4S2RP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
617
structure length
615
Chain Sequence
HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Protein APP-1
total genus 213
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2rP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2rP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2rP03
4IKUA 2BWXA 2GG2A 2BHBA 3IL0A 2P98A 5D6EA 3OOOA 2BWYA 2EVCA 2BWUA 4U6CA 1WN1A 2GU7A 4KM3A 2P99A 1WKMA 2GU4A 5CE6A 4U70A 1BN5A 3PKCA 2GG9A 4MATA 2GU6A 2BWSA 5CDVA 1CHMA 1N51A 4U71A 3IU8A 1O0XA 3BIPA 1C23A 2B3LA 2GZ5A 4IECA 2GG3A 2GG8A 4FLJA 4PV4A 1KQ0A 4A6VA 1B6AA 5CNXA 4RGZ1 2BWVA 1WBQA 2V3YA 1R5HA 1XGSA 4R60A 3MATA 1YVMA 2V3XA 1W7VA 5CLSA 1XGMA 3FMQA 2P9AA 2BWWA 4IDYA 3FMRA 2Q94A 1QXWA 3L24A 2B3KA 4RZYA 4FO8A 4QR8A 3IU9A 2BH3A 5E2CA 1KQ9A 4ZWOA 5E5BA 1MATA 2NQ6A 4HXXA 5D6FA 1YW9A 4RZZA 1R5GA 2BWTA 4FLIA 1C27A 4IKSA 4U1BA 4ZWUA 2BHCA 4A6WA 2BN7A 4Z7MA 4U76A 3PN9A 1C22A 2DFIA 2Q96A 3IG4A 2GU5A 3TB5A 1M35A 2Q95A 4IF7A 3PKEA 3QOCA 2OKNA 3S6BA 3PKBA 3CB5A 3PKAA 1XNZA 1YW8A 1YW7A 4FLKA 5FCHA 2V3ZA 5JHUA 2V6CA 3CTZA 4JUQA 5JFRA 2GG5A 2GGCA 4U69A 2EVOA 2NQ7A 4ZWPA 2ADUA 1PV9A 4PNCA 3IU7A 1A16A 2GA2A 5CDLA 2EA4A 4U6JA 1BOAA 2MATA 4FKCA 3L7GA 4U6ZA 1C21A 2BHAA 2BB7A 2GG0A 4FO7A 2G6PA 3MR1A 3OVKA 4OOKA 3BITA 2OAZA 2EA2A 4U75A 1B59A 1W2MA 5FCFA 1QXZA 2B3HA 3I7MA 3FM3A 1QXYA 5CIKA 4S01A 2Q92A 1XGNA 2GGBA 1WLRA 2HOWA 3D27A 3RVAA 4IKRA 4S00A 1YJ3A 1WL9A 2IW2A 1KP0A 3PKDA 1JAWA 1WY2A 3Q6DA 5CDEA 4ZNGA 2Q93A 4FLLA 4EGEA 4FUKA 4IPAA 4IU6A 2GTXA 4U73A 2GG7A 1QZYA 1C24A 2BHDA 4B28A 3RORA 3MX6A 4U6EA 3BIQA 2ZSGA 3O5VA 4S2RP 4U6WA 1Y1NA 2Q8KA 3CB6A 2EVMA 4IKTA 1R58A 1XGOA 5JI6A 4S2TP 1WL6A 3TAVA 3PEBA
chains in the Genus database with same CATH superfamily
4IKUA 2BWXA 2GG2A 2BHBA 3IL0A 2P98A 5D6EA 3OOOA 2BWYA 2EVCA 2BWUA 4U6CA 1WN1A 2GU7A 4KM3A 2P99A 1WKMA 2GU4A 5CE6A 4U70A 1BN5A 3PKCA 2GG9A 4MATA 2GU6A 2BWSA 5CDVA 1CHMA 1N51A 4U71A 3IU8A 1O0XA 3BIPA 1C23A 2B3LA 2GZ5A 4IECA 2GG3A 2GG8A 4FLJA 4PV4A 1KQ0A 4A6VA 1B6AA 5CNXA 4RGZ1 2BWVA 1WBQA 2V3YA 1R5HA 1XGSA 4R60A 3MATA 1YVMA 2V3XA 1W7VA 5CLSA 1XGMA 3FMQA 2P9AA 2BWWA 4IDYA 3FMRA 2Q94A 1QXWA 3L24A 2B3KA 4RZYA 4FO8A 4QR8A 3IU9A 2BH3A 5E2CA 1KQ9A 4ZWOA 5E5BA 1MATA 2NQ6A 4HXXA 5D6FA 1YW9A 4RZZA 1R5GA 2BWTA 4FLIA 1C27A 4IKSA 4U1BA 4ZWUA 2BHCA 4A6WA 2BN7A 4Z7MA 4U76A 3PN9A 1C22A 2DFIA 2Q96A 3IG4A 2GU5A 3TB5A 1M35A 2Q95A 4IF7A 3PKEA 3QOCA 2OKNA 3S6BA 3PKBA 3CB5A 3PKAA 1XNZA 1YW8A 1YW7A 4FLKA 5FCHA 2V3ZA 5JHUA 2V6CA 3CTZA 4JUQA 5JFRA 2GG5A 2GGCA 4U69A 2EVOA 2NQ7A 4ZWPA 2ADUA 1PV9A 4PNCA 3IU7A 1A16A 2GA2A 5CDLA 2EA4A 4U6JA 1BOAA 2MATA 4FKCA 3L7GA 4U6ZA 1C21A 2BHAA 2BB7A 2GG0A 4FO7A 2G6PA 3MR1A 3OVKA 4OOKA 3BITA 2OAZA 2EA2A 4U75A 1B59A 1W2MA 5FCFA 1QXZA 2B3HA 3I7MA 3FM3A 1QXYA 5CIKA 4S01A 2Q92A 1XGNA 2GGBA 1WLRA 2HOWA 3D27A 3RVAA 4IKRA 4S00A 1YJ3A 1WL9A 2IW2A 1KP0A 3PKDA 1JAWA 1WY2A 3Q6DA 5CDEA 4ZNGA 2Q93A 4FLLA 4EGEA 4FUKA 4IPAA 4IU6A 2GTXA 4U73A 2GG7A 1QZYA 1C24A 2BHDA 4B28A 3RORA 3MX6A 4U6EA 3BIQA 2ZSGA 3O5VA 4S2RP 4U6WA 1Y1NA 2Q8KA 3CB6A 2EVMA 4IKTA 1R58A 1XGOA 5JI6A 4S2TP 1WL6A 3TAVA 3PEBA
chains in the Genus database with same CATH topology
4IKUA 2BWXA 2GG2A 2BHBA 3IL0A 2P98A 5D6EA 3OOOA 2BWYA 2EVCA 2BWUA 4U6CA 1WN1A 2GU7A 4KM3A 2P99A 1WKMA 2GU4A 5CE6A 4U70A 1BN5A 3PKCA 2GG9A 4MATA 2GU6A 2BWSA 5CDVA 1CHMA 1N51A 4U71A 3IU8A 1O0XA 3BIPA 1C23A 2B3LA 2GZ5A 4IECA 2GG3A 2GG8A 4FLJA 4PV4A 1KQ0A 4A6VA 1B6AA 5CNXA 4RGZ1 2BWVA 1WBQA 2V3YA 1R5HA 1XGSA 4R60A 3MATA 1YVMA 2V3XA 1W7VA 5CLSA 1XGMA 3FMQA 2P9AA 2BWWA 4IDYA 3FMRA 2Q94A 1QXWA 3L24A 2B3KA 4RZYA 4FO8A 4QR8A 3IU9A 2BH3A 5E2CA 1KQ9A 4ZWOA 5E5BA 1MATA 2NQ6A 4HXXA 5D6FA 1YW9A 4RZZA 1R5GA 2BWTA 4FLIA 1C27A 4IKSA 4U1BA 4ZWUA 2BHCA 4A6WA 2BN7A 4Z7MA 4U76A 3PN9A 1C22A 2DFIA 2Q96A 3IG4A 2GU5A 3TB5A 1M35A 2Q95A 4IF7A 3PKEA 3QOCA 2OKNA 3S6BA 3PKBA 3CB5A 3PKAA 1XNZA 1YW8A 1YW7A 4FLKA 5FCHA 2V3ZA 5JHUA 2V6CA 3CTZA 4JUQA 5JFRA 2GG5A 2GGCA 4U69A 2EVOA 2NQ7A 4ZWPA 2ADUA 1PV9A 4PNCA 3IU7A 1A16A 2GA2A 5CDLA 2EA4A 4U6JA 1BOAA 2MATA 4FKCA 3L7GA 4U6ZA 1C21A 2BHAA 2BB7A 2GG0A 4FO7A 2G6PA 3MR1A 3OVKA 4OOKA 3BITA 2OAZA 2EA2A 4U75A 1B59A 1W2MA 5FCFA 1QXZA 2B3HA 3I7MA 3FM3A 1QXYA 5CIKA 4S01A 2Q92A 1XGNA 2GGBA 1WLRA 2HOWA 3D27A 3RVAA 4IKRA 4S00A 1YJ3A 1WL9A 2IW2A 1KP0A 3PKDA 1JAWA 1WY2A 3Q6DA 5CDEA 4ZNGA 2Q93A 4FLLA 4EGEA 4FUKA 4IPAA 4IU6A 2GTXA 4U73A 2GG7A 1QZYA 1C24A 2BHDA 4B28A 3RORA 3MX6A 4U6EA 3BIQA 2ZSGA 3O5VA 4S2RP 4U6WA 1Y1NA 2Q8KA 3CB6A 2EVMA 4IKTA 1R58A 1XGOA 5JI6A 4S2TP 1WL6A 3TAVA 3PEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKU A;  2BWX A;  2GG2 A;  2BHB A;  3IL0 A;  2P98 A;  5D6E A;  3OOO A;  2BWY A;  2EVC A;  2BWU A;  4U6C A;  1WN1 A;  2GU7 A;  4KM3 A;  2P99 A;  1WKM A;  2GU4 A;  5CE6 A;  4U70 A;  1BN5 A;  3PKC A;  2GG9 A;  4MAT A;  2GU6 A;  2BWS A;  5CDV A;  1CHM A;  1N51 A;  4U71 A;  3IU8 A;  1O0X A;  3BIP A;  1C23 A;  2B3L A;  2GZ5 A;  4IEC A;  2GG3 A;  2GG8 A;  4FLJ A;  4PV4 A;  1KQ0 A;  4A6V A;  1B6A A;  5CNX A;  4RGZ 1;  2BWV A;  1WBQ A;  2V3Y A;  1R5H A;  1XGS A;  4R60 A;  3MAT A;  1YVM A;  2V3X A;  1W7V A;  5CLS A;  1XGM A;  3FMQ A;  2P9A A;  2BWW A;  4IDY A;  3FMR A;  2Q94 A;  1QXW A;  3L24 A;  2B3K A;  4RZY A;  4FO8 A;  4QR8 A;  3IU9 A;  2BH3 A;  5E2C A;  1KQ9 A;  4ZWO A;  5E5B A;  1MAT A;  2NQ6 A;  4HXX A;  5D6F A;  1YW9 A;  4RZZ A;  1R5G A;  2BWT A;  4FLI A;  1C27 A;  4IKS A;  4U1B A;  4ZWU A;  2BHC A;  4A6W A;  2BN7 A;  4Z7M A;  4U76 A;  3PN9 A;  1C22 A;  2DFI A;  2Q96 A;  3IG4 A;  2GU5 A;  3TB5 A;  1M35 A;  2Q95 A;  4IF7 A;  3PKE A;  3QOC A;  2OKN A;  3S6B A;  3PKB A;  3CB5 A;  3PKA A;  1XNZ A;  1YW8 A;  1YW7 A;  4FLK A;  5FCH A;  2V3Z A;  5JHU A;  2V6C A;  3CTZ A;  4JUQ A;  5JFR A;  2GG5 A;  2GGC A;  4U69 A;  2EVO A;  2NQ7 A;  4ZWP A;  2ADU A;  1PV9 A;  4PNC A;  3IU7 A;  1A16 A;  2GA2 A;  5CDL A;  2EA4 A;  4U6J A;  1BOA A;  2MAT A;  4FKC A;  3L7G A;  4U6Z A;  1C21 A;  2BHA A;  2BB7 A;  2GG0 A;  4FO7 A;  2G6P A;  3MR1 A;  3OVK A;  4OOK A;  3BIT A;  2OAZ A;  2EA2 A;  4U75 A;  1B59 A;  1W2M A;  5FCF A;  1QXZ A;  2B3H A;  3I7M A;  3FM3 A;  1QXY A;  5CIK A;  4S01 A;  2Q92 A;  1XGN A;  2GGB A;  1WLR A;  2HOW A;  3D27 A;  3RVA A;  4IKR A;  4S00 A;  1YJ3 A;  1WL9 A;  2IW2 A;  1KP0 A;  3PKD A;  1JAW A;  1WY2 A;  3Q6D A;  5CDE A;  4ZNG A;  2Q93 A;  4FLL A;  4EGE A;  4FUK A;  4IPA A;  4IU6 A;  2GTX A;  4U73 A;  2GG7 A;  1QZY A;  1C24 A;  2BHD A;  4B28 A;  3ROR A;  3MX6 A;  4U6E A;  3BIQ A;  2ZSG A;  3O5V A;  4S2R P;  4U6W A;  1Y1N A;  2Q8K A;  3CB6 A;  2EVM A;  4IKT A;  1R58 A;  1XGO A;  5JI6 A;  4S2T P;  1WL6 A;  3TAV A;  3PEB A; 
#chains in the Genus database with same CATH topology
 4IKU A;  2BWX A;  2GG2 A;  2BHB A;  3IL0 A;  2P98 A;  5D6E A;  3OOO A;  2BWY A;  2EVC A;  2BWU A;  4U6C A;  1WN1 A;  2GU7 A;  4KM3 A;  2P99 A;  1WKM A;  2GU4 A;  5CE6 A;  4U70 A;  1BN5 A;  3PKC A;  2GG9 A;  4MAT A;  2GU6 A;  2BWS A;  5CDV A;  1CHM A;  1N51 A;  4U71 A;  3IU8 A;  1O0X A;  3BIP A;  1C23 A;  2B3L A;  2GZ5 A;  4IEC A;  2GG3 A;  2GG8 A;  4FLJ A;  4PV4 A;  1KQ0 A;  4A6V A;  1B6A A;  5CNX A;  4RGZ 1;  2BWV A;  1WBQ A;  2V3Y A;  1R5H A;  1XGS A;  4R60 A;  3MAT A;  1YVM A;  2V3X A;  1W7V A;  5CLS A;  1XGM A;  3FMQ A;  2P9A A;  2BWW A;  4IDY A;  3FMR A;  2Q94 A;  1QXW A;  3L24 A;  2B3K A;  4RZY A;  4FO8 A;  4QR8 A;  3IU9 A;  2BH3 A;  5E2C A;  1KQ9 A;  4ZWO A;  5E5B A;  1MAT A;  2NQ6 A;  4HXX A;  5D6F A;  1YW9 A;  4RZZ A;  1R5G A;  2BWT A;  4FLI A;  1C27 A;  4IKS A;  4U1B A;  4ZWU A;  2BHC A;  4A6W A;  2BN7 A;  4Z7M A;  4U76 A;  3PN9 A;  1C22 A;  2DFI A;  2Q96 A;  3IG4 A;  2GU5 A;  3TB5 A;  1M35 A;  2Q95 A;  4IF7 A;  3PKE A;  3QOC A;  2OKN A;  3S6B A;  3PKB A;  3CB5 A;  3PKA A;  1XNZ A;  1YW8 A;  1YW7 A;  4FLK A;  5FCH A;  2V3Z A;  5JHU A;  2V6C A;  3CTZ A;  4JUQ A;  5JFR A;  2GG5 A;  2GGC A;  4U69 A;  2EVO A;  2NQ7 A;  4ZWP A;  2ADU A;  1PV9 A;  4PNC A;  3IU7 A;  1A16 A;  2GA2 A;  5CDL A;  2EA4 A;  4U6J A;  1BOA A;  2MAT A;  4FKC A;  3L7G A;  4U6Z A;  1C21 A;  2BHA A;  2BB7 A;  2GG0 A;  4FO7 A;  2G6P A;  3MR1 A;  3OVK A;  4OOK A;  3BIT A;  2OAZ A;  2EA2 A;  4U75 A;  1B59 A;  1W2M A;  5FCF A;  1QXZ A;  2B3H A;  3I7M A;  3FM3 A;  1QXY A;  5CIK A;  4S01 A;  2Q92 A;  1XGN A;  2GGB A;  1WLR A;  2HOW A;  3D27 A;  3RVA A;  4IKR A;  4S00 A;  1YJ3 A;  1WL9 A;  2IW2 A;  1KP0 A;  3PKD A;  1JAW A;  1WY2 A;  3Q6D A;  5CDE A;  4ZNG A;  2Q93 A;  4FLL A;  4EGE A;  4FUK A;  4IPA A;  4IU6 A;  2GTX A;  4U73 A;  2GG7 A;  1QZY A;  1C24 A;  2BHD A;  4B28 A;  3ROR A;  3MX6 A;  4U6E A;  3BIQ A;  2ZSG A;  3O5V A;  4S2R P;  4U6W A;  1Y1N A;  2Q8K A;  3CB6 A;  2EVM A;  4IKT A;  1R58 A;  1XGO A;  5JI6 A;  4S2T P;  1WL6 A;  3TAV A;  3PEB A; 
#chains in the Genus database with same CATH homology
 4IKU A;  2BWX A;  2GG2 A;  2BHB A;  3IL0 A;  2P98 A;  5D6E A;  3OOO A;  2BWY A;  2EVC A;  2BWU A;  4U6C A;  1WN1 A;  2GU7 A;  4KM3 A;  2P99 A;  1WKM A;  2GU4 A;  5CE6 A;  4U70 A;  1BN5 A;  3PKC A;  2GG9 A;  4MAT A;  2GU6 A;  2BWS A;  5CDV A;  1CHM A;  1N51 A;  4U71 A;  3IU8 A;  1O0X A;  3BIP A;  1C23 A;  2B3L A;  2GZ5 A;  4IEC A;  2GG3 A;  2GG8 A;  4FLJ A;  4PV4 A;  1KQ0 A;  4A6V A;  1B6A A;  5CNX A;  4RGZ 1;  2BWV A;  1WBQ A;  2V3Y A;  1R5H A;  1XGS A;  4R60 A;  3MAT A;  1YVM A;  2V3X A;  1W7V A;  5CLS A;  1XGM A;  3FMQ A;  2P9A A;  2BWW A;  4IDY A;  3FMR A;  2Q94 A;  1QXW A;  3L24 A;  2B3K A;  4RZY A;  4FO8 A;  4QR8 A;  3IU9 A;  2BH3 A;  5E2C A;  1KQ9 A;  4ZWO A;  5E5B A;  1MAT A;  2NQ6 A;  4HXX A;  5D6F A;  1YW9 A;  4RZZ A;  1R5G A;  2BWT A;  4FLI A;  1C27 A;  4IKS A;  4U1B A;  4ZWU A;  2BHC A;  4A6W A;  2BN7 A;  4Z7M A;  4U76 A;  3PN9 A;  1C22 A;  2DFI A;  2Q96 A;  3IG4 A;  2GU5 A;  3TB5 A;  1M35 A;  2Q95 A;  4IF7 A;  3PKE A;  3QOC A;  2OKN A;  3S6B A;  3PKB A;  3CB5 A;  3PKA A;  1XNZ A;  1YW8 A;  1YW7 A;  4FLK A;  5FCH A;  2V3Z A;  5JHU A;  2V6C A;  3CTZ A;  4JUQ A;  5JFR A;  2GG5 A;  2GGC A;  4U69 A;  2EVO A;  2NQ7 A;  4ZWP A;  2ADU A;  1PV9 A;  4PNC A;  3IU7 A;  1A16 A;  2GA2 A;  5CDL A;  2EA4 A;  4U6J A;  1BOA A;  2MAT A;  4FKC A;  3L7G A;  4U6Z A;  1C21 A;  2BHA A;  2BB7 A;  2GG0 A;  4FO7 A;  2G6P A;  3MR1 A;  3OVK A;  4OOK A;  3BIT A;  2OAZ A;  2EA2 A;  4U75 A;  1B59 A;  1W2M A;  5FCF A;  1QXZ A;  2B3H A;  3I7M A;  3FM3 A;  1QXY A;  5CIK A;  4S01 A;  2Q92 A;  1XGN A;  2GGB A;  1WLR A;  2HOW A;  3D27 A;  3RVA A;  4IKR A;  4S00 A;  1YJ3 A;  1WL9 A;  2IW2 A;  1KP0 A;  3PKD A;  1JAW A;  1WY2 A;  3Q6D A;  5CDE A;  4ZNG A;  2Q93 A;  4FLL A;  4EGE A;  4FUK A;  4IPA A;  4IU6 A;  2GTX A;  4U73 A;  2GG7 A;  1QZY A;  1C24 A;  2BHD A;  4B28 A;  3ROR A;  3MX6 A;  4U6E A;  3BIQ A;  2ZSG A;  3O5V A;  4S2R P;  4U6W A;  1Y1N A;  2Q8K A;  3CB6 A;  2EVM A;  4IKT A;  1R58 A;  1XGO A;  5JI6 A;  4S2T P;  1WL6 A;  3TAV A;  3PEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...