4S2RP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
617
structure length
615
Chain Sequence
HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Protein APP-1
total genus 213
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2rP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2rP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2rP03
4ZNGA 5JHUA 4R60A 2BHAA 1YVMA 4U6ZA 3PN9A 3O5VA 2G6PA 2BHBA 1C24A 2GGCA 2BWXA 4EGEA 5FCFA 1KQ9A 2EVOA 2Q94A 1QXWA 4U75A 1M35A 2V6CA 4JUQA 2EA4A 2BHCA 4ZWUA 4PNCA 4IKUA 4FLKA 2BWYA 4FLJA 2NQ7A 4S2RP 3IU7A 2OKNA 2Q92A 2GG3A 4IKTA 4FO7A 1N51A 1YW9A 2B3LA 2GU4A 1QXZA 1W2MA 5CLSA 2MATA 1KQ0A 3CB5A 4ZWOA 1R5HA 3IU9A 2IW2A 4U73A 5CDVA 4B28A 2BWUA 1YW8A 2OAZA 2BH3A 4KM3A 2GTXA 1XGMA 1R58A 4U71A 4PV4A 2GG5A 5CIKA 2GG2A 1WL6A 2ADUA 3FMQA 4IDYA 3S6BA 3PKDA 3TB5A 1WLRA 3QOCA 3I7MA 4U69A 2NQ6A 2Q8KA 5CDLA 5E5BA 4IPAA 5FCHA 3RVAA 2GG0A 3CB6A 2Q96A 3FMRA 3D27A 1B59A 2BWTA 2GG8A 3PKEA 1C27A 2P9AA 1WN1A 2GU7A 5JFRA 1WBQA 1QXYA 4QR8A 1YW7A 2BWVA 3BITA 4Z7MA 5JI6A 1XGNA 1C21A 5E2CA 3BIPA 4IECA 1XGSA 5CDEA 3CTZA 1YJ3A 4U70A 1R5GA 1WL9A 4U6WA 3IG4A 4A6VA 4IF7A 3OVKA 3OOOA 2B3HA 3MR1A 4U6EA 2GZ5A 1C22A 2EVCA 4RGZ1 4RZYA 3RORA 1QZYA 4S01A 2B3KA 5CE6A 4OOKA 4HXXA 2BN7A 1PV9A 3IU8A 1O0XA 2DFIA 4U1BA 3L24A 2GA2A 2V3XA 1A16A 4IU6A 3PEBA 1XGOA 4FKCA 1KP0A 5CNXA 4MATA 3MX6A 1B6AA 2EVMA 2V3ZA 4FLIA 1W7VA 4FO8A 1BN5A 2Q93A 2GU6A 3PKBA 4U6CA 3Q6DA 4IKSA 2GGBA 2BWSA 1MATA 2V3YA 3PKCA 4U6JA 2BB7A 4S2TP 1JAWA 5D6FA 2EA2A 1C23A 3MATA 1BOAA 2BHDA 2P98A 2HOWA 2P99A 4A6WA 1XNZA 3TAVA 3BIQA 3FM3A 1WKMA 2GG9A 4IKRA 4ZWPA 5D6EA 4FUKA 1CHMA 4RZZA 4S00A 2BWWA 1Y1NA 1WY2A 2ZSGA 2GG7A 2Q95A 3PKAA 3IL0A 4U76A 3L7GA 2GU5A 4FLLA
chains in the Genus database with same CATH superfamily
4ZNGA 5JHUA 4R60A 2BHAA 1YVMA 4U6ZA 3PN9A 3O5VA 2G6PA 2BHBA 1C24A 2GGCA 2BWXA 4EGEA 5FCFA 1KQ9A 2EVOA 2Q94A 1QXWA 4U75A 1M35A 2V6CA 4JUQA 2EA4A 2BHCA 4ZWUA 4PNCA 4IKUA 4FLKA 2BWYA 4FLJA 2NQ7A 4S2RP 3IU7A 2OKNA 2Q92A 2GG3A 4IKTA 4FO7A 1N51A 1YW9A 2B3LA 2GU4A 1QXZA 1W2MA 5CLSA 2MATA 1KQ0A 3CB5A 4ZWOA 1R5HA 3IU9A 2IW2A 4U73A 5CDVA 4B28A 2BWUA 1YW8A 2OAZA 2BH3A 4KM3A 2GTXA 1XGMA 1R58A 4U71A 4PV4A 2GG5A 5CIKA 2GG2A 1WL6A 2ADUA 3FMQA 4IDYA 3S6BA 3PKDA 3TB5A 1WLRA 3QOCA 3I7MA 4U69A 2NQ6A 2Q8KA 5CDLA 5E5BA 4IPAA 5FCHA 3RVAA 2GG0A 3CB6A 2Q96A 3FMRA 3D27A 1B59A 2BWTA 2GG8A 3PKEA 1C27A 2P9AA 1WN1A 2GU7A 5JFRA 1WBQA 1QXYA 4QR8A 1YW7A 2BWVA 3BITA 4Z7MA 5JI6A 1XGNA 1C21A 5E2CA 3BIPA 4IECA 1XGSA 5CDEA 3CTZA 1YJ3A 4U70A 1R5GA 1WL9A 4U6WA 3IG4A 4A6VA 4IF7A 3OVKA 3OOOA 2B3HA 3MR1A 4U6EA 2GZ5A 1C22A 2EVCA 4RGZ1 4RZYA 3RORA 1QZYA 4S01A 2B3KA 5CE6A 4OOKA 4HXXA 2BN7A 1PV9A 3IU8A 1O0XA 2DFIA 4U1BA 3L24A 2GA2A 2V3XA 1A16A 4IU6A 3PEBA 1XGOA 4FKCA 1KP0A 5CNXA 4MATA 3MX6A 1B6AA 2EVMA 2V3ZA 4FLIA 1W7VA 4FO8A 1BN5A 2Q93A 2GU6A 3PKBA 4U6CA 3Q6DA 4IKSA 2GGBA 2BWSA 1MATA 2V3YA 3PKCA 4U6JA 2BB7A 4S2TP 1JAWA 5D6FA 2EA2A 1C23A 3MATA 1BOAA 2BHDA 2P98A 2HOWA 2P99A 4A6WA 1XNZA 3TAVA 3BIQA 3FM3A 1WKMA 2GG9A 4IKRA 4ZWPA 5D6EA 4FUKA 1CHMA 4RZZA 4S00A 2BWWA 1Y1NA 1WY2A 2ZSGA 2GG7A 2Q95A 3PKAA 3IL0A 4U76A 3L7GA 2GU5A 4FLLA
chains in the Genus database with same CATH topology
4ZNGA 5JHUA 4R60A 2BHAA 1YVMA 4U6ZA 3PN9A 3O5VA 2G6PA 2BHBA 1C24A 2GGCA 2BWXA 4EGEA 5FCFA 1KQ9A 2EVOA 2Q94A 1QXWA 4U75A 1M35A 2V6CA 4JUQA 2EA4A 2BHCA 4ZWUA 4PNCA 4IKUA 4FLKA 2BWYA 4FLJA 2NQ7A 4S2RP 3IU7A 2OKNA 2Q92A 2GG3A 4IKTA 4FO7A 1N51A 1YW9A 2B3LA 2GU4A 1QXZA 1W2MA 5CLSA 2MATA 1KQ0A 3CB5A 4ZWOA 1R5HA 3IU9A 2IW2A 4U73A 5CDVA 4B28A 2BWUA 1YW8A 2OAZA 2BH3A 4KM3A 2GTXA 1XGMA 1R58A 4U71A 4PV4A 2GG5A 5CIKA 2GG2A 1WL6A 2ADUA 3FMQA 4IDYA 3S6BA 3PKDA 3TB5A 1WLRA 3QOCA 3I7MA 4U69A 2NQ6A 2Q8KA 5CDLA 5E5BA 4IPAA 5FCHA 3RVAA 2GG0A 3CB6A 2Q96A 3FMRA 3D27A 1B59A 2BWTA 2GG8A 3PKEA 1C27A 2P9AA 1WN1A 2GU7A 5JFRA 1WBQA 1QXYA 4QR8A 1YW7A 2BWVA 3BITA 4Z7MA 5JI6A 1XGNA 1C21A 5E2CA 3BIPA 4IECA 1XGSA 5CDEA 3CTZA 1YJ3A 4U70A 1R5GA 1WL9A 4U6WA 3IG4A 4A6VA 4IF7A 3OVKA 3OOOA 2B3HA 3MR1A 4U6EA 2GZ5A 1C22A 2EVCA 4RGZ1 4RZYA 3RORA 1QZYA 4S01A 2B3KA 5CE6A 4OOKA 4HXXA 2BN7A 1PV9A 3IU8A 1O0XA 2DFIA 4U1BA 3L24A 2GA2A 2V3XA 1A16A 4IU6A 3PEBA 1XGOA 4FKCA 1KP0A 5CNXA 4MATA 3MX6A 1B6AA 2EVMA 2V3ZA 4FLIA 1W7VA 4FO8A 1BN5A 2Q93A 2GU6A 3PKBA 4U6CA 3Q6DA 4IKSA 2GGBA 2BWSA 1MATA 2V3YA 3PKCA 4U6JA 2BB7A 4S2TP 1JAWA 5D6FA 2EA2A 1C23A 3MATA 1BOAA 2BHDA 2P98A 2HOWA 2P99A 4A6WA 1XNZA 3TAVA 3BIQA 3FM3A 1WKMA 2GG9A 4IKRA 4ZWPA 5D6EA 4FUKA 1CHMA 4RZZA 4S00A 2BWWA 1Y1NA 1WY2A 2ZSGA 2GG7A 2Q95A 3PKAA 3IL0A 4U76A 3L7GA 2GU5A 4FLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZNG A;  5JHU A;  4R60 A;  2BHA A;  1YVM A;  4U6Z A;  3PN9 A;  3O5V A;  2G6P A;  2BHB A;  1C24 A;  2GGC A;  2BWX A;  4EGE A;  5FCF A;  1KQ9 A;  2EVO A;  2Q94 A;  1QXW A;  4U75 A;  1M35 A;  2V6C A;  4JUQ A;  2EA4 A;  2BHC A;  4ZWU A;  4PNC A;  4IKU A;  4FLK A;  2BWY A;  4FLJ A;  2NQ7 A;  4S2R P;  3IU7 A;  2OKN A;  2Q92 A;  2GG3 A;  4IKT A;  4FO7 A;  1N51 A;  1YW9 A;  2B3L A;  2GU4 A;  1QXZ A;  1W2M A;  5CLS A;  2MAT A;  1KQ0 A;  3CB5 A;  4ZWO A;  1R5H A;  3IU9 A;  2IW2 A;  4U73 A;  5CDV A;  4B28 A;  2BWU A;  1YW8 A;  2OAZ A;  2BH3 A;  4KM3 A;  2GTX A;  1XGM A;  1R58 A;  4U71 A;  4PV4 A;  2GG5 A;  5CIK A;  2GG2 A;  1WL6 A;  2ADU A;  3FMQ A;  4IDY A;  3S6B A;  3PKD A;  3TB5 A;  1WLR A;  3QOC A;  3I7M A;  4U69 A;  2NQ6 A;  2Q8K A;  5CDL A;  5E5B A;  4IPA A;  5FCH A;  3RVA A;  2GG0 A;  3CB6 A;  2Q96 A;  3FMR A;  3D27 A;  1B59 A;  2BWT A;  2GG8 A;  3PKE A;  1C27 A;  2P9A A;  1WN1 A;  2GU7 A;  5JFR A;  1WBQ A;  1QXY A;  4QR8 A;  1YW7 A;  2BWV A;  3BIT A;  4Z7M A;  5JI6 A;  1XGN A;  1C21 A;  5E2C A;  3BIP A;  4IEC A;  1XGS A;  5CDE A;  3CTZ A;  1YJ3 A;  4U70 A;  1R5G A;  1WL9 A;  4U6W A;  3IG4 A;  4A6V A;  4IF7 A;  3OVK A;  3OOO A;  2B3H A;  3MR1 A;  4U6E A;  2GZ5 A;  1C22 A;  2EVC A;  4RGZ 1;  4RZY A;  3ROR A;  1QZY A;  4S01 A;  2B3K A;  5CE6 A;  4OOK A;  4HXX A;  2BN7 A;  1PV9 A;  3IU8 A;  1O0X A;  2DFI A;  4U1B A;  3L24 A;  2GA2 A;  2V3X A;  1A16 A;  4IU6 A;  3PEB A;  1XGO A;  4FKC A;  1KP0 A;  5CNX A;  4MAT A;  3MX6 A;  1B6A A;  2EVM A;  2V3Z A;  4FLI A;  1W7V A;  4FO8 A;  1BN5 A;  2Q93 A;  2GU6 A;  3PKB A;  4U6C A;  3Q6D A;  4IKS A;  2GGB A;  2BWS A;  1MAT A;  2V3Y A;  3PKC A;  4U6J A;  2BB7 A;  4S2T P;  1JAW A;  5D6F A;  2EA2 A;  1C23 A;  3MAT A;  1BOA A;  2BHD A;  2P98 A;  2HOW A;  2P99 A;  4A6W A;  1XNZ A;  3TAV A;  3BIQ A;  3FM3 A;  1WKM A;  2GG9 A;  4IKR A;  4ZWP A;  5D6E A;  4FUK A;  1CHM A;  4RZZ A;  4S00 A;  2BWW A;  1Y1N A;  1WY2 A;  2ZSG A;  2GG7 A;  2Q95 A;  3PKA A;  3IL0 A;  4U76 A;  3L7G A;  2GU5 A;  4FLL A; 
#chains in the Genus database with same CATH topology
 4ZNG A;  5JHU A;  4R60 A;  2BHA A;  1YVM A;  4U6Z A;  3PN9 A;  3O5V A;  2G6P A;  2BHB A;  1C24 A;  2GGC A;  2BWX A;  4EGE A;  5FCF A;  1KQ9 A;  2EVO A;  2Q94 A;  1QXW A;  4U75 A;  1M35 A;  2V6C A;  4JUQ A;  2EA4 A;  2BHC A;  4ZWU A;  4PNC A;  4IKU A;  4FLK A;  2BWY A;  4FLJ A;  2NQ7 A;  4S2R P;  3IU7 A;  2OKN A;  2Q92 A;  2GG3 A;  4IKT A;  4FO7 A;  1N51 A;  1YW9 A;  2B3L A;  2GU4 A;  1QXZ A;  1W2M A;  5CLS A;  2MAT A;  1KQ0 A;  3CB5 A;  4ZWO A;  1R5H A;  3IU9 A;  2IW2 A;  4U73 A;  5CDV A;  4B28 A;  2BWU A;  1YW8 A;  2OAZ A;  2BH3 A;  4KM3 A;  2GTX A;  1XGM A;  1R58 A;  4U71 A;  4PV4 A;  2GG5 A;  5CIK A;  2GG2 A;  1WL6 A;  2ADU A;  3FMQ A;  4IDY A;  3S6B A;  3PKD A;  3TB5 A;  1WLR A;  3QOC A;  3I7M A;  4U69 A;  2NQ6 A;  2Q8K A;  5CDL A;  5E5B A;  4IPA A;  5FCH A;  3RVA A;  2GG0 A;  3CB6 A;  2Q96 A;  3FMR A;  3D27 A;  1B59 A;  2BWT A;  2GG8 A;  3PKE A;  1C27 A;  2P9A A;  1WN1 A;  2GU7 A;  5JFR A;  1WBQ A;  1QXY A;  4QR8 A;  1YW7 A;  2BWV A;  3BIT A;  4Z7M A;  5JI6 A;  1XGN A;  1C21 A;  5E2C A;  3BIP A;  4IEC A;  1XGS A;  5CDE A;  3CTZ A;  1YJ3 A;  4U70 A;  1R5G A;  1WL9 A;  4U6W A;  3IG4 A;  4A6V A;  4IF7 A;  3OVK A;  3OOO A;  2B3H A;  3MR1 A;  4U6E A;  2GZ5 A;  1C22 A;  2EVC A;  4RGZ 1;  4RZY A;  3ROR A;  1QZY A;  4S01 A;  2B3K A;  5CE6 A;  4OOK A;  4HXX A;  2BN7 A;  1PV9 A;  3IU8 A;  1O0X A;  2DFI A;  4U1B A;  3L24 A;  2GA2 A;  2V3X A;  1A16 A;  4IU6 A;  3PEB A;  1XGO A;  4FKC A;  1KP0 A;  5CNX A;  4MAT A;  3MX6 A;  1B6A A;  2EVM A;  2V3Z A;  4FLI A;  1W7V A;  4FO8 A;  1BN5 A;  2Q93 A;  2GU6 A;  3PKB A;  4U6C A;  3Q6D A;  4IKS A;  2GGB A;  2BWS A;  1MAT A;  2V3Y A;  3PKC A;  4U6J A;  2BB7 A;  4S2T P;  1JAW A;  5D6F A;  2EA2 A;  1C23 A;  3MAT A;  1BOA A;  2BHD A;  2P98 A;  2HOW A;  2P99 A;  4A6W A;  1XNZ A;  3TAV A;  3BIQ A;  3FM3 A;  1WKM A;  2GG9 A;  4IKR A;  4ZWP A;  5D6E A;  4FUK A;  1CHM A;  4RZZ A;  4S00 A;  2BWW A;  1Y1N A;  1WY2 A;  2ZSG A;  2GG7 A;  2Q95 A;  3PKA A;  3IL0 A;  4U76 A;  3L7G A;  2GU5 A;  4FLL A; 
#chains in the Genus database with same CATH homology
 4ZNG A;  5JHU A;  4R60 A;  2BHA A;  1YVM A;  4U6Z A;  3PN9 A;  3O5V A;  2G6P A;  2BHB A;  1C24 A;  2GGC A;  2BWX A;  4EGE A;  5FCF A;  1KQ9 A;  2EVO A;  2Q94 A;  1QXW A;  4U75 A;  1M35 A;  2V6C A;  4JUQ A;  2EA4 A;  2BHC A;  4ZWU A;  4PNC A;  4IKU A;  4FLK A;  2BWY A;  4FLJ A;  2NQ7 A;  4S2R P;  3IU7 A;  2OKN A;  2Q92 A;  2GG3 A;  4IKT A;  4FO7 A;  1N51 A;  1YW9 A;  2B3L A;  2GU4 A;  1QXZ A;  1W2M A;  5CLS A;  2MAT A;  1KQ0 A;  3CB5 A;  4ZWO A;  1R5H A;  3IU9 A;  2IW2 A;  4U73 A;  5CDV A;  4B28 A;  2BWU A;  1YW8 A;  2OAZ A;  2BH3 A;  4KM3 A;  2GTX A;  1XGM A;  1R58 A;  4U71 A;  4PV4 A;  2GG5 A;  5CIK A;  2GG2 A;  1WL6 A;  2ADU A;  3FMQ A;  4IDY A;  3S6B A;  3PKD A;  3TB5 A;  1WLR A;  3QOC A;  3I7M A;  4U69 A;  2NQ6 A;  2Q8K A;  5CDL A;  5E5B A;  4IPA A;  5FCH A;  3RVA A;  2GG0 A;  3CB6 A;  2Q96 A;  3FMR A;  3D27 A;  1B59 A;  2BWT A;  2GG8 A;  3PKE A;  1C27 A;  2P9A A;  1WN1 A;  2GU7 A;  5JFR A;  1WBQ A;  1QXY A;  4QR8 A;  1YW7 A;  2BWV A;  3BIT A;  4Z7M A;  5JI6 A;  1XGN A;  1C21 A;  5E2C A;  3BIP A;  4IEC A;  1XGS A;  5CDE A;  3CTZ A;  1YJ3 A;  4U70 A;  1R5G A;  1WL9 A;  4U6W A;  3IG4 A;  4A6V A;  4IF7 A;  3OVK A;  3OOO A;  2B3H A;  3MR1 A;  4U6E A;  2GZ5 A;  1C22 A;  2EVC A;  4RGZ 1;  4RZY A;  3ROR A;  1QZY A;  4S01 A;  2B3K A;  5CE6 A;  4OOK A;  4HXX A;  2BN7 A;  1PV9 A;  3IU8 A;  1O0X A;  2DFI A;  4U1B A;  3L24 A;  2GA2 A;  2V3X A;  1A16 A;  4IU6 A;  3PEB A;  1XGO A;  4FKC A;  1KP0 A;  5CNX A;  4MAT A;  3MX6 A;  1B6A A;  2EVM A;  2V3Z A;  4FLI A;  1W7V A;  4FO8 A;  1BN5 A;  2Q93 A;  2GU6 A;  3PKB A;  4U6C A;  3Q6D A;  4IKS A;  2GGB A;  2BWS A;  1MAT A;  2V3Y A;  3PKC A;  4U6J A;  2BB7 A;  4S2T P;  1JAW A;  5D6F A;  2EA2 A;  1C23 A;  3MAT A;  1BOA A;  2BHD A;  2P98 A;  2HOW A;  2P99 A;  4A6W A;  1XNZ A;  3TAV A;  3BIQ A;  3FM3 A;  1WKM A;  2GG9 A;  4IKR A;  4ZWP A;  5D6E A;  4FUK A;  1CHM A;  4RZZ A;  4S00 A;  2BWW A;  1Y1N A;  1WY2 A;  2ZSG A;  2GG7 A;  2Q95 A;  3PKA A;  3IL0 A;  4U76 A;  3L7G A;  2GU5 A;  4FLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...