4S2WA

Structure of e. coli rpph bound to sulfate ions
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
157
Chain Sequence
SMIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA pyrophosphohydrolase
publication title Structures of RNA Complexes with the Escherichia coli RNA Pyrophosphohydrolase RppH Unveil the Basis for Specific 5'-End-dependent mRNA Decay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 41
structure length 157
sequence length 161
ec nomenclature ec 3.6.1.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4s2wA00
2O5FA 3I7UA 4NFWA 4S2YA 3F6AA 5ANSA 1R67A 3X0OA 1NFSA 4NFXA 2DHOA 1MUTA 1VCDA 2QKMB 3ACAA 5ANWA 2KDVA 3AC9A 3EESA 3HYQA 4C9WA 1PUSA 3P5TA 3RH7A 3EF5A 3GZ6A 4N1TA 2YVNA 2GT2A 2XSQA 3MGMA 1RRQA 4KYXA 3X0JA 1IRYA 1PUQA 1U20A 2ICKA 2DSBA 3Q2TA 2A8TA 3OGAA 1Q33A 3H95A 3GRNA 3GZ8A 2I8TA 3O69A 3R03A 4K6EA 5ANVA 3SMDA 1PPVA 3COUA 1XSCA 3HHJA 5ISYA 1HX3A 1RYAA 1XSBA 3X0PA 1MP2A 3X0IA 3N77A 1NFZA 5FSIA 5FSNA 4IJXA 3EEUA 2PQVA 3GWYA 2B06A 1JKNA 5CFJA 2A8SA 5GHMA 1VC9A 1MQWA 2FMLA 4ICKA 3EXQA 3O8SA 1XSAA 5FSOA 2O1CA 1VHGA 2YVOA 4ZG0A 4KG3A 4YOQA 2A8PA 1V8YA 5ANUA 1V8VA 2G74A 2DSCA 2QJTA 3Q2SA 3X0MA 4HVYA 4JZUA 3DKUA 1NQYA 2I6KA 2PNYA 3SONA 1X83A 2CL3A 1Q54A 3L85A 5CFIA 5BONA 3MDGA 1VK6A 2GB5A 2QJOA 2GT4A 4S2WA 4S2XA 2FVVA 4JZSA 1VC8A 2YYHA 2B0VA 3F13A 4YPHA 2J8QA 3BAPA 2RRKA 2I8UA 4C9XA 3MCFA 1G9QA 2A6TA 5FSMA 4DYWA 4HFQA 3GZ5A 5GHQA 3I7VA 2W4EA 3GG6A 3X0LA 4YPRA 1JRKA 1VIUA 2R5WA 2VNPA 3E57A 5I8UA 1MR2A 1PPXA 3I9XA 4S2VA 3ZR0A 5C8LA 3MDIA 5GHPA 5GHJA 3SHDA 4JZVA 4V14A 1I9AA 4ILQA 1V8SA 3FK9A 5ANTA 3FFUA 4KTBA 1K2EA 2DSDA 5DEQA 3ZR1A 5DDGA 1V8MA 3BHOA 1GA7A 2G73A 5DPKA 1KHZA 3Q93A 3CNGA 2FKBA 3Q1PA 5FSLA 1OW2A 1V8RA 1Q27A 5C7QA 3O61A 2VNQA 2KDWA 5FSKA 1SU2A 3X0NA 1V8UA 3WHWA 1PUNA 1V8NA 5DD4A 3Q91A 5BS6A 2Q9PA 2B2KA 2YVMA 1PVFA 3X0SA 1G0SA 1TUMA 1V8TA 1SZ3A 2ICJA 2YVPA 1QVJA 3O52A 2A8QA 1MQEA 2JVBA 4MPOA 1F3YA 1VHZA 1KT9A 3KVHA 1PPWA 5IW4A 5IW5A 1KTGA 3A6TA 3G0QA 3P6YA 3FJYA 3X0QA 2AZWA 5C7TA 3A6VA 5LPGA 1V8IA 3A6SA 1X51A 3N9UA 1RRSA 1HZTA 1MK1A 2O5WA 5GHIA 1VIQA 1VRLA 1V8WA 2A8RA 3ID9A 1NQZA 3J7Ye 1K26A 3BM4A 1X84A 4JZTA 5GHOA 3Q4IA 3A6UA 3DUPA 5GHNA 3FCMA 3FSPA 3X0RA 5HZXA 3O6ZA 3QSJA 1V8LA 3U53A 3X0KA 2DUKA 4KG4A 1SJYA 4N1UA 1SOIA
chains in the Genus database with same CATH superfamily
2O5FA 3I7UA 4NFWA 4S2YA 3F6AA 5ANSA 1R67A 3X0OA 1NFSA 4NFXA 2DHOA 1MUTA 1VCDA 2QKMB 3ACAA 5ANWA 2KDVA 3AC9A 3EESA 3HYQA 4C9WA 1PUSA 3P5TA 3RH7A 3EF5A 3GZ6A 4N1TA 2YVNA 2GT2A 2XSQA 3MGMA 1RRQA 4KYXA 3X0JA 1IRYA 1PUQA 1U20A 2ICKA 2DSBA 3Q2TA 2A8TA 3OGAA 1Q33A 3H95A 3GRNA 3GZ8A 2I8TA 3O69A 3R03A 4K6EA 5ANVA 3SMDA 1PPVA 3COUA 1XSCA 3HHJA 5ISYA 1HX3A 1RYAA 1XSBA 3X0PA 1MP2A 3X0IA 3N77A 1NFZA 5FSIA 5FSNA 4IJXA 3EEUA 2PQVA 3GWYA 2B06A 1JKNA 5CFJA 2A8SA 5GHMA 1VC9A 1MQWA 2FMLA 4ICKA 3EXQA 3O8SA 1XSAA 5FSOA 2O1CA 1VHGA 2YVOA 4ZG0A 4KG3A 4YOQA 2A8PA 1V8YA 5ANUA 1V8VA 2G74A 2DSCA 2QJTA 3Q2SA 4J7HA 3X0MA 4HVYA 4JZUA 3DKUA 1NQYA 2I6KA 2PNYA 3SONA 1X83A 2CL3A 1Q54A 3L85A 5CFIA 5BONA 3MDGA 1VK6A 2GB5A 2QJOA 2GT4A 4S2WA 4S2XA 2FVVA 4JZSA 1VC8A 2YYHA 2B0VA 3F13A 4YPHA 2J8QA 3BAPA 2RRKA 2I8UA 4C9XA 3MCFA 1G9QA 2A6TA 5FSMA 4DYWA 4HFQA 3GZ5A 5GHQA 3I7VA 2W4EA 3GG6A 3X0LA 4YPRA 1JRKA 1VIUA 2R5WA 2VNPA 3E57A 5I8UA 1MR2A 1PPXA 3I9XA 4J7GA 4S2VA 5C8LA 3ZR0A 5GHPA 5GHJA 3SHDA 4JZVA 4V14A 1I9AA 4ILQA 1V8SA 3FK9A 5ANTA 3FFUA 4KTBA 1K2EA 2DSDA 5DEQA 3ZR1A 5DDGA 1V8MA 3BHOA 1GA7A 2G73A 5DPKA 1KHZA 3Q93A 3CNGA 2FKBA 3Q1PA 5FSLA 1OW2A 1V8RA 1Q27A 5C7QA 3O61A 2VNQA 2KDWA 5FSKA 1SU2A 3X0NA 1V8UA 3WHWA 1PUNA 1V8NA 5DD4A 3Q91A 5BS6A 2Q9PA 2B2KA 2YVMA 1PVFA 3X0SA 1G0SA 1TUMA 1V8TA 1SZ3A 2ICJA 2YVPA 1QVJA 3O52A 2A8QA 1MQEA 2JVBA 4MPOA 1F3YA 1VHZA 1KT9A 3KVHA 1PPWA 5IW4A 5IW5A 1KTGA 3A6TA 3G0QA 3P6YA 3FJYA 3X0QA 2AZWA 5C7TA 3A6VA 5LPGA 1V8IA 3A6SA 1X51A 3N9UA 1RRSA 1HZTA 1MK1A 2O5WA 5GHIA 1VIQA 1VRLA 1V8WA 2A8RA 3ID9A 1NQZA 3J7Ye 1K26A 3BM4A 1X84A 4JZTA 5GHOA 3Q4IA 3A6UA 3DUPA 5GHNA 3FCMA 3FSPA 3X0RA 5HZXA 3O6ZA 3QSJA 3MDIA 1V8LA 3U53A 3X0KA 2CZRA 2DUKA 4KG4A 1SJYA 4N1UA 1SOIA
chains in the Genus database with same CATH topology
2O5FA 3I7UA 4NFWA 4S2YA 3F6AA 5ANSA 1R67A 3X0OA 1NFSA 4NFXA 2DHOA 1MUTA 1VCDA 2QKMB 3ACAA 5ANWA 2KDVA 3AC9A 3EESA 3HYQA 4C9WA 1PUSA 3P5TA 3RH7A 3EF5A 3GZ6A 4N1TA 2YVNA 2GT2A 2XSQA 3MGMA 1RRQA 4KYXA 3X0JA 1IRYA 1PUQA 1U20A 2ICKA 2DSBA 3Q2TA 2A8TA 3OGAA 1Q33A 3H95A 3GRNA 3GZ8A 2I8TA 3O69A 3R03A 4K6EA 5ANVA 3SMDA 1PPVA 3COUA 1XSCA 3HHJA 5ISYA 1HX3A 1RYAA 1XSBA 3X0PA 1MP2A 3X0IA 3N77A 1NFZA 5FSIA 5FSNA 4IJXA 3EEUA 2PQVA 3GWYA 2B06A 1JKNA 5CFJA 2A8SA 5GHMA 1VC9A 1MQWA 2FMLA 4ICKA 3EXQA 3O8SA 1XSAA 5FSOA 2O1CA 1VHGA 2YVOA 4ZG0A 4KG3A 4YOQA 2A8PA 1V8YA 5ANUA 1V8VA 2G74A 2DSCA 2QJTA 3Q2SA 4J7HA 3X0MA 4HVYA 4JZUA 3DKUA 1NQYA 2I6KA 2PNYA 3SONA 1X83A 2CL3A 1Q54A 3L85A 5CFIA 5BONA 3MDGA 1VK6A 2GB5A 2QJOA 2GT4A 4S2WA 4S2XA 2FVVA 4JZSA 1VC8A 2YYHA 2B0VA 3F13A 4YPHA 2J8QA 3BAPA 2RRKA 2I8UA 4C9XA 3MCFA 1G9QA 2A6TA 5FSMA 4DYWA 4HFQA 3GZ5A 5GHQA 3I7VA 2W4EA 3GG6A 3X0LA 4YPRA 1JRKA 1VIUA 2R5WA 2VNPA 3E57A 5I8UA 1MR2A 1PPXA 3I9XA 4J7GA 4S2VA 5C8LA 3ZR0A 5GHPA 5GHJA 3SHDA 4JZVA 4V14A 1I9AA 4ILQA 1V8SA 3FK9A 5ANTA 3FFUA 4KTBA 1K2EA 2DSDA 5DEQA 3ZR1A 5DDGA 1V8MA 3BHOA 1GA7A 2G73A 5DPKA 1KHZA 3Q93A 3CNGA 2FKBA 3Q1PA 5FSLA 1OW2A 1V8RA 1Q27A 5C7QA 3O61A 2VNQA 2KDWA 5FSKA 1SU2A 3X0NA 1V8UA 3WHWA 1PUNA 1V8NA 5DD4A 3Q91A 5BS6A 2Q9PA 2B2KA 2YVMA 1PVFA 3X0SA 1G0SA 1TUMA 1V8TA 1SZ3A 2ICJA 2YVPA 1QVJA 3O52A 2A8QA 1MQEA 2JVBA 4MPOA 1F3YA 1VHZA 1KT9A 3KVHA 1PPWA 5IW4A 5IW5A 1KTGA 3A6TA 3G0QA 3P6YA 3FJYA 3X0QA 2AZWA 5C7TA 3A6VA 5LPGA 1V8IA 3A6SA 1X51A 3N9UA 1RRSA 1HZTA 1MK1A 2O5WA 5GHIA 1VIQA 1VRLA 1V8WA 2A8RA 3ID9A 1NQZA 3J7Ye 1K26A 3BM4A 1X84A 4JZTA 5GHOA 3Q4IA 3A6UA 3DUPA 5GHNA 3FCMA 3FSPA 3X0RA 5HZXA 3O6ZA 3QSJA 3MDIA 1V8LA 3U53A 3X0KA 2CZRA 2DUKA 4KG4A 1SJYA 4N1UA 1SOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5F A;  3I7U A;  4NFW A;  4S2Y A;  3F6A A;  5ANS A;  1R67 A;  3X0O A;  1NFS A;  4NFX A;  2DHO A;  1MUT A;  1VCD A;  2QKM B;  3ACA A;  5ANW A;  2KDV A;  3AC9 A;  3EES A;  3HYQ A;  4C9W A;  1PUS A;  3P5T A;  3RH7 A;  3EF5 A;  3GZ6 A;  4N1T A;  2YVN A;  2GT2 A;  2XSQ A;  3MGM A;  1RRQ A;  4KYX A;  3X0J A;  1IRY A;  1PUQ A;  1U20 A;  2ICK A;  2DSB A;  3Q2T A;  2A8T A;  3OGA A;  1Q33 A;  3H95 A;  3GRN A;  3GZ8 A;  2I8T A;  3O69 A;  3R03 A;  4K6E A;  5ANV A;  3SMD A;  1PPV A;  3COU A;  1XSC A;  3HHJ A;  5ISY A;  1HX3 A;  1RYA A;  1XSB A;  3X0P A;  1MP2 A;  3X0I A;  3N77 A;  1NFZ A;  5FSI A;  5FSN A;  4IJX A;  3EEU A;  2PQV A;  3GWY A;  2B06 A;  1JKN A;  5CFJ A;  2A8S A;  5GHM A;  1VC9 A;  1MQW A;  2FML A;  4ICK A;  3EXQ A;  3O8S A;  1XSA A;  5FSO A;  2O1C A;  1VHG A;  2YVO A;  4ZG0 A;  4KG3 A;  4YOQ A;  2A8P A;  1V8Y A;  5ANU A;  1V8V A;  2G74 A;  2DSC A;  2QJT A;  3Q2S A;  3X0M A;  4HVY A;  4JZU A;  3DKU A;  1NQY A;  2I6K A;  2PNY A;  3SON A;  1X83 A;  2CL3 A;  1Q54 A;  3L85 A;  5CFI A;  5BON A;  3MDG A;  1VK6 A;  2GB5 A;  2QJO A;  2GT4 A;  4S2W A;  4S2X A;  2FVV A;  4JZS A;  1VC8 A;  2YYH A;  2B0V A;  3F13 A;  4YPH A;  2J8Q A;  3BAP A;  2RRK A;  2I8U A;  4C9X A;  3MCF A;  1G9Q A;  2A6T A;  5FSM A;  4DYW A;  4HFQ A;  3GZ5 A;  5GHQ A;  3I7V A;  2W4E A;  3GG6 A;  3X0L A;  4YPR A;  1JRK A;  1VIU A;  2R5W A;  2VNP A;  3E57 A;  5I8U A;  1MR2 A;  1PPX A;  3I9X A;  4S2V A;  3ZR0 A;  5C8L A;  3MDI A;  5GHP A;  5GHJ A;  3SHD A;  4JZV A;  4V14 A;  1I9A A;  4ILQ A;  1V8S A;  3FK9 A;  5ANT A;  3FFU A;  4KTB A;  1K2E A;  2DSD A;  5DEQ A;  3ZR1 A;  5DDG A;  1V8M A;  3BHO A;  1GA7 A;  2G73 A;  5DPK A;  1KHZ A;  3Q93 A;  3CNG A;  2FKB A;  3Q1P A;  5FSL A;  1OW2 A;  1V8R A;  1Q27 A;  5C7Q A;  3O61 A;  2VNQ A;  2KDW A;  5FSK A;  1SU2 A;  3X0N A;  1V8U A;  3WHW A;  1PUN A;  1V8N A;  5DD4 A;  3Q91 A;  5BS6 A;  2Q9P A;  2B2K A;  2YVM A;  1PVF A;  3X0S A;  1G0S A;  1TUM A;  1V8T A;  1SZ3 A;  2ICJ A;  2YVP A;  1QVJ A;  3O52 A;  2A8Q A;  1MQE A;  2JVB A;  4MPO A;  1F3Y A;  1VHZ A;  1KT9 A;  3KVH A;  1PPW A;  5IW4 A;  5IW5 A;  1KTG A;  3A6T A;  3G0Q A;  3P6Y A;  3FJY A;  3X0Q A;  2AZW A;  5C7T A;  3A6V A;  5LPG A;  1V8I A;  3A6S A;  1X51 A;  3N9U A;  1RRS A;  1HZT A;  1MK1 A;  2O5W A;  5GHI A;  1VIQ A;  1VRL A;  1V8W A;  2A8R A;  3ID9 A;  1NQZ A;  3J7Y e;  1K26 A;  3BM4 A;  1X84 A;  4JZT A;  5GHO A;  3Q4I A;  3A6U A;  3DUP A;  5GHN A;  3FCM A;  3FSP A;  3X0R A;  5HZX A;  3O6Z A;  3QSJ A;  1V8L A;  3U53 A;  3X0K A;  2DUK A;  4KG4 A;  1SJY A;  4N1U A;  1SOI A; 
#chains in the Genus database with same CATH topology
 2O5F A;  3I7U A;  4NFW A;  4S2Y A;  3F6A A;  5ANS A;  1R67 A;  3X0O A;  1NFS A;  4NFX A;  2DHO A;  1MUT A;  1VCD A;  2QKM B;  3ACA A;  5ANW A;  2KDV A;  3AC9 A;  3EES A;  3HYQ A;  4C9W A;  1PUS A;  3P5T A;  3RH7 A;  3EF5 A;  3GZ6 A;  4N1T A;  2YVN A;  2GT2 A;  2XSQ A;  3MGM A;  1RRQ A;  4KYX A;  3X0J A;  1IRY A;  1PUQ A;  1U20 A;  2ICK A;  2DSB A;  3Q2T A;  2A8T A;  3OGA A;  1Q33 A;  3H95 A;  3GRN A;  3GZ8 A;  2I8T A;  3O69 A;  3R03 A;  4K6E A;  5ANV A;  3SMD A;  1PPV A;  3COU A;  1XSC A;  3HHJ A;  5ISY A;  1HX3 A;  1RYA A;  1XSB A;  3X0P A;  1MP2 A;  3X0I A;  3N77 A;  1NFZ A;  5FSI A;  5FSN A;  4IJX A;  3EEU A;  2PQV A;  3GWY A;  2B06 A;  1JKN A;  5CFJ A;  2A8S A;  5GHM A;  1VC9 A;  1MQW A;  2FML A;  4ICK A;  3EXQ A;  3O8S A;  1XSA A;  5FSO A;  2O1C A;  1VHG A;  2YVO A;  4ZG0 A;  4KG3 A;  4YOQ A;  2A8P A;  1V8Y A;  5ANU A;  1V8V A;  2G74 A;  2DSC A;  2QJT A;  3Q2S A;  4J7H A;  3X0M A;  4HVY A;  4JZU A;  3DKU A;  1NQY A;  2I6K A;  2PNY A;  3SON A;  1X83 A;  2CL3 A;  1Q54 A;  3L85 A;  5CFI A;  5BON A;  3MDG A;  1VK6 A;  2GB5 A;  2QJO A;  2GT4 A;  4S2W A;  4S2X A;  2FVV A;  4JZS A;  1VC8 A;  2YYH A;  2B0V A;  3F13 A;  4YPH A;  2J8Q A;  3BAP A;  2RRK A;  2I8U A;  4C9X A;  3MCF A;  1G9Q A;  2A6T A;  5FSM A;  4DYW A;  4HFQ A;  3GZ5 A;  5GHQ A;  3I7V A;  2W4E A;  3GG6 A;  3X0L A;  4YPR A;  1JRK A;  1VIU A;  2R5W A;  2VNP A;  3E57 A;  5I8U A;  1MR2 A;  1PPX A;  3I9X A;  4J7G A;  4S2V A;  5C8L A;  3ZR0 A;  5GHP A;  5GHJ A;  3SHD A;  4JZV A;  4V14 A;  1I9A A;  4ILQ A;  1V8S A;  3FK9 A;  5ANT A;  3FFU A;  4KTB A;  1K2E A;  2DSD A;  5DEQ A;  3ZR1 A;  5DDG A;  1V8M A;  3BHO A;  1GA7 A;  2G73 A;  5DPK A;  1KHZ A;  3Q93 A;  3CNG A;  2FKB A;  3Q1P A;  5FSL A;  1OW2 A;  1V8R A;  1Q27 A;  5C7Q A;  3O61 A;  2VNQ A;  2KDW A;  5FSK A;  1SU2 A;  3X0N A;  1V8U A;  3WHW A;  1PUN A;  1V8N A;  5DD4 A;  3Q91 A;  5BS6 A;  2Q9P A;  2B2K A;  2YVM A;  1PVF A;  3X0S A;  1G0S A;  1TUM A;  1V8T A;  1SZ3 A;  2ICJ A;  2YVP A;  1QVJ A;  3O52 A;  2A8Q A;  1MQE A;  2JVB A;  4MPO A;  1F3Y A;  1VHZ A;  1KT9 A;  3KVH A;  1PPW A;  5IW4 A;  5IW5 A;  1KTG A;  3A6T A;  3G0Q A;  3P6Y A;  3FJY A;  3X0Q A;  2AZW A;  5C7T A;  3A6V A;  5LPG A;  1V8I A;  3A6S A;  1X51 A;  3N9U A;  1RRS A;  1HZT A;  1MK1 A;  2O5W A;  5GHI A;  1VIQ A;  1VRL A;  1V8W A;  2A8R A;  3ID9 A;  1NQZ A;  3J7Y e;  1K26 A;  3BM4 A;  1X84 A;  4JZT A;  5GHO A;  3Q4I A;  3A6U A;  3DUP A;  5GHN A;  3FCM A;  3FSP A;  3X0R A;  5HZX A;  3O6Z A;  3QSJ A;  3MDI A;  1V8L A;  3U53 A;  3X0K A;  2CZR A;  2DUK A;  4KG4 A;  1SJY A;  4N1U A;  1SOI A; 
#chains in the Genus database with same CATH homology
 2O5F A;  3I7U A;  4NFW A;  4S2Y A;  3F6A A;  5ANS A;  1R67 A;  3X0O A;  1NFS A;  4NFX A;  2DHO A;  1MUT A;  1VCD A;  2QKM B;  3ACA A;  5ANW A;  2KDV A;  3AC9 A;  3EES A;  3HYQ A;  4C9W A;  1PUS A;  3P5T A;  3RH7 A;  3EF5 A;  3GZ6 A;  4N1T A;  2YVN A;  2GT2 A;  2XSQ A;  3MGM A;  1RRQ A;  4KYX A;  3X0J A;  1IRY A;  1PUQ A;  1U20 A;  2ICK A;  2DSB A;  3Q2T A;  2A8T A;  3OGA A;  1Q33 A;  3H95 A;  3GRN A;  3GZ8 A;  2I8T A;  3O69 A;  3R03 A;  4K6E A;  5ANV A;  3SMD A;  1PPV A;  3COU A;  1XSC A;  3HHJ A;  5ISY A;  1HX3 A;  1RYA A;  1XSB A;  3X0P A;  1MP2 A;  3X0I A;  3N77 A;  1NFZ A;  5FSI A;  5FSN A;  4IJX A;  3EEU A;  2PQV A;  3GWY A;  2B06 A;  1JKN A;  5CFJ A;  2A8S A;  5GHM A;  1VC9 A;  1MQW A;  2FML A;  4ICK A;  3EXQ A;  3O8S A;  1XSA A;  5FSO A;  2O1C A;  1VHG A;  2YVO A;  4ZG0 A;  4KG3 A;  4YOQ A;  2A8P A;  1V8Y A;  5ANU A;  1V8V A;  2G74 A;  2DSC A;  2QJT A;  3Q2S A;  4J7H A;  3X0M A;  4HVY A;  4JZU A;  3DKU A;  1NQY A;  2I6K A;  2PNY A;  3SON A;  1X83 A;  2CL3 A;  1Q54 A;  3L85 A;  5CFI A;  5BON A;  3MDG A;  1VK6 A;  2GB5 A;  2QJO A;  2GT4 A;  4S2W A;  4S2X A;  2FVV A;  4JZS A;  1VC8 A;  2YYH A;  2B0V A;  3F13 A;  4YPH A;  2J8Q A;  3BAP A;  2RRK A;  2I8U A;  4C9X A;  3MCF A;  1G9Q A;  2A6T A;  5FSM A;  4DYW A;  4HFQ A;  3GZ5 A;  5GHQ A;  3I7V A;  2W4E A;  3GG6 A;  3X0L A;  4YPR A;  1JRK A;  1VIU A;  2R5W A;  2VNP A;  3E57 A;  5I8U A;  1MR2 A;  1PPX A;  3I9X A;  4J7G A;  4S2V A;  5C8L A;  3ZR0 A;  5GHP A;  5GHJ A;  3SHD A;  4JZV A;  4V14 A;  1I9A A;  4ILQ A;  1V8S A;  3FK9 A;  5ANT A;  3FFU A;  4KTB A;  1K2E A;  2DSD A;  5DEQ A;  3ZR1 A;  5DDG A;  1V8M A;  3BHO A;  1GA7 A;  2G73 A;  5DPK A;  1KHZ A;  3Q93 A;  3CNG A;  2FKB A;  3Q1P A;  5FSL A;  1OW2 A;  1V8R A;  1Q27 A;  5C7Q A;  3O61 A;  2VNQ A;  2KDW A;  5FSK A;  1SU2 A;  3X0N A;  1V8U A;  3WHW A;  1PUN A;  1V8N A;  5DD4 A;  3Q91 A;  5BS6 A;  2Q9P A;  2B2K A;  2YVM A;  1PVF A;  3X0S A;  1G0S A;  1TUM A;  1V8T A;  1SZ3 A;  2ICJ A;  2YVP A;  1QVJ A;  3O52 A;  2A8Q A;  1MQE A;  2JVB A;  4MPO A;  1F3Y A;  1VHZ A;  1KT9 A;  3KVH A;  1PPW A;  5IW4 A;  5IW5 A;  1KTG A;  3A6T A;  3G0Q A;  3P6Y A;  3FJY A;  3X0Q A;  2AZW A;  5C7T A;  3A6V A;  5LPG A;  1V8I A;  3A6S A;  1X51 A;  3N9U A;  1RRS A;  1HZT A;  1MK1 A;  2O5W A;  5GHI A;  1VIQ A;  1VRL A;  1V8W A;  2A8R A;  3ID9 A;  1NQZ A;  3J7Y e;  1K26 A;  3BM4 A;  1X84 A;  4JZT A;  5GHO A;  3Q4I A;  3A6U A;  3DUP A;  5GHN A;  3FCM A;  3FSP A;  3X0R A;  5HZX A;  3O6Z A;  3QSJ A;  3MDI A;  1V8L A;  3U53 A;  3X0K A;  2CZR A;  2DUK A;  4KG4 A;  1SJY A;  4N1U A;  1SOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...