4S2VA

E. coli rpph structure, ki soak
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
139
Chain Sequence
SMIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Complexes with the Escherichia coli RNA Pyrophosphohydrolase RppH Unveil the Basis for Specific 5'-End-dependent mRNA Decay.
pubmed doi rcsb
molecule keywords RNA pyrophosphohydrolase
molecule tags Hydrolase
source organism Escherichia coli
total genus 38
structure length 139
sequence length 157
ec nomenclature ec 3.6.1.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4s2vA00
1K26A 3HHJA 3ACAA 5ANTA 5IW5A 5LPGA 5ANVA 1PUNA 1Q54A 1SU2A 3Q93A 5C8LA 3Q2SA 4MPOA 2DSBA 1NFZA 4S2VA 4YPRA 3X0IA 2W4EA 2YVNA 3H95A 4NFXA 4YOQA 3Q91A 1MUTA 2B2KA 3A6TA 3L85A 4V14A 1PPXA 2A8RA 3SHDA 5CFIA 2I8TA 3MGMA 2A8QA 2GT4A 3Q1PA 5CFJA 5ISYA 4JZSA 1V8NA 1KTGA 1MQEA 2G74A 1RRQA 3I7VA 1XSBA 3EF5A 5DDGA 1MR2A 4JZVA 2KDWA 2KDVA 2ICJA 5BS6A 2YVMA 5FSMA 4S2XA 3COUA 3RH7A 3FCMA 4S2WA 4C9WA 2ICKA 1HZTA 1XSAA 2A8PA 1JRKA 3G0QA 2A8SA 3BAPA 1V8YA 3GZ8A 1MK1A 1NQZA 4KG3A 5GHOA 5GHQA 2I6KA 4C9XA 2Q9PA 1V8VA 4KTBA 2O1CA 4DYWA 2A8TA 1V8RA 1VC8A 1VC9A 2YYHA 3DUPA 1I9AA 2J8QA 2JVBA 4NFWA 2QJOA 3SONA 2VNPA 1GA7A 3X0LA 5DPKA 3ID9A 2FMLA 3I7UA 3Q4IA 2QJTA 1K2EA 5FSNA 4JZUA 2VNQA 1V8LA 1X83A 5DD4A 5ANSA 1KHZA 4N1TA 3X0SA 3X0NA 5GHPA 1TUMA 1Q27A 2DHOA 5GHIA 3O61A 2DSCA 1MQWA 3DKUA 4ILQA 5FSLA 1R67A 5FSKA 4HFQA 3O52A 1MP2A 1PPVA 3GZ6A 1V8UA 1G9QA 1KT9A 3X0KA 3FFUA 3EESA 3ZR1A 4ZG0A 3QSJA 3MDGA 2G73A 5ANUA 1QVJA 3MCFA 2PNYA 3F6AA 3E57A 4N1UA 1OW2A 5DEQA 4KYXA 1VK6A 5C7QA 3J7Ye 2FVVA 1NFSA 3BM4A 1U20A 3GG6A 3O69A 1VHZA 3KVHA 3O6ZA 3A6SA 5GHMA 3WHWA 1SOIA 1VCDA 1NQYA 3EXQA 3GZ5A 1V8SA 1V8TA 1VIQA 4IJXA 2YVOA 5IW4A 3P5TA 5ANWA 1PUQA 5I8UA 5BONA 2PQVA 3A6UA 3X0QA 1RRSA 2XSQA 1JKNA 3N9UA 4HVYA 3OGAA 5GHNA 2B06A 1VIUA 2GT2A 3BHOA 3CNGA 3X0RA 2GB5A 1PVFA 2R5WA 2B0VA 3R03A 4KG4A 3X0MA 1G0SA 3X0JA 1V8MA 3F13A 4S2YA 5GHJA 1X84A 4YPHA 1XSCA 1V8IA 2RRKA 1V8WA 1SJYA 2I8UA 5FSOA 3U53A 3ZR0A 1Q33A 3EEUA 3MDIA 3HYQA 3N77A 1IRYA 2DUKA 1VHGA 2DSDA 1SZ3A 2YVPA 3X0PA 3FSPA 2QKMB 3FK9A 2A6TA 1PUSA 3A6VA 4K6EA 1VRLA 3O8SA 1HX3A 1PPWA 2FKBA 3AC9A 3FJYA 3GRNA 3Q2TA 1RYAA 3GWYA 4ICKA 2CL3A 3SMDA 3X0OA 2AZWA 4JZTA 5FSIA 1F3YA 2O5WA 1X51A 5C7TA 3I9XA 3P6YA 2O5FA 5HZXA
chains in the Genus database with same CATH superfamily
1K26A 3HHJA 3ACAA 5ANTA 5IW5A 5LPGA 5ANVA 1PUNA 1Q54A 1SU2A 3Q93A 5C8LA 3Q2SA 4MPOA 2DSBA 1NFZA 4S2VA 4YPRA 3X0IA 2W4EA 2YVNA 3H95A 4NFXA 4YOQA 3Q91A 1MUTA 2B2KA 3A6TA 3L85A 4V14A 1PPXA 2A8RA 4J7GA 3SHDA 5CFIA 2I8TA 3MGMA 2A8QA 2GT4A 3Q1PA 5CFJA 5ISYA 4JZSA 1V8NA 1KTGA 1MQEA 2G74A 1RRQA 3I7VA 1XSBA 3EF5A 5DDGA 1MR2A 4JZVA 2KDWA 2KDVA 2ICJA 5BS6A 2YVMA 5FSMA 4S2XA 3COUA 3RH7A 3FCMA 4S2WA 4C9WA 2ICKA 1HZTA 1XSAA 2A8PA 1JRKA 3G0QA 2A8SA 3BAPA 1V8YA 3GZ8A 1MK1A 1NQZA 4KG3A 5GHOA 5GHQA 2I6KA 4C9XA 2Q9PA 1V8VA 4KTBA 2O1CA 4DYWA 2A8TA 1V8RA 1VC8A 1VC9A 2YYHA 3DUPA 4J7HA 1I9AA 2J8QA 2JVBA 4NFWA 2QJOA 3SONA 2VNPA 1GA7A 3X0LA 5DPKA 3ID9A 2FMLA 3I7UA 3Q4IA 2QJTA 1K2EA 5FSNA 4JZUA 2VNQA 1V8LA 1X83A 5DD4A 5ANSA 1KHZA 4N1TA 3X0SA 3X0NA 5GHPA 1TUMA 1Q27A 2DHOA 5GHIA 3O61A 2DSCA 1MQWA 3DKUA 4ILQA 5FSLA 1R67A 5FSKA 4HFQA 3O52A 1MP2A 1PPVA 3GZ6A 1V8UA 1G9QA 1KT9A 3X0KA 3FFUA 3EESA 3ZR1A 4ZG0A 3QSJA 3MDGA 2G73A 5ANUA 1QVJA 3MCFA 2PNYA 3F6AA 3E57A 4N1UA 1OW2A 5DEQA 4KYXA 1VK6A 5C7QA 3J7Ye 2FVVA 1NFSA 3BM4A 1U20A 3GG6A 3O69A 1VHZA 3KVHA 3O6ZA 3A6SA 5GHMA 3WHWA 1SOIA 1VCDA 1NQYA 3EXQA 3GZ5A 1V8SA 1V8TA 1VIQA 4IJXA 2YVOA 5IW4A 3P5TA 5ANWA 1PUQA 5I8UA 5BONA 2PQVA 3A6UA 3X0QA 1RRSA 2XSQA 1JKNA 3N9UA 4HVYA 3OGAA 5GHNA 2B06A 1VIUA 2GT2A 3BHOA 3CNGA 3X0RA 2GB5A 1PVFA 2R5WA 2B0VA 3R03A 4KG4A 3X0MA 1G0SA 3X0JA 1V8MA 3F13A 4S2YA 5GHJA 1X84A 4YPHA 1XSCA 1V8IA 2RRKA 1V8WA 1SJYA 2I8UA 5FSOA 3U53A 3ZR0A 1Q33A 3EEUA 3MDIA 3HYQA 3N77A 1IRYA 2DUKA 1VHGA 2DSDA 1SZ3A 2YVPA 3X0PA 3FSPA 2QKMB 3FK9A 2A6TA 1PUSA 3A6VA 4K6EA 1VRLA 2CZRA 3O8SA 1HX3A 1PPWA 2FKBA 3AC9A 3FJYA 3GRNA 3Q2TA 1RYAA 3GWYA 4ICKA 2CL3A 3SMDA 3X0OA 2AZWA 4JZTA 5FSIA 1F3YA 2O5WA 1X51A 5C7TA 3I9XA 3P6YA 2O5FA 5HZXA
chains in the Genus database with same CATH topology
1K26A 3HHJA 3ACAA 5ANTA 5IW5A 5LPGA 5ANVA 1PUNA 1Q54A 1SU2A 3Q93A 5C8LA 3Q2SA 4MPOA 2DSBA 1NFZA 4S2VA 4YPRA 3X0IA 2W4EA 2YVNA 3H95A 4NFXA 4YOQA 3Q91A 1MUTA 2B2KA 3A6TA 3L85A 4V14A 1PPXA 2A8RA 4J7GA 3SHDA 5CFIA 2I8TA 3MGMA 2A8QA 2GT4A 3Q1PA 5CFJA 5ISYA 4JZSA 1V8NA 1KTGA 1MQEA 2G74A 1RRQA 3I7VA 1XSBA 3EF5A 5DDGA 1MR2A 4JZVA 2KDWA 2KDVA 2ICJA 5BS6A 2YVMA 5FSMA 4S2XA 3COUA 3RH7A 3FCMA 4S2WA 4C9WA 2ICKA 1HZTA 1XSAA 2A8PA 1JRKA 3G0QA 2A8SA 3BAPA 1V8YA 3GZ8A 1MK1A 1NQZA 4KG3A 5GHOA 5GHQA 2I6KA 4C9XA 2Q9PA 1V8VA 4KTBA 2O1CA 4DYWA 2A8TA 1V8RA 1VC8A 1VC9A 2YYHA 3DUPA 4J7HA 1I9AA 2J8QA 2JVBA 4NFWA 2QJOA 3SONA 2VNPA 1GA7A 3X0LA 5DPKA 3ID9A 2FMLA 3I7UA 3Q4IA 2QJTA 1K2EA 5FSNA 4JZUA 2VNQA 1V8LA 1X83A 5DD4A 5ANSA 1KHZA 4N1TA 3X0SA 3X0NA 5GHPA 1TUMA 1Q27A 2DHOA 5GHIA 3O61A 2DSCA 1MQWA 3DKUA 4ILQA 5FSLA 1R67A 5FSKA 4HFQA 3O52A 1MP2A 1PPVA 3GZ6A 1V8UA 1G9QA 1KT9A 3X0KA 3FFUA 3EESA 3ZR1A 4ZG0A 3QSJA 3MDGA 2G73A 5ANUA 1QVJA 3MCFA 2PNYA 3F6AA 3E57A 4N1UA 1OW2A 5DEQA 4KYXA 1VK6A 5C7QA 3J7Ye 2FVVA 1NFSA 3BM4A 1U20A 3GG6A 3O69A 1VHZA 3KVHA 3O6ZA 3A6SA 5GHMA 3WHWA 1SOIA 1VCDA 1NQYA 3EXQA 3GZ5A 1V8SA 1V8TA 1VIQA 4IJXA 2YVOA 5IW4A 3P5TA 5ANWA 1PUQA 5I8UA 5BONA 2PQVA 3A6UA 3X0QA 1RRSA 2XSQA 1JKNA 3N9UA 4HVYA 3OGAA 5GHNA 2B06A 1VIUA 2GT2A 3BHOA 3CNGA 3X0RA 2GB5A 1PVFA 2R5WA 2B0VA 3R03A 4KG4A 3X0MA 1G0SA 3X0JA 1V8MA 3F13A 4S2YA 5GHJA 1X84A 4YPHA 1XSCA 1V8IA 2RRKA 1V8WA 1SJYA 2I8UA 5FSOA 3U53A 3ZR0A 1Q33A 3EEUA 3MDIA 3HYQA 3N77A 1IRYA 2DUKA 1VHGA 2DSDA 1SZ3A 2YVPA 3X0PA 3FSPA 2QKMB 3FK9A 2A6TA 1PUSA 3A6VA 4K6EA 1VRLA 2CZRA 3O8SA 1HX3A 1PPWA 2FKBA 3AC9A 3FJYA 3GRNA 3Q2TA 1RYAA 3GWYA 4ICKA 2CL3A 3SMDA 3X0OA 2AZWA 4JZTA 5FSIA 1F3YA 2O5WA 1X51A 5C7TA 3I9XA 3P6YA 2O5FA 5HZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K26 A;  3HHJ A;  3ACA A;  5ANT A;  5IW5 A;  5LPG A;  5ANV A;  1PUN A;  1Q54 A;  1SU2 A;  3Q93 A;  5C8L A;  3Q2S A;  4MPO A;  2DSB A;  1NFZ A;  4S2V A;  4YPR A;  3X0I A;  2W4E A;  2YVN A;  3H95 A;  4NFX A;  4YOQ A;  3Q91 A;  1MUT A;  2B2K A;  3A6T A;  3L85 A;  4V14 A;  1PPX A;  2A8R A;  3SHD A;  5CFI A;  2I8T A;  3MGM A;  2A8Q A;  2GT4 A;  3Q1P A;  5CFJ A;  5ISY A;  4JZS A;  1V8N A;  1KTG A;  1MQE A;  2G74 A;  1RRQ A;  3I7V A;  1XSB A;  3EF5 A;  5DDG A;  1MR2 A;  4JZV A;  2KDW A;  2KDV A;  2ICJ A;  5BS6 A;  2YVM A;  5FSM A;  4S2X A;  3COU A;  3RH7 A;  3FCM A;  4S2W A;  4C9W A;  2ICK A;  1HZT A;  1XSA A;  2A8P A;  1JRK A;  3G0Q A;  2A8S A;  3BAP A;  1V8Y A;  3GZ8 A;  1MK1 A;  1NQZ A;  4KG3 A;  5GHO A;  5GHQ A;  2I6K A;  4C9X A;  2Q9P A;  1V8V A;  4KTB A;  2O1C A;  4DYW A;  2A8T A;  1V8R A;  1VC8 A;  1VC9 A;  2YYH A;  3DUP A;  1I9A A;  2J8Q A;  2JVB A;  4NFW A;  2QJO A;  3SON A;  2VNP A;  1GA7 A;  3X0L A;  5DPK A;  3ID9 A;  2FML A;  3I7U A;  3Q4I A;  2QJT A;  1K2E A;  5FSN A;  4JZU A;  2VNQ A;  1V8L A;  1X83 A;  5DD4 A;  5ANS A;  1KHZ A;  4N1T A;  3X0S A;  3X0N A;  5GHP A;  1TUM A;  1Q27 A;  2DHO A;  5GHI A;  3O61 A;  2DSC A;  1MQW A;  3DKU A;  4ILQ A;  5FSL A;  1R67 A;  5FSK A;  4HFQ A;  3O52 A;  1MP2 A;  1PPV A;  3GZ6 A;  1V8U A;  1G9Q A;  1KT9 A;  3X0K A;  3FFU A;  3EES A;  3ZR1 A;  4ZG0 A;  3QSJ A;  3MDG A;  2G73 A;  5ANU A;  1QVJ A;  3MCF A;  2PNY A;  3F6A A;  3E57 A;  4N1U A;  1OW2 A;  5DEQ A;  4KYX A;  1VK6 A;  5C7Q A;  3J7Y e;  2FVV A;  1NFS A;  3BM4 A;  1U20 A;  3GG6 A;  3O69 A;  1VHZ A;  3KVH A;  3O6Z A;  3A6S A;  5GHM A;  3WHW A;  1SOI A;  1VCD A;  1NQY A;  3EXQ A;  3GZ5 A;  1V8S A;  1V8T A;  1VIQ A;  4IJX A;  2YVO A;  5IW4 A;  3P5T A;  5ANW A;  1PUQ A;  5I8U A;  5BON A;  2PQV A;  3A6U A;  3X0Q A;  1RRS A;  2XSQ A;  1JKN A;  3N9U A;  4HVY A;  3OGA A;  5GHN A;  2B06 A;  1VIU A;  2GT2 A;  3BHO A;  3CNG A;  3X0R A;  2GB5 A;  1PVF A;  2R5W A;  2B0V A;  3R03 A;  4KG4 A;  3X0M A;  1G0S A;  3X0J A;  1V8M A;  3F13 A;  4S2Y A;  5GHJ A;  1X84 A;  4YPH A;  1XSC A;  1V8I A;  2RRK A;  1V8W A;  1SJY A;  2I8U A;  5FSO A;  3U53 A;  3ZR0 A;  1Q33 A;  3EEU A;  3MDI A;  3HYQ A;  3N77 A;  1IRY A;  2DUK A;  1VHG A;  2DSD A;  1SZ3 A;  2YVP A;  3X0P A;  3FSP A;  2QKM B;  3FK9 A;  2A6T A;  1PUS A;  3A6V A;  4K6E A;  1VRL A;  3O8S A;  1HX3 A;  1PPW A;  2FKB A;  3AC9 A;  3FJY A;  3GRN A;  3Q2T A;  1RYA A;  3GWY A;  4ICK A;  2CL3 A;  3SMD A;  3X0O A;  2AZW A;  4JZT A;  5FSI A;  1F3Y A;  2O5W A;  1X51 A;  5C7T A;  3I9X A;  3P6Y A;  2O5F A;  5HZX A; 
#chains in the Genus database with same CATH topology
 1K26 A;  3HHJ A;  3ACA A;  5ANT A;  5IW5 A;  5LPG A;  5ANV A;  1PUN A;  1Q54 A;  1SU2 A;  3Q93 A;  5C8L A;  3Q2S A;  4MPO A;  2DSB A;  1NFZ A;  4S2V A;  4YPR A;  3X0I A;  2W4E A;  2YVN A;  3H95 A;  4NFX A;  4YOQ A;  3Q91 A;  1MUT A;  2B2K A;  3A6T A;  3L85 A;  4V14 A;  1PPX A;  2A8R A;  4J7G A;  3SHD A;  5CFI A;  2I8T A;  3MGM A;  2A8Q A;  2GT4 A;  3Q1P A;  5CFJ A;  5ISY A;  4JZS A;  1V8N A;  1KTG A;  1MQE A;  2G74 A;  1RRQ A;  3I7V A;  1XSB A;  3EF5 A;  5DDG A;  1MR2 A;  4JZV A;  2KDW A;  2KDV A;  2ICJ A;  5BS6 A;  2YVM A;  5FSM A;  4S2X A;  3COU A;  3RH7 A;  3FCM A;  4S2W A;  4C9W A;  2ICK A;  1HZT A;  1XSA A;  2A8P A;  1JRK A;  3G0Q A;  2A8S A;  3BAP A;  1V8Y A;  3GZ8 A;  1MK1 A;  1NQZ A;  4KG3 A;  5GHO A;  5GHQ A;  2I6K A;  4C9X A;  2Q9P A;  1V8V A;  4KTB A;  2O1C A;  4DYW A;  2A8T A;  1V8R A;  1VC8 A;  1VC9 A;  2YYH A;  3DUP A;  4J7H A;  1I9A A;  2J8Q A;  2JVB A;  4NFW A;  2QJO A;  3SON A;  2VNP A;  1GA7 A;  3X0L A;  5DPK A;  3ID9 A;  2FML A;  3I7U A;  3Q4I A;  2QJT A;  1K2E A;  5FSN A;  4JZU A;  2VNQ A;  1V8L A;  1X83 A;  5DD4 A;  5ANS A;  1KHZ A;  4N1T A;  3X0S A;  3X0N A;  5GHP A;  1TUM A;  1Q27 A;  2DHO A;  5GHI A;  3O61 A;  2DSC A;  1MQW A;  3DKU A;  4ILQ A;  5FSL A;  1R67 A;  5FSK A;  4HFQ A;  3O52 A;  1MP2 A;  1PPV A;  3GZ6 A;  1V8U A;  1G9Q A;  1KT9 A;  3X0K A;  3FFU A;  3EES A;  3ZR1 A;  4ZG0 A;  3QSJ A;  3MDG A;  2G73 A;  5ANU A;  1QVJ A;  3MCF A;  2PNY A;  3F6A A;  3E57 A;  4N1U A;  1OW2 A;  5DEQ A;  4KYX A;  1VK6 A;  5C7Q A;  3J7Y e;  2FVV A;  1NFS A;  3BM4 A;  1U20 A;  3GG6 A;  3O69 A;  1VHZ A;  3KVH A;  3O6Z A;  3A6S A;  5GHM A;  3WHW A;  1SOI A;  1VCD A;  1NQY A;  3EXQ A;  3GZ5 A;  1V8S A;  1V8T A;  1VIQ A;  4IJX A;  2YVO A;  5IW4 A;  3P5T A;  5ANW A;  1PUQ A;  5I8U A;  5BON A;  2PQV A;  3A6U A;  3X0Q A;  1RRS A;  2XSQ A;  1JKN A;  3N9U A;  4HVY A;  3OGA A;  5GHN A;  2B06 A;  1VIU A;  2GT2 A;  3BHO A;  3CNG A;  3X0R A;  2GB5 A;  1PVF A;  2R5W A;  2B0V A;  3R03 A;  4KG4 A;  3X0M A;  1G0S A;  3X0J A;  1V8M A;  3F13 A;  4S2Y A;  5GHJ A;  1X84 A;  4YPH A;  1XSC A;  1V8I A;  2RRK A;  1V8W A;  1SJY A;  2I8U A;  5FSO A;  3U53 A;  3ZR0 A;  1Q33 A;  3EEU A;  3MDI A;  3HYQ A;  3N77 A;  1IRY A;  2DUK A;  1VHG A;  2DSD A;  1SZ3 A;  2YVP A;  3X0P A;  3FSP A;  2QKM B;  3FK9 A;  2A6T A;  1PUS A;  3A6V A;  4K6E A;  1VRL A;  2CZR A;  3O8S A;  1HX3 A;  1PPW A;  2FKB A;  3AC9 A;  3FJY A;  3GRN A;  3Q2T A;  1RYA A;  3GWY A;  4ICK A;  2CL3 A;  3SMD A;  3X0O A;  2AZW A;  4JZT A;  5FSI A;  1F3Y A;  2O5W A;  1X51 A;  5C7T A;  3I9X A;  3P6Y A;  2O5F A;  5HZX A; 
#chains in the Genus database with same CATH homology
 1K26 A;  3HHJ A;  3ACA A;  5ANT A;  5IW5 A;  5LPG A;  5ANV A;  1PUN A;  1Q54 A;  1SU2 A;  3Q93 A;  5C8L A;  3Q2S A;  4MPO A;  2DSB A;  1NFZ A;  4S2V A;  4YPR A;  3X0I A;  2W4E A;  2YVN A;  3H95 A;  4NFX A;  4YOQ A;  3Q91 A;  1MUT A;  2B2K A;  3A6T A;  3L85 A;  4V14 A;  1PPX A;  2A8R A;  4J7G A;  3SHD A;  5CFI A;  2I8T A;  3MGM A;  2A8Q A;  2GT4 A;  3Q1P A;  5CFJ A;  5ISY A;  4JZS A;  1V8N A;  1KTG A;  1MQE A;  2G74 A;  1RRQ A;  3I7V A;  1XSB A;  3EF5 A;  5DDG A;  1MR2 A;  4JZV A;  2KDW A;  2KDV A;  2ICJ A;  5BS6 A;  2YVM A;  5FSM A;  4S2X A;  3COU A;  3RH7 A;  3FCM A;  4S2W A;  4C9W A;  2ICK A;  1HZT A;  1XSA A;  2A8P A;  1JRK A;  3G0Q A;  2A8S A;  3BAP A;  1V8Y A;  3GZ8 A;  1MK1 A;  1NQZ A;  4KG3 A;  5GHO A;  5GHQ A;  2I6K A;  4C9X A;  2Q9P A;  1V8V A;  4KTB A;  2O1C A;  4DYW A;  2A8T A;  1V8R A;  1VC8 A;  1VC9 A;  2YYH A;  3DUP A;  4J7H A;  1I9A A;  2J8Q A;  2JVB A;  4NFW A;  2QJO A;  3SON A;  2VNP A;  1GA7 A;  3X0L A;  5DPK A;  3ID9 A;  2FML A;  3I7U A;  3Q4I A;  2QJT A;  1K2E A;  5FSN A;  4JZU A;  2VNQ A;  1V8L A;  1X83 A;  5DD4 A;  5ANS A;  1KHZ A;  4N1T A;  3X0S A;  3X0N A;  5GHP A;  1TUM A;  1Q27 A;  2DHO A;  5GHI A;  3O61 A;  2DSC A;  1MQW A;  3DKU A;  4ILQ A;  5FSL A;  1R67 A;  5FSK A;  4HFQ A;  3O52 A;  1MP2 A;  1PPV A;  3GZ6 A;  1V8U A;  1G9Q A;  1KT9 A;  3X0K A;  3FFU A;  3EES A;  3ZR1 A;  4ZG0 A;  3QSJ A;  3MDG A;  2G73 A;  5ANU A;  1QVJ A;  3MCF A;  2PNY A;  3F6A A;  3E57 A;  4N1U A;  1OW2 A;  5DEQ A;  4KYX A;  1VK6 A;  5C7Q A;  3J7Y e;  2FVV A;  1NFS A;  3BM4 A;  1U20 A;  3GG6 A;  3O69 A;  1VHZ A;  3KVH A;  3O6Z A;  3A6S A;  5GHM A;  3WHW A;  1SOI A;  1VCD A;  1NQY A;  3EXQ A;  3GZ5 A;  1V8S A;  1V8T A;  1VIQ A;  4IJX A;  2YVO A;  5IW4 A;  3P5T A;  5ANW A;  1PUQ A;  5I8U A;  5BON A;  2PQV A;  3A6U A;  3X0Q A;  1RRS A;  2XSQ A;  1JKN A;  3N9U A;  4HVY A;  3OGA A;  5GHN A;  2B06 A;  1VIU A;  2GT2 A;  3BHO A;  3CNG A;  3X0R A;  2GB5 A;  1PVF A;  2R5W A;  2B0V A;  3R03 A;  4KG4 A;  3X0M A;  1G0S A;  3X0J A;  1V8M A;  3F13 A;  4S2Y A;  5GHJ A;  1X84 A;  4YPH A;  1XSC A;  1V8I A;  2RRK A;  1V8W A;  1SJY A;  2I8U A;  5FSO A;  3U53 A;  3ZR0 A;  1Q33 A;  3EEU A;  3MDI A;  3HYQ A;  3N77 A;  1IRY A;  2DUK A;  1VHG A;  2DSD A;  1SZ3 A;  2YVP A;  3X0P A;  3FSP A;  2QKM B;  3FK9 A;  2A6T A;  1PUS A;  3A6V A;  4K6E A;  1VRL A;  2CZR A;  3O8S A;  1HX3 A;  1PPW A;  2FKB A;  3AC9 A;  3FJY A;  3GRN A;  3Q2T A;  1RYA A;  3GWY A;  4ICK A;  2CL3 A;  3SMD A;  3X0O A;  2AZW A;  4JZT A;  5FSI A;  1F3Y A;  2O5W A;  1X51 A;  5C7T A;  3I9X A;  3P6Y A;  2O5F A;  5HZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...