3A 4AEJA 5BNNB 4XUQA 4GWIA 3WQ1A 4LT5A 3EYPA 3KB5A 3IIIA 2RS51 1GWKA 2R6QA 2WZR1 3WNNA 4AHWA 4XMAA 5FMCA 4FXKB 4DO0A 3POGA 3RVHA 3MLJA 1OSGA 3H1MA 4D69A 1Y9GA 2YU2A 5AVAA 1UMHA 1Y4WA 5IVJA 4NIHA 4Q8KA 4BZ4A 2VW2A 5A1LA 3I2DA 2R042 3W20A 2VMCA 3A4UA 3EXUA 3NJVA 2OZJA 3H3ZA 4IV1A 4XUOA 3WDTA 4PLMA 2AEZA 4YW1A 1CVNA 3WZ1A 2HEYF 2PHXA 2ZS6B 1AXYA 1PX4A 2QQVA 4LBNA 4P9IA 4QPGB 5F32A 5I93A 2W9XA 2WYSA 2RS12 5F2WA 3U1XA 4FO9A 1V6LA 3AKRA 1M06G 5FPBA 1SQ4A 5LCWL 2BNOA 1EPWA 3O12A 5EQUA 3TWIA 3POSA 2R072 5LA9A 4RQPB 1GU3A 1SEFA 3GNEA 1QJY2 4MGYE 4BM8A 1CIYA 2WNUC 3C7FA 1AR73 4CUAA 2PLV3 2JDHA 5JI7A 1PO13 3Q9OA 3FL7A 4COWA 4QDSA 4PDWB 1ZREA 1GZTA 5JXHA 1N3PA 4BQWA 1PVXA 3PURA 5TSWA 3AZZA 4LBQD 4BMEA 3MZHA 2PQSA 5M0TA 1HIXA 3VKLA 4ATEA 1XU2A 1L7RA 4V1PA 2B45X 1H9WA 4XJ8A 5ABJC 1OBNA 1OH4A 1LTEA 2X5IA 1RUOA 4ES9A 4Z2WA 2O1QA 4ET7A 1FPN1 2OT7A 3MI8A 3NKTA 1W8UA 3FJSA 4YVSA 5JIAA 4D0QA 4P14A 1VP6A 1C5HA 5FLIA 4RN5A 3ZIWA 1JYIA 2D5FA 1GZCA 1AR81 4CEYA 1IS6A 2WJSA 5FPXA 3AP7A 5FY7A 4HT1T 3SMHA 2ZX1A 2YGMA 5EYXA 1LRHA 1MS8A 2CNAA 2WS93 2ZGNA 4PIZA 2IXIA 4JV4A 3USSA 4GAZA 3WEZA 1HLCA 3ON7A 1R1A2 3K2OA 4C90A 3C7GA 1R092 5LEJA 2ZGMA 4NRMA 4PLOA 2BDRA 2A6XA 2ZGRA 3TB0A 4AHZA 3KS7A 1VB4A 3MICA 2Q1MA 1Z7S3 1ULDA 4IERA 3AJYA 4BQ4A 2W87A 1AXKA 1BEV2 1HRI2 2HLEA 2XB6C 1E5HA 1CD3G 4H3WA 4R4ZA 4XBQA 5JXIA 1HB2A 3PUIA 4QXKA 4WVWA 2VMHA 1PMHX 2ZZQA 4QPIC 1UXZA 4NR1A 3RGBA 4AHXA 1HN1A 1RUI3 2WNEA 3LFIA 4Q1RA 3VBUB 4EN7B 4H14A 2B42B 4FPOB 2OKXA 3VHOA 1RHI2 2WN3A 1C8M2 1UD1A 1G8WA 1UOGA 4LORA 5JSPA 4QAWA 3E6DA 5A3MA 1J3QA 2GMMA 2ZHKA 2H6CA 3BCWA 3D5OA 4XHXA 3VGIA 3ZDVA 3AMQA 4QKDA 4QX8A 2R041 3MF9A 4RYDA 5FWEA 2OZ6A 2AGSA 5FZ7A 1SBFA 4E4DX 4XXPA 2OQ6A 2RM23 1BZWA 1U5IA 3D3AA 2K0GA 4XFHA 2NPIA 3K77A 4AVAA 2DUPA 3V0AB 3GHNA 1UN1A 5IVVA 1W8HA 5GLWA 3PUQA 4YFZA 1DGWX 3CDZB 2W92A 4YW5A 5D8AB 3VHNA 3SISA 3IT8A 1QWRA 1SLTA 3I4IA 1RUE3 1BK1A 2XLGA 5GZDA 2Y8KA 2PQQA 4GWNA 4DXRA 3VD4A 2R071 1DZTA 4ZS3A 1PMIA 3KQRA 3POIA 3OTFA 1RUC3 5FDBA 2I07B 2ETEA 4AK3A 2LTNA 4A44A 1YIPA 2BGOA 2CDPA 4PBPA 3VBFA 1XB9A 2VOXA 2V5YA 1A6CA 1WD3A 4NO4A 1VAKA 1DQ4A 2RV9A 1ASJ3 1F4HA 2QQJA 3PJYA 4NIIA 2VOVA 3MV11 4RA0A 3NAPB 1LOGA 3O0VA 4IESA 1YQCA 1YFWA 4IV3B 2QTWB 3AP6A 1HXS3 1KGYA 1OD3A 5FP7A 4UBGA 1W2UA 3WNOA 1JZ2A 1H6XA 1S0IA 4LE3A 4BDVB 4FPEA 1S2KA 1W6QB 1K12A 4YM2A 4BIFA 2A3WA 2P6HA 1TNRA 2QUOA 5FRAA 5H9PA 3RWKX 1MS5A 1SCSA 4DB5A 4FPHA 1CAXB 2ZEWA 3Q8BA 3FLPA 2QQNA 2C6SA 2TNFA 2JENA 3VBRC 4N53B 2HBTA 2FBEA 2CL2A 2VMIA 4YGCA 2BBAA 1QDOA 2YV8A 1RITA 1ZM1A 3OEBA 3T0DA 2WRAA 1LOFA 1ODNA 3HOBA 1OOPB 3GXUA 4DXTA 5L7OA 4YW7A 3GGLA 2Q1FA 3WP4A 4CDUA 3LPGA 4K3UA 4AI8A 4BIOA 1RUG1 4CEWA 4HVOA 2ATFA 1XNAA 2XUMA 2WZPP 2VE1A 1W8NA 1OH3A 4GALA 3PDQA 1J59A 4WVMB 1YQ2A 5DDJ3 4WBBA 4SLIA 1VBC3 4NPMA 3HQRA 2C9KA 1BVVA 4GD4A 3J26N 1GZWA 4A4AA 4YSFA 5FFOC 5KHIA 3O14A 2J1VA 5LASA 1H4HA 1W9TA 3I59A 5L73A 1AYN1 2ZABA 1F2NA 2BQPA 2P37A 4ZHNA 3JD73 4QQPA 4X8PA 2E63A 3TRSB 5ACA3 2DBNA 2EALA 1JS9A 2OXBA 4ZY9A 3ZVXA 4COYA 3S0MA 1K5MA 4JRLA 4XZUG 2GU9A 4HFSA 2VVEA 5G04L 2ZAAA 3ACIA 4RQPC 2WN2A 1V6OA 4KMQA 3VBHA 5JOWA 4EZ4A 3VBSB 4YZ2A 4DUVA 2EA7A 3ZXDA 1LHNA 1QH6A 2PLV2 4YWAA 3JBG3 1SDWA 2PAEA 2FZ1A 3WF3A 2ZGSA 5FZDA 3WX5A 5C4WC 5IK4A 4JKLA 1UX6A 5C33A 1G86A 3NQHA 4EWEA 5C3SA 2BOJA 1H1IA 4IEUA 2NZ9A 5D21A 2RR13 3PLQA 3LWCA 3M7AA 5K0UA 3ZXLA 4I01A 4RFRB 5LA0A 1AHSA 2VCCA 2A3YA 4OYUA 4FTBA 1AL0G 3W5NA 1NG0A 2YFUA 5JSRA 1QJEA 2Y6JA 4QB1A 2BYVE 1CZSA 5C3PA 2MEV3 1UKRA 3HBKA 5FYTA 3VBOB 4Y5TA 3WINE 3PJQA 4HN0A 3RMXA 1RVF3 2ZMNA 3T1LA 2PHWA 4R9DA 4Z8BA 5I0RA 4MO3M 4XFFA 2J1UA 3QCWA 3AKPA 3H42B 4AI0A 3ZFGA 3IBMA 2G4IA 5JOYA 2WS92 4PIXA 4QHOA 4IE0A 1ND3C 2BWCA 4JGYB 3D6EA 4LIVA 1ZZ6A 3OB8A 5A3LA 1BLZA 3WDVA 5GALA 4CCNA 3LE0A 1FMD1 2JE9A 2YU1A 5CFDB 1E5RA 4PHZA 3NV4A 3LDBA 3NNGA 1Z7S2 2JE8A 4OUEA 2HEVF 5LBCA 4OMCA 4PJYA 4DZGA 4LKEA 1NZCA 2JDYA 2OUJA 1D2QA 3BB6A 3MIGA 4FQZA 4EE2A 1NLSA 4QXBA 1NY72 3DF0A 3M70A 1JOPA 2W1SA 2ADDA 1CPMA 3ETQA 1DCSA 1REFA 4HK9A 3CMGA 3AKQA 3VBUC 3RDIA 1RUI2 4JHZA 2ZGQA 4QHBA 4HKWA 4LBQB 1PM7A 1VBB3 1SCRA 3S5QA 3ZYJB 4Q0QA 1LECA 1ZBA2 1V6NA 3SCGA 4LQRA 3TAYA 4CP9B 4JKMA 4RHV1 3ME2A 1HQNA 4UF0A 4AEDB 3OPWA 1GWLA 1FATA 2XONA 2WQ8A 3AZWA 4AQ2A 4OZXA 3GALA 2RM22 5KHKA 1NXMA 1QXRA 1HRV1 3GJAA 3HD8B 3UV9A 4A2UA 3AVSA 4J6GA 4LO8A 1H8TC 1QNWA 5AC91 3V0BA 1K45A 2BRTA 1QDCA 2PHUA 1VBD3 3ES1A 2W1QA 2WKKA 2P3YA 3HQXA 4KNCA 2FCTA 5FQ0B 5IYYA 4XJAA 5A33A 1ZNPA 4ZU5A 1C4RA 5L19A 3ZN6A 3PNAA 5FZBA 4MXWA 3VZNA 3KSCA 5A1AA 5F3CA 5FAXA 5FLHA 3WP6A 3RZGA 4XTMA 1R083 2VUJA 4G4FA 3S6PA 1U12A 4FPJA 2ZXQA 3O0XA 1JYCA 3AP4A 2WUHA 3THDA 2V4AA 4UFLA 3FBMA 2ET1A 2YB7A 5EZWA 1NYWA 2QQIA 2XKOA 3KCYA 3SC7X 3SHRA 2E51A 3OY8B 5JR7B 1GUIA 3LA3A 3WDWA 4BHPA 1KJRA 4A45A 4J25A 1JZ8A 1HXS2 1NX9A 4QX1A 2WA4A 4WM7B 4NIDA 4XFAA 4UFJA 3BOWA 5C7GA 4HSJA 4IE4A 3POBA 5KXCA 3I3QA 1LAJA 1GKBA 2ZKNA 3WNPA 4C8DA 3AYEA 3KGLA 2DCYA 2A6VA 4P9YA 1GOGA 1PO22 5FZFA 5GZFA 1DQ5A 2AYHA 1D0GA 3KHBA 2Q8OA 1UQXA 4AAXA 4XCAA 1OA2A 3S7IA 1RXGA 1AR63 4YM3A 5BPXA 2ZPXA 4GWMA 2BUKA 2R30A 2OUHA 4XAAA 3NJYA 5HXVA 3B00A 3B01A 3ZX7A 2WZR3 4N7UA 4O9GA 2QVSB 2WNUA 5A1FA 4XF4A 4N7IA 4DMIA 1XYNA 2Q5TA 2GN7A 5A7QA 1S0EA 4FPCA 1S0BA 3HWJA 3BIEA 1UY1A 4A7YA 5DDJ2 5LBBA 4GJYA 5DAVA 1VBC2 4CUGA 2OW4A 1H1MA 5JVVA 2KD7A 1XPWA 5ABJA 5H9QA 1MZ6A 4E8CA 3DGTA 3LEGA 3IAQA 1RUJ1 2SLIA 3P1IA 2VZPA 4QHZA 5KHHA 4JHTA 1QJX1 5A7SA 4OHXA 3JD72 5GLZA 4LOTA 1B09A 5ACA2 5BXXA 4QQLA 5GZCA 3POYA 1JHNA 2DTWA 2JXAA 4YW3A 4CCDA 2CWSA 3V56A 2VECA 1Z0HA 2YXSA 4GMP1 2HWD1 3VD9A 3ORJA 4E4SA 5FK8A 5LK7B 4BA6A 2VNRA 3RJ2X 1VBA1 4NAMA 5IVYA 4ZONA 3I97A 3KHCA 2PYTA 3WF0A 4YZ5A 3JBG2 5T3NA 3ROUA 2D7FA 1QF3A 5A3NA 5FMOS 2RR12 3N7MA 5FP4A 1UX7A 4BYYA 2VBBA 4W65A 2WT0A 3CQOA 1FPN3 2VR4A 2EIDA 2EIEA 1AZDA 1SFPA 4B1LA 4XF9A 2A5ZA 4N43C 2A70A 5DAPA 4FAHA 4QPIA 1XU1A 2MEV2 2XDVA 5JZGB 1AR83 1UIKA 1TME1 4DNYA 3RMYA 1RMU1 1RVF2 1ULFA 2B9UA 4QD2A 2XLFA 2F4PA 1SDDB 3FMGA 1S0FA 5F6LB 4OI1A 5FJHA 3BTZA 1VPHA 4P9LA 4XF0A 3K4DA 1QQP3 1PNFA 1W06A 1CONA 3J8F1 1PIV1 4R8HA 2IXJA 1LHOA 5A7PA 1LOCA 2VW1A 5IATA 1XXNA 1YIFA 3I49A 5IFPA 3SH4A 2VZTA 3AXDA 4XC9A 2VZVA 1RUD2 4P02B 2ORZA 3I2JA 4D3WA 3ZXKA 4EN8B 1UKGA 1CJDA 2TBVA 2SBAA 3U0ZA 3BTAA 1PO21 3ZYRA 4QGNA 4ZXKA 5DMYA 4Y20B 3B02A 3DXTA 1MS4A 2E33A 3ILFA 1GWMA 4CP0A 1QKQA 4XUNA 4CDQB 1WMEA 4MGZE 4A7KA 1G9FA 1VBB2 2BV4A 2PELA 2ZEYA 3DECA 1O3SA 1FYUA 2PHFA 2OS2A 2WQZC 2R043 2ZA9A 3H3UA 4ZPIA 1HV1A 1WBLA 1WMFA 1NT0A 2WSVA 3RFRA 4E4ZA 3RZMA 3BPSA 4XABA 4BOWA 1W3XA 3CJXA 1VRH1 1Q3EA 1RC6A 5EJ1B 2JG8C 2LW8A 4Y4RA 1C1LA 2J7MA 4J1WA 2W08A 3KV5A 4KH9A 4NROA 4WZFA 3W21A 4AGRA 3NL1A 4AL9A 3M1HA 3UGHA 3LDRA 2WC2A 2AACA 4PQQA 5T5OA 3UKVA 2NMOA 1SACA 1YXWA 5JLVA 5FJKA 4NVPA 1NCRC 1DZRA 4A6SA 3I3EA 4EN6B 5JOXA 1ZZ7A 3MGUA 4AVBA 2GNDA 2R073 1JUIA 1VBD2 1TNFA 4BE3A 5FZCA 5J3UA 2GP3A 1DYPA 3H8OA 4CU6A 3VBRA 4ISRA 2GH8A 2DVGA 2VZRA 3VDDB 4KG8A 1PX3A 4EZHA 2WWUA 1A78A 1KXGA 3WCRA 2UURA 1M4WA 3WP5A 1LB2A 2BJSA 1R082 1UYXA 1EAH2 2X10A 2CV6A 2DWRA 1I9RA 4ZXEA 2QNKA 1XBFA 5B2GB 4P9XA 1LOBA 3BOPA 1MEC1 4PF5A 1AUYA 1KEXA 5A3PA 3TNPB 3FN9A 4S2DA 1SMVA 1YUDA 1MS1A 3LA7A 1JN2P 5F5CA 4OI2A 4XFIA 3OPZA 3S7EA 5LA1A 1L7LA 4B4RA 3ZPYA 1LHVA 3DPRB 1IKPA 4LOSA 4A41A 2W52A 1Y43B 2RG4A 3OYWB 3ZYPA 2JEMA 5FZMA 1L3JA 1W9YA 2W3JA 3ES4A 3LB9A 4TN7A 3W58A 5IVFA 3MPPG 4HPKB 1ODMA 3AYCA 2CWMA 2HEWF 4NRQA 4QU2A 2JB4A 1V6MA 3M8LA 3ZYHA 5GM0A 4ZU4A 4E9KA 4B3NA 3O0WA 3C3VA 4X8NA 1AR62 1C3HA 5T55A 4G9SB 1RTVA 4MZUA 1RUG3 4RQPA 5J36A 2RS52 4YRDA 2WZR2 5GJ6A 3WDYA 2VZ1A 4BQ1A 1MZFA 1RUD1 5FZ3A 2VULA 2Y6KA 3BPZA 4Q27A 3ZFFB 5A6YA 1V6JA 2IUWA 4NWVA 4XBLA 5C4WA 4BK5A 5FZLA 2Y6FA 4AOCA 1KDMA 1RUH1 1AL21 2IZWA 5CKQA 3ZR6A 3OD4A 5J09A 5I8TA 2W95A 4FI9A 1X8EA 5FZEA 1CZTA 1BBT2 2BFUS 3WG1A 2VW0A 1AYN3 3ZSJA 4Y22A 1D4M1 5LBEA 1O8PA 1W90A 4PIYA 4KBBA 1J84A 4COZA 2VNOA 1W28A 5APAA 3RI8A 2YPJA 4W8JA 4QQ2A 1POQA 1Y9QA 4AVCA 4FT8A 4M0HA 2VOKA 5JMOA 2K2SA 1H1AA 5A7WB 3A23A 2Q30A 1NCQB 3ZXGA 4ARXA 5E6HA 1YJLA 4I30A 5L9BA 1YQ6A 4JZRA 4KWKA 1ND3A 3MUY1 3H3LA 2WSUA 3RWNA 2C4XA 4LITA 3QLQA 3O1PA 2CGPA 1OC1A 1RJ8A 2R32A 3WSOA 3BTYA 3UGGA 3GZUC 2JD4A 3H50A 1IPSA 2Y64A 3ILNA 3OBTA 5KR7A 2VXJA 3INAA 4JCKA 4WVZA 5FZKA 4IE7A 5BV6A 2OIIA 2LM3A 1KQRA 4H7LA 4CE8A 1GICA 2NYYA 3SH5A 4IEWA 1DF0A 1FPN2 3ACLA 3MV01 4N9HA 5LRRA 2D5HA 2GSYA 2NQYA 4R52A 4BLIA 4FOWA 1EAH1 3ETPA 4MH0E 3VBUA 1AR82 4IXLA 3KCXA 5CADA 1DGRA 1XOYA 4WM8C 2LRPA 2D6OX 2IXCA 3WW4A 4CYDA 1QJU1 4LO4B 1X9TA 4NE9A 1GR3A 3ZYBA 1W6OA 5A80A 2DVBA 3KVAA 5FZ0A 1H2KA 4MX3A 3UKNA 2W68A 1FMD3 2QBXA 5BNOB 3AM2A 3CJIC 4M3CE 4RS5B 2X29A 4XVHA 4DRVA 2I74A 2JDMA 4IEXA 3GDBA 1WUVA 4AEKA 5CFCB 5FY9A 5FKBA 3QD6A 1H8TA 5EJ3A 4FSJA 3VKFC 3CKHA 2FHRA 4Q2FA 4LBKA 3PTYA 1QXJA 2ZGLA 5DG1A 4Q4Y1 3ZOIA 1W39A 2C24A 1W0OA 3GF6A 1UIJA 1EUTA 4I0BA 2WNVB 4LHKA 4QKBA 5F2SA 3M3IA 4AF9A 2R061 3A0KA 3PVEA 4CDWC 2W1UA 4PLNA 2DUOA 1LGNA 3PL0A 4ISQA 5FYVA 2YUEA 1ND2B 1Q8SA 4RHV3 5LRSA 2YBPA 2YG0A 1RL3A 1VAMA 3OSDA 1EPZA 4AVTA 2ARAA 4MVTA 2J1SA 3IDEA 4PI2A 1EYBA 1OA4A 1HRV3 1MQTB 1V00A 3ZFEB 4CZSA 1BBT1 3CF6E 3POEA 4LO7A 2XWJB 1WZXA 5AC93 4OHZA 1JYVA 4HOOA 2EVXA 1WW7A 4P08A 2IWGB 4XUTA 2DV9A 2QFEA 3Q8EA 4XJZA 1EV11 1UY3A 1OT5A 2MNGA 3IN9A 2GZWA 2OA2A 5A3TA 4Q0PA 3Q8AA 4W4ZA 1PGW2 1CAXA 1XNBA 2NMNA 4UT5A 4XJ9A 2WABA 2YZ4A 3WG3A 1CAWA 1U0AA 2YC0A 3H1WA 4INDA 4K7JA 5JUVA 4K1ZA 3OOXA 3WW2A 4QGMA 1AYM1 4BXSV 2FCVA 3LZZA 2WQ4A 1GNYA 3A21A 4RR3B 4WVVA 1H2LA 4HN1A 4BLJA 3KVBA 3NSTA 5IVBA 1UZWA 4NHMA 1ZVFA 2AENA 3AB0A 1MVEA 2XVLA 3NV2A 4WVMA 1ULOA 2XL7A 2YDEA 3O5SA 1UOBA 2FDFA 3DPRC 2ZGPA 2VMGA 2R16A 1VRBA 2UYBA 1C1FA 4GIQA 2JD9A 3X29B 2F17A 3MEPA 1W04A 2JICA 1I6XA 4LK6A 1JYWA 3MIEA 1CGPA 2ZEZA 1DIWA 4YZ3A 1GP6A 2W94A 4UFMA 4XE9A 3WW1A 4B29A 2ERFA 4K21A 3DYMA 3AZVA 2QE3A 2JX9A 3PIJA 1CAUB 2ZTNA 3T09A 1O5LA 4A42A 1UNBA 2EAAA 3KQ4B 1ULCA 5CB7A 1RUG2 2RE9A 2CDOA 5FZIA 2B9VA 5FZ9A 1STMA 1QXPA 1W2TA 1WA4A 3SQOA 4BISA 4E4HA 3O1SA 1WLCA 5FYMA 2Z69A 4YZ1A 1NLQA 2P6CA 3SKJE 4LA3A 1IOAA 1UY4A 2Y26A 2BERA 4M3CA 1K5JA 1HN0A 3SEEA 1WCUA 1HB1A 3LF7A 2VMFA 2DVDA 3E5QA 2Y38A 5L36A 1RUJ3 1SG3A 4YVWC 2BP6A 5BUVA 4TWTA 1AYN2 1QJX3 3WOGA 3FE5A 2X05A 3EO6A 2VBPA 1PK6B 1S0JA 1ZBA3 2Y6HA 1Q8OA 2YBSA 1W6NB 2PHDA 2FQPA 2ZMLA 3PIGA 1QOSA 3Q8CA 3UJQA 3KT1A 5KXBA 5SV8A 4IEOA 3VD3A 4CSWA 5LATA 3DL3A 3NO8A 5FZOA 1Q8VA 4FVVA 4GMP3 2EF6A 2HWD3 2BBVA 2YY1A 4FPYA 1SFYA 4BXFA 1VBA3 1DQ0A 2IXHA 1S0CA 4QPYA 3BU0A 1RUF1 3WNMA 2XVKA 4I3PA 4UW3A 4I09A 5F3GA 5DZGA 1AJKA 5G05L 1XYPA 1MS9A 3M3EA 3ZDSA 5J98B 4CRQA 5J48A 2VZUA 1PGW1 4Y1XA 5F6KA 4V2WA 4XFBA 1D0HA 2G1MA 2D6MA 4GWJA 3HN1A 1TME3 1HQWA 4C1WA 1RMU3 5LK5A 4N9IA 1UU6A 3D8CA 5CU1A 2WAOA 1VIWB 1B35C 3N7KA 5CVRA 3N4MA 1OMIA 3FBYA 5DN2A 2PA7A 1ENRA 5A32B 1QJFA 3MIFA 1JOBA 1PIV3 3J8F3 1WCDJ 1FOD1 4R4XA 2AREA 2K46A 4XDPA 5FPAA 3B7MA 5J1XA 3W5MA 2JG8A 1FMD2 5FYIA 4CP2A 1NOVA 4MG2A 1LCLA 5CBLA 5FY5A 1RYYA 1ZBE2 3UT0A 3DCQA 1PO23 2P4EA 1LESA 1NA1C 2CAUA 2DVAA 4IV1B 5GLUA 1NCRA 4MV2A 4IEYA 3ZO0B 1W8WA 2RDRA 4BPZA 2J1EA 1V0AA 2QJVA 2P3KA 3AJZA 1REDA 5IUQA 2VVDA 3N3HA 5C8WA 3WVJA 5BNNC 1BYHA 1CX1A 4QX7A 5H9RA 4IEPA 2CAVA 2WFPA 2E26A 4F7ZA 4ZZ5A 4ZKTB 2V09A 2WWSA 2Z2SB 3NWKA 1OQEA 2GC0A 2DVFA 1VRH3 4P00B 1W8OA 4RHV2 4BQ3A 5JI9A 4UFKA 4QPWA 1W8FA 1PZ7A 3WG2A 1YQ5A 1GQGA 2JDAA 2VBDA 3T0AA 3OY8A 5LWBA 3MHZA 2Z79A 1HRV2 3ZFEC 1OFSA 3E1F1 4IE5A 4JDOA 3H1YA 4QPGC 4Y1UA 5AC92 1YI9A 2C5DA 3GHMA 4LBLA 2JB8A 1CIWA 5EP9A 5B4XA 3NW4A 1BK0A 1I3HA 2X5IB 5F8PA 2WO1A 1H0BA 5FZ4A 2VD7A 1K42A 2A75A 2RJKA 1LOEA 1IS3A 2ZCWA 2I2SA 3SKVA 4AZZA 4YVSB 3GZAA 1GBGA 4O7XA 1UPSA 2YHJA 3FFQA 3ILRA 5DQ0A 3RNSA 3UESA 3DEMA 3ZKUA 3IM0A 1OVSA 3A0NA 2XH6A 4FFFA 4XETA 4CEYB 4PDWC 3K4ZA 2Z4FA 2ZMKA 2I45A 4RGGA 5CNAA 4YM1A 4A6OA 2GMPA 4IGPA 1MEC3 2WZ8A 4AFCA 1LEMA 1GNHA 1VE0A 2YYOA 4LR4A 3UKTA 1OLQA 4C0HA 5KXDA 2XKPA 5JR2A 4HONA 1F35A 5CISA 2D43A 2AR6A 4AW7A 1IKQA 1XYOA 2Z42A 5E1RA 5FBJA 3U07A 5KWRA 5T5PA 2GMEA 1D4VB 4OQ8A 5K9YA 4QM9A 3LOBA 3GBWA 1WMXA 1XRUA 3PUHA 4I0WB 2PN5A 2XJVA 2VAUA 2P17A 4M4PA 5HBAA 1ZYBA 2QQOA 4XYXA 2P5BA 1W2AX 4COUA 1OFNA 4IDZA 3AFGA 1LGCA 4Q0VA 4JTOA 2JWPA 3AYAA 2QZ3A 2FDKA 4QKFA 4ATFA 1WCSA 2VOTA 3P3PA 4O65A 3IMNA 2VU9A 2D6LX 2QDRA 1RUD3 2WIIB 2UU8A 5DUVA 1XE8A 2QCSB 4E8DA 1WWYA 1ZBE1 2TUNA 1DZQA 3K51A 1ULGA 1DYKA 3ZSKA 1TEIA 1UWWA 3LEIA 2Y33A 3I2IA 1SPPA 3VKNA 4PF1A 4IEQA 1RUH3 1AL23 1DQ6A 2R0HA 2BVBA 5HI0A 1GV9A 1IG0A 2J42A 1ZZ8A 4Y1ZA 1I1EA 4JQRA 4LE4A 1HKDA 3H9AA 4CPBD 1RUJ2 3SNMA 4UFHA 2V4VA 1P8JA 4UAPA 1AR91 1W6PA 2RS31 4XIKA 1UY2A 1QJX2 2XJUA 1A34A 1UYPA 1XNCA 2VUAA 4UI9L 5C5UA 5CG9A 4GMP0 4XQDA 2VH9A 2GAUA 1VB2A 2E7QA 5IAVA 5HCFA 3AVRA 3ZXJA 4CDXB 4WM8A 4DFSA 1U5ZA 5DUWA 2R49A 1QOOA 4NJ4A 1NZIA 2HWD2 2WAAA 4AEMA 4CU9A 5I91A 5I8YA 3BN6A 4YW6A 1W9SA 1LHWA 1WLWA 1VBA2 1YLLA 4M4RA 4OQ9A 4Q4X1 1F5FA 2JG9B 1DBNA 3CJIA 4LHSA 1F8VA 5D8AC 3M3QA 2C1FA 1KS4A 5L9RA 3ELNA 5T5JA 5I0UA 5FYCA 1ENSA 2DUQA 1O4TA 1XJAA 2ZZJA 4P9WA 5HCBA 5FZ6A 1ZZCA 3HR9A 2C26A 2O14A 1OKQA 3DUIA 4Q4V1 4YZ4A 2JJ6A 1TG7A 3AK0A 3KT7A 4Y1VA 1EAH3 5DAXA 4O9EA 3OPTA 1COV1 1TME2 4QDRA 1RMU2 2RDQA 3ZMNA 4HANA 1SLAA 2ARXA 1QJU3 4Q0UA 4CDWA 4FPKA 4ZZ8A 2WL1A 3VUOA 4IEZA 3NAPC 4XIOA 1BXHA 5IK5A 4IV3C 2AEYA 5L7OB 3I7DA 4DQAA 3J8F2 1PIV2 3ECQA 2YROA 3JB4C 4OHWA 4AE2A 3GZEA 4CDUB 4KGGA 3KD4A 5DXDA 5FKCA 4CEWB 4D94A 3PMEA 2NP0A 1CAVA 3DYOA 1AR71 1MVQA 1NQDA 2YPDA 5FUIA 5FZAA 5C3OA 3N7LA 1PO11 4LPLA 5FZ1A 3PUAA 2K9ZA 4IETA 2MPFA 2RHPA 4Q4Y3 4CXXA 4N53C 5FZGA 4KWUA 3CZJA 4R9BA 5FPZA 4HETA 2Q8EA 3ZKYA 4ASKA 1J58A 2Y6LA 3FLTA 5D1IA 3QBQA 2OPWA 2VTXA 4CPBA 3TEZA 1OOPC 2E7TA 5ANQA 2RS53 3I59B 3LSDA 1C28A 5GLVA 2R063 3THTA 1WKYA 2VL4A 4XCBA 4NIAA 5FUNA 4BWOA 1PGL1 4B4QA 3P3NA 5FO9B 2WLQA 4GKXA 1K5MB 1R1ZA 1T2XA 5A6QA 5A3OA 5EJZB 3I2OA 1DHKB 1OF3A 2PXJA 3OGJA 3VBHB 1VRH2 4YGEA 4CUCA 4K1YA 2HKXA 1Q43A 1QH7A 3T2QA 3ZXAC 1BBT3 2IVIB 4LKDA 1LENA 1UOFA 4KQ7A 4D7SA 1ULEA 3MW2A 4L99A 2A71A 2JECA 3A7QA 4UW5A 2VNVA 1EV13 4K40A 4NOTA 5E8AA 4B7EA 3DPRA 5GLTA 2VY0A 4F3JA 3POWA 5K0UB 2C9AA 4L97A 1IHMA 1LEDA 1V6KA 5EHDA 3MW3A 2CYFA 1D7PM 3FHQA 5HV0A 2A6ZA 3L9JT 2FDIA 2P2KA 3AFKA 2R7EB 3ZXFA 5IT6A 3MO4A 1WW5A 3MUZ1 4RFT0 3MIDA 1AYM3 3VBSC 2Q1ZB 1JOJA 2UY9A 4FFIA 5FP3A 5F5IA 1ACCA 4FP2A 4EN9B 1RJ7A 3WDXA 3FUQA 1XQNA 4H55A 5LA2A 3TBDA 4U36A 4K8FA 3OBZA 3ENRA 2WFF1 3VZLA 4LKSA 5FXVA 1MEC2 3ZFGB 3ZIXA 1FI2A 1TMF1 3V65A 5ANNA 2NN8A 4YGDA 3T2TA 4A3XA 1O91A 1OVPA 3K75B 1A8DA 1S0DA 1G7YA 2DU1A 3B5LB 2LUWA 4DEVA 1OLRA 3RRDA 1HDKA 1JHJA 2PHRA 1JODA 3VBOC 3BVCA 4QM8A 5FZ8A 4YVWA 1JI6A 2RMU2 3B94A 3CHXA 3FLRA 5HXMA 3SITA 3VHPA 4Z1VA 4MGTA 1BVP1 1EP0A 2ZHLA 1IGOA 1W8ZA 4LJHA 4LLOA 5LB6A 2BTVC 4Q4W2 2ID4A 4JGZB 2JDKA 4BJ0A 5FWJA 4Y33A 2WYFA 5IK7A 2FDGA 1HQLA 1RUE1 4JGYC 1XC6A 2R1BA 3EB7A 3LD8A 2IC1A 4LO6B 1XE0A 2XUEA 4QQOA 2FDHA 3VKMA 4CXYA 1OQ1A 1VBE2 2JKBA 4OVEA 1XNKA 4GH4B 5DPNA 5CFDC 3ZSLA 3KT4A 1J3PA 2D6NA 3AP5A 4HVRA 4NMIA 3WNXA 2V5DA 3J7NA 2CTVA 5I0TA 4HZFA 1OXCA 3VLBB 1CWPA 3N36A 1RUH2 4UF0B 1AL22 2WR9A 3OBAA 4B7KA 4BMBA 3K46A 5FO7B 4D8MA 1JBCA 4KU8A 2ZACA 1D4M2 2QKDA 4OCTA 1KJLA 1O4ZA 2ZHMA 2A6YA 2WINB 4S2HA 1N1TA 2P3IA 3V0BB 1UYYA 1JTZX 3USUA 2CSGA 4EV0A 1PGSA 2O8OA 3U11A 4HBNA 4TLFA 3AMNA 1JU3A 4HKLA 3UNPA 1MS0A 2H0BA 4OUMA 4W6YA 3ZN6B 5F5AA 4MXWB 3I3BA 1B35A 2XWBB 2VCMA 3WQ0A 4CDXC 4DRRA 3RYKA 4GKYA 4B4PA 4AEDC 4LXLA 2XJTA 4V2VA 1RUF3 3D82A 3N9NA 4CP1A 4B8EA 1OQDA 3MDPA 5F5QA 3SCFA 5IVEA 2EXHA 3OGRA 1DP0A 2Q0AA 1HB4A 5JIUA 2JG9C 1DLLA 1BMV1 3I2KA 2X53S 1POV1 1T6GC 1CQ9A 3FFZA 3IPVA 4K9SA 4XHBA 1FAYA 5AFEA 4Y5SA 1GZ9A 1US2A 5C6CA 4EJRA 1NA1A 3UETA 1GOFA 2QDNA 3PMSA 2ZGOA 2WO2A 3RSJA 5FR3A 1HB3A 1LR5A 1RGSA 5LW9A 1O6UA 3SCHA 4NUBA 1H2NA 3JCIA 2KXLA 4FXGB 3THCA 2YGLA 1LU1A 1W99A 4QT6A 4RGKA 3I2GA 3FUOA 5BNNA 5KC5A 1IPKA 4FBFA 2RJ2A 5LY1A 1QJU2 4L11A 3IAPA 3OG2A 1FOD3 2VQAA 1IQDC 1F9KA 1HV0A 3GM8A 3OJBA 4Q26A 5C8CB 1OD5A 1C57A 2XJSA 3E5UA 4U2AA 1CX4A 2QQKA 2WNUB 4WM7C 3UK9A 2D6PA 3J9SA 3UJOA 3ZFEA 2RMU1 2GC2A 1YWKA 3IMMA 4QPGA 3RI9A 4LBJA 5CKMA 3NVCA 2VPVA 3HVDA 4D7YA 2PFWA 3VDBA 3KLSA 3EBRA 4FP3A 4GA9A 4NHKA 2D3PA 2E6VA 4Q4W1 4FFHA 4Q4Y2 3VDAA 3ACGA 4TYSA 4C1XA 5ABJB 1ZA4A 1N47A 4KG0A 4XACA 2B7YA 2DURA 2NM1A 5I0SA 2R1DA 4SBVA 1GLHA 1E5IA 1XSQA 1ZZBA 5BNPB 2BWAA 1VBE1 2R062 5F37A 3M3CA 1QY4A 1SZBA 4XURA 5A3UA 3GBGA 1UU4A 2JIJA 1O7FA 2DU0A 2G19A 1W05A 3QH7A 4PDWA 4UFIA 1TVGA 3NMBA 4LULA 4CXWA 5CIRA 1HX6A 2P3JA 3HMYA 4AI3A 2XQRA 1SLLA 1AXZA 3C7HA 4S2GA 1C8NA 4XBNA 2HWC1 5FTTC 2HH9A 2ENRA 4K8RB 1EV12 2V72A 1MR5A 2KM2A 2A3XA 1CESA 3DN7A 4D6QA 4IQPA 2HWE1 1E57A 1X82A 1OPOA 4MGKE 4H7MA 2D97A 4LNVA 2FDJA 2JDUA 3AXEA 3U4SA 3VDCA 2ILMA 3AX4A 5FY0A 5IJRA 2VJXA 3GCWA 1X33A 3H7JA 4QPIB 4YNIA 4XW3A 3WY6A 1PMJX 1AYM2 3IB3A 4XQWA 5T5LA 4XJWA 1CAUA 1ST8A 1Y9MA 4LEJA 2GP5A 3BIWE 1NLRA 4LIUA 1MACA 3GJBA 1J3RA 4JDNA 5E88A 4AQSA 4XFCA 4PQ9A 2Y60A 4UW6A 2VGDA 2VTXJ 3R05A 2GN3A 3AMHA 3OGVA 2XG3A 4L9BA 4PT6A 1OA3A 1TQ5A 3N9MA 2EXIA 4XF1A 5IWFA 2YMZA 1JMUB 1I5ZA 4BQYA 5JZGC 1A3KA 4HK8A 5A7NA 1JZ5A 4Z92B 2W91A 1UZZA 2VO5A 2VZSA 3ZLIA 1YEWA 2UY8A 4D6RA 5JXJA 5JXGA 3RZKA 3MYXA 2BZDA 4FPGA 1Z78A 2KR2A 1WBFA 1F5JA 3HNBM 3MF6A 3N7JA 5FP9A 4E2GA 4NAOA 4RSUA 3NRUA 2QZ2A 4LA2A 4JGZC 2BW8A 4DXZA 1URXA 1YI7A 1W2NA 3PHMA 3WNKA 4AHYA 5JPMB 1ZBE3 4AVSA 3V0AA 1ENXA 4S2FA 3IIAA 2W47A 4AFBA 1H4GA 2H0VA 4Y26A 1OKOA 4NHLA 5K8SA 3WUCA 4IW3A 4H2AA 4LUMA 3JQWA 3DXUA 4EWAA 3H8RA 3LEKA 1KFXL 4QB6A 5D8AA 2RVAA 4MXVA 1UCXA 2XMLA 2XBO1 1S55A 3POFA 2CY6A 3WP3A 1HW5A 3WF2A 2CGNA 1AR93 2RS33 2YC4A 4FQ4A 4DXSA 2H6BA 4CDQC 3KV4A 5FO8B 2BGCA 2JDNA 4LKFA 2HYKA 4NPRA 4ITCA 2AC1A 1CPNA 4C91A 1DLCA 4YW4A 1YO8A 2GH2A 2J1AA 3R4SA 2W46A 3PU3A 2ES3A 3I3MA 3NAPA 5FYBA 1ZA7A 4IV3A 4I2OA 4Q4X3 1RUF2 3HBZA 5C9AB 3ZN4A 5AFBA 1QHDA 3WHUA 2HWF2 1K3IA 4WV8A 1AF9A 1W6QA 1Y7BA 1R64A 1ZRDA 2HWB2 4BH9A 2VTFA 3NV3A 3WG4A 2ZJCA 2OYZA 4Q4V3 1W0NA 1L7QA
chains in the Genus database with same CATH topology
4N53A 2O8QA 3VDDC 2BPA2 3RJRA 1COV3 1FNYA 1KITA 1F31A 4BCUA 1OOPA 2DFCA 1JUHA 5JAXA 3R0RA 5DZEA 1FNZA 4QQHA 2D6KA 4AQ6A 1FOD2 3H8UA 1V9U2 5C8CC 2XL9A 2O0OA 4LHLA 4R9AA 3K48A 3WQ7A 2G9GA 2UWAA 3MPBA 1G6NA 1YCIA 5C4WB 1DGLA 3KM5A 1FV3A 4YM0A 2R0FA 3B9IA 2ZHNA 1GANA 4P9GA 2PHTA 1O3TA 4Y22B 1G9BA 1S1AA 4MUVA 5GKAC 4ASLA 3ZYIB 5BNPC 1SLCA 3VBSA 2EAKA 3ZFFC 4M0NA 3WXPA 1KRIA 4Q0SA 3B93A 3T1MA 2VNGA 5DG2A 4AI1A 1ND3B 3IDCB 1PNGA 5J7MA 4ONUA 1QQP1 4AYUA 1YNAA 3DKWA 3VBOA 2BEOA 1FV2A 1D2SA 1H2MA 1LULA 1YJKA 3BALA 3UL2A 4META 1MS3A 3PVNA 3VN4A 3RZZA 3D0SA 4TSVA 1AJOA 1NCQC 3GZTB 2ZX4A 3WT3A 3IWZA 2G9FA 5K7PA 2PTMA 1IZ3A 4FPFA 4XDQA 4JGYA 3U4XA 4E2QA 1PVC1 2HWF1 3R4UA 1X50A 2WFF3 4Y5Z0 4KWLA 2QQPA 3D4KA 2IXLA 1TMF3 5CFDA 1IS4A 2HWB1 1W6OB 4Q29A 1NQJA 3R6SA 4JDMA 3CU7A 3H7YA 1BKZA 4R9CA 2F6BA 4IL7A 4XQ4A 1DGRN 2BNNA 4HKOA 4FOYA 1WLDA 4TZDA 3KMHA 4NWWA 1H8TB 2RS11 4YYOA 1N1VA 4LBQA 4RGAA 4XEZA 1C5IA 4Y24A 1BJQA 1WW6A 5T50A 5KC6A 1VAVA 1W6MB 4GULA 1UAIA 3KZ4C 1V9U1 3RPQA 3SH3A 3MFAA 4AXOA 1QOTA 4CDXA 4D7TA 5BNOC 1QJY1 3LGRA 4AEDA 5BNQA 4RS5C 4UW4A 5CFCC 2JE7A 5KBFA 2ZX2A 2JG9A 3RG0A 4ORFA 1JH5A 4RL7A 5FQ0A 4P5HA 5JCTA 3E6CC 3JZVA 4JRAA 3FHIB 5F1RA 2WNVC 5FBZA 3TOJA 1AR92 2RS32 1IS5A 3TNQA 3WG2A 1QNYA 2ZX0A 4OI0A 1V6IA 1CR7A 4GB32 4DPNA 1X7NA 1ND2C 2IFWA 3AMMA 3B69A 1S0GA 3L2YA 1CAWB 1VLNA 1ZZ9A 5JWPA 2UWCA 3MW4A 1MQTC 1R1A1 3QOPA 3WV6A 1R091 3TN92 1O3RA 3ZSEA 1CJPA 4Q4X2 5C9AC 4WM7A 4PBOA 1POV3 2CGOA 3ZN5A 5F9TA 3QH6A 2E9QA 1BEV1 1HRI1 2XJPA 4DS0A 1JXNA 4Q4V2 4P9JA 5GZEA 3CNAA 1GQHA 1N3OA 1Q8PA 4ES8A 1COV2 3QACA 3OGGA 5FOJB 1WW4A 5KHJA 1LOAA 1RHI1 1C8M1 3N35A 5BY5A 4RR3C 3OBRA 4URTA 3KCCA 4X6QB 4AG4A 1GNZA 5EXOA 4AWDA 2D98A 4OULA 1N1YA 3B9CA 3V64A 3LKJA 3ST7A 2RMU3 4I0AA 4YW2A 1YFUA 3MIBA 3LSEA 1AR72 1ALYA 4YG0A 1PO12 3CEWA 2BNMA 1RB8G 4Q4W3 1N3QA 1NE4A 4XTPA 3H0OA 4M3CB 3U10A 2D3RA 2ZGKA 1MZ5A 4GQ7A 3RYPA 5KHGA 3MLKA 1VBE3 2DCTA 1MZEA 2FZ2A 1UMZA 4QX5A 4N43B 5FCCA 2UYAA 3ALQA 2PAKA 2VVFA 1PGL2 3AKSA 3G7DA 3WW3A 1LODA 4EN0A 4YARA 3AMPA 2WT2A 3L2HA 5T54A 2D44A 1ONAA 5CG8A 3HT1A 3CL1A 4DY5A 4AGGA 4FAGA 1OHFA 1LU2A 1D4M3 2HWC3 3ZXEA 2B5HA 1DU3D 4LLFA 5KXEA 1SLBA 3MIHA 3PVOA 4KWJA 2EIGA 1VR3A 5DUUA 1S2BA 1PK6C 3SXWA 2DYCA 1PZ9A 3CO2A 1Q56A 2HWE3 1QU0A 5JZGA 4GB31 4AQTA 1YFXA 4XFGA 4AFDA 3VL8A 2ZX3A 2E53A 3VBFB 3TN91 3B3QE 4HL0A 4JGZA 1QMJA 4HVQA 5FMOL 1YYNA 4LTAA 2KA3A 4W6XA 2WFF2 3WD5A 4XZPA 1ZRFA 1TMF2 4GH4A 2EXJA 2X8KA 2GNTA 3WLUA 4KGQA 3DV8A 4DOUA 4Q8LA 2JG8B 2VG9A 4KU7A 3JUUA 4Y20A 1H9PA 4DY3A 1WLTA 4F83A 2PAMA 1LKNA 4CDQA 1G9AA 3VHRA 1NCRB 4MSVA 4IEVA 2GNMA 5LEKA 2DCJA 1RUE2 4XF3A 2Z5WA 1IPJA 3JU9A 3FWEA 4COVA 1RUC2 4XMIA 5DUXA 1KDKA 2PLV1 1J1TA 3URFA 4AFMA 2XBO3 4IV1C 1GZWB 1ASJ2 3NKGA 4NN0A 5EWSA 4G3YC 1APNA 1DQ1A 2DFBA 1DFQA 2A7AA 3IKWA 3VDDA 1AVBA 4FPLA 5AVPA 3BODA 2RJLA 4E27A 1GSLA 1KD7A 3ZYGA 4EWDA 2W0XA 3RYRA 1RUNA 2WS91 1U5YA 4YLZA 4FTEA 1POV0 4LBMA 5J96B 5C8CA 2W39A 2P34A 3VZJA 3E5XA 1BMV2 1UZYA 2HJIA 2E7AA 2Y0OA 4AI2A 1Z7S1 2FMYA 3OYWA 3VKOA 4JC1A 5E89A 1Q5OA 2X5IC 5CA6A 1OPMA 4QMAA 3R4DB 1ENQA 2ZBJA 4HPKA 1NY71 4I02A 4YVSC 4M00A 1PZ8A 1VALA 1RUI1 4K20A 4CEYC 2AZ5A 2XVGA 5BNPA 1G9DA 2AH2A 1EY2A 1ZBA1 1RINA 2IFRA 3ZMOA 3ZFFA 1UL9A 2NLRA 4MGIE 3AP9A 1JW6A 3E6BA 4OUSA 1AX1A 2RM21 5FREA 4QGLA 1G9CA 2GALA 2XGXA 2XLAA 1N1SA 1DQ2A 4AGVA 3OD0A 3VL9A 5HCAA 1QGLA 2BVVA 4LHNA 2WT1A 1O3QA 4YG6A 2MHFA 4HMZA 1NCQA 1W6PB 2DF7A 1RUC1 1XNDA 1RIRA 3MLLA 2OPKA 3I8TA 1GYKA 1NE6A 4M3CF 2WLPA 4WM8B 1KS5A 1YRZA 2PHLA 2BFUL 4Z82A 4YGBA 4E2SA 1ASJ1 3EQEA 1ZRRA 4JVAA 5EYYA 2N7GA 5FOBB 4HSLA 1WD4A 3WR0A 2EXKA 1HXS1 2HWC2 4FOQA 3CJIB 3EJKA 1OI6A 3MFCA 4GXLA 4LUKA 3HT2A 2C0ZA 5A33B 3VZKA 2HWE2 2DCZA 3WCSA 1GFF2 3OCPA 3WUDA 5JPNB 3W59A 1LHUA 2DCKA 2FMDA 2LALA 1PVC3 3E97A 1DG6A 4XOGA 2HWF3 2XJRA 1BCXA 2WA3A 3VBFC 4M01A 4DINB 3GYDA 5BNOA 3FZ3A 3LCPA 2GC3A 2IXKA 4RS5A 2HWB3 4OFGA 4CDWB 5DZFA 3CLPA 4RD7A 5CFCA 1Q8QA 1H30A 4XJUA 2ARBA 1LGBA 4OLLA 5DDJ1 3VZMA 1QJZA 1VBC1 4AFAA 5JDBA 1Y3TA 1CAVB 3ZSMA 1CN1A 5BYNA 2RS13 3M4FA 1TE1B 1VJ2A 2WNVA 1ZX5A 4FCAA 1WMDA 1IQAA 3JD71 3AZXA 1FT9A 1AX2A 4OHVA 5ACA1 1KFUL 1LOFC 1V9U3 5L7OC 1ND2A 4XXAA 4Q1PA 3LAGA 2AUYA 1QJY3 2ZOEB 1SBEA 4Y4YA 3AYDA 5SV5A 2D3SA 4CDUC 1A8MA 4CEWC 2XHKA 1MQTA 3FX3A 4WZCA 4FOVA 3M2MA 5C9AA 2UWBA 3AKTA 3JBG1 3JQXA 3WHTA 2XJQA 2XBO2 2B46X 2RR11 2A6WA 1UPIA 1SBDA 3AZYA 3VZOA 1WGPA 4ZU7A 5JMCA 5EV7A 5JSOA 4N90A 2ZGTA 2MEV1 4XPVA 5J37A 3W9AA 3S30A 1RVF1 1K5MC 4ASMB 1BQPA 3HAGA 4L2NA 4RR3A 3VBHC 4FTSA 5E16A 1R1A3 3ASIA 1R093 4L92A 1DGWA 5GZGA 3TYJA 2Q4SA 1O4YA 2ZAHA 5T52A 2VQ0A 3FC0A 2GC1A 5H9SA 5K0UC 1BEV3 1HRI3 2GNBA 3APBA 1V70A 3EHKA 3C2UA 2ZKLA 1YFYA 2V73A 4YG3A 2B8MA 4YVWB 3VV1A 1PHMA 4Y1YA 3O7OA 1RHI3 1C8M3 1J1LA 3LOIA 3OF1A 3LA2A 4LO5B 5I8SA 4XILA 3THPA 1VBB1 3IDBB 2DTYA 3I54A 1O5UA 3D0JA 4KL1A 3ZFGC 2VXRA 5IK8A 4X6RB 3NJZA 1YHFA 1LJ7A 4L8QA 4UBHA 4I3GA 4LBOA 5FLJA 3SLIA 4OHYA 3BU7A 4AVVA 4EROA 1X36A 4CTEA 4UXAA 1ZRCA 4OI4A 3PVBB 1PK6A 1W6NA 4YFWA 2XPJA 4F8AA 1VBD1 4MLOA 1NXD1 4PCRA 1WCKA 5JOZA 1U5XA 2VOWA 3USUB 3HIFA 4A7ZA 1H8VA 4GH4C 4HLTA 3RQ0A 1R081 1SFNA 1AX0A 4W6WA 2GDFA 1B35B 2JDZA 5CAZA 3M3OA 2TEPA 1UW8A 2OVUA 4JAAA 1DDLA 1UU5A 4C0BA 2ET7A 3RS6A 2ZGUA 1SLIA 2Y0IA 1REEA 1QQP2 4J1XA 3GBFA 3JB8A 3J4UH 4GB33 1FXZA 3KGZA 3IPVB 3ATGA 1X8MA 4Z07A 5EFUA 4MYEA 1NA1B 1XE7A 4JTNA 3VBRB 1UF2C 1W0PA 2B39A 1FX5A 3G6JB 2D93A 3NV1A 3TN93 5A32A 2D40A 1W6MA 1AR61 3WDUA 4K6BA 2A73B 1PVC2 4AEJA 5BNNB 4LT5A 3WQ1A 3KB5A 4AHWA 2RS51 2R6QA 2WZR1 4XMAA 4FXKB 3MLJA 1OSGA 3H1MA 4D69A 5AVAA 4Q8KA 4BZ4A 2VW2A 3I2DA 2R042 3A4UA 3EXUA 4IV1A 2OZJA 3H3ZA 3WDTA 4PLMA 4YW1A 1CVNA 3WZ1A 2HEYF 2PHXA 2ZS6B 1AXYA 4LBNA 4P9IA 4QPGB 5I93A 2RS12 4FO9A 1V6LA 3AKRA 1M06G 1SQ4A 2BNOA 1EPWA 3O12A 3TWIA 3POSA 2R072 4RQPB 1SEFA 3GNEA 1QJY2 4MGYE 4BM8A 2WNUC 1AR73 2PLV3 5JI7A 1PO13 3Q9OA 4COWA 4PDWB 1ZREA 1N3PA 3MZHA 1PVXA 5TSWA 3AZZA 4LBQD 4BMEA 1HIXA 3VKLA 4ATEA 1XU2A 4V1PA 4XJ8A 2B45X 1H9WA 5ABJC 2X5IA 1LTEA 1RUOA 4ES9A 4Z2WA 2O1QA 1FPN1 3MI8A 3NKTA 4YVSA 3FJSA 5JIAA 4P14A 1VP6A 1C5HA 5FLIA 3ZIWA 1JYIA 2D5FA 1GZCA 1AR81 4CEYA 1IS6A 2WJSA 5FPXA 3AP7A 4HT1T 3SMHA 2ZX1A 2YGMA 5EYXA 1LRHA 1MS8A 2CNAA 2WS93 2ZGNA 4PIZA 2IXIA 4JV4A 3USSA 1HLCA 1R1A2 4C90A 5LEJA 1R092 2ZGMA 4PLOA 3TB0A 2A6XA 2ZGRA 4AHZA 3KS7A 1VB4A 3MICA 2Q1MA 1Z7S3 1ULDA 4IERA 3AJYA 1AXKA 1BEV2 1HRI2 2XB6C 4R4ZA 4H3WA 1CD3G 4XBQA 4QXKA 4WVWA 2VMHA 2ZZQA 4QPIC 4NR1A 4AHXA 2WNEA 1RUI3 4Q1RA 3VBUB 4EN7B 4H14A 2B42B 4FPOB 3VHOA 1RHI2 1C8M2 1UD1A 1G8WA 5JSPA 3E6DA 5A3MA 1J3QA 2GMMA 2ZHKA 2H6CA 3BCWA 3D5OA 4XHXA 3VGIA 3AMQA 2R041 3MF9A 2OZ6A 2AGSA 1SBFA 4E4DX 4XXPA 2RM23 1BZWA 1U5IA 3V0AB 2K0GA 4XFHA 2NPIA 4AVAA 2DUPA 3GHNA 1UN1A 5GLWA 4YFZA 1DGWX 4YW5A 5D8AB 3VHNA 3SISA 3IT8A 1QWRA 1SLTA 3I4IA 1RUE3 2XLGA 1BK1A 5GZDA 2PQQA 4GWNA 2R071 1DZTA 1PMIA 3KQRA 3OTFA 1RUC3 5FDBA 2I07B 2ETEA 4AK3A 2LTNA 1YIPA 4PBPA 3VBFA 2VOXA 2V5YA 1A6CA 1WD3A 4NO4A 1VAKA 1DQ4A 1ASJ3 3PJYA 2VOVA 4RA0A 3NAPB 1LOGA 3O0VA 4IESA 4IV3B 1YFWA 3AP6A 1HXS3 4UBGA 1W2UA 1S0IA 4LE3A 4FPEA 1S2KA 1W6QB 4YM2A 4BIFA 2A3WA 2QUOA 1TNRA 5FRAA 5H9PA 1MS5A 1SCSA 4DB5A 4FPHA 1CAXB 3FLPA 2TNFA 2JENA 3VBRC 4N53B 2FBEA 2CL2A 2VMIA 4YGCA 1QDOA 2YV8A 1RITA 1ZM1A 1LOFA 5L7OA 1OOPB 3WP4A 4CDUA 4K3UA 4AI8A 4BIOA 1RUG1 4CEWA 4HVOA 2ATFA 2XUMA 2WZPP 4GALA 1J59A 4WVMB 5DDJ3 4WBBA 4SLIA 1VBC3 1BVVA 4YSFA 3J26N 1GZWA 5FFOC 5KHIA 3O14A 1H4HA 3I59A 5L73A 1AYN1 2ZABA 1F2NA 2BQPA 2P37A 3JD73 4QQPA 4X8PA 2E63A 3TRSB 5ACA3 2EALA 3ZVXA 4COYA 3S0MA 1K5MA 4JRLA 2GU9A 4HFSA 2VVEA 2ZAAA 4RQPC 3VBHA 1V6OA 5JOWA 3VBSB 4YZ2A 2EA7A 3ZXDA 1LHNA 1QH6A 2PLV2 3JBG3 1SDWA 2PAEA 2FZ1A 2ZGSA 3WX5A 5C4WC 5IK4A 1UX6A 5C33A 1G86A 4EWEA 1H1IA 4IEUA 2NZ9A 2RR13 3PLQA 3LWCA 3M7AA 5K0UA 3ZXLA 4I01A 4FTBA 1AHSA 2A3YA 1AL0G 1NG0A 5JSRA 2BYVE 2MEV3 1UKRA 3VBOB 3WINE 3PJQA 4HN0A 3RMXA 1RVF3 2ZMNA 3T1LA 2PHWA 4R9DA 4Z8BA 5I0RA 4XFFA 3QCWA 3AKPA 4AI0A 3ZFGA 3IBMA 2G4IA 5JOYA 2WS92 4PIXA 1ND3C 2BWCA 4JGYB 3D6EA 1ZZ6A 5A3LA 3WDVA 5GALA 1FMD1 2JE9A 5CFDB 3NV4A 1Z7S2 2HEVF 4PJYA 4DZGA 1NZCA 3MIGA 2OUJA 1D2QA 3BB6A 4FQZA 1NLSA 1NY72 3DF0A 3M70A 1CPMA 3ETQA 1REFA 4HK9A 3AKQA 3VBUC 3RDIA 1RUI2 4QHBA 2ZGQA 4HKWA 4LBQB 1PM7A 1VBB3 1SCRA 3ZYJB 4Q0QA 1LECA 1ZBA2 1V6NA 3SCGA 3TAYA 4RHV1 3ME2A 1HQNA 4AEDB 1FATA 4AQ2A 3AZWA 4OZXA 3GALA 2RM22 5KHKA 1NXMA 1QXRA 1HRV1 3UV9A 3HD8B 4A2UA 4J6GA 4LO8A 1H8TC 1QNWA 5AC91 3V0BA 1QDCA 2PHUA 1VBD3 3ES1A 2WKKA 3HQXA 5FQ0B 4KNCA 4XJAA 5A33A 1ZNPA 4ZU5A 1C4RA 5L19A 3ZN6A 3PNAA 3VZNA 4MXWA 3KSCA 5FAXA 5FLHA 3WP6A 4XTMA 1R083 2VUJA 4G4FA 3S6PA 1U12A 4FPJA 3O0XA 1JYCA 3AP4A 5EZWA 3FBMA 2ET1A 1NYWA 2XKOA 3KCYA 3SHRA 2E51A 3OY8B 5JR7B 3LA3A 3WDWA 4BHPA 1KJRA 1HXS2 2WA4A 4WM7B 4XFAA 3BOWA 4HSJA 5KXCA 1GKBA 2ZKNA 3AYEA 3KGLA 2DCYA 2A6VA 4P9YA 1PO22 5GZFA 1DQ5A 2AYHA 1D0GA 2Q8OA 3S7IA 1OA2A 4YM3A 1AR63 5BPXA 2ZPXA 4GWMA 2BUKA 2R30A 2OUHA 5HXVA 3B00A 3B01A 3ZX7A 2WZR3 4N7UA 4O9GA 2QVSB 2WNUA 4XF4A 4N7IA 4DMIA 1XYNA 2Q5TA 2GN7A 1S0EA 4FPCA 1S0BA 3HWJA 4A7YA 5DDJ2 1VBC2 2OW4A 1H1MA 5JVVA 5ABJA 5H9QA 1MZ6A 3DGTA 1RUJ1 2SLIA 5KHHA 1QJX1 4OHXA 3JD72 5GLZA 5ACA2 1B09A 5BXXA 4QQLA 5GZCA 3POYA 1JHNA 2DTWA 2JXAA 4YW3A 2CWSA 3V56A 2VECA 1Z0HA 2YXSA 4GMP1 2HWD1 4E4SA 5LK7B 4BA6A 2VNRA 3RJ2X 1VBA1 2PYTA 4YZ5A 3JBG2 5T3NA 3ROUA 2D7FA 1QF3A 5FMOS 2RR12 3N7MA 4BYYA 4W65A 2WT0A 1FPN3 1AZDA 4XF9A 2A5ZA 4N43C 2A70A 4FAHA 4QPIA 1XU1A 2MEV2 5JZGB 1AR83 1UIKA 1TME1 4DNYA 3RMYA 1RMU1 1RVF2 1ULFA 2B9UA 4QD2A 2XLFA 2F4PA 3FMGA 1S0FA 5F6LB 4OI1A 4P9LA 4XF0A 1QQP3 1PNFA 4R8HA 1CONA 3J8F1 1PIV1 2IXJA 1LHOA 1LOCA 2VW1A 1XXNA 1YIFA 3SH4A 3AXDA 1RUD2 4D3WA 3ZXKA 4EN8B 1UKGA 1CJDA 2TBVA 2SBAA 3U0ZA 3BTAA 1PO21 3ZYRA 4QGNA 4ZXKA 4Y20B 3B02A 1MS4A 3ILFA 4CP0A 1QKQA 4CDQB 1WMEA 4MGZE 4A7KA 1G9FA 1VBB2 2PELA 1O3SA 1FYUA 2PHFA 2WQZC 2R043 2ZA9A 3H3UA 1HV1A 1WBLA 1WMFA 2WSVA 4E4ZA 4BOWA 3CJXA 1VRH1 1Q3EA 1RC6A 2JG8C 1C1LA 4J1WA 2W08A 4KH9A 4WZFA 4AGRA 3NL1A 3M1HA 5T5OA 2WC2A 3UKVA 5JLVA 2NMOA 1SACA 1YXWA 4NVPA 1NCRC 1DZRA 4EN6B 5JOXA 1ZZ7A 3MGUA 4AVBA 2GNDA 2R073 1JUIA 1VBD2 1TNFA 4BE3A 5J3UA 1DYPA 3VBRA 4ISRA 2GH8A 2DVGA 3VDDB 4KG8A 1A78A 1KXGA 3WCRA 2UURA 1M4WA 3WP5A 1LB2A 1R082 1EAH2 2CV6A 2DWRA 1I9RA 5B2GB 2QNKA 4P9XA 1LOBA 3BOPA 1MEC1 4PF5A 1AUYA 3TNPB 4S2DA 1SMVA 1YUDA 1MS1A 3LA7A 1JN2P 4OI2A 4XFIA 3OPZA 3S7EA 4B4RA 3ZPYA 1LHVA 3DPRB 1IKPA 2W52A 1Y43B 3OYWB 3ZYPA 2JEMA 1L3JA 3ES4A 3LB9A 3W58A 3MPPG 4HPKB 3AYCA 2CWMA 2HEWF 4QU2A 3M8LA 1V6MA 5GM0A 4ZU4A 4E9KA 4B3NA 3O0WA 3C3VA 4X8NA 1AR62 1C3HA 5T55A 4G9SB 1RTVA 4MZUA 1RUG3 4RQPA 5J36A 2RS52 4YRDA 2WZR2 5GJ6A 3WDYA 4BQ1A 1MZFA 1RUD1 2VULA 4Q27A 3BPZA 3ZFFB 1V6JA 4NWVA 4XBLA 5C4WA 1KDMA 1RUH1 1AL21 2IZWA 3OD4A 5J09A 5I8TA 1X8EA 3WG1A 2BFUS 1BBT2 3ZSJA 2VW0A 1AYN3 4Y22A 1D4M1 4PIYA 4COZA 4KBBA 2VNOA 3RI8A 2YPJA 4QQ2A 1Y9QA 4AVCA 4FT8A 4M0HA 2VOKA 2K2SA 1H1AA 3ZXGA 2Q30A 1NCQB 1YJLA 4I30A 4KWKA 1ND3A 2WSUA 3RWNA 3QLQA 2CGPA 1RJ8A 2R32A 3GZUC 2JD4A 3H50A 3ILNA 3OBTA 3INAA 4JCKA 4WVZA 5BV6A 2OIIA 2LM3A 1KQRA 4H7LA 1GICA 2NYYA 3SH5A 4IEWA 1DF0A 1FPN2 3ACLA 4N9HA 5LRRA 2D5HA 2GSYA 2NQYA 4R52A 4BLIA 4FOWA 1EAH1 4MH0E 3VBUA 1AR82 4IXLA 3KCXA 5CADA 1DGRA 4WM8C 2D6OX 2IXCA 3WW4A 4CYDA 1QJU1 4LO4B 1GR3A 1W6OA 2DVBA 1H2KA 4MX3A 3UKNA 2W68A 1FMD3 5BNOB 3AM2A 3CJIC 4M3CE 4RS5B 2X29A 4DRVA 2I74A 4IEXA 4AEKA 1WUVA 5CFCB 3QD6A 1H8TA 5EJ3A 4FSJA 3VKFC 2FHRA 4Q2FA 4LBKA 3PTYA 1QXJA 2ZGLA 5DG1A 4Q4Y1 1W39A 1W0OA 3GF6A 1UIJA 4I0BA 2WNVB 4LHKA 3M3IA 4AF9A 2R061 3A0KA 3PVEA 4CDWC 4PLNA 2DUOA 1LGNA 4ISQA 2YUEA 1ND2B 1Q8SA 4RHV3 5LRSA 1RL3A 1VAMA 1EPZA 4AVTA 4MVTA 3IDEA 1EYBA 1OA4A 1HRV3 1MQTB 1V00A 3ZFEB 4CZSA 1BBT1 3CF6E 4LO7A 2XWJB 5AC93 4OHZA 2EVXA 1WW7A 2IWGB 2DV9A 2QFEA 4XJZA 1EV11 2MNGA 3IN9A 2GZWA 2OA2A 4Q0PA 1PGW2 1CAXA 1XNBA 2NMNA 4XJ9A 2YZ4A 3WG3A 1CAWA 1U0AA 2YC0A 3H1WA 4INDA 4K7JA 4K1ZA 3WW2A 4QGMA 1AYM1 3LZZA 2WQ4A 4RR3B 4WVVA 1H2LA 4HN1A 4BLJA 3NSTA 4NHMA 1ZVFA 2AENA 3AB0A 1MVEA 2XVLA 3NV2A 4WVMA 2XL7A 2YDEA 3O5SA 3DPRC 2ZGPA 2VMGA 2R16A 2UYBA 1C1FA 4GIQA 3X29B 3MEPA 2JICA 1I6XA 3MIEA 1CGPA 4YZ3A 1DIWA 3WW1A 4XE9A 4B29A 2ERFA 4K21A 3AZVA 2QE3A 2JX9A 1CAUB 2ZTNA 1O5LA 2EAAA 1ULCA 5CB7A 1RUG2 2RE9A 1QXPA 1WA4A 1WLCA 2Z69A 4YZ1A 4LA3A 1IOAA 2Y26A 4M3CA 2DVDA 3E5QA 2Y38A 5L36A 1RUJ3 4YVWC 5BUVA 4TWTA 1AYN2 1QJX3 3WOGA 3FE5A 3EO6A 1PK6B 1S0JA 1ZBA3 4N43A 1Q8OA 1W6NB 2PHDA 2FQPA 2ZMLA 5KXBA 1QOSA 3UJQA 3KT1A 5SV8A 4IEOA 3DL3A 3NO8A 1Q8VA 4FVVA 4GMP3 2EF6A 2HWD3 2BBVA 2YY1A 4FPYA 1SFYA 1VBA3 1DQ0A 2IXHA 1S0CA 4QPYA 1RUF1 2XVKA 4I3PA 4UW3A 4I09A 5DZGA 1AJKA 1XYPA 1MS9A 3M3EA 3ZDSA 5J98B 4CRQA 5J48A 1PGW1 4Y1XA 5F6KA 4XFBA 1D0HA 2D6MA 3HN1A 1TME3 1HQWA 4C1WA 1RMU3 5LK5A 4N9IA 1UU6A 3D8CA 5CU1A 1VIWB 1B35C 3N7KA 5CVRA 3N4MA 1OMIA 3FBYA 2PA7A 1ENRA 5A32B 3MIFA 3J8F3 1PIV3 1WCDJ 1FOD1 4R4XA 2AREA 3B7MA 2JG8A 1FMD2 4CP2A 1NOVA 1LCLA 5CBLA 1ZBE2 1PO23 1LESA 1NA1C 2CAUA