4S2SA

Crystal structure of fab fragment of monoclonal antibody roab13
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
224
structure length
219
Chain Sequence
EVQLQESGGGLVKPGGSLKLSCAASGFTFSTYAMSWVRQTPEKRLEWVASISTGDNTYYTDSVRGRFTISRDNARNILYLQMSSLRSEDTAMYFCTRGRGDRGDLFGYWGQGTLVTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords RoAb13 Fab Heavy chain
publication title A Linear Epitope in the N-Terminal Domain of CCR5 and Its Interaction with Antibody.
pubmed doi rcsb
total genus 45
structure length 219
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s2sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s2sA01
4JG0L 4JO2H 4HUWA 2CIIA 1TQBC 2Q8BL 5GGRY 1A6AA 5MEND 4YDKH 2A9MH 3U0PB 4RFOL 4JKMA 1F3JB 5CUSH 1VFBA 1AC6A 1CS6A 1NGYB 1TVHA 5DEFB 3B5HA 1MF2L 1S9YA 2IFFL 4Z95H 5HYFA 3UTTD 5IT2H 2ARWA 2B2XL 3MLRL 4Y19A 3UO1H 4KVNH 4E9LA 5DUMH 1LE9A 1A1OB 1T3FB 2QSCH 3WFBL 5IMMA 1QZ1A 3O3AA 4KKNA 4LHUD 4MJ5B 5LVEA 3VFRB 1FL6A 3IAGC 5EB9A 3CDYA 3T0XA 3DMMB 1B90A 3ARYA 2P24B 1EX0A 3MXVL 3VGHA 3FQWB 3DXAE 5F3HA 1I1FA 5MHSE 1TPXC 4BM7A 2KL6A 4M1CD 1I3GH 1B4RA 4XWGL 1ZGLM 5F7LB 2YN5A 3LEYH 4DW2H 4GBXD 1N2RA 3V4VH 4WIQA 3UBXI 1UM5H 5JHDB 3OTTA 2AGJH 2R39A 3O6LH 5IMLB 2W92A 4JFHD 1TDQA 3OR7B 3AY4C 5D72L 1WBYB 1D5ZB 4RMWA 4EUPH 5LGKA 3IETA 3MLSL 4NKMB 3FOMA 5DRXA 3NIDF 5I1KL 4WEBH 4ORGB 1MJJA 1NMCB 3QH3A 3ISWA 1CF8H 5GISL 4H0IA 4F9LA 2DQIH 3QZWB 4XVSH 3X12B 3SGKC 3BP5A 1QBML 4UT6L 5I1HH 4JPKH 4M6OH 1PZ5A 4F57H 4LAQL 5F93C 4UINL 4PS4H 1CXIA 5C71A 3TVMB 5FYKL 1HSAB 5E08L 2OXHA 1M7XA 1V3KA 2VZUA 3TIDB 1S5HB 4AQ1B 5B21A 2R1YB 2XKUA 1NLBL 1FVDA 3FB5B 5FV2A 1MCQA 4UOW0 3FQXA 4C83A 1DZBA 4M7ZB 3S5LG 1R3JA 5J11C 1CN4A 4J4PC 4M5YH 2NW3B 3QEQE 5ADOH 3VXRD 3BGMB 1HHJB 5D96C 4NNYA 1VKXA 2DMCA 3QUXD 3HZYA 1Q9KA 1TJGH 1MNUL 4XMPL 4FZ8H 4KTDH 1KYOJ 1F8TL 2W59A 2XNAA 5JXAL 1J7VR 1T89A 3IAQA 2HFGH 2DQDL 5IK3A 2MPAH 5KZCB 5L9DH 3BH9A 1KG0B 2Z92B 2IPUK 2BY1A 3MA9H 2AJVH 1FG9C 4RAVA 1P9MA 4M1DH 4U1JA 5MERA 1I1AA 4G8EB 3NFPA 2VIRA 5C0GB 2C3VB 1ROWA 3FMGH 3JV4B 3OKOA 1EXUB 4RMTA 4M02A 4HC1H 5TH2B 2DICA 1CG9B 2X4QA 1AD9A 4NHCL 2GJJA 1CGUA 2NPLX 2OZ4A 4L4VE 1ZS8A 3U7YH 1RQ5A 32C2A 3QO1A 2ZOLB 3RDTB 1G7JB 3E8UH 1URLA 3TZVC 4JAMB 4ETQB 4GH7B 3C8HA 5CBAA 1XF2A 3GMQB 4P4KA 3QIBB 2F8XC 1IILE 5CEXA 4NHUA 2DKSA 3WNMA 3CC5A 5C0AB 1CICC 2VXSL 5E70A 3PHQB 3IKCA 3U9UB 3SDCC 1BFTA 4E42B 1QNZH 3V79C 1ZHKB 2WBWB 4WFFD 3PWPA 1MJ8L 3BKML 4KWUA 2GHWB 3T0AA 3W0WD 3Q0HA 1NEZG 2X89D 4CVXB 2DDQL 5FK9B 5TF1H 1EVTC 1AGEA 5CIPB 3T0EC 4QTIH 4U0QB 3T3ME 5FYLE 4OZFA 3V0VA 4Q6IC 5C0RH 1FZOB 3VA6A 4EI5D 4G7VH 4KDTC 2PW1A 3GSVA 4JRXE 5I9QB 3VWJC 5IEKA 1AHWB 2QQLH 3BPCA 3JXAA 3KHOA 3QWOA 4IRSD 2ENYA 2ZG2A 4RA3A 1CD1B 5HI4D 3BQUC 5EUKA 1DBJL 5BRZB 5KVEL 3QCTH 4LPWA 2IPTH 3JBG7 4PJHE 4LPVA 1F4AA 4AEHH 5ILTL 2YZ1A 1V7ML 2XWTA 2A73A 3ULVE 4AT6A 1PFCA 2R9HD 4ZSOA 3EDJA 3MO1B 3EYUH 4PJGA 4IIQA 43C9B 2Z31B 1YY9C 1LD9B 1KOAA 5B4MC 5INCA 1AO7B 4EN3B 1E6JH 4J6RL 3GZKA 4H1LB 4PJCE 4U6YB 3FONB 1SBBA 4ODVL 4IJ3B 4GXUM 4EOWH 1EEYB 1I7RA 12E8L 1R5IB 1J11A 4JFDB 2BSRA 3MMEA 3QUKB 4V1DE 3LDBC 1DUZB 4YIQB 5D9SB 2A6DA 1MELA 4BH8B 1M4KA 4TNWK 4JVUA 3BKYH 3MTRA 1R3IL 2VXQH 3O6KL 4XPFH 3EUUA 4H5SB 1A6VL 1NAMA 4JM4H 3SDDC 5CGYD 3WNLA 4Y19D 4LEXH 3IT8D 4AMKL 1V3LA 1C5DA 2OJEA 5JW3H 2C3HA 1ZSDA 1B2WL 1RU9L 3ZDYF 3FCTA 2PW2B 2J3SA 1MJUH 3AU1B 2YRPA 5T5FH 1LILA 3MGOA 4HGMA 5IVZB 3TPKA 4JG1L 1GZPA 3EO0A 4GAYA 2HTKD 2UUDH 5F7YC 4R7NB 4XRCB 2FRGP 3TH2T 1MHCA 1UB6B 4Y16C 3ILPB 4GG6F 4PGDB 1RZJH 2NY1D 2ZCKH 3JV6A 1D5MA 1U92A 3GMPA 4Z7UE 4HJ0C 3WFDH 1BFOB 5JHLL 4LCWA 3V4UL 4ONOA 1IT9L 4DZBB 1C12A 2VDOL 3WS3A 1ERNA 1BBDL 1CL7L 1DQLH 3NGBC 2BX5A 3P9MA 3IF1B 1VDGA 1QR1B 1AGBA 1G9NC 4U1GB 4Z0XB 2A1WL 1AIFA 3RWFB 4Z7VA 1GAFL 4HWZB 2CXKA 2XZCH 1J9CT 5T3ZH 2WUCH 1IARB 3B9AA 3JUZA 3LEVL 5JR1L 4JFPB 4YE4L 4QRRE 4F8QA 1EV2E 4Y4HB 1I75A 1PJ9A 3RRQA 4LIQH 1S7WA 4UQ2B 2N4IA 4I48B 4X6FB 3S36H 5AYUL 3VWKD 3BUYB 2R56H 1MFCL 4HJJH 4JRYA 2QR0A 4LASL 4K23H 3V0AC 5LGJB 3GB7A 2VLLA 3CZFA 5CLWA 3RWDA 1I3RA 5FO7B 2HFEA 4XXCA 1ZANL 3R0MA 1YEJL 1JZ6A 1XGRB 1A5FL 1LO2H 2XKNB 4OT1H 5KW9L 4KROB 5GGTA 2UYLB 1U3HB 2FHFA 3P0YL 5ISZA 3MQIA 4EQ2A 3PE9A 1A7QL 4M7KH 4NN7B 4P2RD 1EBPA 4U05A 2FJFB 2FX9L 4LKXA 4Z76A 5ESQA 1I1AD 4OZGB 5K9KA 2I60L 3VXPB 2WWMD 4TOYH 1OAUL 3LIZH 3RNKB 1UM6L 5GS1A 1D6VL 5CGMA 4HUKB 5I1JL 4LSTH 5HHVH 4U6HA 3IFLH 2OBGA 2D31A 5IVXE 5D93C 2NY0B 4GG8B 5CP3A 3FRPA 1NLDL 2XICA 4I0PA 3WSQH 5TDNA 3U0TA 2DYPB 1AY1H 5FUCC 4F7PB 4H0GA 2YD4A 2EEDA 2JJTA 4TVPD 1DSFL 1X5GA 1SEBA 2FWOA 1H15A 1NKOA 1CXEA 5KS9E 2R4SH 3S4SG 4P4KD 1CFTA 4FQ2H 2O5XL 1F4WH 3KYKH 4JFQB 2EYSA 1RIHL 2HKFL 4WU5A 5GIRB 2BVQB 4HH9A 2VKXA 2EYRA 3SO3B 3PL6B 3NPSB 2CDEB 1ZE3C 3CVHL 4ONGH 1DQDL 2W0PA 4CNIB 1F6AA 2IADA 4JEGB 3LKRA 1QSFE 1FNFA 5JW5B 4KFZC 1SJXA 4MNGB 2GJZB 3BPLB 4NQCB 1UM4L 1IE5A 2BJML 1WBXA 4JHZA 3IDMB 2LU7A 3UPAA 3QFJB 3VD3A 3QUZC 4PRNB 3OAUL 1GVIA 5DYOA 1NCCL 2F53E 1TZIB 5FA4A 2VL5B 2F58H 5ACMA 4FFZL 3V9FA 3SE8L 2Q20A 4LK4A 4YFEA 4L29A 3VXOA 2BRRL 1MEXH 4TQEH 2O26U 2VZTA 4R3SB 4EVNA 4N9GB 1KACB 4ONHB 3S5LB 1B4JL 5FKPA 1CLZH 2H8PA 1QFOA 4U6TA 3KYAA 2E6JA 1I8KA 3RWHB 2DB8A 4YNYA 1LK3L 4RGMC 5F1NB 1EHAA 1FJ1A 5E8DH 2ZOKB 5BQ7A 1RJLA 1G7PB 1IMHC 1S78C 4ZUWA 1LE5B 1BECA 5DVOA 1VFMA 3MA7B 1DL7H 2CMRL 4OUUA 2MCG1 1YNLH 2NX5A 2Y7QA 4FZEH 1IGTB 3NTCL 1JZ2A 4MXQC 3KPRA 3O4LB 4QCIA 3KPSE 3A6CH 4LSQL 3FN9A 1YMHB 2DMKA 2GTZA 4Z18A 1JK8B 4BSWA 3PGCB 3VE0A 3B2VH 2DLTA 5D1XB 3GKWL 1EPFA 1BZ7A 4XC3L 1UT9A 3BEVA 2FX8H 1T04B 1RJYA 4XPGH 2Y1VA 3JWDH 3U79A 2A74A 4F7TA 2AEPH 4DKEH 1MLCB 2XA8L 3LKOB 3HLAB 5E2UL 2W60B 1RZGB 5I1AA 1FYHB 3IDYB 1TCRB 1UGNA 1A6UL 1N4XH 4KK6D 5D2LA 3QXUA 3WYRA 3SCMD 1I85A 2VXTH 3VFTA 4N0CD 5CUSL 2LQRA 4TRPL 1WZKA 4LPUA 4M6NH 3NCJH 3GBNH 4X5XA 1GGBH 4HUVB 4KUCF 3RBSA 1YQ2A 2VLRB 4I13B 1PVHA 4PJEA 4Q97A 2NY4C 3NCCB 1NEZB 3CSYA 3QDMB 4TUKH 5CJQH 4KKBD 5CILL 1QQDB 5ALBH 1CFBA 3GBML 5IKCA 5CZVL 4M7JH 1BPVA 2IPKA 1KCVH 4RIRB 3BGFB 5EPMB 2DQTL 2XZQH 4ZFZB 4DWHA 3R06B 3V4VL 3GFUA 3T3MF 1NC4B 4X6EA 3TLRA 2PYFA 4G9DB 2R23A 5GSVA 2MWCA 2Q6WA 2KUTA 4PV9A 3B2UD 5B22A 3FB8A 1DCLA 3MV9B 2VDKL 2OJZH 2NZ9D 4N1CA 5F9AC 4XTRC 5F70A 3DXAD 4EUPB 1U8QA 5MHSD 1RVFH 4WI5A 3SKOB 1KNOB 1CF8L 2CLZA 4PJHF 4XGZA 1SJEB 1FYTE 3IFPB 4I2XE 3WFZA 4HIIA 3ZTNH 1PDKA 5FAAA 4JPKL 2YD6A 1AI1H 3MLXL 3ULVF 3WHXA 4YHKH 3NABH 1JV5A 1EJOL 1ZLVH 3HKFA 4PS4L 2F74B 2HMID 3X3GL 4ZS6D 2QHRL 2YD5A 4KXZI 3V8OA 2CKBH 3BIAX 4HIXL 3KAAA 5DJDA 3U1SL 2B1HL 5DC0A 3BD3A 4PJCF 3V95A 4PB0H 4PYGA 1OAYH 4HX1B 4XC1L 2G5RA 3AY4A 3NZHH 2ADJA 1CBVH 3OKMB 1IZJA 5I30H 3OKNB 2P45B 2Y5TA 4UT7L 3SJVB 4LCUB 2WSKA 4OCNC 3C5ZC 1TLKA 1KLGA 2LU3A 3SGKA 2ICES 2MPAL 5E9DE 1TJHL 3FOLB 4X6CE 5F88B 3MA9L 3ZKMD 4UV7L 4XVTL 1FN4A 2Y72A 4GO6B 2NY7L 1LP9A 4HGWB 4DOHE 2ZG1A 3RI5K 4KZDL 4I0PD 4UBDD 5FUOH 4HC1L 1OM3L 3PWVA 3GNML 1RI8A 5E5UB 3E6HB 5DTFB 1KCUH 4J4PA 2X4NA 3C5JB 1AP2B 3MV8B 4RQQB 4OD2B 3U7YL 4S1DD 3B8SA 2EIDA 2OSLA 3QJFB 5TFSL 5T1KB 3E8UL 3DV6B 4YHYC 5HSFA 1YUHB 1A7PH 4HXBL 3QO0A 1T20A 5BVJB 1FGNH 5BZWA 1KEMH 3T0BA 3ZHDA 5HVHC 4HT1H 4WW2F 4Z0BL 4LLUB 3RL2A 1O7SA 4Z7UF 3V0WH 4WEMB 4JJ5A 4C55A 3NA9H 2WZPD 1XF3B 1XGQA 1A1MA 4TSBH 2J6EL 3KNBA 3D9AL 4L4VD 1QNZL 4J3SA 3GEWB 2R69H 5HYSA 4R8WH 4JLRB 2HVKB 3QI9B 5D6DC 1R3KA 5EZIL 3SE4C 1JGEA 1DN0A 4IMKC 4E41A 2VNCA 2X9XA 3VFWB 3S96B 3MRFA 3O2DA 4QTIL 4KUCD 1RURH 2MOVA 1SY6L 3BP7A 3FFDB 3WKNA 4MWFA 3WFEL 4HLJA 3KLHD 5E8EB 1AGDA 2UUDK 5C0RL 3IDNB 4H25B 3TZVA 2LVCA 2VAJA 5DJAA 1RZ8A 5J13C 2QQLL 1JWUA 3L3IA 4ZNEA 1MREH 4CJ0A 4NOFA 3CU1A 1CICA 2OTUB 3QCTL 2R0KL 2HT3C 1S9WB 1MFDH 1NBQA 3BN9D 1OP3H 4DN3H 4UU9B 4AEHL 5H35A 1FPTL 5FYLD 1HHGA 1JYNA 2VLKA 3G6AA 2Q76A 4NQTA 3TBYB 5HHPA 1E27B 2ZJSH 2P8PB 5DHYB 3FO9B 2D0FA 4LPXA 4JRXD 2DIJA 5H8DA 3OG4B 1WEJL 1LGVA 3T0EA 1K6QH 1WCQA 1WTGT 3DX6B 4XB7A 1YA5A 5E00A 1NC2B 1RK0B 1Q9OA 1JI2A 2ICWA 4Q6IA 4S1RL 1V3JA 5F8RC 1E6JL 1RJZB 4KDTA 4KZEH 1UWEH 1HXMA 3DSFL 1FFNA 3I3DA 3VWJA 4IOIA 5E1AB 1J87A 5F9OL 4F7EB 3MR9B 5HYJE 3KPQB 3I6KA 3ULVD 1YEEL 4FQPA 1T0MB 1T7WA 1UB5A 1O0VA 5EBLB 3BQUA 5EU6E 2A0LD 3SKNA 1LNUA 1Z0MA 1PKQE 2VMFA 1GIGH 4LFHG 5KS9F 4JANB 4XNUL 3S88H 2VDML 4WRLA 1IAMA 4LLWA 4JM4L 3TO4A 1WAAA 4JE4B 1R5VA 1IM9A 5DFWH 1JGDA 3HC0A 3QP3A 3ARDD 2EDFA 3RGVC 2MTPA 4WI2A 1GL4B 5INDA 2DM4A 4ELME 3GSQA 3SPVA 5K9QI 4Y5VB 2D7TH 2X4TB 3L6FA 5M94B 5CP7A 4F37K 3O81A 4JO1H 1U42A 2W1NA 5CJOH 3RQ3A 1HH6B 1U8KA 2C3WA 4QKXB 4PB9L 4JGMA 2BC4B 2EDLA 3G9VA 3PV6A 5CHNA 3UC0H 3NZ8B 2WP3O 1JNNH 3ZKXB 5HI3C 5JQ6L 4WV1C 4H88L 3CFDB 2XI9A 3V7AG 3WNKA 1T7XA 3K80A 1FVCB 3RAJH 4R0LB 2JCCE 2I9TA 4KU1A 3NFNB 4PBWD 2JELH 2NY2C 3UJTL 4PPTA 4OD1H 3BZEA 1MWAA 5I1GH 4Q2ZB 5I1CL 3D48R 4M9PA 5DHVA 1N0LA 5GZOD 4NOBA 1ZT4B 2XZCL 4KJWC 5BO1L 4JO4H 1YEDB 3RPIA 5EBGA 4PRIB 3O6FD 3AFLA 3VFNB 3K74B 1D9KC 2AJUH 4WJ5B 4JO3H 4XH2B 1LDSA 1KJ3L 1BIIB 1INDH 1BLNB 5D7KD 5D5MB 3P0VH 1T1YA 5E8PA 5DK2B 3U0WH 3GBLA 1CWVA 4U1NA 1KPRB 1MOEA 1QEWA 2DD8L 1A9BA 1OTSC 5DK0A 4JGJA 1KCRL 4XMLH 4QXGL 3IDJA 5EBWA 1FH5H 1MAKA 4PP2B 3ZSSA 3FFCE 3HI1A 5CEZH 4G6JH 5HPOA 5EORH 5TDOA 3DRTB 2BRQA 3WDIA 4KQ4H 4MNQE 1BREA 3SBWA 5FGCB 1H8OA 4E5XB 2DTSA 1GOGA 5LCVL 1MCKA 3GSNA 3QPXL 5C0DA 4D0DA 1NMAH 3I9GH 1LK2A 3CFJA 2P5EE 3GSUA 3FO2B 4TOYL 3LIZL 3NFSH 3VFUB 2BNUA 2J8UE 1KB5A 2C5DC 3NCYP 2NY5L 4NT6A 2XN9A 3WO4C 4Y4FB 3HG1A 1X6NA 2ERJB 2OK0L 1QLRA 3IFLL 4PJFE 4CKVX 3D0LA 3B9DA 3IB4A 4J4PD 1QO3A 5MEPA 4LEOB 4GG6B 2V5YA 2HT4C 2R0WH 1J1PL 3QUYC 3MODH 4S10A 1HH9B 3C9NA 5GGRB 1AY1L 5IBTL 1WTLA 1OW0C 3I50H 4JFOA 2EZ0C 4AEFA 3L5JA 1U8LA 1JP5A 1BWMA 1N6QH 4WTZA 4MMXC 3W82A 1FO0L 3TYFA 3D85A 4U1HB 2PXYA 5EDXA 1OPGH 4ZOBA 4JZOB 4MJIE 1JF1A 2VQUA 1MCEA 4L3CA 4X4YB 3G6JE 4ONGL 3WJLC 4LHQB 2E6QA 3NH7L 3QRGL 4X5WB 5KSBA 43CAB 1YEIH 2FO4B 3CVIH 3VXME 3GSRB 1YZZA 3D39B 5IJVA 4UZGA 4HIHB 3QQ9D 3FAXA 2NTFB 4TUOA 4ZDHB 1N5AB 1XGTB 4FQ1H 1BOGA 3DGGB 3TZVD 4ZUTB 1DVFD 4PJ7E 2FGWH 3I3EA 1QSFD 3L3KB 3EYQD 3BDBA 4GW5A 1BQHB 2SEBB 4XAWL 1P2CA 4HCRA 3AAZB 5I71B 4HKXA 3QEGH 1CICD 2YC1A 5DRZB 3H9YA 3B3IB 2Q87A 3SDCD 5L2KB 1XAUA 5F89B 1V05A 2DAVA 3MRJB 1VGKB 5T5NF 2F53D 3BP6A 1QPPA 4DFHA 2HJLA 1BJ1H 4JFEB 1LEKB 5GJSL 3ARRA 3VFGL 4LP4A 4X6BA 1WBZA 1JGLL 1YDPB 3LMJL 5CBEA 3OHXA 1XH3B 2N7AA 3WKML 4FZEL 3C60B 3DV4A 3NCYS 3ZYOA 2FNBA 4X8XA 2D4DA 3MJ9H 4XPBL 4D94A 4J23A 4RDQF 4X6CF 3BZ4B 1ZLVK 1PKOA 5EFIB 5J6HA 2UZIH 3B2VL 3P9LB 2R1XA 4PJDB 1T03L 4PJ5A 3S35X 5ITBH 4D0CB 2FX8L 3O3BB 3EOBB 2C4FU 3DO7B 1UG9A 4BK5A 3EYSH 3M17B 3MRPA 5L8JB 4X9FA 4M4PA 5HDQH 4PJAA 1UC6A 4S11A 3ES6A 1JPFB 4MX7A 2X9WA 3UZQA 2X4UB 4O2EB 4HFUL 5DI8B 4YXKH 5MEOA 4R7DA 1A7NH 1MHHB 5IB4A 2VXTL 1YY9D 2WIMA 5B4MD 3OKLB 2BMKA 1OSZB 3BZDA 5JUEL 2ZUYA 4CU6A 1EHLH 1XR8B 4M6ML 3CH8A 3UTQA 1P1ZB 1Y6MR 3ARXA 5KSUA 1KLFA 1NUNB 4HMCA 5J4MA 4HS3A 1NFKA 3VFOA 1IKFL 3L7FB 3MJGX 3N9GL 5EZJA 4L8DA 1C08A 1GZQA 5A2LH 5LAXA 4TUKL 3P73B 2DQCH 5CJQL 5E5MB 1IZKA 2VQ1A 4Z78A 2WBJC 1T6WA 5ALBL 2QADC 2M8XA 2VUOA 4LVNC 3CFBB 3MGTB 2UWEB 4AIZB 4OM1H 1CYGA 3HMXH 2XZQL 4HBCH 2FX7H 3QIWD 2ZUQC 4P2OD 2H2SD 5E2VH 3DBXA 4OCSH 4DVRL 1WIPA 3SDDD 2HWZL 4WENB 1MFNA 3MROA 3VCLB 1J18A 4AY0A 4IOSD 1XF5B 3EZJB 1SYVA 2FL5A 3I6LE 3L5XL 3ZKSD 2HKHH 4ALAH 1TXKA 4BSJA 3OWEA 3TP4A 2GW5A 3QNYB 2PN5A 2AJYH 1RZIB 2DM7A 1XIWA 5DHXB 1WK0A 2CIKB 1B6DA 1CFNA 1U8JB 1DDHB 3BAEH 4MHHG 5IW3A 2FEDC 4NQSA 3TYGL 2F54E 3ZTNL 2P44B 3QXDA 1AI1L 2WINB 4LCCB 3V6FB 4P5MA 1CI5A 2IBZX 2XWBA 4X8JA 5TDPA 2NY3B 4Y16D 3FQRB 1JPSH 3C6LB 3LS5H 1OGAB 2VC2H 3QDJB 4U0RB 3VD9A 2CKBB 2FYYB 1YNTB 4Y88A 5LGHH 5JMRA 1I3UA 1FYTD 5JLZB 1FNEB 1BM3L 2YPVL 3NZHL 5E94B 1QSVA 5FM5M 3PHOA 5SWSE 5ABDE 5I30L 4NFCA 1PEZA 2BXYA 5C0FB 5DEZA 5IBLD 3OKEA 4WY7H 3TESA 4JHBA 4P99A 3KS0H 2ED9A 3R0NA 5I8EB 4RISL 1OP3K 3V5KB 3TCLB 3SGEI 2NTSP 3WN5B 4OCYH 1U8PB 1KLUB 4OAWA 4GAGL 1TQCB 5HTSA 3TO2B 3REWB 2ADIA 4LHUG 3HG1D 4MB3A 2HLAB 5K33A 4OLVL 1IKNC 1BJMA 4ZUUB 2IBGA 4ELMF 5FOBA 3TWCL 2NXZB 4YC2B 2CR6A 3THMH 5HGDA 4M7LH 4LKCB 2GUOB 5J12B 1T0NA 3D85D 1NBZA 2WMPA 2QSQA 2RJMA 3STZA 3C5ZA 1B0RB 2Y07L 3CFEA 4LLYB 4QRQB 3BP4A 4H26B 4HJGA 1FGNL 2WNGA 2HRPL 1FFPA 3RWJA 3UEZA 2OQJA 1UXWB 1YJDH 2JCCF 3NA9L 1TIUA 1UQSA 3JV0A 1Q0YL 5KAQF 4TSBL 3O2WH 3EJYC 3QQNA 3LZFH 4QYOA 3UYPA 4JHWL 1KJMA 4PJ8C 4U7SA 2BVPA 2AKRB 1REIA 2XTJC 4P3DB 2K7PA 4N90E 1NFIB 4ZAKB 2LTQC 1B0GA 4U1LA 5JXED 1RURL 2EICA 4KI5C 1G7HB 4XCNB 4NWTH 4PJXA 2P8LA 3RU8L 3LKPA 1ONQA 4BZ1L 4JFZH 4MXWH 2FLRT 4JM2B 1AJ7L 3VXNB 1A6PA 2JJWA 2Q7YB 4EDXA 5DF0A 1ITCA 1CU4L 2X5PA 1ADQL 4V1DB 1MREL 3A67L 2FECL 4YHOL 5IOPA 2D0HA 4K94H 4NN5B 1F42A 2HTLC 1BF2A 4MD4B 4NQVB 5EU5B 3ULUC 5DVMA 2YD1A 2E9IA 1ACYH 3GM8A 2IAMB 4KK5D 3QUZD 1BQUA 3BIBX 1RUPH 3QIUC 1JUFA 3SE4A 5DJYB 3HR6A 4KJQD 3LRHA 4IMKA 4LLQB 1NFDA 4WFHE 5JPMA 4LDOB 4HUUA 1MAJA 1QRNB 2H32A 4XP4L 3U4AA 3ZSTA 4GW1A 3VXSA 1HOCA 3JTTA 1QFWM 3DVGA 3QA3B 4PJ5D 1BJ8A 2I26N 3O3EB 4KZEL 2J8UF 4BKLB 3ZTJH 4BZYA 1EFQA 4C56E 5ID0A 5AAMA 3MNVA 1T7ZA 1UA6H 4PJFF 3UAJC 1EEZA 1MCLA 1IGFL 5D70L 3P4NA 3LQAH 1I7TB 5I6XB 4OV6F 4YO0B 4ZS7H 3MLPA 3F7YB 3VXUE 3KXFB 4Z5RB 2XQYG 5E8NB 2Q7NA 1UVQB 5ANME 1R5WB 3DURB 4JZJB 3RFZC 2VISB 4MXQD 4I3RH 2YOCA 2D7NA 1FDLH 2VABB 4K8RD 5HYJD 2G75A 1HK6A 3PV7A 2BVEA 2WIIA 4HWNA 3G6JF 4MXVE 3P3YA 5JPNA 5F7FA 2ADFH 5EU6D 4P5KA 2A83B 2ZNWA 3FZUC 4FQXD 5D6CA 3MUJA 2MQ3A 2VRAA 5DURB 5EZLA 4OIBA 1DBKH 3TJEL 4JO1L 5CJOL 3ULSB 5C0JB 4XMKH 4WFGE 4P5TD 3BXNA 2E7BA 2FD6L 4TSCH 4FQHA 4G8GE 1XGPA 5MP6H 2CK0H 1PY9A 1X5JA 4Q9RL 3CSBA 1VFAB 2VZSA 5C8JA 5J7CC 1NFDF 3K7UA 4IS6A 1M71A 1OVZA 4PJ7F 5D7IB 2FZ3B 5DGRA 1U91B 3VFMB 4HUXB 1YEGH 5C08B 1NGXA 4TULH 4YDVB 5DVLA 5DMKB 5I1GL 3H42H 4WUKH 3ARFC 3HNSH 3QRFM 1P7QD 3MRNA 3TCXA 1T4KB 3P30H 2BNQE 5K9OB 3N1QC 3H3BC 4XAKD 5EU4A 4JO4L 1A7OL 3CVHA 4KK9D 4JCMA 1EVUA 2OI9B 3WXWH 5IBUG 2BXZA 1LEGB 1IM3A 2OZ4H 1H5BC 4PTUA 4NC1C 4X0KB 2EXWD 4MLSA 3W2DL 2AEQL 1L0YA 4JQIH 2X44D 4M61A 4DFIA 1U8IA 2G60H 3NN8A 4OGYL 4P2QB 5IVXB 4TVPH 4WV1A 3U82B 2ICEA 1MCWW 1DFBL 4ODTL 4YH6A 3U36B 3WDHA 3HUJA 2N56A 3RA7H 2NLJA 5GRWA 3QG7H 1T1WB 3OL2A 2CLVA 4MJ2A 2IMNA 4XTRD 4NBXB 3C2AH 3IJYA 4QHLB 3QISA 5KN5A 1HKLH 3IU4H 5D7JB 3ARZA 1EFXB 3GSWA 4K7PX 5FKAA 5CEZL 1U41A 3W39A 1BD2A 3QDGE 1DBAH 5GS0C 5J06A 4F7MB 2VZ1A 3ZE0E 3MCKA 2BOBB 4G6FD 1D9KA 5TE4L 4RFEA 2R2BA 1KXVC 1MPAH 5HDLA 3I9GL 1IEAB 2ATPA 3GIVA 4H8WL 4HEPG 5JW4Q 4OZFH 1K8DB 1XCQB 3NFSL 3PWNA 5BMFL 2PYEE 1S8DB 5AD0A 4X9IA 1RZKL 3MV01 1HHKA 4G6KH 1F2QA 4LNRB 1EGJL 1XF1A 3MREA 4XNYL 4Q9QH 4MNQD 5D71H 4TTDC 1SBSL 4QT5A 5T1MB 25C8H 2EH8H 1W0VB 4Q9BA 4CVZA 3TBVB 1YPZB 2HJKB 3N1PC 3QNZA 4KJPC 3C5ZD 5C9KA 1NCUA 3QQ4A 2P5ED 4WGVB 3RUGE 1F5WA 1R0AH 3WHE1 2NXYB 3ARGB 1UZ6E 1OPGL 2AV1A 1J1XL 4G9FE 1RUQH 3BH8B 1J8HB 1M6OB 3BPNB 4YWGL 4GAJL 2OR9H 4PLKC 5A16B 3WFCH 4AL8L 1DR9A 4KHXH 3TC9A 4MZ3A 4UDUA 4ESKA 4RCAA 3TNNA 5I75B 2AI0L 1MRCL 4IMLB 2WAHA 5SX5H 1JFQL 5DJ2A 5DRNA 4D9QE 1Q9LB 4W70A 1OW0A 1T21B 1G0XA 4MJID 4TUJB 2F8VA 4N5EC 5F44A 2P42B 3CX2A 4YBHA 3KPMA 5D8JL 1MUJA 1AE6L 4IDLA 2GJ6B 1DE4B 4IEFB 4KI5E 3O6ML 3PQYA 1G9EA 5K9JL 1NAMH 4K3EH 1I4FA 1H0DB 4FQLL 3VXMD 4G6AD 3WUWB 4D3CH 1W2KT 2EC8A 3H9SB 3L1OL 2D03L 4AM0A 4XVJH 5IB2B 4AEIH 3IXTA 5D1ZD 1H8NA 5BV7H 3RY4A 4FXGA 5A3IC 1C16B 3ULUE 1Y0LA 4G42A 5GRYA 1MHPL 3T3PE 3MJ9L 4OZIA 1EO8L 4GKZA 1CDYA 2ORBH 4M7ZC 3VG9B 1WLHA 2V9RA 3GMMB 2XFXB 2JB6B 4GT7A 5LQBL 2XV6B 4ZUVA 3VRLE 1HHHA 3EHBC 1AH1A 4ZNCD 2OTWB 1P6AB 1X6LA 2HA1A 4PG9A 4UI2A 3KG5A 2HT3D 5I1LB 3QQ3A 1QBBA 2XQYK 2ZUXA 2DQEL 1K8IB 5HDQL 2H6PA 4R4BB 1VCAA 2C4FT 1DTUA 3EFFB 3F5WB 5DD5H 2CUIA 3D0VA 5GGQH 4LSVL 3O9WD 5IW1B 2F8OA 3I84A 1EHLL 1ZA3A 1G9ML 2ZUWA 1NGQH 4R90H 4L8CA 1FZKA 1XGYL 5GRJL 1KELH 5KANI 4C58B 3LEXA 5H2BA 3ECBB 4OZFG 3Q1SH 2DJUA 4MQ7A 1AQKL 1ZTXH 3D25B 3HRZB 4LQFL 3O8XB 5KBNC 4GRMA 3RDTC 5EA0L 6FABL 1DLFL 5DWUH 5BCAA 4N0FB 5B39B 4S1QH 3MV11 4X4ME 5ALCL 5GRVL 4NNXB 3QIBC 2DWDB 1YN7B 1Z9MA 1T5WA 3I2CH 4HBCL 5DSCB 1KV3A 5GGTH 3JTSA 35C8H 1HSBB 5KSVA 2OM5A 4OCSL 4I3SL 3CX5K 3EO9H 5BXFA 4HZLB 2NW2A 3HE6B 4APQD 4N8PA 2RFXA 4DKAA 2EE3A 1F13A 1JHLH 4FQCH 5EWIL 5I17B 1GSMA 4ZPVB 4PREB 2PCPA 1BQSA 2QQQA 3RGVD 4U1KA 2PTUA 4NRZA 5AYQA 4DKFH 1J5OH 2OS7A 1K3ZA 4EXPX 2P48B 3JWOH 3HE7C 4NO0B 3OR6A 4WUUA 1YMMB 3AXLB 4G3YH 5IGXH 4XBGB 4Y4KB 5CP3H 5C7XH 4QRTB 4MMZC 1L7TH 3UYOD 2EDBA 5DZLA 3O2VH 2FH8A 1K4DB 4QF1B 2J6EA 3IRZA 2R29L 4U1MB 3MLYH 1I8IA 3I6LD 5I9QC 4HMEA 3T4YA 3KPNB 1JPSL 4YEFA 1MI5E 1SMOA 2HLFC 2YA1A 5IROA 2ARJA 4F58L 4X6DB 1KIPB 4JFXB 5BVPL 4BFIB 1D5IH 1LEIB 2DS4A 1FSKC 2NY2D 5LGHL 4HFWA 2IANB 2VDRL 5FO9B 1J1OL 2AJSH 1T2QL 2GFBA 4NM8H 2EO9A 1SY6A 2XPGA 1CCZA 4KQ3H 3TBWB 2XG4A 4LCIH 1R24B 4KJWD 5DUPH 5TE7H 2IH1B 5AWNL 2C26A 1W0WA 2YD7A 4FTVB 3WBDA 3H0TB 5KSAC 2P7TA 1IGJB 4Y5YA 1ZVSB 1VADA 2C7UB 3RVVC 3O11B 2V7HA 1JI1A 2IQ9H 4EN3C 3D3VA 4LMQI 2BDNH 3BEWA 3MV7A 4OCYL 4ODUB 4D8PA 3FJTA 1QLEH 4YR6B 1UZ8A 1R3HB 4L4TA 2J5LC 3QNXA 1H3PH 2KQNA 3X13B 4IJ3C 5SWSD 1OTUC 5F7MC 3E6FB 4EI6A 1CGSL 4N8VA 4MXVF 1OTSD 3GMOB 4H20H 3W9DB 3ZYIA 3CCHB 4MAYD 1EEQA 1U36A 2G2RA 1FNGB 3R8BB 2AK4A 4POZC 3F58H 4OZ4B 5EOQH 1LDPL 2YKLH 2A6IB 4K2UL 3ZO0A 4LOUC 1OLZA 2JB5L 2O5YH 5IHBA 1HDMA 4LSUH 3TPUA 4JQVC 3QBTB 1MFAL 5GSRA 3STLB 1QR4A 1SYSB 2D7QA 2EE9A 4K9EH 4MQSB 2V2XB 5DDHA 1BFVL 3S4SA 4G6MH 3B83A 1CFVL 4IRJB 5J9PB 2OCFD 4M7LT 3MZGB 1SM3L 1ETZB 3LRSB 3FTGB 4QHKI 1NAKH 3LZFL 4S1SH 5IMOA 2R2EA 5SWZA 5JOFB 3QUYD 1QA9B 5DEGB 1M7DA 4G80A 1CFSA 3HR5A 3WUZA 4GMSL 2JK5A 4FQQA 3R1GH 1SJHB 1FV1A 2ZCLH 4PUBH 4HUWB 5C07A 5IW6A 4JFFA 2CIIB 2X9YA 5JHDE 4LRIC 3RHWK 1A6AB 5GGSA 4U1GC 3LS4H 5D2NC 3LQZA 2HFTA 4NQEA 4GLRI 5FYJE 1TCMA 4XNQA 1VFBB 2O5ZL 4N90D 1TVHB 1QFWI 1ZEAL 1MSPA 4P46A 4K7FA 1CR9H 4Y19B 2APVA 1FCGA 1LE9B 2YPLA 1OTTC 5IMMB 1FZMA 3O3AB 1PX3A 4Y8DC 5F9WB 4Y8AA 4OLXL 4WI7A 1FP5A 1NPUA 3HNTH 1FL6B 5DD1L 2YK1H 5BJTA 1FIGL 3ZE0F 3F8UB 1HILA 5F3HB 1I9RL 1I1FB 3UJJH 1P4LA 2VXVH 3S8WA 4P2YA 3MJ8A 2NY6D 3H3PH 4IHOB 1U6AL 4P23C 4TSAL 1UA6L 2VYRE 3RZCD 4OCMC 5T3XH 4FQJH 3O41A 3L9RA 2Q8AL 5EOCH 4ZS7L 1U3HC 3GM0A 1I9IL 1RZKC 5L88H 4OIIH 4YHML 1MRFH 4Y2DD 1GJIA 1T66D 3IETB 1X5LA 5BS0A 3FOMB 3KPTA 5DRXB 1MJJB 3QH3B 3RUGF 3QIUA 1KN2H 1CLYH 3FHAA 3BP5B 1UZ6F 4C56D 1CFQB 1HI6A 1PZ5B 1NDMA 4ZD3L 4DCQA 5FHAL 3VXUD 3RIAK 5F71A 1FVDB 3IDGA 4OFVA 3VRIA 3FQXB 4XCYA 4C83B 3PG2A 2NQCA 3SDXA 3MRQA 1R3JB 4XP6H 5C09A 4YZFE 4Z8FH 2YMXH 4NNYB 3PL6C 1SVCP 2B4CC 3HZYB 1LQSR 2CK0L 5TQ0L 5IB1A 1KTRL 2ZKHH 3N85L 4RZCA 4BQ8A 3VD7A 1OD7A 3QCUL 1QD0A 2XNAB 4KI5F 3BPLC 3BRDA 5IK3B 3L3HA 5C0AE 3BH9B 1IC7L 4BYHA 3H42L 4WUKL 1FO0A 2DBLH 1FG2A 3M8OL 3T4AA 4WFGD 4RAVB 3S97C 5J0BA 4U1JB 1I1RA 1HYSC 3NFPB 2DM2A 2VIRB 4CL7A 5DXWA 3OKOB 4YFLF 4LSPH 2WBJD 2QADD 3SGDI 2YUWA 5AZEH 1UH4A 1DUYA 1MCSA 3ULUF 1PGRB 2H1PL 2X4QB 5SX5K 1AGCA 1AD9B 5DVKA 1P5UA 1K4CA 3K1DA 5ELIA 5FEBA 3RIFF 3CU7A 1KSRA 1ZS8B 1TTFA 4TVPL 1KUMA 3WXVL 1VSCA 2EDJA 2YPKA 3T3PF 2P46B 3HZVA 32C2B 5C6WH 3QO1B 4F2MA 2BFVL 4YGVA 2KDGA 5HHNA 5CBAB 3GJFA 1P4IH 3OJMB 1PG7H 1PG7W 2BNRA 1PY4A 3VRLF 5CEXB 1JBJA 3C2AL 4GKNA 1OAXH 1OCWL 1FNHA 5BRZE 3ARFA 5I1IL 1A22B 3CC5B 1TTGA 4OZHB 5EC2A 4K3JL 4QRPA 3IKCB 4AH2A 2IGFH 3ETBF 1IAIM 4KHTH 4YPGA 2D7MA 3PWPB 3MV7D 4LLDA 4NCDA 1V7NL 2WP3T 1ES0A 2WWKO 4ENEC 3I02A 3O2DH 1H5BA 1BJ1J 5D7LB 1AGEB 4OGXH 1AO7E 3TT1L 2B1AL 1G7IB 3EZ8A 4UTAH 4HEME 1UH3A 1MQKL 4OZFB 4PG2C 3ZDXE 5C0CA 2G9HA 3V0VB 1U93A 4OFYD 1S7RB 1KF9B 4G6KL 4U33A 2RCSH 5HHOA 4IBLT 3GSVB 2GSIA 3QDGD 3VXQA 5IEKB 2FEEI 5DR5H 2EH8L 4ZQKB 3KLAA 5H37H 3IDYC 4JFDE 4ZTPH 2DWEA 1JWSA 1B0WA 4ONFL 3OKDA 2AQ2A 1QVOB 4RAHA 3B9VA 5EUKB 4ZFGH 1Q0XL 1H3VA 1JL8A 3EOTH 3QYCA 5L6YH 5HGBA 2PYED 2VWEE 5JO5B 2XWTB 2A73B 5T1LD 1NCAH 1J0YA 4ZSOB 2GKIA 1J05A 5ESVA 4QHMA 4PJGB 4EKXA 3WFCL 1JZ5A 3QUXC 4HS8H 4IIQB 2W9EL 3CZJA 5E8OA 5INCB 5E03A 1P7HL 2VLJA 5KTEH 4U7KA 4LQ1A 4UNVA 4NZTH 4P9MH 1U95A 2VZVA 5DJXA 4FXKA 4F3FA 3S6CA 1EIBA 4NGHL 3IRPX 4G9FD 1I7RB 3U6RA 5FF6A 2BSRB 3MMEB 5ESAA 2A6JA 5FCUH 3AMKA 2BY0A 1TETH 2EEAA 2A6DB 5TGBA 4CRPA 4K3EL 2FBJH 3QG6A 2ZPKL 4D3CL 5D1QA 1FNSL 1NAMB 4TNVK 4K7PH 4D9QD 3EJYD 4XVJL 4YK4B 3UTSA 4PJ8D 1C5DB 2OJEB 1ZSDB 4F15B 3MACH 2XTJD 1NBYA 1L0XA 3LB6D 1NL0H 3VW3L 5BV7B 1RK1B 3K8LA 4K71B 4J3TA 4KI5D 4NO2A 3MGOB 4EIGB 4RWYH 5I1EL 3AM8C 1GZPB 3EO0B 4GAYB 2Y4SA 4O58H 3U7WL 3T65B 2ZWLT 3UTPE 2H26A 1MHCB 1N6VA 3D69A 3RWEA 3LVEA 4OSUL 5HHQA 1D5MB 5L7XL 3GJEB 1U92B 3GMPB 1Z3GH 1U8HA 4LCWB 3ULUD 1MWAH 5DA0B 1T80A 1C12B 5F1OB 3C2SA 3WS3B 1FRGH 5DHVH 2F5AL 3FO0H 3BMVA 4YFLI 2CLRA 3TIEA 3P9MB 5DMIL 1G6RB 4QOKA 4EI5C 4OTXH 3QIUD 1AGBB 5HGAA 1AIFB 4Z7VB 2R0ZL 5GGQL 2ICWI 4X7FC 5HYSG 4PGEA 5HI4C 1KN4L 2R1YA 4OLYL 4NZJA 4OZGE 3BPOC 1Q1JH 2XA3A 1J0HA 4X4XB 3BWUC 1S7WB 3KS0J 5T33L 1J86A 2GT9A 4RX4A 3U4BL 2AJXL 3KR3H 3HA0A 3Q1SL 4JRYB 1OL0A 2I5YL 3UAJD 2QR0B 3ALWA 2XZAH 4DUWA 3HI5H 4UDTB 2NZIA 3GB7B 2VLLB 4FMFA 3CZFB 4OGAD 1G9NH 3RWDB 1I3RB 1W8NA 2JE8A 2HFEB 3WNNA 5A40E 3KVQA 5HD8C 3P40A 3MRBA 5JA8B 3L3GA 4PRHA 5GGTL 1WISA 5KVDH 3MNWA 4LGRB 4DJMA 5J6GA 4LF3A 3GSNH 1F90L 3AS2A 3TA3D 5ISZB 3CX5J 3BSZL 2V2TA 3EBAA 2GTWB 4LKXB 4Z76B 3QI9C 4XNMA 1CIDA 1KB5H 5ESQB 5K9KB 5DA4A 5F97E 1KGCE 4NQCE 2X7LA 3QWRA 5GS1B 1CDHA 1Z9LA 4RMVA 3OGOE 5B38B 1KPUB 4IDJH 3QFJE 4U6HB 2Q3ZA 5CGYC 3BKJH 2D31B 2PO6A 1YYMH 2XG5A 4M9OA 5TDNB 5C6PB 1XEDA 3QEUA 4HPOL 4FOMA 1WZ1H 2E5EA 1SEBB 2FWOB 1H15B 3S35L 4XHJD 3WIFA 3K8KA 4LGPB 3WNOA 1D5IL 1ZWIA 2EYSB 1S7SA 3GSOA 4WU5B 2GQHA 3C5SA 2AJSL 3O45A 3ARFD 4HH9B 7FABH 2EYRB 5BW7C 2MCPL 2V5TA 2FH6A 2Q8BH 4JPVH 4LCIL 1WIOA 1RIVL 4RFOH 3TNMA 2Z91A 3HE7A 1ADQA 2I27N 3MGAA 2P47B 1MI5D 1MF2H 2IFFH 4YXLL 1WBXB 2B2XH 1MJ7L 2BDNL 1FZOA 3PWLB 2W91A 3L5WA 3MUY1 3O4LE 3WFBH 3KWWA 5DYOB 1K5NA 1JNJA 5T1DH 5A1AA 5FA4B 3P2TA 1B88A 5HHOD 3DOSA 2K3TA 4OF6A 3MXVH 4HCRH 1DP0A 4L29B 4L8SA 3VXOB 4ZYKA 1HEZA 4MD5A 1CDGA 4EVNB 5EOQL 4XWGH 1P7KA 2HH0L 3GHBH 5FKPB 4FNLL 2H8PB 1WICA 2AXJA 3F65A 5IV2A 4ZXBC 3VWKC 4L1HA 5C2BH 1I8KB 5GS0D 1JHTA 2MHAA 3MO1A 4YNYB 3NACL 5L2JB 2R1WA 5KSAA 4YZFF 1FJ1B 5D72H 5FYLL 5BQ7B 2FO1A 3P77A 1RJLB 4EN3A 3LRGA 4ZUWB 3MLSH 5EO9A 2PETA 3WCYA 5I1KH 1WWBX 2CDGA 5FYJU 2NX5B 1YQVL 2Y7QB 3D6GA 4WCYL 4BZ2L 4L3EA 1ZKAA 2FJGA 3KPRB 3R4DA 4MQTB 4QCIB 2FSEA 2ITDA 4U3HA 5HYEA 5LKNA 5B8CC 1QBMH 4UT6H 2VLRE 2EC9U 5F7DA 4NZUL 2GTZB 2XY2A 4BSWB 2EE6A 4U1IA 4TTDD 4GS7B 3QDME 3VE0B 4UINH 2P4AB 4XCEA 2APFA 3QULA 5FYKH 3ZKXC 5E08H 5F1IA 1BZ7B 3ULVL 3BEVB 5DC9B 4HIJA 5IG7A 1RJYB 1IL1A 3R1GL 2A74B 4F7TB 1NLBH 3FN3A 4PGZA 3MLTA 4KGLA 2ZCLL 4H5SA 3IVKA 4JQVA 3T2PA 4QEGA 3MRCA 4MDIA 3UJIL 2VDLL 5D2LB 3OZ9L 4PLKD 4PGJA 3VFTB 1PSKL 3G6DL 1MNUH 3MV9E 1MIML 4XMPH 3DX7A 3ZT5A 4X5XB 1F8TH 5JXAH 5H94A 1IRAY 1IGCL 2P5WA 4LSSL 1CR9L 2DQDH 2E3VA 1H3XA 3G5VA 4F9PC 1MCFA 4PJEB 4NQDA 1RUML 4WU7B 1PW3A 3PDDA 4XRCA 3CSYB 5IHUL 3HNTL 4KY1L 4N5ED 4WO4A 5JHDD 1MRDL 1JGUL 2BVUA 5FGSA 3DRQA 5IKCB 3UTZA 5FYJD 5C0BE 2IPKB 3UJJL 1UFUA 5C9JA 4YDJB 5SX4I 2OL3L 4NHCH 4R2GC 3IF1A 4LRIA 3DPBA 3ZDXF 5KVMC 3FRUA 4Z0XA 4X6EB 5D2NA 4RDQG 3SQBA 4TPRL 1HZHL 2R23B 2NCMA 5GSVB 4G8GB 4QOKD 2JIXA 4PV9B 4NZDA 1PLGH 3FB8B 3OXRB 2ESVE 4CBPA 4FQIL 3SJVE 4YXHH 3TVMD 8FABA 5IF0A 3S7GA 1U8QB 1JWMA 1KN2L 1NKRA 4WWKA 4XGZB 2O61A 3BUYA 4JPIA 1CLYL 1F6LL 3C6SA 1X5IA 3W81A 4HIIB 1X5HA 4ELKA 1U9KA 2EDWA 2KKQA 3WHXB 4WTWA 3BKMH 1JV5B 4RX4D 1TPXB 3BHBA 2Y23A 4QO1A 1JE6A 4XP1L 5HPMA 4NN6C 4JQXC 5DJDB 4P23A 4GMTH 4PJ9A 1QYGL 4J3WA 4P3WA 3L5IA 3LY6A 2E8ZA 3MV8E 1DN2A 4OGZA 3HZKA 5KZCD 2ADJB 3Q3GA 1A7RL 1ZLWH 3T2OA 1P4BL 2FJFA 1NH6A 3FQUA 1EGJA 2Y5TB 3EOAB 1CQYA 4CN4A 2ZKHL 3D2UA 2AVGA 1DBJH 1KLGB 3RTQB 1RHFA 2X10A 5ILTH 5F6IB 2C1OB 1V7MH 4QXTA 5KOMC 2DBLL 2BSSA 4MJ4A 1S7QA 1FN4B 1AKJB 1WVZA 4KK6C 4P0DA 1FFRA 3SCMC 3RDTD 1LP9B 5IJKC 1IC1A 4FHBD 4XCFL 3O0RL 1FL3A 5AZEL 1N7ML 3PWVB 3QIBD 3G5ZB 3B9KC 2AABH 4J6RH 2X4NB 3L95B 2QKIA 2HP4A 1A3RH 2MKLC 4ODVH 5C0AD 1IAII 3PL6A 3KHQA 2OSLB 1JTPA 3VG0L 3WJJC 2BVOB 2XKSA 4GXVL 5CJBA 1FBIL 1O7VA 1EHXA 1OAKL 3QO0B 1GHFL 4EDWL 5DQDL 4WVRA 3BO8A 5HYQA 4CMHC 5BZWB 4MNGA 3RL2B 4W6YB 3IDMA 4Q9CA 4JJ5B 1XGQB 1A1MB 2IGFL 4NPYA 5MENA 1A6VH 3KNBB 4TVSa 1MVUA 1UKSA 4AMKH 3B2UC 4TNWF 1R3KB 3MZTA 2I07A 1B2WH 1RU9H 1JGEB 1DN0B 3UTTA 5CKAA 4JKWA 1KULA 4E41B 4R3SA 1OB1A 3MRFB 4OZGF 2M2DA 3BP7B 4YHPA 5BRZD 4MWFB 4G5ZL 4JG1H 4LHUA 4HK0A 4O51A 1AGDB 2J4WL 1JZ7A 4XXDA 3TZVB 5DJAB 1RZ8B 1X5FA 3UBXA 5HGHB 5DR5L 1JWUB 1V8HA 2BVYA 4G43B 3L3IB 2ZOKA 1SMAA 3VJ6A 2HMIC 3CFCH 4ZS6C 4OBRA 5F3BA 2L0DA 3CIQA 1CICB 1T1ZA 2FIRT 3GSXA 3MA7A 3T1WA 5I8KL 3RVVD 1AO7D 1IGTA 4EN3D 5HHMD 4ZUSA 4N1HB 1BBDH 5H35B 1CL7H 1HHGB 2DTML 1BVLA 2VLKB 3G6AB 2Q76B 4PJIE 3BUTA 1BWWA 5HHPB 4NO3A 1OWRM 3DX8A 2A1WH 1QUNA 1OTUD 1GAFH 2H32H 4R4ND 4HS8L 4P4RA 3IFNL 3T0EB 1WIUA 4JFDD 1Q72L 4HWEL 3LEVH 5JR1H 5E00B 5KTEL 4YE4H 1VGEH 4ODXA 2ICWB 2MJWA 4Q6IB 1FE8L 4POZD 4DVBA 5ICXA 4M8QA 2X1WL 1HXMB 1GC1L 1FFNB 4HS6A 3VWJB 1A4KA 4LOUD 4IOIB 5AYUH 2AEIT 1TNNA 4M62H 3I6KB 4L8BA 2ZNXA 4LASH 1W72L 4KKAD 3BQUB 3TFKD 2EDYA 1BBJA 2VJXA 4P59L 2EKSA 3OF6D 3SKNB 5F7HA 1LNUB 4LGSB 3ET9F 4H0HB 5GGVH 2AXFA 2FBJL 4DUXA 1X9QA 1ZANH 1YEJH 3VXRA 3D87B 1A5FH 1GYAA 4LLWB 3HCVA 1BVZA 4K7PL 4S1DC 3TO4B 5KW9H 3QUXA 3KJ4C 2P5WD 1X44A 3MBXL 5CJ8A 1R5VB 3P0YH 1IM9B 4X99A 1JGDB 3HC0B 1A7QH 2FX9H 1JRHI 5D4QA 4NBYB 1OT1A 5TE6H 7CGTA 3LN4B 5EPMA 2I60H 4PRIE 4UNUA 5T3ZE 3C6LC 3L6FB 3TN0B 5KJRL 5CP7B 1GH7A 1A8JH 3DNKA 1UM6H 3VI4E 4U0RC 4RWYL 1U8KB 2CJUL 2AW2A 4O58L 3PV6B 5EU3A 5CHNB 4LIQE 5D5ME 1TZGL 1EERB 3L3JA 1NLDH 5LXGL 1E0OB 3SE3C 4HKJA 4NFDA 3S3PA 1NGWA 1IQDA 4JFYA 2I9TB 3T2NL 3SDAC 2O5XH 4Y4HD 3BZEB 1MWAB 1RIHH 1OTTD 1IC5H 4OTXL 4RRPG 2Y9RT 1MCNA 4J12A 4OCXL 5FGCE 3CVHH 3UTPD 1DQDH 4PGCA 3L3OA 3GMLA 5IHZA 3RPIB 4Z77A 3AM8A 5IR1A 4MAUH 1UM4H 1WITA 2J88H 3ARPA 2BJMH 3ZE2E 3BN9C 3IGAA 1L9MA 4F7CA 4HX1A 4PJBB 2EEBA 1CGWA 1EZVX 2NXZC 3W0WA 3OAUH 5FDWA 2OR8A 5E8PB 1A1NA 1T1YB 1NCCH 2X89A 5J12C 2E7LA 3HI5L 4KROD 4J3XA 4U1NB 3DUUA 1QEWB 1U3HD 4FFZH 3SE8H 3ESUF 2DIAA 5DK0B 4ACPA 1AGFA 1G9NL 2BRRH 3IDJB 4WI6A 5EBWB 3TF7C 4EI5A 3CK0L 1FFOA 1B4JH 4MD0A 3HI1B 5KVDL 5TDOB 2CXGA 3CLFL 4IRSA 2ZSVA 2AXGA 3U9PH 4HDIA 4YBLB 4WI3A 4JKLA 2NY0D 3GSNB 4D0DB 5C0DB 3JV5A 3WE6A 5L0QC 1G7QA 1ZHLA 2NYYD 5CD3A 1LK2B 2DYPD 3CFJB 3GSUB 4ZAKC 2XQBH 2BNUB 1MQ8A 2VLMD 1KB5B 2CMRH 4NT6B 3FQNA 1F58L 2XN9B 1Y6KR 3NTCH 3D39E 3HG1B 1QLRB 2F19L 4MB4A 3D0LB 1KB9K 4EBQH 4QRSB 1QO3B 5MEPB 1FCCA 1KT2A 5AZ2L 3ARDC 3C9NB 3PL6D 3R8QA 4JFOB 3PIQA 4YAQA 1A14L 1U8LB 3GKWH 2XY1A 4XC3H 3TGXA 4NN5C 3TYFB 3D85B 1KGCD 2PXYB 4NQCD 2DQUL 4LDEB 3NCBB 2XA8H 1JZ8A 7FABL 4L3CB 3QFJD 5E2UH 5L2KE 3SKJL 4GRLB 4JPVL 3KJ6H 3L7EA 1A6UH 1HYSD 5DJCA 5J56B 2VH5H 1JGVL 3ARBB 4JFEE 4TRPH 5KSBB 2GEEA 2VE6A 2VQTA 3LPFA 2YBRB 3K2MC 2ID5A 5F7KC 5IJVB 5D93B 1VHPA 2WQRA 1CD8A 3EYOA 4TUOB 2IALA 2EDRA 5T1DL 3UZVB 2C1PA 4NNPL 5GZOC 1BOGB 1ORQB 1K9TA 5CILH 5E95B 3QDHA 1JTOA 4PJDE 3VU2A 4HCRL 1I7ZA 3GBMH 3O6FC 5CZVH 4OQ1A 4LBEA 4WW2C 3AREC 2OLDA 4GW5B 4DEPC 5DMJB 1P2CB 1I3VA 2DQTH 3GHBL 4HKXB 4MS8C 2YC1B 3DIFB 5C2BL 3SDYL 4JZJC 2GCYA 5ACLA 3O4LD 4BA8A 1AQDA 5F72S 4JB9H 5LWYL 3LKNA 4NCC1 3BP6B 2HJLB 4ENED 4MSWA 5EOCJ 1J88A 2VDKH 1IFHL 1RK0A 3DYPA 4X6BB 1WBZB 4W6WB 5CJXA 5CBEB 3OHXB 4XPAH 5D1XD 2KQMA 3MRHA 3MRGA 3DV4B 4NRYB 2E8YA 2HT2C 3WFHA 1UJ3C 3MLXH 5ACZA 2RHEA 1EJOH 3GI8H 5J6HB 1JYWA 2R1XB 4PLOB 3BDXA 2EC9T 5IFAH 4PJ5B 3X3GH 1GGUA 2QHRH 2RAMA 2QSTA 3BT2L 4HIXH 3U1SH 2UWEE 3VWKA 4DGYH 4ZXBA 1CK0L 2B1HH 1CDUA 1VPOL 2IQAB 1JMXA 1OHQA 2YXFA 3MRPB 4IM8A 4PJAB 4RGMB 4XC1H 3QWQB 1ZLWK 1JF5A 3ES6B 1NCWL 4MX7B 1SEQL 2VLRD 3RVXD 2NNAA 5MEOB 4KRPC 4R7DB 4WI4A 1BZQK 3QDMD 5IB4B 4UT7H 4LSRH 4WDIA 5FHBL 1U8NA 3MYZA 2X4TA 4K8RL 1IEHA 4A6YL 1GGYA 2OI9C 3UTQB 3GO1L 5B8CA 5KSUB 1J8KA 4HS3B 1TJHH 3VFOB 4JPWH 4P2RA 5EN2A 5F6HJ 3IAPA 5EZJB 1C08B 1RY7B 1NC4D 1GZQB 5HHXL 5LAXB 4UV7H 4XVTH 3CFDA 3G04A 3F6LA 2VQ1B 3OJ2C 2NY7H 4Z78B 1OT2A 4KZDH 3C08H 4J7RA 4MDJA 1OM3H 3MV9D 1OGAE 3NFNA 5BZDA 3GNMH 3QDJE 4ISVA 3OJDB 1S9VA 2YEZA 1HWGB 2BHZA 3HZMA 3QQ9C 3DBXB 4AG4L 4CDHA 4ZO8A 2F9BT 3MROB 5TFSH 4WHTA 3O3UN 1SYVB 2FJHA 2FL5B 5HDBE 5GPRA 3V6OC 1PLGL 2X40A 4HXBH 1FAIL 1DVFC 2L7UA 3L5HA 4YXHL 1EO7A 1OY3B 2VL4A 3EYQC 4Z0BH 3RJQB 3S9DB 1XIWB 4F9PA 1CFNB 1MHEA 4HGKC 1BLNA 3HAEG 2NY4B 5I76A 2JJVA 4NQSB 1BP3B 2QSVA 2J6EH 3D9AH 4PJIF 2FGZA 1UACL 1DQJA 4P5MB 1ED3A 2VN4A 4X8JB 2MMXA 5TDPB 3ARQA 4C54A 5EZIH 3EAKA 4YPJA 3SKMA 2Z9TA 3SJVD 4GMTL 2UVFA 1SY6H 3DRTA 3EYFA 3WFEH 5TQ2H 1A2YA 3G5XA 2DQHH 3ARGC 3RGHA 3PHOB 4L5FL 4HK3J 1RFDL 4KKCC 1OWWA 1GC1C 3M1BA 5EC1A 5F21B 1WC7A 3MLZL 4PRPE 2BSTA 3OPZL 4HW6A 2R0KH 5F7UA 2JKXA 2H9GA 3I75A 1FPTH 3S34L 4OAWB 3V6BR 2DL9A 4GG6A 3H9HA 2ADIB 3MV8D 2HJFA 4JKKA 5I74B 2E7CA 4OCLC 3QHFL 5T1KD 1WEJH 2BY2A 1C7SA 1JHKL 1UCBH 2ICWJ 5FOBB 2E27H 5HD8D 4S1RH 4U1HA 5CINL 3K4AA 2AABL 2V17L 3VI4F 1A3RL 3DSFH 5HGDB 3MUZ1 5F9OH 4Y5XB 3SE9L 4QTHA 1NBZB 1YEEH 4U49A 3STZB 3C5ZB 5D5MF 5CEYA 4PYHA 3U83A 3CFEB 4UB0H 5M7QA 1N64L 2X4OA 4HJGB 3QI9D 2CDFA 3EO1A 1XGUA 1FFPB 3RWJB 3MRMA 2OQJB 4XNUH 4P2OC 3QIWC 2VDMH 1UQSB 2DJSA 5TPWL 2H2SC 4ETYA 1ZGLA 3AROA 4XHQA 1JPTH 3SCMA 5IJKA 4QYOB 1KJMB 4DK6A 2WK2A 3MLWL 2X42A 2BVPB 5DT1L 2AK1L 2ZUVA 3HFML 3IDUA 3T77A 2IH3A 1QRNE 3B9KA 3BIKA 3LHPL 1FL5A 1B0GB 1BQHA 2EDKA 4U1LB 1H9VA 4NUGL 3V5HA 4HK3N 4EIZC 1RZFH 4RWHA 3ZE2F 4PJXB 2P8LB 3LKPB 1ONQB 3WS6A 4PB9H 4XX1E 4YHYB 3MRJA 4EDXB 4WHCA 4F37F 5HVHB 5JQ6H 4Z7OE 4L9LC 4H88H 4NP4L 5E2TL 1LO4H 5IOPB 3CFCL 4QNPE 3KXFE 3KPPB 4OKDA 4YHLL 4Q74A 3GI9L 2BOCA 1PYWB 5HYIA 1NC2D 1QSEE 1LHZA 2LE9A 3UJTH 3UPCA 3X3FH 5I1CH 5FIEA 1JUFB 1CVRA 1QFHA 4R97B 5BO1H 5JPMB 4HUUB 4D0CA 3DXAA 5IBLC 4PY8J 4QWWC 3IS0X 3E1F1 4NUJA 1FFQA 2H32B 3GDBA 1VGEL 4GW1B 3VXSB 4GKSA 1HOCB 5KVGL 3JTTB 3DVGB 5CMAB 1A6WL 1CD9B 1T83C 2ED8A 1KJ3H 4LARH 1S5IL 4ZXBD 5MI0C 1JPFA 1P5VA 3MNVB 4M62L 5DI8A 1EEZB 4P2CG 1UCTA 3P4NB 1MHHA 1E4XH 3Q6FA 4LVHB 2DD8H 5BOPA 4LLMA 1XR8A 1KCRH 4QXGH 4XPTL 5D7IE 4FMKA 5GGVL 4NKOA 1NGZA 5C08E 2YUXA 1YN6A 3S98A 4HG4K 2BHYA 4I77L 4Y4KC 1Q9WA 3INUL 2G75B 4L3AA 5LCVH 4M03A 2WIIB 5IFJA 5JPNB 3QPXH 1MAML 4P5KB 3AMLA 2WM0A 5D6CB 1L7IL 3CFBA 5TE6L 3K2UL 4N8VG 1BVKA 3FQTA 4UAOC 5EZLB 4Y1AE 1HNFA 1FC2D 1ZT7A 3KLDA 2NY5H 3ZHKA 3V5DA 5HJ3A 2OK0H 3QEQA 2YXMA 1DLHA 4P2QE 5CSZA 3BXNB 4P3CL 5IB5A 4JDZA 1J1PH 4FQHB 1S7UA 4PRDA 5IBTH 1XGPB 3BZFA 2Z8VC 4UQ3A 1Q94A 5DO2D 5C8JB 4IS6B 4PJDF 1FZJB 4M4RA 5JXEC 4P57A 5T3ZD 3K0WA 3C8KA 1FO0H 2JJUA 1T1XA 3J7HA 1IC5L 4WW1B 3SN6N 3MJ7A 3MRNB 1C1EL 3A0OA 3VFPA 2V2WA 5CEZE 4YHIA 5CJ5A 2ITCA 3V6OE 1INQA 5EU4B 3NH7H 3QRGH 1EJ6A 1U8MA 3CVHB 3QDJA 2HVJA 2FCBA 1ZHBA 5SV4A 3TBTA 2AQ1A 1IM3B 4MAUL 2FYYA 2J88L 8CGTA 4PTUB 2FB4L 4L4VA 4UIKL 4R2GD 4PTTA 4KK5C 2Y25A 1CXKA 3NN8B 4WV1B 2ICEB 3GJFH 2DQGL 4KJQC 5I8CA 1CQKA 3HUJB 3T0VA 5GRUL 2NLJB 3PDGA 1MCOL 1YPZE 2X4RA 3SDAA 2NY2B 5IM7A 2X09A 4DTGL 3IJYB 1G7LA 4XAWH 5FM4A 4BELD 5KN5B 1PEWA 2UWEF 4I0CC 4IRJC 4W68A 3D5OF 5FKAB 3G9AB 2BSED 3W39B 4Y4FD 1BD2B 3VMNA 2EDNA 2XZZA 4BJLA 1J8HE 1YY8A 3U9PL 4YX2L 4XNZC 3MCKB 4XCCH 1D9KB 4N0RA 1IQWL 4OJFL 4RFEB 5GJSH 2R2BB 1I9EA 2ZSWA 3VFGH 2ATPB 3GIVB 1F45A 3UROR 1JGLH 3LMJH 1F3RB 2XQBL 3PWNB 3WKMH 1UEYA 2EDQA 5AD0B 4JRXA 1HCFX 4XPBH 4EBQL 4K8RC 3MREB 3KDMA 5FXCH 1XFPA 4QT5B 4QRQA 2M26A 1KB9J 4CVZB 5FOJA 1T03H 3QNZB 4FQXC 4S2SA 4Z7QE 4R96A 2VDPL 4PJHA 5GS0H 3QQ4B 2GJ6E 3PJSA 5EIVA 2QHLA 3QAZB 4CMMA 1JN6A 2AV1B 3D39D 4NJAL 3H9SE 3RBGA 4L4JA 4P5TC 5A2JH 4MA7L 3KJ6L 3MRKA 4HFUH 2EH7H 4FG6C 5F9WC 1PZUB 5HDBF 4GUPB 1QFUH 4KTEL 1RZ7H 2VH5L 4ZAKA 2AP2A 4FABL 4UDUB 3ILQD 3Q2CA 3WO4B 5JUEH 2QQKL 4LNVA 1F3DH 4PJCA 2LVEA 1EA9C 4M6MH 3TNNB 1NCDL 3TEUA 3B9KD 1OARL 1Z9OA 3BISA 3H3KA 2P1YA 4KJYA 5DJ2B 3RKPA 3T8XA 1IKFH 2YD3A 2Z35A 3ARDA 1CE1L 3MYJA 3AS1A 3N9GH 3FB7A 4LLVA 5L2KD 4V1DA 1MFBL 3N1FC 1BOYA 3KPMB 3S37X 4XWOD 4KK9C 1MUJB 3QHZL 1QFWL 1YEFL 4HIEA 3PQYB 2EXYD 3FN0L 3BWAA 2EXWC 1RSFA 3X11A 4DVRH 3C60D 2HWZH 4AM0B 2OL3A 1NGPL 3MOQA 3IXTB 4JB9L 3L5XH 1QKZL 4FXGB 5EG6C 1KTKE 4BFGA 3WDJA 3X14A 2Z93A 4XPAL 1Y0LB 4MA3A 4G42B 4YUEL 5DJ0A 3TYGH 4GJTB 4OZIB 2GAZA 1EHNA 4GKZB 1A3LH 5SWQA 2R15A 1WCBA 3A6BH 3GI8L 3O6FA 4WW2A 3AREA 3K8MA 1OLLA 2Z4QA 5IFAL 4Z7UA 4ZUVB 5C0BB 1HHHB 4HH8A 4ZTOL 3FO1A 5GS2D 4DGYL 4U6XA 5B3JE 4PG9B 4JZJA 2VISA 3QQ3B 1K2DA 4FXLA 2VABA 1BM3H 2H6PB 2YPVH 4GSDL 2D3VA 4RMQA 3ZHLA 3D0VB 4JM2F 4OI9A 2ESVB 4LSRL 5EU7C 1F97A 4QRRA 5KG9A 1KPVA 1OGTA 4RISH 4L8CB 1FZKB 4RGOL 1UJ3A 1YMME 3IJSA 5H2BB 4JPWL 2R2HA 4GAGH 4MQ7B 1D5BA 4HQQL 3QEQD 3D18A 4OLVH 1A21A 4GRMB 4EJ1C 1EBAA 3EDDA 4UOJA 1N59A 2HYMA 4NO5A 4KRLB 1M05A 2XRAL 3C08L 5EUOB 3DHJA 1A4JB 3TWCH 5C08A 5CD5D 1T5WB 3QXTA 5JDSA 3JTSB 4X6DE 5KSVB 5GHWL 3CDCA 1VENA 5BXFB 2IANE 1P53A 2NW2B 3C09B 2RFXB 3AS3A 3Q6GL 1D5XA 5J57B 2Y07H 2PCPB 4MQXD 4LRNL 4F8TA 4Z7OF 3HB3D 4U1KB 3WD5L 1KTLB 2NY3D 4FTVE 4HUMB 4ZFOA 4QNPF 2VITA 2HRPH 3C6LD 2EECA 1A6ZA 3WMSA 3QDJD 4WUUB 4G6AC 1Q0YH 5IVXA 2OTPA 3EKCA 3OKYA 2H41A 3DLQR 4JHWH 2VDNH 5D1ZC 1ZXQA 1I8IB 1WGOA 4QHNA 3E3QC 1IEBA 3T4YB 3BKCL 1OF2A 2LV4A 5KS9A 1P84K 2QV2A 4WFEE 3V6ZA 1M1SA 4O02L 4I0KA 2ARJB 4RBPH 3SDAD 2ZUSA 1PX4A 1CE6A 5TQ2L 3RU8H 4HFWB 2DQHL 2YA2A 4BZ1H 2GFBB 1QG3A 2XPGB 3MOBH 2YRZA 4G8FA 4F7MA 1AJ7H 1DVFA 1FGVH 3RWCA 5JIHA 1CU4H 1QSFA 1ADQH 1EUUA 1CGTA 4M93C 3A67H 4YHOH 1F4HA 1W0WB 4O4YL 1FVEA 2B5IC 1CT8A 2P7TB 4Y5YB 1DQTA 4NCC2 1VADB 2V7HB 3SDCA 1I9JL 4OM0L 5D7IF 3RWGA 2EYTA 3D3VB 3BEWB 3MV7B 4D8PB 1KIQB 2F53A 2NXZD 1S9XA 3IYLW 1CTOA 1AXTL 4OF7A 5CZXC 3RVWC 5GZNC 4L4TB 5MEQB 1INEL 3IDXL 4F33A 4FRWA 2C3XA 4N8VB 3DX9A 1NANH 3CDGA 3O9WC 3J8F7 4HKZA 5E4EB 2IG2H 1UCBL 4XP4H 3VGAC 3B6SA 2E27L 2G2RB 3WIIH 2AK4B 3IDIA 4O2CA 2ZCHL 1HDMB 1T0PB 3QZWG 4BQ6A 1NSNH 3TPUB 1VACB 5IVXF 4BQ9A 1IGFH 4HHAA 5D70H 5GSRB 4AENA 5DS8A 4UB0L 1NBVH 4YK4C 1LWRA 3WIHL 5DDHB 1W72A 3S4SB 4HKBA 1PAMA 4OCRL 4GRWH 4F15C 3H7LA 3QB7C 1RMFL 4J8RA 4ZAKD 3S36X 3DUSA 2YUVA 3EGSA 3KPSA 5BV7C 3KYOA 4K71C 3V4PL 3UXFA 4PJIB 4Y19E 3GIZL 1JPTL 1T21A 4LCYA 4APQC 2CK2A 4NRXA 2MQCA 1GGCL 5SWZB 2R2EB 5IMOB 4JM2D 5J1SC 3PDOA 1M7DB 1CFSB 3HR5B 4I18C 2AJ3A 4V1DD 4OI7A 3B5TA 2UV3A 2JK5B 4FQQB 2AEWA 3TJEH 1RZFL 1FV1B 4XPHL 5C07B 4IOFD 1UYWL 4JFFB 2R8SL 2IAMD 2FD6H 2FECI 4HV8A 3HPLA 3LQZB 4NQEB 1A7BA 1LO4L 1MY7A 1KIRA 4Q9RH 4XNQB 4P2OA 2H2PC 3QIWA 1QRND 1YPZF 4I4WA 3C8DA 3SDDA 3CH1A 4P46B 4ZFFB 4K7FB 1MCJA 2CRZA 3X3FL 2QL1A 2YPLB 2W07A 1JYVA 2IC2A 1II4E 3CUPA 2JB6A 2LTQB 3DROA 1A7OH 4FFVC 2VERN 1XZ0A 3QUML 3KXFD 3ARED 1Y6NR 3IXAA 1P4LB 5ERWA 3MJ8B 2X4SA 1F11A 4LARL 3W2DH 4MS8D 2AEQH 4ERSH 4R4BA 2E6PA 4OGYH 3GJFK 3MBEB 4L9LA 4Y16A 1MCCA 1DFBH 4ODTH 3P4OA 3ULUL 3O41B 3L9RB 1E4XL 1E4KC 1BQLL 1Z5LA 3U46A 1U58A 5BS0B 2Q3AA 4MAYC 4RFNB 4X83A 4Z7QF 4QXWA 4QRRD 1FYTA 2GY7B 1TVDA 1J12A 3QIUB 4PRBA 4I2XA 5DURD 3GRWA 5IQ9A 4HAGA 2HT2D 4HPYH 1HI6B 1JNLH 4OF0A 4R6UA 3JWOC 1A9EA 1NDMB 4HG4J 1KBGL 4KVCH 5EU7E 4DCQB 5TE4H 2J2ZA 3I85A 1T83A 5JDJA 4H8WH 4NNXA 3PNWB 5I66A 1J0JA 5BMFH 2DBJA 3IDGB 1KJ2L 3VRIB 3FB6A 4HZLA 1RZKH 4XCYB 5D7SL 5C08D 3SDXB 1VERA 3MRQB 5C09B 1EGJH 4XNYH 3CFKA 1CGVA 1SBSH 4KRPD 1AC0A 1WWAX 3WLBA 4TVPE 3GGWA 5J8OA 2IPUG 3QEHA 5IB1B 4P9HC 1QOKA 3WEXA 5J1AA 2WV3A 4RZCB 3STBA 1DQQA 2DI9A 3AXLA 5E9DA 5F7EL 4FN0A 4U6VL 5DD6A 4X6CA 3L3HB 5DMGD 4D9LH 4OZHE 4H1LG 3DVIA 1J1XH 1FO0B 4M3KB 1FG2B 3TT3L 3F7VA 3T4AB 2GSGA 4OLZL 4YWGH 1QTYT 3PWPE 4GAJH 3ZL4L 4AL8H 3SQOL 1C5BL 2F5BH 5F7WC 3RX5A 3HPJA 3PABA 5D7LE 1G7MA 4MCZA 2AQ3A 5ETUA 5ICZA 1K85A 1DUYB 1KIPA 4LDLB 4YLQT 2AI0H 1KTDA 1AGCB 1MRCH 4MA1C 2WLZA 1K4CB 1JFQH 3VFSA 2RGSA 2VO5A 5D7JD 3TBWA 2YPKB 1EFXD 3HZVB 5FO8A 3BMWA 2BCKA 3IS1X 4CVUA 3BN3B 4NKQB 3E3QE 5HHNB 3GJFB 1YECL 4Y2OA 5JXEA 4M43L 4OFIA 2BNRB 5D8JH 1AE6H 3O11A 3HS0B 4GKNB 3O6MH 2X05A 5K9JH 1TVBA 2NY6C 5B3JF 4FQLH 5CS7A 5EC2B 2W9DL 4QRPB 5F1KC 4AH2B 1HHIA 3L1OH 2D03H 1MCWM 4JDVB 4YPGB 3RZCC 4AQOA 3NCFB 2Z8SA 4LLDB 3E6FA 3BGAA 3MRIA 4ZSOE 1DEEA 1ES0B 2I9LB 5FUZH 4PJGE 4XCCL 3HNVH 3LD8C 3DVNA 3ROOA 2EIZA 3I02B 4LVEA 1H5BB 2D0GA 4Y2DC 1T66C 4EQ3A 3W11D 4NDMA 1G1YA 3QUZA 3BJ91 5ITFB 4B41A 4G8IA 5C0CB 1MHPH 1U93B 1VEPA 1MIEL 1EO8H 2NXYD 1CLOL 3ARGD 4KK8D 5HHOB 5I73C 2GSIB 4XZUA 3VXQB 1KCSH 1J8HD 4KKCD 5I8OH 2VUYA 1KC5L 5LQBH 2DWEB 1JWSB 3OKDB 5GS0L 4LU5L 1JYXA 15C8L 5DQJA 5HGBB 4X6DF 2DQEH 4UILL 1UXSA 3KPSD 2H3NA 3BDYH 2YD8A 1J05B 5ESVB 4QHMB 1JCKA 2EH7L 4MHHI 1QFUL 1RZ7L 4LSVH 3PGDA 3PWJA 4ZODA 3RL1A 5E8OB 1HINL 2VLJB 4M3JA 1TJIL 1XR9A 1G9MH 4HBQA 4PLNC 1U95B 1XGYH 5GRJH 2D9QB 5HYJA 3OKKA 3QSKB 1S7TA 5DJXB 4A6YA 4FXKB 1A64A 4F3FB 4TYUA 5EU6A 5DJ6A 3H9SD 3U6RB 4FQXA 1AQKH 4LQFH 5FF6B 4NIKB 1U3YA 3GMRA 5EA0H 6FABH 2O93L 3DGCR 1PKQA 5ESAB 1DLFH 2A6JB 2RB8A 5EIQA 2RR3A 4OKVB 5TGBB 1CXLA 5A2IH 5ALCH 5DRWA 4LCWE 1AXSA 3QG6B 2W0FA 3MLUL 4OD3L 4P5TA 5DLML 3QCVL 2X70A 3P4MA 4M48L 4I3SH 5D1QB 1QPXA 1FLRL 1ZHNA 5F96L 1NUGA 3UTSB 1RIUL 5EWIH 3NCEB 4ELMA 4Z7VE 1IC4L 2ZUTA 5DZOA 2QTEA 4YGAB 1NBYB 1G6VK 3EJJX 4NO2B 4IHOA 1NUFA 1P7QA 5F9JA 4U31A 5DFTA 1T22B 1V5JA 4RNRA 2A77L 1S3KL 5HVGB 1GGTA 5FYJL 1A3LL 3WL9A 4X7TA 5GJTL 4JRYE 3A6BL 2H26B 1N6UA 2R29H 4LMQE 3RWEB 3D69B 4OCWL 3QJHA 5HHQB 5HBBA 2JCCA 1X4ZA 4RBPK 2J7LA 4W4OC 4M1GL 1U8HB 4JY6A 5I19L 4F58H 5BVPH 4KDVA 3RVTC 1EUTA 1T5XA 2CLRB 3TIEB 3RTQC 2VDRH 1J1OH 4QOKB 3U4EA 1T2QH 1CFQA 1XCTA 5JIKA 5F6IC 4N1EA 5ENWA 5HGAB 5ISZE 4HSQA 1N5YL 2V7NA 1RHHA 5AWNH 4QWWD 3O8XD 4PGEB 1L6XA 1JNHA 2X1XR 3ARSA 4CADA 2FIKA 3PWUA 5DGQA 2V5MA 1A0QL 1OP5H 2GT9B 5EO1A 3AB0C 2DMBA 3MXWH 1FHGA 2BHUA 2OXGA 3HE6D 4K3DL 3BE1L 4ODHL 3DYOA 1GPOL 4ZOCA 1CGSH 5FFLA 3UBXG 2JTDA 4UV4L 3S37H 4JR9L 2Y36L 1BGXL 5LG1A 2YSSA 3FFCA 3MRBB 1LDPH 3L3GB 4PRHB 4MNQA 4NYLA 4K2UH 3MNWB 4NO0D 4UOW1 3ZYJA 1YMMD 2JB5H 3BVNA 5E9DD 5J6GB 4LF3B 4UUJA 4Y4KD 5IHLB 4PGBA 5JOEA 1MFAH 2V2TB 1AR1C 4FFYL 4X80H 2P5EA 4O2FA 1CGYA 3CLEL 2B0SL 5E6IB 1KFAL 4ODSH 1BFVH 4XNMB 2J8UA 1ZLSL 4JHAH 1CFVH 4PRPB 3LN5A 1Z9SA 1WZLA 2X7LB 1QP1A 4DAGH 4RRPA 4PJFA 3DYMA 5FA3A 1SM3H 2LAGB 1IAIL 3BX7C 5KVFL 2PO6B 2IAND 3L3DA 2OP4L 2VDNL 1U8OA 3VH8A 4PLJC 4PIRF 1N0XL 3QEUB 4LVOB 4Q0XL 3FL7A 1QHOA 1CZ8L 3LB6C 4FTVD 4GMSH 3WIFB 3RJDA 1C7TA 1P84J 4OZHA 3T08A 4KUZL 3T09A 1ZWIB 4MJIA 1JTTA 1S7SB 3GSOB 3C5SB 3O45B 3PUCA 1HIML 4O5LH 3MOBL 4JKPL 3G6JA 1CTNA 5J1TC 1FGVL 1ORSA 1YEKL 1CXFA 5D7LA 3TNMB 2FATL 2Z91B 3HE7B 2O5ZH 1IJ9A 3VXMA 1G7IA 4N8CL 4WFED 1ZEAH 3MFFA 3RHWF 4MCYA 3N1MC 4MVBD 1E28A 1R3LA 2AV7A 1AFVH 2NX5E 1S7RA 5D1ZA 5LBSH 3KPRE 3L5WB 5D6DA 3KWWB 1HQRA 1K5NB 4WHDA 2XOTA 4OLXH 1ZT1A 3ROLA 1AD0A 4ZQKA 5DD1H 4PJ7A 1FIGH 4PRAA 1QVOA 4NWUL 1SHMA 4L8SB 2IG2L 4ZYKB 1I9RH 1FSKB 1HEZB 4MD5B 3WIIL 3B8YA 3EFDL 1P7KB 4IRJD 2UY7A 3IU3A 4UNTA 4EUPG 5JO5A 1U6AH 5IV2B 3OAYH 1H3GA 4TSAH 4MNHA 5HXMA 1JHTB 2MHAB 1NSNL 2B7DT 3QHTC 5FV1L 2GITA 3TO4C 4LP5A 4X98A 2R1WB 2Q8AH 5KSAB 1LO3L 5D2LE 1NBVL 3MCLL 4WNQA 1I9IH 4MJ6B 4NKDA 3P77B 4WEUD 4YHMH 4OGAC 5HHMB 2HN7A 1IBGL 5EO9B 1QSEB 2CDGB 1PQZA 5C92A 1IAKA 4HMDA 4GRWB 4QXUL 3TN0C 4B0MM 2J5LB 4L3EB 2FJGB 4HF5L 2FSEB 2ITDB 5A43C 4OZHF 1IGYA 5F7DB 4PJEE 3HI6L 4I5BA 3TA3C 4DGVL 3O9WA 5IUSA 4U1IB 5EULV 3U30B 2X6MA 4X7SL 4ZD3H 4XCEB 4M6AA 3F12A 4X7CC 3QULB 1YNKH 5FHAH 2CGRL 5F1IB 3KYMB 3HTLX 3BYTA 4PBVC 4HIJB 5IG7B 3RNQA 5C0ND 1IL1B 1RPQA 3QPQC 3MLTB 4PV8A 5IFHL 3IVKB 5CLTA 1HXYA 1B6UA 3I6GA 3RIAF 4G7YL 3MRCB 4MDIB 1GGIL 4R26H 4X5LA 3RWIA 2FR4A 3EJZC 3D1MC 3T1FA 4FG6D 5C0IA 1JRHL 3OMZA 5TQ0H 5T3XE 2IBZY 3TM6A 4OB5H 1NCTA 3N85H 1RK1A 3DX7B 1XF4A 4JJHA 4XHJC 3AVEA 1E4WL 2I25N 3QCUH 1H3WM 4APQA 5H94B 2EDTA 4YDIL 2P5WB 1FNLA 1FAKT 3REVA 1IC7H 1TNMA 4WHYH 3G5VB 4NQDB 3M8OH 3H7BA 3NOIA 3T65A 5EBMA 3RGVA 5F9DC 3FT3A 3VRJA 4I18A 4WO4B 3UMTA 3PP4L 5DFVD 1XMWA 3CPLA 3VXTB 3DRQB 2APWA 3GJEA 4PJGF 3RY6C 3UTZB 2PKDA 3OAZH 4Y1AB 4KMLB 3MRLA 5C9JB 5D7KE 2H1PH 5FECA 3LV3A 1CGXA 4RGNB 1G6RA 5EH1A 4ERSL 3LH2H 3FRUB 3QXAA 3WXVH 5D2NB 1IAOA 4U1SA 4YHZL 4W6XB 2BFVH 1D3CA 3ARUA 3GKZA 1YYLL 3SBWC 2JIXB 4ZO9A 5EIIA 4YBLC 2NR6D 4DZ8B 4NJ9H 1RUKL 8FABB 5IF0B 3ZMRA 3OX8B 1OCWH 1BMGA 4X4XA 1JWMB 5I1IH 2F54A 4WWKB 2O61B 4O9HH 4JPIB 4K3JH 3C6SB 2Z8WC 4HPYL 4ELKB 1JNLL 1S9KC 5DD3L 1V7NH 4UDTA 4KVCL 1BX2A 1K3IA 3U2SB 2YA0A 5I2IA 5FCSH 3BRGC 3BHBB 4OQTL 1PBYA 1LP9E 5HPMB 4MB5A 3TT1H 1GOFA 2B1AH 2DQJL 4JN2A 4P23B 4PJ9B 5K93A 3WHE0 4OFDA 1MQKH 5JW4R 5SWSA 3FFCD 1MVFA 5I1DA 1I8MA 3HZKB 2PXYC 4NZRL 4HWBA 1E4KA 2M1KA 3Q3GB 2DIBA 5GGUA 2GTWA 3FQUB 4GRLC 4MAYA 4KMTL 1BEYH 5E99L 4ONFH 2V9TA 3D2UB 3O3DB 3ARBC 5CZKA 1Q0XH 2G5BA 5B38A 1EEUA 1KPUA 3CMOL 4D9LL 4QXTB 4OLUH 2QLVB 3F62A 2BSSB 1S7QB 3IJHA 1NUDA 2W9EH 1S7VA 2F5BL 1FIEA 4Z7VF 1FL3B 3HAEA 2P8MA 3DMMC 2AJZA 4E41E 1F3DJ 2YD2A 2B4CL 1WV7T 4E0RA 2QKIB 3QUYA 3PGFL 1VA9A 2HG5A 3FKUS 4NGHH 4GKOA 2BP3A 1U3JA 3PWPD 3G5YA 1ND0A 3HC4L 4ZNEE 1JPGA 4M5ZL 3BO8B 5HYQB 5IESL 4N0UB 3FT2A 5DUBA 4D2NA 5IMKA 5GRVK 4JY5H 2X4PA 2YR3A