4S2SA

Crystal structure of fab fragment of monoclonal antibody roab13
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
224
structure length
219
Chain Sequence
EVQLQESGGGLVKPGGSLKLSCAASGFTFSTYAMSWVRQTPEKRLEWVASISTGDNTYYTDSVRGRFTISRDNARNILYLQMSSLRSEDTAMYFCTRGRGDRGDLFGYWGQGTLVTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RoAb13 Fab Heavy chain
publication title A Linear Epitope in the N-Terminal Domain of CCR5 and Its Interaction with Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 219
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s2sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s2sA01
4HUUA 1RULL 4NRXB 3TT3L 4JKPL 3QA3A 2VLMD 4QF1B 4BQBA 1CFVL 3G6AA 1OGTB 3U48A 1GOHA 3SE8L 2AS5M 4RSVA 5CHNB 4FXGB 2FLRT 5TFSL 3JBG7 5HI5C 4XCYA 1XF3A 2OZ4A 4TSCL 3WKML 3FT3A 2FO4B 2F54D 4WV1A 2F19L 1MRCL 3QUXA 4P4KA 5B22A 3TBWA 1IEBB 5C2BH 1IQDA 1P4LB 4P2QD 2FJHB 3PWUB 2UUDK 4QY8B 2JJVA 1Z9SA 3QIUC 2DQDH 4JHBA 3EO9L 5A2IH 4JN1L 4K3HA 5T3ZL 3F7YB 4ACPA 5HHOB 2BC4B 4X9HA 5F3HB 4F7EB 5FECA 12E8L 2V9TA 2LVCA 5I0ZA 3GUTA 4WY7L 5E9DB 4JZJA 5DJ8A 3FB8B 3AUVA 2NTSP 5C0IA 3TNMB 3QHFL 2R4RH 2BHZA 4Z7QF 2IG2L 3ULUF 1K2DA 1WIUA 4PJEB 3A6OA 3AREA 2DWEA 5D2NC 1BBJB 4Q9BA 3MGOB 4U1HB 3MRMA 1CGSL 3FAWA 4Y5VC 1NMBL 1V3JA 3EYUL 3W9EB 3WJJA 1AGBB 4TUJB 3I6GA 4QRTA 4WTZA 5GIRB 3MYJA 4G6KL 3UTOA 4J4PC 5E00B 5HYJA 1D7FA 1RZIB 2BVOB 3MRNB 1N6QL 4HSQA 4PR5A 1QUNA 1U8IA 3LQMA 1RZ8A 4YO0B 3ROOA 1T0MA 1MF2H 4FQPA 1JVKA 1G9MC 5H8DA 2VERN 2EDQA 2EZ0D 4RAHA 2GK0B 5HI3D 2YK1H 2YPVL 4KK9C 35C8L 1XGPB 4F3FA 3EO1A 4XWGH 3BD4A 5DS8B 2WWMD 4LSVL 1LEGA 1A7QH 3KPLA 4I48A 2YUZA 4O4YH 5INCB 1QO3A 4GQ9H 3S9DB 2XRAH 3U46B 1CFQB 2AKRB 3ZYZA 2FHFA 1BQLL 2NNAB 1G9ML 2WBJA 1SBSH 1IGIL 4NQDE 3VFOB 1HHKA 1JF1A 1YY9D 3PHOB 3FL7A 5T3XD 4ORGB 4OZGF 1H5BA 3CK0H 1JNNL 1ROWA 3MO1A 3QUYC 3S88H 2DL2A 3IFNH 3WSQH 1CLOH 3CX2A 4OIBA 5I18L 1BBDL 1YA5A 4X7SL 3E8UH 5IV2A 1PG7W 5DJ0B 4OZIF 1JHLL 1RZGB 2M26A 4GRWH 3FO0H 3MX0A 3QULB 5IIEA 3O8XA 2A83A 4PJHE 2OK0H 1KJ3L 1D6VH 1I3VA 3K4DA 4XCFL 5FDWB 2Y5TA 2MKWA 1CDGA 3ULUD 4P46C 5D7IF 1HILB 4KI5D 4LAQH 4K23L 4HWEH 2EXYC 4JREB 4KJYB 3QDMD 4HEME 3QH3A 2G2RB 4RBPK 5D9SB 2VC2H 3HNSL 4CDHA 3QCUH 4YHYB 1V3LA 3BQUB 2DYPB 1IQWL 3DVGA 1FSKB 2XKUA 4HLJA 4YBHA 1HYRC 3U9UB 4PRAA 5ALCH 1PDKA 5LCVH 2W60B 1CGUA 4D9RD 3IETA 3LRSA 1MH5B 3LN4B 1W72L 3QUZA 5J3HC 5EA0H 1RHHB 5DRZB 3DHJA 3K1DA 4HGMA 5E4EC 4L8SC 1CIUA 5D1XD 1CTNA 1UB5B 3V6OA 4FQ2L 1Q9OB 3PP3H 3LS5L 1LP9E 4LPWA 5C0AE 4XNUL 3EJZD 3QNYB 4FFZL 1CVRA 5AZ2L 3VMNA 4FS0A 4KROD 4GBXB 1R24B 4ZFZB 3TVMC 2R0WH 2B4CL 3KYKH 3CMOL 1SEBB 4JKMA 1JPFB 5TGBB 2BFVL 3QNZA 3NZ8A 3I3BA 1T20A 4P4RA 2VDRL 4OM1L 2X4TB 4RDQG 5TE7L 2JE8A 1ZA3B 1QBLL 4D0CB 5DHXB 4YGVB 4XB7A 5IHZB 2BSSA 3BGMA 4EVNB 4F7MB 3GSWA 3EUUA 1MLBB 2EC9U 3U7YL 2QBWA 4OLXL 1U93B 4E0RB 3E6FA 2HKFH 2EXWC 4R4FH 3K7UA 2NR6C 1NKOA 1U92A 5BO1L 1ZGLA 3U79A 2FX7H 3AXLA 1GSMA 1CD8A 1E4KC 1WBYA 4MD0A 4IS6A 5TH2A 1DVFA 3SO3C 3U4BH 3W39B 4HMDA 4BSVB 4XP1L 2VXUL 4YXKL 1BD2E 3VW3L 3PDOB 1NEUA 3T09A 1FE8L 1CGYA 1S7TA 3OKMB 3RKPA 3TZVC 4HXBL 1UM4H 3P4OA 3F5WB 2WUCL 4FTVD 4PJXB 4HXAL 3GFUA 4XBPB 5C0FA 1RJZB 5GGVH 1R3KB 1ZVSA 4G7VL 5I8CA 5F9WB 3UTTB 5ICYB 3PWVA 4MJIE 5DC4B 3DSNA 3E2HB 2WZPD 2DLTA 4FMFA 3V4UH 2QR0A 3OAUH 4PG9B 4UBDD 3UAJC 3FB7A 5ADOH 2BNQE 1HKLH 5BQ7B 4FABL 3FN9A 4AH2A 3LV3B 4ODBD 4G9FB 1DBBL 4L4VE 1KPVB 1MCPL 2IBZX 5I30L 3MGTB 4EUPB 4N1EA 3NCEB 3LIZH 1CDBA 4AIOA 2FBOJ 1LO5A 2WP3T 3P3YA 4PP1C 2W07A 2J8UE 3F62A 5I6XC 1CG9A 1G7IB 1BJMA 3QUKB 2Z35B 4L8DB 4XRCA 4OQTA 5EUOE 2AERT 5D1ZB 5ICXB 5FOBA 1VEMA 4LBEA 3DTXA 2R29L 4U7SA 4XWOC 5DD5L 4BFGA 1P6AB 1RJLB 1QR1A 3TYGL 5DWUL 1NH6A 4HK0B 4N9GA 1RZ7L 5D8JL 3C6LB 3EHBC 4LHJB 4QWWC 4UAOC 4LSRH 1RZJL 4GAYB 4LLVB 4QRQB 2YMXL 2FHBA 2P8LA 5I0DA 1ZHLB 2AVGA 1VFOA 2L7JA 5HVFB 5I19H 3L7FB 5HHOD 3LEXA 2HVKA 4OKVA 1NEZB 1PZ5A 3GBLA 3TYFA 1JWSB 1NC4B 5J6HB 4YZFE 2QKIB 1UJ3A 3FQNB 4AJ0A 5CJ5A 2C7UA 4MAYB 3ULSB 1GRWA 4XXCC 3RWCA 3UZQA 4AQ1B 4O58H 4DKFH 1UH4A 3HMWH 3D69A 4NKIH 3VGEA 2AJZA 3RI5F 2IALA 1A9BA 2NTFB 5H37H 1A7NL 4U7KA 1LE5B 3QIBB 3OJDA 1NSNL 2XPGB 2XKNB 3GMNB 5MP6L 1QSZA 3VG0H 1J86A 2ED7A 1AQDB 2FZ3A 5CSZB 3OKEB 2AAVA 5FUZH 4WIQA 4XBGB 5FHBL 1KNOA 2R2CA 4MCYB 4Y2DA 2Z91A 3ZKSD 4JCLA 3UPCA 1MHPH 1C5BL 3LRGA 2R0LL 4CUCA 1ZT7B 1CQYA 5F44A 4X6DB 2ZNXA 3S8WA 1A4JB 1I8LA 5KAQG 3Q5YA 1DQLL 5C0RL 4XP4H 1ZLUK 1JL8A 1R3JA 1M6OA 4NN6B 4OUUB 5DJYA 3WN5B 3SE4C 4P5TB 3SDYL 4S1SL 4EN3C 4HCRH 3CFBB 3OG6B 3WXWL 4W6WB 3MJ8B 5JW4M 4X6BB 3G5XA 3HNVL 3N1MC 4K3EH 4OLVL 2X6MA 4HIIA 5J8OA 3LN9A 1FV1A 5ID1A 3MLXH 2DBJA 4ZOEA 4DN4H 3VU2A 4NKMA 1JTOA 2GSGA 1KB5H 3JV0A 4JO1L 1IC5L 4TVPH 2P8PB 1IKFL 4PY8J 4XVUC 4YHOL 2OSLA 5K9KB 1ZT1A 1R5IB 4G6JL 4U4BA 4S1QL 3O6FD 5JW4Q 1JHTB 4PYHA 1IEHA 2VABA 4PLOB 2EKSA 4HUKB 5D7LE 3QIUA 3G6DH 5B21A 4ENEC 3SHSA 4Y8DC 3AS2A 2OR9H 1WZKA 4E5XB 5MENE 2DBLH 2H9GB 1FGVH 4YE4L 3WUWB 5IFJA 5EOQH 3A67H 1B0RA 1ORQB 4WI3A 4S0TD 1OTTD 2FHCA 4POZD 4MQXC 3BQUC 1KN4L 4KY1L 5CGYD 4OI8A 3MYZA 4U6YB 1J18A 2ZUXA 4PJXF 1RPQA 3UTSE 1CL7L 5DEGB 5D2NA 1S7VB 4R2GC 2DYPD 3IGAA 2VKXA 5FGCE 5HBBA 4Y5VA 5DQJA 5IB5A 4Z7WE 3CMGA 5FYJL 2MMXA 4UU9B 3BKJL 4P3WA 1DUZA 4J4PA 1X5FA 1AJ7H 4PJBE 4ZUVA 1U8PB 2E7MA 4JQXC 5FA4A 4G80B 2UUDH 3R8QA 1WTGT 1QFUL 5TPWH 2EIZA 4M5ZL 2NCMA 6FABH 3ARFC 1PBYA 1M7XA 2DQTL 2R56H 3G5ZA 3PWLA 4HKZA 1TZIB 2FX9L 4GSDL 1JV5A 4YDKL 3I2CH 4H1LA 1HHIA 3RUGB 2A38A 4ODUA 3QEQA 4M6OH 2HFTA 3X12B 2RIKA 4MWFA 1EUTA 4CN4A 1U3HC 3RWHA 1MY7A 2Y07L 4WTWA 3JWOC 3VFGH 2DN7A 5T33L 5CINL 2ZUYA 3K2UL 4WHYG 4CRPA 2CH8A 5JHDE 3MNVA 5DXWA 2CLRA 1KB9K 1EGJL 5GRJH 2H8PA 5BZWA 2Q86A 3VXUB 2Z0BA 3QUYA 2ORBL 1UWGH 2CK2A 3MJ9L 1A7PL 4GRWB 1I7ZA 4KTEL 5F8QC 1BGXH 1HXYB 4PGCA 4M7LL 4ZS6D 2HKHH 3VFRB 3VD3A 4HZAA 5IHUL 1CICC 1VPOH 1YC7A 5KJRL 1PD6A 4GS7C 1F90L 4ZTPL 3MLTB 4ZUTA 3VD9A 5J1AB 3RNKA 1KB9J 4GUPB 3BZEA 4U33A 2ERJB 2J88L 2IH3A 4MQ7B 2ZOKA 2YEZB 4P46A 4X6EA 3MREA 2I25N 1I3RA 4XTRD 2OYPA 4O2FB 2LABA 3SOBH 1WCBB 4XNMA 3UTTD 3FHQA 1VFAB 2IPTH 4KH2A 3VXQB 1MFEL 3V8OA 3GMLA 5D6CB 5HHME 5ACZB 4X6DF 3RWEA 1RIHH 2VZVA 5SX4I 5KVMC 3LKPB 1MUJB 1YY8A 4NQCE 3OR7A 4OGXL 4QXWA 1NFDA 2NX5B 3GJFK 3BH8A 1I7RB 5H35B 1QRKA 3S4SB 4L8SA 1Z9MA 4OCSL 3RGVC 2XA8H 4WRLA 3S34L 2HRPH 2BOCB 1U91B 4KKAD 4WUUA 2ESVE 2L7UA 4FQJL 2O61B 5D1ZD 4G7YL 1FVDB 4LASL 4JM4H 1I1FA 1OTSC 1OHQA 5D7SL 5IM7B 4J8RA 2QQQA 3TVMA 4KRNA 5IBUB 2V5TA 4GAJH 4IDLA 4Y19B 3WHXB 4LQFL 4MSWA 4JFXB 4WGVB 3BKYL 4RBPH 3MLYL 1XZ0B 4NM4H 2YBRB 1Q0XH 2B1HL 3VXSA 4IHOA 2AJ3A 5C07B 3UYOD 3Q3GB 3VI3F 1UWEL 4GG6E 5IW3A 2XTJE 3EOBB 5SWQA 4U6VH 1I4FB 4WWKB 3LKQA 5IG7A 4OAWA 3S35H 2BNRA 4PUBH 5SWSD 3QIBC 1EMTL 1GGIH 1V7NH 5E8EB 3OKKB 2FSEB 1BM3L 2VAAB 1C5CL 2B2XL 4QTIL 1E4KA 3GMQB 4HF5H 4M6MH 1TPXB 2P24B 1AQKL 1OP5H 2F58H 2G75A 2X89A 2D0GA 1DANU 3UO1H 4OV5B 2X4SB 3FN3A 3MRIA 3W2DH 2OTWB 4ZXBC 3T0BA 5C08B 3TZVA 5EO9A 3BT2L 3BW9A 2PNDA 1M71A 3DUSA 5E95B 4LEXL 4JPVL 1AHWB 4NGHL 1T03H 1R5WB 1RIVH 2BVUA 4K71B 2CUIA 2AEPH 5DZNA 2NY0C 3QCVL 3PGDB 5GS2H 3GNML 4MJ4A 1FNEB 3RGHA 1I8KA 3L3GA 5EBGA 4RX4D 4R97B 3G6JB 5C0ND 3B8YA 3MV9E 1AKJD 3GM8A 1U41A 5ANME 3MRBB 1PG7L 4HH8A 4P5TD 1EO7A 1ZANH 3NCYP 3C09C 3RZCC 4DOHE 1QSFB 3H9SA 3CUPB 5HVHB 3L5WB 3ULVC 3BJ91 3OJ2C 5I1HH 1DQTA 2FO4A 2ATPB 2FIKA 1LE9B 5CWSB 3BFOA 2VDQL 4JFPA 3ARTA 3LKSB 1FH5H 4UT9L 4EXPX 4OZFA 5GJTH 4R90H 4FA8A 2LQRA 4YDJB 5C2BL 4JY5H 3V5HB 2C5DC 2EE6A 3QP3A 4F7EA 2A77H 4NO2A 4ZD3H 1HSAB 1DLFH 4GRWF 1IM9B 2Q8AH 2CXKA 3BP6B 3O41A 2AV7A 1DUYB 4M43H 3AU1A 5HHVH 1R5VB 1RZKH 5L2KA 3D2UB 4YHNB 3X3GH 3FRPG 3MNWA 1XGYH 1J7VR 1YEGH 3TNNB 5CEYA 1CBVL 5ABDE 1D6EA 4G8IA 1H3WM 2CGRL 2W92A 1EBPA 2R4RL 2CJUL 3DMMD 4JKKA 2XNAA 4XXCA 2EC8A 3MNZB 4X7TA 2FNBA 3W9EA 1A1NA 4Y2OA 2FB4L 3WNLA 3QR2A 3GMOA 3VXRA 4DCQA 3S3JA 2FEDC 4RMQA 1RZIA 2VLME 3K46A 2VL5B 2WNGA 4HWNA 3P4NA 5F7YC 2NXYC 1RIUL 5DHVH 4EOWH 3D0LB 3HZMB 4P23B 1QHOA 1L9MA 2BVPB 2F54E 1CDHA 4PB9H 3NIFF 1TZHA 2H26A 3SPVB 4P2QE 4I77H 4OFDA 3RTQB 3LN5A 5GSRB 2YK1L 5CBAB 2NY2B 5DF0A 4XWGL 3GO1L 2APVA 2HMID 5EZLB 4LHQB 2P44B 2NY4B 2AEIT 4J3WA 1RU9H 1UB6A 3PHQB 3SE4A 5GSVA 3T2OA 2XRAL 4EN3A 2VYRE 3CH1B 2Y23A 4JHAH 1HOCA 3DX7A 4Y88A 3MODH 3ARVA 4WI5A 2IFGA 3LHPH 1V05A 2V17H 2AK4D 1RZFH 5DMGD 1S7WA 2FD6H 5CJBA 3THMH 5IEKB 3CPLB 3MOBL 2A6IB 2X4PB 3S88L 3VXUD 1CFTA 1UCBH 4B7IA 3IFNL 3WSQL 1CLOL 3QULA 3ZTNH 2HJFB 3E8UL 1ZGLP 4QLRA 2X1OA 5IQ7H 3K74B 4NSKA 3IFPB 4K07A 4KMLB 1ZT4A 5EPMB 4Q9RL 2FJGA 2YZ1A 3WL9B 4XGZA 3ALXA 2A2QT 3MLSH 2XWTB 1CFNB 1X5YA 2OK0L 1T0NB 5DEZA 3OF6A 3QAZC 1D6VL 2FECL 4YHML 3PWNB 3BP7A 2MQ3A 4GRMA 4XXDA 3BQUA 4OBSA 3GI9H 4LAQL 2C26A 4KTDH 3NA9L 5LAXA 2XN9D 3SDXF 1P4BH 3RWIA 4X4ZA 4MDIA 4NOFA 5EDXA 2EE9A 4NC2B 1F4YH 4QHMB 4QGTA 3VXMA 1MCQA 3F58H 4Z7OE 3IJHA 5IESH 4U1LB 1S7XA 5T3XE 2CIKA 4F7PA 5LCVL 4HWZB 4OV6F 3V5DA 2FGZA 1T5WA 1D5XB 2NX5D 5DJ6A 5EA0L 1YPZA 4HC1L 4R7DB 3IDUA 1Y0LA 4PTTB 3J8F7 5DRXA 4JQXA 5KVFH 3K0WA 3K4ZA 2VQ1A 3ELAT 2DQEH 4MA3B 2X70A 3SDDB 3ARFA 4OF8A 2YD5A 4OZHB 5B8CC 5T1DH 3ZDXF 1EGJA 4NQXA 3G9AB 5BRZA 3NGBC 3BE1H 3KYKL 2FYYB 5DRNB 3W11D 1HINH 1DE4B 3QDJA 4Y19D 5EWIH 2OTUB 5FUOL 4FZEH 1XIWB 1U3HA 5C2UB 4KI5E 4OIIH 4LLWA 4EDWL 4EI5B 4G6AD 3VXTA 3QDME 1U93A 2IGFH 3V0VB 2ITCB 3CXDH 5C07D 2YA0A 3BX7C 3LB6D 3L3HB 3P2TA 2UYLA 4M7KH 5IBLD 4AQOA 3D3VB 1FZMB 2ZNWA 1GL4B 2UWEB 4N90E 3SBWC 2AJUL 3MUY1 4WWKD 2CDEB 2CKBH 3B5GA 4O00A 4YHIB 3TESA 3RVVC 4D9RE 4LLYB 5IBTH 5HDBF 4HJJL 3GGWA 4KQ4H 2FX7L 1PLGL 3CSGA 5GGRA 4JM2C 2W0PA 4G8GA 4RMUA 3U4BL 1CICA 1J0IA 4CVZB 3MLUL 2VDLH 5DMKA 1T4KB 5E8OB 2Z8VC 5C08D 4K71C 3FOMB 1UM4L 4GMTH 3TBYB 2BNUA 3SGKC 3MRDB 4DFHA 4PJCA 1LO2H 5IVZB 1KIQB 4DKDC 1BJ8A 5C0CA 5JORA 2P5WA 4MD5A 3PWPE 1MJ8H 1OGAB 1MJ7L 3NAAL 4YQXH 4Z78B 3OAUL 4G9FA 3DX6A 4FQ1L 4BSJA 4IRZH 4QRUA 4UIMB 4EUPA 5DHYB 2NW3A 5ADOL 4C4KT 1HKLL 1NUFA 5KS9E 1H3XA 4KKBC 5ACMA 3T1FB 1BPVA 2GFBB 1G7IA 3WMSA 4JY6B 3CLFH 4FZ8L 4F37F 1WC7A 1QBMH 3LIZL 5CD3B 1QSFD 3QEGH 4R0LB 1C1EH 1N59B 5L0QB 3HPJB 5HGBA 3R4DA 3HE6C 1WFTA 3RGVA 1JYXA 2IADA 1DR9A 3CFKA 1MCBA 5F89B 3ZDZF 1AGCB 3HZYB 5HGHA 2V5YA 3DURA 3V4VH 1YEEH 5IMLA 1DL7H 1BX2B 4LLVA 2ZCKH 2NXZB 2P5EA 4BFEA 3BP4A 5FK9A 1PVHA 4PP2B 4BZ1L 3BH9B 1OQOA 1U9KA 3N1GC 4XPAH 5H94B 5TDPA 4JFEA 5ILTH 1EZVY 2OL3H 4FTVE 4LSRL 4ODVH 4HIJA 3KPQB 2WIIA 3CFJA 3T4YB 1A6ZB 2A74B 1IM9D 2K7QA 4F33B 4AEHH 4Z7UB 5I19L 1UM6H 3FQNA 4GKNA 4Q2ZA 1E4XL 4LNRB 4PJIE 4A6YL 3MV8B 1I7UB 1YEJL 3HS0A 3D2UD 4MAYA 2RFXA 3REWB 3VI4F 3QXAA 1B6DA 4N5UA 4QHKI 5JMRA 3GJFH 1R3HA 4OD3H 2HAZA 4YBQC 4U1NA 2NTFA 5LG1A 3OKYA 3QIBA 3DOSA 3OXSA 3MZGB 5IB2B 3HMWL 5TDOA 4AIXA 4XBGA 1LO3H 1BFSA 5EIIA 4HUVB 5FF6A 4S2SA 5I73C 4HFWB 3BPOC 5D2LA 1UYWH 4HJGA 2EDEA 4M1GH 1J1OL 4JZNB 3VG0L 4ZXBA 3DJ9A 5FUZL 3SY0A 4TNVF 2APTA 4P23D 5ID0B 5A2JH 4KJWD 5KVDL 1C08A 1GC1H 4LP4A 5D4QA 1NJ9A 5EU5A 5J11B 3VFUA 3RTQD 1MSPA 4HIEB 2F53B 3P11H 4PGBA 4GW4B 3RWJB 2NY2D 1FFRA 4OCMC 4XNXH 3RVWD 4X6BA 3AS3A 4M8QB 1QQDA 5JLZA 2NY4D 3E3QC 5HHOE 3QG6A 2JELL 4DVBB 1N7ML 1NCBL 1CWVA 2R23A 5E9DE 1NPUA 4OFKA 2WLZA 4RFNB 4HCRL 4OZHF 3RZCA 4K3EL 2AJYH 5D7JB 4TVPD 2WIMA 4JQVC 3SGDH 1TETL 4IRSC 2FATL 3DX8B 5K9KA 4DN4L 1ODAA 1MFDH 5BMFH 2PUQT 4PJEE 4F7CB 5J9PB 1A1MA 1VKXB 5I16A 4QYOA 4WHCA 5ACLA 3FFCB 1WQVT 5C0GB 3EKCA 4D2NA 2IQ9H 1FHGA 2UWEF 4E5XA 2EZ0C 3LQAH 2VXTH 4OCRL 4S1RL 3QPXH 3G6DL 2W91A 1PKQA 1SEQH 2C4XA 4RFEB 5DD1H 2OR9L 4NM8H 3GIVB 2DBLL 2CXGA 1E28B 1T21A 3HG1B 1KIPA 4L3EB 2G5BB 2UY6A 2BDNL 4U6YA 1ONQB 2ZUUA 5DVMA 4M1DH 5DEGA 2VL4A 5MI0C 2CPCA 4NHCH 3GSNB 5I1LB 4DGIH 4M9OA 4X4XB 2ZWLT 4PPTA 1YY9C 2QADB 3MRLB 1F13A 1ULVA 3DVNB 5CJQL 1IAOB 3SCMB 2BOBA 1NGZB 2HT2D 4NIKB 2ICWJ 2IPKB 5DHVB 3MUGA 3V8CA 3V6BR 4RQQA 1QLFA 3UBXB 2VTFA 3C08H 4NRYB 3O0RH 2NLJA 3AC0A 4FRWA 1IGTB 1EEZB 1WICA 2WP3O 5B3JE 1L0QA 4TNWK 1ZEAL 1N4XH 3TA3C 3QFDB 3FZUD 1HEZB 3MCG1 1NEZG 5K93A 1VFMA 4LPCA 1CCZA 1QTYT 5I9QC 2GJ6B 5EC1B 1FL6B 5AUMB 3NABL 1FG2A 3O45A 1JK8A 5TPWL 3FQTB 1FLRL 5BXFA 1IL1A 1XAUA 4PJ5B 4FFVD 5M95B 1AD0A 3ZTJG 4OF3A 5F9JA 2P8MA 4K9EC 3ULUC 4NZJA 1H15B 4S11A 4D0BA 4HIHA 2KKQA 3BUYA 5IF0B 3TBVA 4QCIB 4AEIH 3I2CL 3T8XB 5DTFA 3FN0H 3Q6FB 1MCFA 3LKRA 2HWZL 4M6OL 4XAWH 1FIGH 3DHMA 5ESAB 2HFFA 3U1SL 3G5YA 4EI5D 2UZXB 1NCTA 2D7TH 1FYTB 3VFGL 3VG9B 4CKVX 3EJYC 1YQ2A 3CC5A 3O9WB 2VNCA 3R06A 4NBYB 1S9XA 2B1AH 1V8HA 3D3VD 4RIRA 2DD8H 3P0VH 3OGCA 3NACH 4TUKH 4Z7UF 4E41B 1UWGL 3MLVH 2NY1B 4CU7A 4ONGL 1I7TA 4KXZI 4XH2B 1KOAA 1XCQA 5IB4B 3H7BA 1F4AA 5EU6A 2MPAH 3MZTA 4JRYA 3UZEA 3HMXA 3ARYA 3FO1B 4MNGB 1IGYB 4EXKA 3OR6A 2VDOH 3ZE2F 5F1IA 1RSFA 3VRIB 4MX7A 3JVGC 2X4QA 1WCBA 1QVOA 5GZOC 3PXHA 3SN6N 2XWBB 4Z76B 3LS4H 3W9DA 3KPSB 1BIHA 1YNTB 1I9RH 4HD9A 5IB3A 1DBKL 1C8PA 1OARH 4HC1A 4WFGD 3EYVA 1A7BA 3SOBL 3KPOB 4RAUB 2ARJA 2WLYA 4WEBH 1ZHKB 4PY7B 1OGAD 2GITB 1A0QL 5EU3B 3V9FA 1RIHL 3IJYB 3NPZB 5I75B 5HTSA 1BZQK 2DLHA 5F1KC 2BCKB 4FQHB 5DJCB 3MUZ1 1MWAH 3WUWG 4IOIA 3IDJB 3MRPB 4X9GA 1QFHA 5BOZG 5GGSY 3DSFH 3GSVB 1NGQL 3S5LB 2BVTA 4KJQD 1BZ9B 2MCG1 2XA8L 5LJYH 4UTBH 2HRPL 1NCWH 4WU5A 5JXED 5F9DC 5F97E 1CN4A 4XCEA 3B6SA 5DT1H 1B3JA 5C1MB 1U8MB 3KR3L 5JQ6H 3CCHB 4X4MA 4NNPH 4XVTH 2NXZD 5F7LB 3C60B 1QRNB 4GAJL 1JGLH 5E6YA 1EV2E 4N0UB 1HHHA 5F6IB 4PJXE 5K9JH 4UBDC 2OJEA 4NM4L 1PX3A 4LHUA 1Q0XL 1Q9KA 5CILH 3VWJC 2VWEE 3MJ6A 3QQ3A 3UTTE 4HH9B 5JUEH 1H3UA 1EEYB 3QO1A 4MNQD 2CKBB 5IOPB 5ERWB 3KYNA 1EHXA 4LMQE 1KXTB 3SBWA 2J12B 1IAII 1F58H 5D7KD 3S35L 3NA4A 5E8PA 1SJHA 2JIXB 5KSUB 4X7FC 3VDBA 4PUBL 1GGIL 1V7NL 4G9FE 5JR1H 3O6KH 2VZTA 4JM2A 4HF5L 4M6ML 4GG8B 1CFSA 3UO1L 2X44D 1P5VA 2BX5A 5GISL 1KPUA 2L0DA 1INQB 1JGVL 3IJSA 5FKPB 5EG6C 4P2OD 2EE2A 1CDJA 4MAUL 3DO7A 1U36A 5GS2D 3SGKA 1A6UL 2AW2A 1SQ2N 5GZND 2FR4A 3FTGB 1RIVL 2E6PA 3DXAB 1NLBH 4CBPA 4NQTA 2HT3C 1D5ZB 2F53D 5LXGL 4WDIA 4JPIB 4NPYA 3M07A 3Q6GH 5J1SC 2APFA 3QJHA 2VXQH 1B0WA 4GXUM 4GXVL 1BOGA 4G43A 4LSPH 4PJDA 5D7JD 3EOAB 4FHBD 1I3GH 4Y5XC 5EO1B 3HE6A 5I1HL 2A6JA 3HLAB 3LKOB 1Z9LA 4R4BB 3MRHA 4YDJA 1G6VK 1E27A 2APXA 2V9QA 1RFDH 1FH5L 3I6KB 4TOYH 2OL3B 1HH9A 4A6YA 1VACA 5JHLH 3H42L 3PWJB 2CR6A 5GJTL 4R90L 4DN3L 1OAKH 2MHAB 4J2XA 1DUYA 4JY5L 3VFTB 1S9YA 1XGUB 2ICCA 1LD9B 3GKWL 4PV8A 2YKLH 4ZD3L 4OF6A 4L4TB 3QJFA 5D1QB 5BVPH 3S4SG 1DLFL 2Q8AL 3GJFB 4M43L 1OT2A 4X6DE 4PJ7A 5HHVL 3MMEB 1QLRA 1RZKL 2QADC 3SEPA 3HG1D 3SCMC 3X11A 4L3ED 1MPAH 1JF5A 1S9WB 4L29B 2J1KA 2LTQB 1IGCL 1LO4H 4O02H 4E42B 2AJXL 4ZUUB 5IBUG 1K4DB 3DVFA 1HQ4B 2AV1A 2DQHH 1NL0H 4DQOL 3GSNL 4KU1A 15C8H 1JUFA 1WBXB 5J12B 3KPRA 3KYMB 4R9HA 3S96B 2WMPA 1NDMB 1F8TH 1BQSA 1YEDB 2C1PB 2IC2A 3O6FC 2GSIB 2YZ8A 3T0EC 4UI2A 1JRHL 4U1KA 2Y7QA 3ZKXC 3STLB 3C9NA 4PYGA 4Y16C 5GSRA 1QD0A 1KLFA 3OXRB 1EZVX 3FRUA 4P3CL 5GGTH 5DLMH 3DRTB 1RUKH 4MXWH 4A2LA 3B2UD 3QZWB 1G9EA 3HAEH 5GJSL 1XF2B 4PRDB 3VI3E 3OKLA 5DEFA 3V5KA 3VCLB 1Q1JH 5C70A 1E6OL 1QHPA 4FQLH 2W0FB 1RU9L 5INDA 2ZG3A 5FYKU 3DYPA 1J05B 1CR9L 1ZLWK 2DLFH 3BZ4B 3IDXH 1QEWB 3RL1B 1EAPB 3VFNB 5C8JA 4GFTB 4OLYH 5IK3B 2VIRA 4LLMB 4RCAA 1S78C 2CKNA 2ITDB 4JQVA 4IRSA 25C8L 3O9WD 1FVEA 4P5MA 2BJMH 4YHZL 4IEFB 1ZLSH 2VITB 4ZOBA 3THML 1WAAA 4QRSB 2GIYA 5DD6A 3ECBA 2M1KA 2X4OB 2R1XA 1UCBL 4E41D 4EI6A 4HUWA 2NY1D 5I1EL 3RVUD 5E2TL 4XBEH 2W65B 3DETC 3WFBH 2XWTA 3VXOB 1C16B 4HBQA 1BVKB 5IQ7L 3LSOA 4WNQB 2XOTA 4NDMB 1JMXA 1GZPA 3P0YL 4F2MA 1ZHBA 2NY5C 3O6LH 4JRWA 5TF1H 1BF2A 5E2VH 1SJEA 2P45B 1AFVH 1CS6A 3VRJA 3LCYA 4MNHB 3N9GH 4QRPA 3KPSD 1J5OL 3GI9L 1I1AC 1TTFA 1G7LA 4KTDL 4QHMA 3LPGA 3RUGE 1F4WL 2DLGA 4D8PB 1P4BL 1OY3B 1C7TA 4HWZA 4OB5H 5AWNL 3TT1H 1B90A 3ALWA 1EO8H 5CBEB 3OBAA 5IESL 1G84A 1AGEA 4UOW1 4XMKH 2PO6D 3TA3A 3DIFB 2DJ4A 5DC0A 43CAA 1W8NA 1JWMA 1Q94A 4D3CH 4Y1AB 3VXUE 3TPUA 3AFLA 4LU5L 3IDIA 2DQEL 4GRWE 1J0HA 5H37G 5JA8B 5JW5B 3BUTA 1U8NA 3T3ME 4V1DA 2AJSL 2O26U 4ELMB 4ZDHA 2QEJA 4FMKA 3EFFB 3JTSA 2V5RA 2GT9A 3HPLB 4KMQA 1XEDA 5F6IC 2X9XA 2FECI 5DFWH 2V2WB 3TM6A 3C60D 1QRND 4Z8FH 1XF5B 3PL6B 4P9ML 1GGYA 1YEIL 5EWIL 2OZ4H 4KK8D 4JO2H 4XPHH 3RKDD 4FZEL 4LOUD 4OIIL 5I1KH 4KVNH 2W1NA 1YDPB 5FO8A 1OB1A 2QQNL 2ADFH 1S7QB 4JFYA 3CFCH 3CXDL 3G5VB 5FYJU 3TJHC 1U8KB 1J0KA 4M7KL 1A7RH 1MREH 1J9CT 1WIOA 3ABZA 3D85B 4O2EB 4CVZA 1ZHNA 2CKBL 2R2EA 2DWDB 2JIXD 2NX5E 5IT2L 1MEXH 1AXSB 4AIZA 1UADC 4HKJB 3C2SA 5T5NG 3L7EA 2IANB 2GAZA 2J3SA 4Q0XH 3C2AH 1CVSC 4WHTA 2BK8A 2I5YH 2BY3A 4FFWC 4JB9H 4LSQH 3JVGA 3CJJA 3QXUA 1V3MA 3CGTA 4GMTL 4OZGA 3WD5L 1GPOH 4Z95H 2RB8A 1LO2L 3VA6A 2X4NB 1PGRB 4CNIB 2Q3AA 4Y19E 1RUPL 3BYYA 3MRFA 3MXVH 3DXAD 2MKLC 4OFVA 1MWAB 3NOIA 4YC2C 4YK4B 4K3JH 4JDVA 2V7NB 4YUEL 3FCTB 1ORSA 3HE7B 5CD3A 4OZIA 1MOEA 5C07E 4UUJB 3RVTD 1G7QA 1Z5LA 3FQWB 4X6CB 2ADJB 4I3SL 5GRWA 4YPGB 3T2NH 4QRRA 3LVEA 1T04A 3O4OB 1C1EL 4EQ2A 3DX9B 1N0LA 5D7IA 1QFWH 3B3IB 3MQIA 2ZOLB 1I8MB 4HKBB 5DMJB 4U0QB 3M45A 2FWOA 4OGAC 3MLZH 1P7QB 1YEEL 3WFEH 1QKZL 1OCWL 5EH1A 4C59B 1T1WB 1U58B 2ZCKL 3KXFB 4WENB 5EU7C 5C08E 4NJAH 1KBGH 3OQ3B 3QWOB 5CP7B 3U4EB 4XPAL 2V7HA 3N85H 2OL3L 2F5BH 3MV8A 4AM0A 1LEIA 2DKMA 4ODVL 1BLNB 3W81A 2CR3A 1U3ZA 5D1QD 4M7ZB 1MY5A 2E5EA 3VWJA 4AEHL 1YUHA 5BS0B 1UM6L 2PETA 3P9LA 4MQTB 4WGWB 5E5MB 1QSVA 5DJ2A 5IB2A 1B4JH 2GTWB 3G6JE 4QNPF 3MJ7A 2H32A 3C5ZB 3QI9B 1JPGB 2FEEI 1QSFE 1DBAH 1LO3L 1S3KH 1UYWL 4EDXB 2Y9RT 3BEWA 4M1GL 4P2RB 3AS0A 4C83A 2Z92B 3BMWA 4NP4H 3ZDXE 2I07B 1LO0L 3QDGD 2YWZA 3U83A 3VH8B 3WO4B 3RY4A 4M7JH 5C6TH 3RX8A 1U95B 3QPQC 1NCDL 4AT6B 1JTTA 1XGQB 1A22B 3IVKA 4JFQB 2MTPA 5GHWH 4NUJB 4UDTA 5AD0A 1GC1L 2GTZB 1FAIL 1BVLB 5IROC 4S1DC 1U2CA 3P30L 5F70A 1MI5B 3P11L 1IARB 4XNXL 1DN0A 4BSWB 4GO6B 3DMMC 4Y5YC 2V2TA 1G9NC 4J12A 4UV4H 3DX8A 4LIQL 1SVCP 4TULL 2EDTA 4U0RB 5EO0B 4RGNB 5HDBE 3HRZA 1F4XH 5GS1B 1QBAA 1LEKB 1TQBB 4Y5XA 4RFOH 5DD0L 1E6JH 1UH2A 1P2CB 1MFDL 5BMFL 1KCSH 1Y18B 3OJVC 2J7LA 2GCYB 5ESQA 3BVNB 1TCRA 2IQ9L 3HCVB 3AS1A 2Z31B 3GSOA 5KSBA 5FUCE 4XCNA 4BKLA 1X5HA 2VXTL 2GUOB 1NBZA 1W0VB 5ICZB 3QPXL 1S7UA 2K9UA 4GKZA 1SEQL 3LEVH 1T83C 5I1LA 2EYRA 4HX1A 4ONHB 1LMKA 4LVHC 4UILH 2ZSWB 2ZUWA 5EZJB 1WSST 2H1PH 1AO7D 4ZPVA 4TPRH 3MRLA 3SCMA 4OLWL 3WYRA 1QLEH 1BMGA 2K3TA 3QDAA 5C0BB 2PXYC 3HA0A 5CJXC 3B9KC 3NPSB 1QACA 2I26N 4XP6H 4PJGA 3UBXA 3FHAA 4OCNC 4KPHH 1F2QA 3TBTB 4NYLA 1KTLA 4QHLA 1GIGL 3VWKC 3EO0B 2I9LA 2VZSA 5F3BA 1RUML 4QTHB 3WFHA 4ELKB 4PLKC 2GJ6A 1DDHA 4NC0B 3SE3C 4R4ND 4UV7H 5EC1A 5HHXH 1J10A 1HI6A 3O6FA 3T0EA 2A6KB 1BQHG 4KK6D 1UZ8B 4BK5A 3P0GB 3HAEB 4PFEA 2PYEB 4Y16A 4ZUSB 3HN3A 5IMOA 2XQYG 5AG8A 1N5AA 5FGSA 5FB8A 2V5MA 1WAAE 2DMBA 2MSPA 4K2UL 2E27L 2BVYA 4FQQA 4K7PY 3T8XA 1IZJA 4G8FA 2KUTA 4K3GA 3AB0B 3C8KB 4LCYB 4P9HH 4PRNB 1KLGB 2JCCA 3KS0J 3WXVL 3VMOA 3MROA 4Q74A 3VRLF 4OQTH 4AEIL 4CADA 1P53A 1A14H 5T1MB 1G7JA 5JDJA 3PL6D 4XAWL 2VLKA 3OKOB 1E4WH 1Q9WA 3F7RA 2D7TL 1AP2B 2F5AH 8FABB 1MLCB 1D5IL 2DOCA 3ES6A 1WJ3A 1JPTH 1NAMA 1A3RL 2OS7A 1SYVB 2ZUQC 2B1AL 3NACL 4TUKL 1HSBB 5DUMH 4DZ8A 3MLVL 3DROB 3D85D 5DRWA 1IGYA 2OJZH 1FZKB 2IPUK 1XR9B 3ETBF 1PQZA 4RMVA 2F74B 4PJAB 4WO4B 3GMRA 2RR3A 1FZJB 2XWBA 5D96B 4LKCA 5E2WL 2IAND 4X99B 1KTDA 4QXUL 1N2RB 2AXHA 3V4PH 3UP1A 2J8HA 3PDGA 1IJ9A 3ARZA 3ARRA 3LS4L 3VDCA 4PJ9C 1I9RL 1FCCA 4OZHE 1ZLWH 1I1AA 1OARL 5F71A 3OZ9H 1BIIB 4JFOB 4PJHF 4NWTH 2QJDA 3QQ9D 3V6ZB 4BM7A 2XG5A 4LCWB 3JWDH 3FMGH 3H9HB 3UJTH 2Z8SA 3TT3H 4JKPH 3HE7D 4MJ6B 4LSUH 3BISA 4D9LL 2ICWB 4NRZA 4LDEB 1JN6B 1KJMB 1U2HA 1RJYA 1MWAL 2DL9A 1PEWA 1YMMD 2PCPB 3RDTB 1T5XA 3D3VE 3DGGA 4HUUB 2ZCHL 3MRQA 4LKXA 5EULV 2UWEE 4ZNEE 4ODWA 3DSFL 3QA3B 4YFLF 3G6AB 3WKMH 5HYSA 3QG7H 4MD4A 1MRCH 1TFHA 3M1BB 1ED3A 5F7EH 4R7NA 2DQIH 4XCYB 1XF3B 5E8NA 1F11A 4NCDA 4JKWA 3ZHLA 5MEQA 1P7QD 3RVXD 3FT3B 3WDJA 3QUXB 4P4KB 4NNPL 4XVTL 3TBWB 3EO9H 4JN1H 3KXFD 1IQDB 5T3ZH 4AL8H 5GGRY 1JGLL 4WY7H 1LP9F 4PRBA 4MZ2A 3CDGB 4JFDA 4QXGL 4WFGE 5CILL 5J13B 1N0XL 4UTAL 5FECB 2EYTA 4N1CA 5JUEL 3GUTB 2Q7YA 5BS0D 1MHEA 4JZJB 3V0WL 1OGAE 5DJ8B 4X7CC 2C3VA 3EYQD 5E0QA 5C0IB 5EZIH 1F58L 4R96A 4M48H 1CGSH 2FJFA 1YZZA 1NMBH 1XMWA 3KYAA 4ZODA 1K2DB 3C5ZD 3IDYC 5JR1L 4HPOL 3AREB 2DWEB 4G6KH 4DK6A 3WO4C 1I85C 1YEHH 3MRMB 4KJPD 2HT4C 4CJ1A 1QSEA 4UT7L 4JN2A 3GEWB 4P2RD 3I6GB 4QRTB 4N1HB 3K8MA 3MYJB 2CDGA 1X4ZA 5HYJB 3TH2T 2OLDA 3B43A 3BD3A 4Z77A 5C09A 1S9VB 2OBGA 2DTML 4G42A 4PR5B 4RGOH 5E2UH 1U8IB 4C56A 2YPVH 35C8H 3S7GA 1RZ8B 3ROOB 1T0MB 1IM3A 3NZHH 4IOFD 1SVZA 3EFDL 1TLKA 3KGRA 4F3FB 1MI5D 4L8CB 2VXVL 3EO1B 4ETYA 1YMHB 4U1MA 1Z6JT 1G9MH 2XWJA 1LEGB 4U1GB 3KPLB 4I48B 5SWSA 4Z7UE 2ATKA 2C4FU 3X17A 1IGIH 3Q6GL 1QO3B 3MV8E 3MA7A 3ROLA 3HLAA 3KYOA 2CUMA 3D0VA 1MRDH 4RGND 3S97C 2WBJB 3WHE0 1TNNA 1I3GL 1X44A 1HHKB 1JF1B 4HHAA 3LZFH 2JJTC 1H5BB 5J6GA 5DZLA 2R8SH 4FQIH 4PRIA 1ZA6A 1UT9A 3ZE2E 1Z0NA 2VLRA 1K3IA 1Q72H 1RFDL 3NFSL 3MO1B 4PJFA 3IYLW 1TJHH 4L4TA 3BWAA 4I3RH 5HJ3A 1KSRA 1G1CA 2Z31D 5EUOF 5IV2B 1T7XA 3A6BL 1KJ3H 1PX4A 4DVRH 2YKLL 4XCFH 4L29A 3S5LG 1EPFA 5IIEB 1NANH 3O8XB 4K23H 4PJAF 2A83B 1IC7H 2D0FA 2Y5TB 2F53E 3HNSH 1MPAL 4WJ5A 1X5ZA 2HJLA 1IQWH 1T6WA 2WQRA 1LO4L 1ADQL 4O02L 3HZVA 4POUB 3QH3B 4TTDC 4ODTL 5F7FA 3STLA 1OL0A 4NKDA 1PY9A 3DVGB 4WI4A 3BAEL 3ORJA 4K94C 4DUXA 4PRAB 4JE4B 1OTUC 1D9KC 2Z4QA 5A40E 1NFKA 3IETB 3TPKA 3LRSB 4AENA 3QWRD 1XF4A 3DI3B 4FQ2H 4XI5C 3X3FH 3T1WA 5HDLA 3KHQA 2PYED 4MA1C 3LS5H 3U36A 4XVSH 3FFCE 4FG6D 1MELA 3VCLA 1JGUH 2O5XL 2OCFD 3EDEA 5DLML 5IROA 1RUKL 4MXWL 1HHJA 1BFTA 3U0PA 1SM3L 1GVIA 2HJKA 1MJJA 3FO2A 1CIDA 5CZVH 4OIAA 4M93C 3PDDA 5TE7H 3FOLA 2BSRB 3D87B 4OF0A 4ZFOL 2DICA 3DMMA 4Y5YA 4UB0L 3CIQA 1GCFA 3HG1E 3RWGA 2OI9C 3QNZB 3NZ8B 4L3EE 3VGAC 1T20B 5LWYH 2OR7A 4P4RB 3GSXA 2B8OT 3IDXL 4RMRA 4OLYL 1FNLA 3BSZL 3AAZA 2BSSB 3BPLB 3GSWB 4BFIA 3FZUC 4PRHA 1FZOA 1ZLSL 4TNWF 3KG5A 5BO1H 1CZ8H 4LSSH 3GDBA 3CSBA 1C16A 4HK3J 4XMPL 3EDJA 3I85A 3E6FB 2EDRA 1IGMH 4XP1H 4FFVC 4XBEL 1KTKE 1U92B 3VW3H 1ZGLB 4M03A 4E9LA 4NBXB 3U7WH 1WWWX 3AXLB 1WBYB 4MD0B 4MDJA 4D9QD 5TH2B 4HXBH 4IS6B 1DVFB 4WO4D 2GJ6E 5SWZA 3BKMH 1VFUA 2WUCH 3OB0H 3UZVB 5KSAC 4FQXC 2I27N 3HR5B 1I9EA 1T83A 3CD4A 4G7VH 4NJ9H 3O6LL 4RAVA 5TDNA 4PJ5E 2YD2A 4D0DA 1G1YA 1T7YA 1S7TB 5E2VL 3P4OB 1O7SA 4ZSOA 2PXYA 1AFVL 4XHJC 4YXLH 1R3IL 5TQ2H 2GYSA 5CJXA 3B9KA 5C0FB 1ZVSB 4K8RC 4C58B 5I8CB 1UZ6F 4N8VA 3IU4L 3RX7A 3PWVB 4FABH 4U1JA 3VWKA 2X7LA 3I3EA 2QR0B 4F9PC 2BY2A 3VFVA 1WK0A 4YX2H 3TT1L 1NBQA 1JPST 3FB7B 4LCWD 5F9OH 4Y1AA 1EO8L 3SE3A 2WINA 5L2JA 1FYTE 3PGFH 4JRXA 4AH2B 4XMKL 1C5DA 4K8RL 1MIMH 3RDTD 1FL3A 2AI0L 1U0QA 1UXWA 4JANA 4KMTL 4D3CL 2BSTA 1LO5B 1AY1L 1UVQA 4E41E 2CK0H 4JDZA 5DD5H 4Z7WF 5F72S 43C9A 1CG9B 1UWXK 5DWUH 4XRCB 2CDFB 5L8LB 2VDMH 2V2WA 4PJBF 2VJXA 5FOBB 1T2XA 1RZ7H 5D8JH 4HUMB 4LBEB 3DTXB 3Q1SL 4MNGE 1QR1B 2YMXH 4Z0XA 4PY8I 3P4MB 3QUXD 4P4KD 2XN9A 4XCCH 4N9GB 3DLQR 1S7QA 3VA2C 3RPKA 4JGUA 4DEPC 4Z8FL 2OZ4L 4JO2L 4OZFH 1Z9OA 3S37H 3KPSE 2P8LB 5CEZH 2Y6SC 2WV3A 2HVKB 3LEXB 5FYKH 4OKVB 4HJ0D 1PZ5B 3QZWG 3KS0H 3WV0A 3TYFB 1F45A 1MREL 1ACZA 2A73A 3EOYG 2XICA 1BECA 4MVBD 1UJ3B 4JFZL 4KJQC 2WANA 2Y36H 2H41A 2A0LC 4OD2A 4P2CG 2C7UB 2AQ1A 1NSNH 2D7NA 5MP6H 3RWCB 1I1CA 1MFBL 1MEXL 4G6ML 3KPMA 3D69B 3UDWC 3ARED 2AJZB 1WFUA 2IALB 1A9BB 2DQGH 4Q0XL 4K7PX 3OJDB 1JMZA 3C2AL 5E08H 1C5BH 4GW1A 5KN5A 2FZ3B 4JB9L 3MRKB 1KNOB 5HYJD 4WU7A 4Y2DB 5MEND 2Z91B 2ZZUT 3GBML 4PJ9A 3VE0A 4JVUA 2YD7A 4HV8A 1CU4L 3UTQA 2VLLA 1E0OB 1WZ1H 1QRNE 5HI4C 4KRPB 4N0UE 3SDYH 1YQVH 3J7HA 1HNGA 4K3JL 3SKUD 1IKNA 1M6OB 3MBEC 4Q9QH 3MBXH 3S36X 3NVQA 5DJYB 3E1F1 4BQ6A 3WHE1 5GQBA 4B41A 5CJ8A 3T2NL 3G5XB 1MNUL 4C55A 4JO1H 4HIIB 1WF5A 2WBJD 1MFCL 1FV1B 5ID1B 4YHOH 3HC3L 4G8EA 1H3TA 1QFWL 1JZ3A 5EBWA 5T1LD 1U58A 1CF8L 5JW4N 4NKMB 2GSGB 3IF1B 5KZCB 3SDXA 3ZMRA 1OW0C 2WUBL 3WFEL 1K85A 2OSLB 4U6TA 5JDSA 1ZT1B 1M05A 5LGHL 4NJAL 4K7PH 3EGSA 2VABB 3N85L 2EKSB 1MHHA 3QIUB 3VFWA 4TUOA 2OQJA 2HLAA 4JJHA 3O8XD 4WEMB 5FA3A 5IFJB 2FBJH 3BDYL 3DXAE 3HI5L 1B0RB 4GLRH 1U8QA 2HTKD 2YS4A 4L9LB 4YEEA 1Q9LA 3MRCA 1CL7H 1F6LL 1B4JL 5C6WH 1EXUA 4JHZA 3DECA 3INUL 3FT2A 1TTUA 3BRFA 1MFNA 4UNTA 4LVOB 2NYYD 5FYJH 3ARDC 3WIFB 3BKJH 5D2NB 3RWDB 4GG6F 3VH8A 3S36H 1I85A 2DJUA 3IGAB 1KGCD 1S3KL 4Y5VB 5DQJB 1NDGA 1YJDC 2Q76A 5IB5B 1CDYA 1NMAH 2Y72A 4NP4L 2CIIA 1DUZB 1HQRA 1UACL 4JLRB 4R6UA 2SEBA 3QUZD 4M7JL 5C6TL 4M5ZH 2A1WH 3HI1A 5FM5O 2ICES 3QO0A 4ZUVB 3IS1X 5GHWL 3LD8C 5FA4B 4GSDH 3D39A 4NO0A 1FBIL 3TBSA 5M94B 2YRLA 4PLJD 2EIZB 4ZUWA 3IB4A 3G5ZB 3PWLB 4TN9A 4L4TE 1A5FH 4RNRA 3ZKNC 1A6WL 4JY4A 1JV5B 3EW3B 3FB5A 2XQBH 4N8PA 4UT6H 4H1LB 1HHIB 3DNKA 3GSQA 4I1NB 5KSVA 1B9ZA 1DEEA 4ODUB 1A2YA 1RD6A 3QEQB 4V2BA 4KKCD 4MWFB 2ADGA 1EGJH 3RWHB 3GB7A 5DFTA 1Y18A 1F4XL 4WUKL 5DO2C 4OD1H 1OWRM 4HWUA 4RFOL 1Y6KR 3I02A 1NCAH 1F42A 2JJTA 1NKRA 4XT1C 2FL5A 4X5XA 5IEHA 1A7PH 3MNVB 1KCSL 4HGKC 5BZWB 2H8PB 1XH3A 4KTEH 2Q86B 2YRZA 4UIKL 3QFJB 3QUYB 3JWOH 4TQEL 1AE6H 5A3IC 5KJRH 4ZTPH 1F90H 5HDOA 5H2BA 1I7ZB 1OAZH 4X9IA 2LAGB 2D7OA 1FLTX 4C57C 1ADQA 5CMAA 1KTRL 2J88H 1IFHH 4CVUA 3T65A 1DVFD 3G08A 3BJLA 3LEVL 2VDPL 4ZUTB 2CUHA 4UILL 3I6LD 3SKJH 3BZEB 2H1PL 2VLJB 4TPRL 4NO3A 5F93C 4V2CB 4NO5A 1QLEL 2IH3B 3F7PC 3C6SA 3FONA 4P46B 4X6EB 5DA4A 4XP6L 2XTJD 4J3OC 1HZHH 1JWUA 3HB3D 2W9DH 1I3RB 4XNMB 4QTHA 4KPHL 3L3OA 2M2DA 4DWHA 3UXFA 3NCCB 1MHCA 2IAMB 4HT1L 3GMLB 4OGXH 1CGXA 3SGDI 3RWEB 4HS8H 4M9PA 3I84A 1YY8B 4UV7L 4OCSH 5HHXL 1D9KA 1NFDB 5DJAA 3S34H 3BH8B 4OJFL 4ZFOA 2R9HD 4EUPH 4FQJH 5E4EB 5FDYA 3F8UB 4L8SB 3I9GH 3O4LA 3QXVA 4UDUA 2J5LC 2FGWH 4LASH 5D6DC 3WNOA 5C92A 4PRNA 1ND0A 5JTWA 4WUUB 1V3KA 2YA2A 1KEML 4HIXH 3U7AA 3WNKA 1I1FB 1NBVH 3BKYH 5HDQH 4P9HL 1NUGA 3CFDA 4J8RB 3AGVA 4ZO6A 2B1HH 3TVMB 2E7LC 4QNPE 5L88L 5E5RB 8FABA 4MSWB 2C1OB 4LLDA 3LH2H 1KLUA 1JP5A 2NY3D 3BHBA 3FT4A 3P40A 5FO9A 3VXSB 2HH0L 1E4WL 1A7OL 4IHOB 4HDIA 2AJ3B 2J6EL 1T1ZA 2F5AL 1JPSH 5I8KL 1VSCA 1KIUA 1EMTH 2IMMA 2WWKO 2C9AA 3ZYJA 4R8WL 2OX5A 3L1OL 5IG7B 3LKQB 4CMMA 4OAWB 4G9DA 4X4YA 5DUML 1AQKH 2BNRB 3KJ6L 4NN7C 5JZ7C 2N56A 4I0PC 3BT2H 4Y1AE 3SO3B 4OM0H 2G75B 4ALAL 1WZMA 4HGWA 1VGEH 5KSAA 4FQXA 3MRIB 5L6YH 4N0CC 3NCBB 4NGHH 4O51A 5LQBH 2I60H 2DQUH 3TZVB 5EO9B 3BW9B 1MCKA 4F8QA 4ELME 2X40A 3QCVH 1M71B 3DUSB 2YUVA 4NQEA 1I1YA 4ORZC 2RAMA 2DMKA 4MCZA 4FXKA 5T5FH 3OZ9L 2QSCH 4U6XA 3I75A 4POYA 1YN6B 1FPTH 1DQDL 1I8KB 4F9PA 4KRPD 1FN4B 4Y4FC 2P47B 3JWDL 3MV7A 1V5JA 3FMGL 3UJTL 2EDYA 4QKXB 5F96H 1WV7T 2VZOA 5E56A 3TIEA 4Z6AT 4LSUL 5BJTA 3VMPA 3G04A 2YPLA 3M1BA 1JGEA 1GGTA 3WO3B 2VDQH 3H9SB 4Z7OF 4APQC 4MS8C 1GHFL 5I6XB 4UT9H 4HS3A 2ZPKH 5F1NA 3N0PB 3KLHC 4IM8A 3QG7L 3PP4L 2FIKB 4I2XB 4JFPB 5F7EL 5T3ZD 1OWWA 3ULVH 1NGYB 2DQIL 5HI5D 5KZCD 2R1YA 2IANE 4OZFB 3KDMA 3CDGA 3NMEA 4WWID 4DKAA 1KC5H 4GAGL 5E70A 1CFBA 3OKDA 4AL8L 4NKQB 1NGXB 5A1AA 4NO2B 4UAOB 2A9ML 1IE5A 2XZCH 3QIUD 3HAEG 3HHRB 4L9LC 2R4SL 3O41B 4ZTOL 2AV7B 1CBVH 2PTUA 3EOTL 2CGRH 3AU1B 4JO4H 2CJUH 5L2KB 3T2PA 5D72H 4LVOC 1JYNA 3MNWB 4JFFB 2FB4H 4KI5F 1VENA 5CEYB 2NMSA 5EZIL 4P5KA 1D6EB 4G8IB 4M48L 4PGZA 1JYWA 1RJCA 2XNAB 1N6UA 3CX5K 4X7TB 1YMME 1RIUH 1A1NB 4OFIA 4YWGL 4X6CE 3UDWA 1UWXH 1MAKA 3GMOB 3VXRB 3BZFA 4DCQB 3BIBX 1EX0A 1YEHL 1S9VA 4ZYKA 3P4NB 1JBJA 1NFIA 2B20A 3VRLE 3W5NA 4J4PD 4RRPA 4ZAKC 2P43B 4OLUH 3ARGC 4RGOL 1PKOA 1U8HA 5E2UL 1PEZA 4NQVA 2X2YA 4L8CA 3OG4B 1TZHB 3GO1H 1YMHA 3CX5J 3KXFE 1A4KA 2H26B 1I9JL 3NZHL 5ETUA 2O5ZL 1VA9A 3LN5B 4YGAB 1CLZH 4AEEA 4KK9D 3SGEH 1CLYL 4WFED 3IXAA 4JFHD 3MBEA 2EIEA 1UB6B 5BS0E 4KHXH 4PS4L 5GSVB 1AIFA 4EN3B 1BFOB 3QEQD 2JB5L 1MRDL 3QEUA 1B2WH 4H8WC 5IWLC 1HOCB 3DX7B 3MOBH 4UQ2A 3KLAB 3UJJH 4AK1A 5KS9F 1NC2A 4HUXA 3LZFL 3WCYA 4O9HH 5DJXA 4DUVA 2R8SL 4FQIL 1S7WB 1QA9A 3HZKA 1OW0A 1Q72L 1CFTB 3QUYD 1DSFH 1TJHL 4NC1C 4P2RE 4KHTH 2FH8A 4H0HB 3BIAX 3NCJH 4I3RL 5DJDA 4Q9RH 5MHSD 3U9PL 1JNJA 4H8WL 1I9IL 1ES0A 5CJOH 4U05A 5IFAH 3BEVA 4PTUA 4DVRL 4YHMH 1KELL 4NSKB 5F88A 1ZT4B 3UC0L 1HXMA 2FJGB 4XGZB 2P4AB 3QQ4A 1XGTA 1VEOA 3NA9H 4DFIA 5LKNA 1IC7L 3HMXH 1MI5E 1NCCH 2IAMC 3BP7B 4GRMB 2D3VA 4YAQA 4XXDB 4MXVF 2NY6C 3LMJL 1PFCA 3TWCH 1X5AA 3O2VL 4N90D 4I18C 2EXYD 5LAXB 3RWIB 4PJIF 4BH7A 3ARDA 3PQYA 4MDIB 5BV7C 4R2GB 4RGNE 4YFLI 5CEXA 3N1QC 5I2IA 4HC1H 3VXMB 3IJHB 2HVJA 1BJ1J 1S7XB 2CIKB 2UV3A 4F7PB 3P4LA 3ALPA 1OAQL 3V5DB 1T5WB 5DJ6B 1YPZB 1Y0LB 5I8OL 3X3FL 2NY7H 5DRXB 4IJ3C 2R1WA 4XVSL 5HGGS 2VQ1B 2X70B 1JGUL 2BSRA 2ZG2A 1FNSL 2ZCLL 4JHWL 4WUUD 3ARFB 3QCTL 5BVJB 5IW6A 2ZUTA 1BWWA 2XA3A 4LVEA 4PJ8C 1TENA 5FKAA 5CKGA 4Y4KB 5CZVL 3PWPD 4ZOAA 4HAGA 4FFYL 5FUOH 1EVUA 4NQXB 4EDWH 5BRZB 1EH9A 5TE4H 3TVMD 3QXTA 5GGSA 4M61A 4WTZG 1AR1C 3QDJB 4FNLH 5LWYL 2HFEA 5C0BE 2PW1A 1U3HB 3WUZA 4LLWB 3VXTB 4PD4K 2AJUH 3VXSD 4R4NC 1J0ZA 5E94A 4Z0BL 2RGSA 5FOJA 2UYLB 1KJ2A 1PYWA 1ZMYA 2CD0A 2X4RA 1CZ8L 4LSSL 4HJJH 3WNPA 1PLGH 3VFMA 1DBJL 1JNLH 5J06A 5J57B 1WWAX 3W0WA 3MLUH 2BNRD 1IGML 2EXWD 2H3NA 3JZ7A 2NR6D 5E03A 3HR5A 4PJEF 4YDVA 3RBGA 3GGWB 3ZSTA 3ILPA 5GGRB 3U7WL 4U3XA 4G8GB 2PYEE 1CICB 2HN7A 4PD4J 3SJVA 2VRAA 3BKML 3DV4A 4GS7B 2X89D 1FNFA 4HWBL 2AABH 2YSSA 4NJ9L 5DMKB 1MQKH 3TZVD 1G6RA 1ITCA 2BNUB 3FKUS 5TQ2L 4YXLL 1MJ7H 3NAAH 1KG0A 4Y4HC 4PJCB 1P1ZA 4FQ1H 4XMLH 3UPRB 2D9CA 1SJVA 5C0CB 5JORB 2P5WB 3GHEH 3LRHA 4MD5B 1MVUA 2GKIA 3ZZ1A 1CDCA 4GH7B 4FZ8H 3DX6B 4YX2L 4NN5C 4QRUB 3UAJD 2NW3B 5F9OL 1DEDA 2HG5A 3T4AB 5TE6H 3PGFL 2DQJL 4Z7NE 2Z93A 5ITFA 3MRJB 3BD5A 1EHLL 1MIML 2CDFA 1WC7B 4RWHA 4YEFA 3T08A 3H9SD 2CK0L 5HGBB 4PP1D 5D6DA 3RGVB 4MMZC 2YD3A 2X41A 5B3JF 2IADB 3CFKB 3BPNC 1F6FB 3VD5A 3P4MA 2VDML 5HGHB 4PJAE 3DURB 5GS0C 4D9QE 2J6EA 4BZ1H 5DDHA 4P3DA 4XWOD 2IF7A 5IMLB 1TTGA 3WLWC 3SKMA 1KIRA 4U7MA 4D94A 2P5EB 3BP4B 4F80A 2E7LA 5FK9B 3TC9A 4XCCL 1P7KA 3CSPA 5TDPB 4JFEB 5FHAH 1E4XH 3EHBD 4A6YH 1YEJH 4QWWD 4WI9A 5FYKD 3S37L 4HIJB 2WIIB 3CFJB 1J88A 5E9DD 1FNAA 5CEZL 4RZCA 1QP1A 4GKNB 4Q2ZB 5EUKA 5FYKL 4YHKH 3HS0B 5L2KD 3GK8H 2RFXB 1UA6L 3QXAB 2OM5A 1X9QA 4MJ2A 4OCYL 4LCWE 5I66A 1R3HB 4LDLB 1K4CA 2Y36L 4U1NB 3K4AA 2ED9A 5CIPA 3OXSB 1J1OH 4BUGA 4I0PA 1MCSA 5TDOB 3MRKA 4X98B 5EIIB 2ICWI 3VXRD 5FF6B 4S2SB 2DQGL 1DCLA 5D2LB 4HJGB 4U49A 5E08L 5KVDH 4ZXBB 1EA9C 2YPKA 5JQHC 2C3HA 4IMLA 5LBSL 2GHWB 3SY0B 2Y5EA 4LCUA 1T22A 3CVHA 4KUZH 1C08B 2AP2A 5GRVK 2XY1A 3CU7A 1NJ9B 3FFDA 4NHUA 1NBYA 1YPZF 5L7XH 5EU5B 1WZ1L 1F4HA 3VFUB 1KENL 2NY0B 2NZ9C 2JELH 1N7MH 1NCBH 2E3VA 2E7HA 2PR4L 1XF1A 4PGBB 4Y4FA 1YQVL 2D2OA 1QQDB 5JLZB 1IEAB 4Q9QL 3MBXL 3WEXB 3QG6B 2X1XR 3X13A 2R23B 1TETH 2FATH 3C09B 1GZQA 4EN3D 3RZCB 3IDGA 4ZS7H 4KTYA 4XNYH 4LLQA 5J7CC 3IF1A 4APQA 2Q6WA 1FIEA 2LV4A 4O2CA 4RISL 1A1MB 4OCRH 4S1RH 2JLLA 2R2HA 4XVUD 4QYOB 5I16B 5IVXA 4KDTC 4U2ZA 1UZ6E 5HYJE 3CDCA 4K7PL 1QPXA 5JIPA 2BDNH 1PKQB 2PTTA 4L9LA 4ENED 2CRMA 2CLZB 2YHGA 4MB3A 3BMVA 2B39A 3NFPA 3FQRA 1T21B 1KIPB 2FBJL 5CJQH 3OF6D 4OFPA 4Q58C 2XZZA 5FYJD 3WIFA 3F6LA 4HMEA 3TFKC 1T66C 3RWDA 1RUAL 4MQXD 3BQUD 4DAGH 4IIQC 4WEUD 3B5HA 3DUUB 5F1OB 2BOBB 3H6JA 3MUGB 1ZEAH 4PJCF 3AMLA 3TO4C 4JLRA 4RQQB 3S36L 4R2GD 3SDCC 1QLFB 1QFWI 3VXMD 2G9HA 2NLJB 3LQZA 1NMAL 2NXYB 1MRFH 1CXLA 3NABH 1JF6A 1G7PA 2HLFC 1FLRH 4ZAKA 4CW1A 3ARGA 2A1WL 4ETQA 1JGDA 3TIDA 3L3DA 5KW9L 2DTSA 4Y4KC 1FG2B 4OUOA 3O45B 1JK8B 1RY7B 5DK3A 1PW3A 3CFIC 5CSGA 5BXFB 1IL1B 1F3JA 1YYML 5IVNA 5D5MA 5B4MC 1AD0B 4GBXD 4LF3A 1SJXA 1YNKH 2VH5L 4JGJA 5F9JB 2P8MB 5IR1A 2HWZH 1A5FL 3L5JA 4D0BB 4HIHB 1LNUA 2H2PC 3BUYB 3TBVB 4LVNB 2XQBL 4UT6L 3U1SH 5IB1A 1KCLA 5DTFB 3GIZL 5BRZD 1K9TA 4K9EH 3LKRB 3OWEA 2EH7H 1YEKL 3QEHA 3QDJD 4L5FH 5IWLA 1U3HD 3B9EA 3U6RA 2HFFB 3G5YB 3QFJA 1IC4L 4OD1L 4I4WA 1NCAL 3CC5B 4LPYA 3QDGA 1BWMA 4OZ4A 2X1WL 4ONGH 4CMHC 3R06B 4UNUA 1S9XB 5KANG 1KGCE 4RIRB 3K8LA 5J1TC 1DP0A 3OGCB 5JNYA 3JWOL 1RMFH 4Z7VB 4LRNH 1AE6L 4M7LT 2D4DA 1I7TB 5D93C 2QV2A 1OAZL 1XCQB 2OR8A 4J1UA 3H7BB 3C8DA 5EU6B 1REIA 4N5EC 3QRGL 5LGKA 2VLJA 1KULA 4JRYB 3TN0C 3PGCA 1TJIH 4F7TA 1IFHL 4G8GD 3PV6A 1CICD 5EOCJ 3MLRH 3RHWK 1DBKH 3OR6B 5F7WC 1GYAA 5F1IB 3SKOA 5E6IC 3V6OE 3SKJL 4MX7B 4RMTA 2X4QB 1K8DB 1QVOB 3QAZB 5I1IH 3LDBC 2AQ3A 2IAMA 5B3NA 3W9DB 5MERA 5CZXC 5IB3B 1HZHL 1A0QH 2W9DL 3EYVB 4I18A 4CU6A 2RCSL 3H3PL 1I8IA 5DUBA 2BRQA 5C0CD 3CLEL 2P5WD 4BA8A 2ARJB 5IJVA 4ZNCD 3P77A 4GMSH 4G9FD 1B6UA 2B5IC 2OP4H 4HS8L 3T0WA 1NGQH 4ODXA 3TO2A 2BVEA 3L6FA 4K55A 3BN9C 3NN8A 1JI1A 3L9RB 1CTOA 3QDHA 4QXTA 1CLCA 4IOIB 1OM3H 4CDGC 3RIFK 1TXKA 4PRPA 3I9GL 5GRUH 5E1HB 2FGWL 3KR3H 1HWGB 5C0DA 4WU5B 1AO7A 3WKNA 3ULVF 4XCEB 3B6SB 4PJ8A 4H26A 2ENSA 1N3NA 3ARBC 2DIBA 4GJTB 4HIXL 5JO5A 2C1OA 3C6LD 5B8CB 4QHNA 3OAZK 1NBVL 5HDQL 1OTSD 5EFIA 3MOAL 3I6LE 2P5ED 3NGBB 4PREA 1CD0A 5HY9A 4JFED 2X9WA 3OKNA 4DGVH 3LH2L 1HHHB 4ISVA 5KTEL 4HQQL 4DZBA 2OJEB 4LHUB 4URTB 2W9LA 4WVRA 1Q9KB 5B38A 1NC4D 1FAKT 3QQ3B 1S8DA 3QO1B 1JPSL 3KYNB 3SQBA 1C12A 4MAYD 4MGXA 3UX9B 4HWBA 3Q5OA 2DLIA 3WIHL 5K9QG 1ZKAA 4LSDA 3DRQA 5F7MC 4KV5F 3PG2A 4QOKA 1SJHB 5E8PB 4M1CC 4YNYA 3QIBD 4H1LG 1ZTXH 1JZ7A 4H25A 1EFQA 5GISH 3HUJA 1JGVH 3TEUA 5EU4A 4LARH 4JM2B 4Z18A 4MAUH 2H6PA 4J3UA 4OM0L 1CFSB 3JTTA 1A6UH 1VGEL 2H32H 4WV1C 5L6YL 2H2SC 5LQBL 5ISZA 3STZA 2I60L 1KPUB 4ZXBD 1BEYH 2DQUL 1AC0A 3IJSB 3QIWC 3WNMA 1YN6A 2PYFA 3DBXA 1J8HB 3DO7B 5IQ9A 4Y4HA 5DD3H 3IS0X 4DKEL 4ERSH 1FN4A 5LXGH 3EYOA 5T5FL 2FR4B 3CFEA 1QFWM 2QSCL 3WIIH 4F9LC 4KGLA 1XT5A 1RK1A 1FPTL 3CSYA 5DI8A 2NY0D 1YN7A 3L3JA 2LFGA 4IRJC 3WE6A 4YDLC 5HVGB 3PJSA 5GXBB 3F6IA 3E6HA 4GXVH 4WDIB 5F96L 3RUGF 2W59A 3SDAC 4NPYB 1RK0A 4IBLT 3QJHB 5I74C 2VE6A 1BOGB 3RZCD 4G43B 3JV4A 4PJDB 4I2XA 5C9JA 2UVFA 1NGYA 3ULVD 3R1GH 3HE6B 3H42H 2ZPKL 2A6JB 3IAGC 2JF1A 4W4OC 4DN3H 3MRHB 4GXUN 1E27B 4N0RA 3ULVL 1NGXA 3GKWH 1HH9B 4A6YB 1VACB 4LGPB 2JK5A 3ZE1E 5DR5H 4JR9H 1XR8A 1KC5L 4M3JA 3T3MF 4GRLC 4XX1E 1S9YB 1RVFL 4N9OB 1NGPH 2A9NH 3IKCA 4PV8B 3QJFB 2I9TA 2XZCL 4JFFA 2GK2A 4CVWA 1Y6MR 5IW1A 2PKDA 1CD9B 1IGCH 3HNTH 4PJ7B 4JO4L 4WW2C 2O5YH 1QLRB 4JAMA 5HGAA 3X11B 2AJXH 2BVQA 5D72L 5IGXH 1IMHC 3OAYK 4NUGL 5B39A 3BIKA 4DQOH 3GSNH 2GEEA 5KANI 1IZKA 1T1YA 4TRPL 1R0AH 3OJMB 1KFAH 1HWHB 2AV1B 4KFZC 1JRHH 3RBSA 32C2A 2FEDD 5I73B 1JUFB 3BPOB 3KPRB 4LCCC 1HYSC 2BMKA 4JDTL 1G0DA 1N8ZA 2NXYD 1FCGA 4P3CH 5DFVD 4U1KB 2Y7QB 4YR6A 5T3ZE 1L6ZA 2VZUA 4OLUL 1TVBA 3C9NB 5GJSH 1GOGA 5HYQA 5GGVY 4BQ8A 4XC3L 3FRUB 4DK3A 4M6NL 1NMCC 3MR9B 1E6OH 4NQDA 4LVNC 2DDQL 1CLZL 2XACC 4M3KB 5E1AA 4HW6A 4PGDA 1CR9H 1BFOA 1G7HA 2DM7A 4XP5L 1T89C 3OKLB 5DEFB 3V5KB 4N8CL 3DI2B 4H5SA 1J11A 4OF5A 4OLZH 5INDB 3UEZA 4RMSA 3KLAA 3D48R 4KHXL 25C8H 5JPMA 3UJIH 3PNWA 3CU1A 4YHZH 1FNGB 1B2WL 1H9VA 4B53A 5C8JB 2VIRB 1YNLL 5JOFB 4RWYL 3UJJL 4P57A 1NGWA 4IRSB 1ZGLM 1XGRB 4WW1A 3EYFA 1MFAH 4O9HL 1FVEB 3L3IA 4P5MB 4U1SA 5I1EH 5E2TH 3QUZC 1RQ5A 5D2NE 3QUMA 3RL2A 5DD6B 3ECBB 2R1XB 3TP4A 4R3SA 4KDTA 1DSFL 4EI6B 4HUWB 4KHTL 4PLJC 4XPFL 4KZDH 1NAMH 3NCJL 3P0YH 1MCRA 5EORH 3FO9B 3P73A 1ZLUH 2EDBA 5CJOL 5EU6D 3GI8H 5IFAL 4ODSL 3MFFA 4JRYD 3LSOB 6CGTA 1K8IA 1GZPB 4F2MB 1J5OH 1ZHBB 2MOVA 1OVZA 4JM2F 2RHEA 1SJEB 2Y4SA 1F4WH 5E2JA 2P48B 3HMXL 1NCCL 3VRJB 1WISA 4WFEE 5DQ9A 5MI0B 4JFHE 2D4FA 4QRPB 5ESVA 2NY5H 3TWCL 1IAKA 1G7LB 4OZFG 5AWNH 4IIQA 3A6CH 2V9RA 4JPKL 4KK5C 2E7CA 1M1SA 3QEQE 3TO4A 1U3JA 1H3GA 1HCVA 4GKOA 3MOQA 1HE7A 3G6JF 3SDCA 5GGQL 1GOFA 5ENWA 1AGFA 1LP9A 5C0AA 4Q6IC 4LU5H 1AGEB 2DIAA 3PE9A 3ARXA 3TA3B 43CAB 2UZYB 4LLUA 4F58L 2AJSH 1JWMB 1Q94B 4LP5A 5BVJA 4XPBH 4CU8A 4YHLL 2NY7L 2X9YA 3DO3A 5I9QB 3TPUB 2WW8A 2PW2A 4Y4KA 3IDIB 2Y25A 5MHSE 1U8NB 4V1DB 5JXAL 3ZHKA 5FO7B 3VXPA 4PJDF 4JVWA 4H20L 4ZDHB 1X7QB 5IHLB 3JTSB 4P9MH 2GT9B 1YEIH 1NANI 3B5TA 4CAGA 2FCBA 1T3FA 4N0YL 2EECA 2QQNH 5TE4L 1KJVA 2VLJE 3JV5A 1TJGL 2R0KL 4KGJA 4FNLL 4ODHL 5F6HJ 1WFOA 4LHUD 4L3AA 5FM5M 5FO8B 1OB1B 4Y89A 1T1XA 4JFYB 1AGDA 4CVXA 1BZ7A 2WBKA 3GRWA 3D5OF 1BD2A 4WI6A 5IT2H 4EZMA 3KWWA 2VR4A 1F00I 4OFYA 3MXWL 4PJ7F 5HPOA 1JNLL 4DTGH 1ZHNB 2IPUG 2R2EB 4XNZB 1GH7A 2EH8H 3VGGA 3RVVD 5KVEL 1NFDE 1YYLH 5IMKA 5HSFA 3O2WL 3IXTA 4AIZB 1MIEL 1MJUL 3WDHA 3H3BC 4MJIA 3TN0A 3L7EB 3K81A 4JM2D 1PSKH 2GAZB 3WD5H 4F57H 4WHTB 3TCLB 2AABL 4OCWH 3UPRA 2X4UA 4WUUE 1MQKL 4TYUA 5E6IA 2BNQA 4QEGA 1EEQA 3HC0A 3LKNA 5ADPH 3ZKQD 1RUPH 4OZGB 2NY3C 4L4VA 3RP1A 4XMLL 5KG9A 4YUEH 4X6FB 3T3PF 3PIQA 1D5MA 3GHEL 4HBCH 2J8UA 3T4AA 3ZKMC 3MRFB 5EOCH 5CCKH 1A6AA 3MRJA 4BZ2L 4LCIL 4I3SH 4JDVB 5EUOA 1JCKA 3WDIA 1ORSB 3VXSE 4OZIB 2KPNA 4J6RH 5TE6L 1G7QB 1W8OA 1FFNA 4KKBD 4BQ9A 4F37K 1Z5LB 1CE6A 4I5BA 5DA0B 5T5NF 2QSTA 4QRRB 1T04B 4FN0A 4LGSB 4P59H 5CD5C 2BNRE 5D7IB 3U30C 1QKZH 1OCWH 4HZLA 5MEOA 2L4OA 1MVFA 5LVEA 1RURH 5DQDH 1IBGH 1ZVYA 3QXDA 2FWOB 3O3BA 3ARBA 3RIAF 3WIHA 4MXVE 3B9AA 2VN4A 1JZ5A 4UQ3A 1WAAF 4K3DH 3C5JB 4LEOA 5FV1L 2V7HB 5FHAL 2R39A 4W68A 2D31A 1DQQA 4AM0B 1LEIB 3RRQA 2GJZA 4X8JA 2QQKH 5F9AC 5C3LD 3VWJB 3NIGF 2DQFA 1D5BA 1YUHB 5HHPA 1SY6A 3P9LB 4YHKL 3GK8L 1DLHA 2P1YA 5DJ2B 5F7KC 1OD9A 4X98A 3MJ7B 2MQCA 4YBQD 1QZ1A 2H32B 4RA0C 1YECH 2E9IA 1LO0H 1BAFH 1CGVA 1TVDA 3H9SE 2MFNA 1NCDH 3OX8A 2DLEA 3KPRD 3BEWB 3CVIH 3N50A 2FO1A 4C83B 3IDMA 2IBBA 3UTPD 1CD1B 1UXSB 3OAZH 4TNVK 1FAIH 3QIWA 3DVIA 4NCC1 1JFQH 3NH7L 4I2XE 5AZEH 1OAUH 3IVKB 1EVTC 3P30H 4KUZL 4UDTB 3JUYA 5AD0B 1X5XA 5CEZE 4YBLC 1QBBA 4F9LA 1GGCH 2NQCA 4LPUA 5L7XL 1IEAA 3U0TA 3WEXA 1A6TA 3FQXA 2VISA 5DK0A 1O5DT 5FYKE 1INEH 4IRJA 4LIQH 5TF0A 4BFBD 2WK2A 4TULH 1F6AA 3KJ4C 1DN0B 5JPNA 3MCKA 5DJZA 3SDAA 1M7DA 3L5XH 3BYTA 2V2TB 5L2KE 3M17A 4QHUA 5DD0H 1MCOH 4JFFE 4HKXB 4ZS7L 4XNYL 3GMPA 3HRZB 1IGJA 2YC1A 4NKOA 4F15C 4Y5XB 5D7LA 3ARSA 3EDKA 1G9NH 4O5LL 3HC4L 4IRSD 4W4OA 1ZS8B 1EHAA 4ZPTA 5I71C 5MENA 2ZG1A 4XNQA 2MNUA 3VXRE 1R3LA 4JPWH 3F7VA 5HI3C 1M4KA 5ESQB 3DV6A 4EUPG 5C0EA 3VGBA 2WWMC 3TLRA 1UEMA 1TCRB 2CLZA 4GRLA 5T1KA 3BKCH 3GSOB 3WBDA 5EOTA 5KSBB 2KH2B 4X0KA 2X05A 4XCNB 4BKLB 1NBZB 4OLWH 5FXCH 1S7UB 4GKZB 3UTSA 1S9KC 1U6AH 2BY1A 2EYRB 4HX1B 4WW2A 1UEYA 1MAMH 4ZPVB 4Z7WA 3DUUA 2Y06H 3MRGB 2D0HA 2KZ1B 4EBQL 3K80A 1GIGH 3SGJC 4PJBA 3AMKA 4QRPD 4XVJH 4DAGL 4PJGB 1FFPA 1RUMH 3MRRA 1FVCA 4NQSA 5T1LA 4NYLB 1KTLB 3L95A 4QHLB 5FYLH 4NNXA 2I9LB 1KXQE 2X1QA 3VFSA 4UMGA 1NCUA 5F3BB 4LCCA 3WFHB 5T3XL 1OSZA 3BWUC 1DDHB 1MRFL 3D18A 1HI6B 3O6FB 3T0EB 4EIZC 2LU3A 3QT2A 3TA3D 3ZKXB 3SDDD 4K2UH 2E27H 4I3GA 4L3CA 4Z5RA 4Y16B 5I1AA 1QYGH 1ETZA 5IMOB 3H0TA 3VD7A 1N5AB 4KI5C 4J3XA 4OGZA 3WXVH 5FB8B 1CT8A 3BP5A 3QHZH 4V1DD 1KF9B 4FQQB 3TV3H 1YNKL 4G8FB 4LPXA 2P7TA 5GPRA 5JHDA 1T89A 2EDOA 2JCCB 5CAYB 1XIWD 3MROB 5DC9B 3OAYH 1QNZH 4GLRI 4CADB 4OGYH 4K7FA 2ZSVA 2QSVA 5C7XH 1CL7I 1G7JB 4K9EL 1D5IH 4Q9CA 2EH7L 3ULUL 5AEAA 5FYJE 4L5FL 3JV6A 1P69B 1X5LA 2VLKB 1A3RH 1W0WA 3U2SA 5I76B 1N5YH 4X5WA 1Q9WB 3LOWA 1EFXA 5E5UB 4Z7VA 5D1XC 3EJYD 3BRDA 1EBAA 3ES6B 4XNZC 1PAMA 1JTPA 1NAMB 2AXGA 1HK6A 3GSRA 4OCXL 5HHQA 1BQUA 2B4CC 3VXME 2V6HA 1RMFL 2YD4A 4LRNL 4DZ8B 3EJZC 5E2WH 5DRWB 4QXUH 3RJQB 2Q8BH 4GW5A 2IJ0C 3GSUA 1ZV5A 2XQYK 4KROC 5EBMA 1PQZB 3V52H 1J0YA 4C54A 1YPZE 5E99L 1OP5K 3ARPA 3JXAA 5GRYA 3GMRB 3KPPA 1K8DA 4HAFA 4AMKL 1OT1A 1TJIL 1TVHA 4BUHA 4LKCB 1XCTA 3IRZA 3F7QA 1KTDB 3MLRL 3GKZA 2W0KA 3UTZA 4X7DC 1KT2A 5I1IL 4NQCA 5GZOD 1QFPA 1G7MA 4R26H 1WLHA 2QQLL 1I1AB 3U4AA 3B4NA 4U2YA 5BRZE 4NNYA 4D9LH 3V6FA 3QDJE 5IKCA 5BOPA 4GMSL 3L9RA 2ESVA 1FP5A 1TQCC 2OP4L 1N64H 2ZCHH 3BPCA 4JJ5A 4Q6IA 1O7VA 1FL5A 4NRZB 1RJYB 1L0XA 5I8EA 1OM3L 1T5XB 3DGGB 3MRQB 4LKXB 1X5JA 4QRRD 4ODWB 1A3QA 1KCKA 3IFOA 5GRUL 5IJKC 5B8CA 4ZFFA 1FFOA 2VZ3A 5HYSB 4MD4B 3RNQA 4PV9A 2E7BA 3B2VL 4XPTL 2XFXA 1ED3B 4TVSa 5GGUA 4R7NB 1NUDA 4JG0H 4G8GE 5E8NB 1F11B 1VB9A 5MEQB 2O93L 2VXSH 5HPMA 4ZO9A 3H9ZA 4GG6A 1K5NA 1VFBA 3UPAA 5C71A 4QXGH 3MTRA 1N0XH 4UTAH 5IHBA 3IT8D 2XZQL 4PRBB 4DGVL 4XZUA 3MV8D 3V0WH 4PJCE 4JFDB 4EKXA 3SE9H 1OLLA 1VDGA 1MCWW 5IMMA 1OF2A 3VXNA 3VWJD 5KSBF 3O6MH 5C0CE 2EYTB 2P5WE 4LMQI 2Q7YB 1DN2A 4GT7A 1MHEB 3F12A 2C3VB 1FO0L 4HPOH 1UQSA 1UM5H 3N1PC 4R96B 4X80H 1RAMA 2FJFB 4NT6A 2B0SL 4UT7H 4PLNC 1RZJC 1ZTXL 2Q87A 1P4IL 4LARL 2MCPH 4EEEA 1UFUA 1FDLH 4PJGF 1OAXH 1Z2KA 1DFBH 1L0YA 2DTMH 2YXMA 1J8HA 5DK2B 2JB6A 1FORL 1QSEB 1S7SA 2VDKH 4JN2B 3O3DA 1EJ6A 4L8BA 3MV9A 4M5YH 1BEYL 2CDGB 5ANMA 5KOVC 4WI8A 5F7DA 1UENA 5C09B 4Z77B 4G42B 3EFDH 3RPIA 4C56B 5DD3L 4ERSL 2VXVH 1RHFA 3Q5TA 2P5EE 1IM3B 4NZUL 3PABA 3WIIL 1L9NA 1S5HA 2ZKHH 5I17A 2A6DA 4HLZH 4JFEE 4I0KA 1M7IA 5DUPL 1Q38A 4XPGL 4YC2B 3RWFA 2HT3D 2BHUA 2QLVB 2J8OA 4HFUL 4U1MB 2XWJB 4P49A 5SWSB 4GQPH 2ATKB 4PB0H 4OCLC 3TJEL 3MA7B 3ROLB 1P84K 1U8JA 3KYOB 2R2BA 3D0VB 2JCCF 1S7RA 3O2DL 1KN2H 2FRGP 5A2FA 3NFSH 4MB4A 5HYEA 1V7MH 3R1GL 1DTUA 2VR9A 4HHAB 5DGRA 5J6GB 3FFCD 4PRIB 1ZA6B 5GRZA 5ALBH 4JO3H 2VLRB 3L5HA 3UYRH 1VADA 3A6BH 4PJFB 5D2LE 3WS3A 4KC3B 1HDMA 2FX8L 3BWAB 5DYOA 5DR5L 4JR9L 2ICEA 5HJ3B 1JNHA 1P84J 1H0DA 3HFMH 2CRYA 4GKSA 4ZMAT 4JKLA 1NGPL 2A9NL 4H88L 1B0GA 1U8OB 3HTLX 1AKJB 3IKKA 5DSCA 4HG4K 2X10A 1CK0L 3HNTL 2O5YL 4ZG1A 1Z3GL 1ADQH 2QADD 4ODTH 3SCMD 4JZOA 3L3KA 3VFPA 1S5IH 3UCRA 2EEAA 4WJ5B 5IGXL 2N7BA 4WFFE 2HJLB 3GMMA 4YFEA 2EDLA 1WVZA 3BAEH 3HZVB 1TZGL 2F54A 1R0AL 1H3PH 2XY2A 1KFAL 4LFHD 1LILA 3OHXA 3PF2A 4P2QA 4NKDB 4S0SD 1HIMH 1J1PH 4HG4J </