4S2RP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
617
structure length
615
Chain Sequence
b'HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein APP-1
molecule tags Hydrolase
source organism Caenorhabditis elegans
publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
total genus 213
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2rP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2rP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2rP03
4U76A 5JFRA 4PV4A 5D6FA 5CNXA 2BHDA 3PKAA 2EVMA 3BIPA 1A16A 3FMRA 1W2MA 2GA2A 4U6WA 4FLKA 4FO8A 4FLIA 4JUQA 4MATA 4IKTA 1KP0A 2NQ6A 2HOWA 2BB7A 1C23A 3RVAA 1XGOA 4U6ZA 1R58A 1XGNA 5JHUA 1CHMA 3PKCA 1WL6A 4U6CA 4RZYA 4A6VA 4U73A 4FKCA 1KQ0A 2EA4A 4R60A 3IU7A 3OVKA 3PKBA 3D27A 3CTZA 3IG4A 1KQ9A 5CDEA 4FO7A 2P9AA 2B3KA 3TAVA 2BWVA 2GU6A 2GGCA 1WLRA 4IF7A 1PV9A 4S01A 4U75A 4U6JA 2OKNA 4U71A 1MATA 4FUKA 3IU9A 4KM3A 1O0XA 1YW9A 2OAZA 3CB5A 4RZZA 1QXWA 2P99A 1QXYA 2GU4A 1B6AA 4IU6A 3PN9A 1YJ3A 3MATA 4IKUA 4QR8A 3O5VA 2EA2A 2MATA 1XGSA 1WY2A 5CLSA 4S2RP 3TB5A 4EGEA 5CDVA 4S2TP 5FCHA 2B3LA 2IW2A 2GG8A 5D6EA 4S00A 4IKRA 3IL0A 2BWTA 1C22A 4U1BA 2BWXA 3BITA 1QZYA 2GG5A 2BWYA 3RORA 5E2CA 1XGMA 1R5GA 3L7GA 2GU5A 3MR1A 1W7VA 2GG9A 3FMQA 1QXZA 3OOOA 1B59A 3IU8A 1XNZA 4IECA 1JAWA 1WBQA 2GG7A 5FCFA 2BWWA 3Q6DA 4U69A 4U6EA 1BOAA 4ZWOA 1C27A 3QOCA 4A6WA 1C21A 1M35A 5CE6A 2GG2A 2Q95A 4IDYA 1C24A 3FM3A 4IKSA 2V3YA 2Q94A 2EVOA 5JI6A 2V3ZA 3I7MA 3S6BA 4B28A 5CDLA 2BHBA 2BN7A 3L24A 1YVMA 5E5BA 3BIQA 4Z7MA 1WN1A 1WL9A 3PKEA 4HXXA 4ZWPA 2P98A 4ZNGA 4RGZ1 2ADUA 1Y1NA 4U70A 2BWUA 2BH3A 2G6PA 4ZWUA 3MX6A 2BWSA 2V3XA 2NQ7A 2GTXA 2ZSGA 3PKDA 2EVCA 4FLLA 2GU7A 3PEBA 1R5HA 1WKMA 5CIKA 4FLJA 2GG0A 4OOKA 2Q8KA 2BHCA 1YW8A 1BN5A 2DFIA 2GG3A 2V6CA 1YW7A 1N51A 2BHAA 3CB6A 2GZ5A 2Q93A 2Q92A 2Q96A 4IPAA 2GGBA 4PNCA 2B3HA
chains in the Genus database with same CATH superfamily
4U76A 5JFRA 4PV4A 5D6FA 5CNXA 2BHDA 3PKAA 2EVMA 3BIPA 1A16A 3FMRA 1W2MA 2GA2A 4U6WA 4FLKA 4FO8A 4FLIA 4JUQA 4MATA 4IKTA 1KP0A 2NQ6A 2HOWA 2BB7A 1C23A 3RVAA 1XGOA 4U6ZA 1R58A 1XGNA 5JHUA 1CHMA 3PKCA 1WL6A 4U6CA 4RZYA 4A6VA 4U73A 4FKCA 1KQ0A 2EA4A 4R60A 3IU7A 3OVKA 3PKBA 3D27A 3CTZA 3IG4A 1KQ9A 5CDEA 4FO7A 2P9AA 2B3KA 3TAVA 2BWVA 2GU6A 2GGCA 1WLRA 4IF7A 1PV9A 4S01A 4U75A 4U6JA 2OKNA 4U71A 1MATA 4FUKA 3IU9A 4KM3A 1O0XA 1YW9A 2OAZA 3CB5A 4RZZA 1QXWA 2P99A 1QXYA 2GU4A 1B6AA 4IU6A 3PN9A 1YJ3A 3MATA 4IKUA 4QR8A 3O5VA 2EA2A 2MATA 1XGSA 1WY2A 5CLSA 4S2RP 3TB5A 4EGEA 5CDVA 4S2TP 5FCHA 2B3LA 2IW2A 2GG8A 5D6EA 4S00A 4IKRA 3IL0A 2BWTA 1C22A 4U1BA 2BWXA 3BITA 1QZYA 2GG5A 2BWYA 3RORA 5E2CA 1XGMA 1R5GA 3L7GA 2GU5A 3MR1A 1W7VA 2GG9A 3FMQA 1QXZA 3OOOA 1B59A 3IU8A 1XNZA 4IECA 1JAWA 1WBQA 2GG7A 5FCFA 2BWWA 3Q6DA 4U69A 4U6EA 1BOAA 4ZWOA 1C27A 3QOCA 4A6WA 1C21A 1M35A 5CE6A 2GG2A 2Q95A 4IDYA 1C24A 3FM3A 4IKSA 2V3YA 2Q94A 2EVOA 5JI6A 2V3ZA 3I7MA 3S6BA 4B28A 5CDLA 2BHBA 2BN7A 3L24A 1YVMA 5E5BA 3BIQA 4Z7MA 1WN1A 1WL9A 3PKEA 4HXXA 4ZWPA 2P98A 4ZNGA 4RGZ1 2ADUA 1Y1NA 4U70A 2BWUA 2BH3A 2G6PA 4ZWUA 3MX6A 2BWSA 2V3XA 2NQ7A 2GTXA 2ZSGA 3PKDA 2EVCA 4FLLA 2GU7A 3PEBA 1R5HA 1WKMA 5CIKA 4FLJA 2GG0A 4OOKA 2Q8KA 2BHCA 1YW8A 1BN5A 2DFIA 2GG3A 2V6CA 1YW7A 1N51A 2BHAA 3CB6A 2GZ5A 2Q93A 2Q92A 2Q96A 4IPAA 2GGBA 4PNCA 2B3HA
chains in the Genus database with same CATH topology
4U76A 5JFRA 4PV4A 5D6FA 5CNXA 2BHDA 3PKAA 2EVMA 3BIPA 1A16A 3FMRA 1W2MA 2GA2A 4U6WA 4FLKA 4FO8A 4FLIA 4JUQA 4MATA 4IKTA 1KP0A 2NQ6A 2HOWA 2BB7A 1C23A 3RVAA 1XGOA 4U6ZA 1R58A 1XGNA 5JHUA 1CHMA 3PKCA 1WL6A 4U6CA 4RZYA 4A6VA 4U73A 4FKCA 1KQ0A 2EA4A 4R60A 3IU7A 3OVKA 3PKBA 3D27A 3CTZA 3IG4A 1KQ9A 5CDEA 4FO7A 2P9AA 2B3KA 3TAVA 2BWVA 2GU6A 2GGCA 1WLRA 4IF7A 1PV9A 4S01A 4U75A 4U6JA 2OKNA 4U71A 1MATA 4FUKA 3IU9A 4KM3A 1O0XA 1YW9A 2OAZA 3CB5A 4RZZA 1QXWA 2P99A 1QXYA 2GU4A 1B6AA 4IU6A 3PN9A 1YJ3A 3MATA 4IKUA 4QR8A 3O5VA 2EA2A 2MATA 1XGSA 1WY2A 5CLSA 4S2RP 3TB5A 4EGEA 5CDVA 4S2TP 5FCHA 2B3LA 2IW2A 2GG8A 5D6EA 4S00A 4IKRA 3IL0A 2BWTA 1C22A 4U1BA 2BWXA 3BITA 1QZYA 2GG5A 2BWYA 3RORA 5E2CA 1XGMA 1R5GA 3L7GA 2GU5A 3MR1A 1W7VA 2GG9A 3FMQA 1QXZA 3OOOA 1B59A 3IU8A 1XNZA 4IECA 1JAWA 1WBQA 2GG7A 5FCFA 2BWWA 3Q6DA 4U69A 4U6EA 1BOAA 4ZWOA 1C27A 3QOCA 4A6WA 1C21A 1M35A 5CE6A 2GG2A 2Q95A 4IDYA 1C24A 3FM3A 4IKSA 2V3YA 2Q94A 2EVOA 5JI6A 2V3ZA 3I7MA 3S6BA 4B28A 5CDLA 2BHBA 2BN7A 3L24A 1YVMA 5E5BA 3BIQA 4Z7MA 1WN1A 1WL9A 3PKEA 4HXXA 4ZWPA 2P98A 4ZNGA 4RGZ1 2ADUA 1Y1NA 4U70A 2BWUA 2BH3A 2G6PA 4ZWUA 3MX6A 2BWSA 2V3XA 2NQ7A 2GTXA 2ZSGA 3PKDA 2EVCA 4FLLA 2GU7A 3PEBA 1R5HA 1WKMA 5CIKA 4FLJA 2GG0A 4OOKA 2Q8KA 2BHCA 1YW8A 1BN5A 2DFIA 2GG3A 2V6CA 1YW7A 1N51A 2BHAA 3CB6A 2GZ5A 2Q93A 2Q92A 2Q96A 4IPAA 2GGBA 4PNCA 2B3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U76 A;  5JFR A;  4PV4 A;  5D6F A;  5CNX A;  2BHD A;  3PKA A;  2EVM A;  3BIP A;  1A16 A;  3FMR A;  1W2M A;  2GA2 A;  4U6W A;  4FLK A;  4FO8 A;  4FLI A;  4JUQ A;  4MAT A;  4IKT A;  1KP0 A;  2NQ6 A;  2HOW A;  2BB7 A;  1C23 A;  3RVA A;  1XGO A;  4U6Z A;  1R58 A;  1XGN A;  5JHU A;  1CHM A;  3PKC A;  1WL6 A;  4U6C A;  4RZY A;  4A6V A;  4U73 A;  4FKC A;  1KQ0 A;  2EA4 A;  4R60 A;  3IU7 A;  3OVK A;  3PKB A;  3D27 A;  3CTZ A;  3IG4 A;  1KQ9 A;  5CDE A;  4FO7 A;  2P9A A;  2B3K A;  3TAV A;  2BWV A;  2GU6 A;  2GGC A;  1WLR A;  4IF7 A;  1PV9 A;  4S01 A;  4U75 A;  4U6J A;  2OKN A;  4U71 A;  1MAT A;  4FUK A;  3IU9 A;  4KM3 A;  1O0X A;  1YW9 A;  2OAZ A;  3CB5 A;  4RZZ A;  1QXW A;  2P99 A;  1QXY A;  2GU4 A;  1B6A A;  4IU6 A;  3PN9 A;  1YJ3 A;  3MAT A;  4IKU A;  4QR8 A;  3O5V A;  2EA2 A;  2MAT A;  1XGS A;  1WY2 A;  5CLS A;  4S2R P;  3TB5 A;  4EGE A;  5CDV A;  4S2T P;  5FCH A;  2B3L A;  2IW2 A;  2GG8 A;  5D6E A;  4S00 A;  4IKR A;  3IL0 A;  2BWT A;  1C22 A;  4U1B A;  2BWX A;  3BIT A;  1QZY A;  2GG5 A;  2BWY A;  3ROR A;  5E2C A;  1XGM A;  1R5G A;  3L7G A;  2GU5 A;  3MR1 A;  1W7V A;  2GG9 A;  3FMQ A;  1QXZ A;  3OOO A;  1B59 A;  3IU8 A;  1XNZ A;  4IEC A;  1JAW A;  1WBQ A;  2GG7 A;  5FCF A;  2BWW A;  3Q6D A;  4U69 A;  4U6E A;  1BOA A;  4ZWO A;  1C27 A;  3QOC A;  4A6W A;  1C21 A;  1M35 A;  5CE6 A;  2GG2 A;  2Q95 A;  4IDY A;  1C24 A;  3FM3 A;  4IKS A;  2V3Y A;  2Q94 A;  2EVO A;  5JI6 A;  2V3Z A;  3I7M A;  3S6B A;  4B28 A;  5CDL A;  2BHB A;  2BN7 A;  3L24 A;  1YVM A;  5E5B A;  3BIQ A;  4Z7M A;  1WN1 A;  1WL9 A;  3PKE A;  4HXX A;  4ZWP A;  2P98 A;  4ZNG A;  4RGZ 1;  2ADU A;  1Y1N A;  4U70 A;  2BWU A;  2BH3 A;  2G6P A;  4ZWU A;  3MX6 A;  2BWS A;  2V3X A;  2NQ7 A;  2GTX A;  2ZSG A;  3PKD A;  2EVC A;  4FLL A;  2GU7 A;  3PEB A;  1R5H A;  1WKM A;  5CIK A;  4FLJ A;  2GG0 A;  4OOK A;  2Q8K A;  2BHC A;  1YW8 A;  1BN5 A;  2DFI A;  2GG3 A;  2V6C A;  1YW7 A;  1N51 A;  2BHA A;  3CB6 A;  2GZ5 A;  2Q93 A;  2Q92 A;  2Q96 A;  4IPA A;  2GGB A;  4PNC A;  2B3H A; 
#chains in the Genus database with same CATH topology
 4U76 A;  5JFR A;  4PV4 A;  5D6F A;  5CNX A;  2BHD A;  3PKA A;  2EVM A;  3BIP A;  1A16 A;  3FMR A;  1W2M A;  2GA2 A;  4U6W A;  4FLK A;  4FO8 A;  4FLI A;  4JUQ A;  4MAT A;  4IKT A;  1KP0 A;  2NQ6 A;  2HOW A;  2BB7 A;  1C23 A;  3RVA A;  1XGO A;  4U6Z A;  1R58 A;  1XGN A;  5JHU A;  1CHM A;  3PKC A;  1WL6 A;  4U6C A;  4RZY A;  4A6V A;  4U73 A;  4FKC A;  1KQ0 A;  2EA4 A;  4R60 A;  3IU7 A;  3OVK A;  3PKB A;  3D27 A;  3CTZ A;  3IG4 A;  1KQ9 A;  5CDE A;  4FO7 A;  2P9A A;  2B3K A;  3TAV A;  2BWV A;  2GU6 A;  2GGC A;  1WLR A;  4IF7 A;  1PV9 A;  4S01 A;  4U75 A;  4U6J A;  2OKN A;  4U71 A;  1MAT A;  4FUK A;  3IU9 A;  4KM3 A;  1O0X A;  1YW9 A;  2OAZ A;  3CB5 A;  4RZZ A;  1QXW A;  2P99 A;  1QXY A;  2GU4 A;  1B6A A;  4IU6 A;  3PN9 A;  1YJ3 A;  3MAT A;  4IKU A;  4QR8 A;  3O5V A;  2EA2 A;  2MAT A;  1XGS A;  1WY2 A;  5CLS A;  4S2R P;  3TB5 A;  4EGE A;  5CDV A;  4S2T P;  5FCH A;  2B3L A;  2IW2 A;  2GG8 A;  5D6E A;  4S00 A;  4IKR A;  3IL0 A;  2BWT A;  1C22 A;  4U1B A;  2BWX A;  3BIT A;  1QZY A;  2GG5 A;  2BWY A;  3ROR A;  5E2C A;  1XGM A;  1R5G A;  3L7G A;  2GU5 A;  3MR1 A;  1W7V A;  2GG9 A;  3FMQ A;  1QXZ A;  3OOO A;  1B59 A;  3IU8 A;  1XNZ A;  4IEC A;  1JAW A;  1WBQ A;  2GG7 A;  5FCF A;  2BWW A;  3Q6D A;  4U69 A;  4U6E A;  1BOA A;  4ZWO A;  1C27 A;  3QOC A;  4A6W A;  1C21 A;  1M35 A;  5CE6 A;  2GG2 A;  2Q95 A;  4IDY A;  1C24 A;  3FM3 A;  4IKS A;  2V3Y A;  2Q94 A;  2EVO A;  5JI6 A;  2V3Z A;  3I7M A;  3S6B A;  4B28 A;  5CDL A;  2BHB A;  2BN7 A;  3L24 A;  1YVM A;  5E5B A;  3BIQ A;  4Z7M A;  1WN1 A;  1WL9 A;  3PKE A;  4HXX A;  4ZWP A;  2P98 A;  4ZNG A;  4RGZ 1;  2ADU A;  1Y1N A;  4U70 A;  2BWU A;  2BH3 A;  2G6P A;  4ZWU A;  3MX6 A;  2BWS A;  2V3X A;  2NQ7 A;  2GTX A;  2ZSG A;  3PKD A;  2EVC A;  4FLL A;  2GU7 A;  3PEB A;  1R5H A;  1WKM A;  5CIK A;  4FLJ A;  2GG0 A;  4OOK A;  2Q8K A;  2BHC A;  1YW8 A;  1BN5 A;  2DFI A;  2GG3 A;  2V6C A;  1YW7 A;  1N51 A;  2BHA A;  3CB6 A;  2GZ5 A;  2Q93 A;  2Q92 A;  2Q96 A;  4IPA A;  2GGB A;  4PNC A;  2B3H A; 
#chains in the Genus database with same CATH homology
 4U76 A;  5JFR A;  4PV4 A;  5D6F A;  5CNX A;  2BHD A;  3PKA A;  2EVM A;  3BIP A;  1A16 A;  3FMR A;  1W2M A;  2GA2 A;  4U6W A;  4FLK A;  4FO8 A;  4FLI A;  4JUQ A;  4MAT A;  4IKT A;  1KP0 A;  2NQ6 A;  2HOW A;  2BB7 A;  1C23 A;  3RVA A;  1XGO A;  4U6Z A;  1R58 A;  1XGN A;  5JHU A;  1CHM A;  3PKC A;  1WL6 A;  4U6C A;  4RZY A;  4A6V A;  4U73 A;  4FKC A;  1KQ0 A;  2EA4 A;  4R60 A;  3IU7 A;  3OVK A;  3PKB A;  3D27 A;  3CTZ A;  3IG4 A;  1KQ9 A;  5CDE A;  4FO7 A;  2P9A A;  2B3K A;  3TAV A;  2BWV A;  2GU6 A;  2GGC A;  1WLR A;  4IF7 A;  1PV9 A;  4S01 A;  4U75 A;  4U6J A;  2OKN A;  4U71 A;  1MAT A;  4FUK A;  3IU9 A;  4KM3 A;  1O0X A;  1YW9 A;  2OAZ A;  3CB5 A;  4RZZ A;  1QXW A;  2P99 A;  1QXY A;  2GU4 A;  1B6A A;  4IU6 A;  3PN9 A;  1YJ3 A;  3MAT A;  4IKU A;  4QR8 A;  3O5V A;  2EA2 A;  2MAT A;  1XGS A;  1WY2 A;  5CLS A;  4S2R P;  3TB5 A;  4EGE A;  5CDV A;  4S2T P;  5FCH A;  2B3L A;  2IW2 A;  2GG8 A;  5D6E A;  4S00 A;  4IKR A;  3IL0 A;  2BWT A;  1C22 A;  4U1B A;  2BWX A;  3BIT A;  1QZY A;  2GG5 A;  2BWY A;  3ROR A;  5E2C A;  1XGM A;  1R5G A;  3L7G A;  2GU5 A;  3MR1 A;  1W7V A;  2GG9 A;  3FMQ A;  1QXZ A;  3OOO A;  1B59 A;  3IU8 A;  1XNZ A;  4IEC A;  1JAW A;  1WBQ A;  2GG7 A;  5FCF A;  2BWW A;  3Q6D A;  4U69 A;  4U6E A;  1BOA A;  4ZWO A;  1C27 A;  3QOC A;  4A6W A;  1C21 A;  1M35 A;  5CE6 A;  2GG2 A;  2Q95 A;  4IDY A;  1C24 A;  3FM3 A;  4IKS A;  2V3Y A;  2Q94 A;  2EVO A;  5JI6 A;  2V3Z A;  3I7M A;  3S6B A;  4B28 A;  5CDL A;  2BHB A;  2BN7 A;  3L24 A;  1YVM A;  5E5B A;  3BIQ A;  4Z7M A;  1WN1 A;  1WL9 A;  3PKE A;  4HXX A;  4ZWP A;  2P98 A;  4ZNG A;  4RGZ 1;  2ADU A;  1Y1N A;  4U70 A;  2BWU A;  2BH3 A;  2G6P A;  4ZWU A;  3MX6 A;  2BWS A;  2V3X A;  2NQ7 A;  2GTX A;  2ZSG A;  3PKD A;  2EVC A;  4FLL A;  2GU7 A;  3PEB A;  1R5H A;  1WKM A;  5CIK A;  4FLJ A;  2GG0 A;  4OOK A;  2Q8K A;  2BHC A;  1YW8 A;  1BN5 A;  2DFI A;  2GG3 A;  2V6C A;  1YW7 A;  1N51 A;  2BHA A;  3CB6 A;  2GZ5 A;  2Q93 A;  2Q92 A;  2Q96 A;  4IPA A;  2GGB A;  4PNC A;  2B3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...