4S3AA

Ispg in complex with intermediate i
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 137
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3aA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3aA02
3NOYA 2YCIX 3TYZA 4C1NA 3B0LA 3MCMA 1AJ2A 1TX2A 3MCOA 3H2OA 3VM0A 4S3BA 2VP8A 3VKRA 4O1EA 3OR1B 3MMAA 3H26A 3OR2A 2AKJA 1TX0A 1TWWA 3MM8A 3VKSA 8GEPA 4CCZA 4MWAC 1Q85A 3TR9A 4PZVA 1TWZA 2DZBA 2VEGA 3MM5A 3MM6A 3VLZA 2E7FA 3H2EA 3OR1A 4O1FA 4DAFA 4DAIA 4GEPA 4MWAB 1AD4A 2XSJB 2Y0FA 3H23A 3MCNA 4MWAA 4C1NB 1Q8AA 2BMBA 3TYAA 1Q7MA 4AOPA 4DB7A 5GEPA 4NIRA 3TYBA 3H2FA 1Q7QA 3H2MA 4HTRA 2DZAA 4NILA 3MM7A 3B0HA 3MMCB 3MM9A 3VKPA 4S3CA 3AOPA 2H9AA 3B0MA 4NL1A 4O0QA 1Q8JA 4DJFA 3VLXA 3OR2B 3MMAB 4DJEC 4DJEA 2Y5SA 5JQ9A 1ZJ8A 2DQWA 4DJDC 3TZFA 3MMBA 4S3DA 1TWSA 4DJFC 4DJED 3TYDA 3TYEA 3B0GA 2OGYA 3H2AA 4S3AA 2XSJA 4HB7A 3H2CA 3V5OA 3H22A 4G39A 3VLYA 1AOPA 1ZJ9A 6GEPA 2YCLA 2H9AB 4G9PA 2VEFA 2YCJA 2Y5JA 3MM9B 3MM7B 4D8ZA 2AOPA 3VKTA 4G38A 3H2NA 3VKQA 4D8AA 4S39A 1AJZA 4MWAE 1AD1A 3B0NA 3TYUA 3MMBB 3GEOA 4MWAD 4D9PA 4S3FA 1EYEA 3TZNA 3H24A 7GEPA 3K13A 4S3EA 2V4JB 3B0JA 4S23A 4DJFD 3VM1A 3BOFA 1AJ0A 2YCLB 4S38A 3MM6B 2YCKX 4DJDA 3MM5B 3BOLA 3TYCA 3MMCA 1Q7ZA 4NHVA 5AOPA 4DJDD 1F6YA 3MM8B 3H21A 2GEPA 2V4JA
chains in the Genus database with same CATH superfamily
1KXTA 4XSLA 1C7SA 4HYWA 2PODA 2YJQA 5A94A 4AC1X 3SCRA 1EJSC 4QX4A 1OCBA 2XISA 3ALGA 1FA2A 3OBAA 3N9SA 2JKEA 4QG9A 4IICA 1PYMA 3QR0A 4JDBA 4O1FA 3WQOA 1SW7A 1XM3A 3I4KA 5E0KA 4Z2JA 1FHVA 1KM3A 2VRQA 3AYRA 2DZWA 3WDJA 1M1BA 5CZTA 1ADOA 1D3HA 3NZRA 1WDDA 4XAPA 1A0DA 1B4EA 4JTQA 3PVFA 2BVWA 1M9HA 2GK1B 1NH6A 2WSYA 1LRQA 4FB7A 4YTUA 3OIXA 3GTHA 3TQPA 3TN5A 4PCPA 3D46A 1UCWA 2QCCA 5JBFA 3OA5A 3MM9B 3KOXA 3STPA 2UBPC 3MHFA 1YMYA 1VRXA 4PEEA 4ZFMA 3LCHA 3IIXA 1WKYA 3C5QA 1NELA 1I60A 2OSYA 1IEQA 2O55A 4IFKA 2OEMA 3V18A 4YCPA 1I8JA 3DG6A 5E09A 3AOFA 1BHGA 5LIYX 1QOQA 1P7TB 3ATYA 3M0IA 1TPWA 1RA5A 3AIWA 1GCYA 3MP4A 4JY9A 4YTSA 4AD2A 3FA5A 4Q4PA 1XQLA 1H49A 3MTWA 5AB3A 3W6LA 5LA2A 1CDGA 4FLRA 1EO7A 2V5CA 5I77A 4Z0SA 3T81A 5DMLA 4XV0A 3AZSA 3CPGA 1YLVA 1GYNA 2OODA 4D71A 4C1KA 3MUIA 4KW2A 2J7BA 2A3HA 1O5XA 3EX6A 1GZJA 1XX1A 3S1VA 1WX0A 4LANA 4KCTA 5D38A 2DSZA 4C6QA 3F7JA 3V75A 3L4UA 2QUTA 4M19A 2XIJA 5JMUA 3ONCA 3NYDA 2WNQA 4HZ8A 5LNWA 1DPMA 4L5ZA 4YHGA 4RE2A 2XSJA 3LHVA 3DECA 1PZ3A 3O1NA 3RM4A 3W7IA 4KWWA 1OC5A 1ONXA 3MO4A 3RGTA 3SCVA 3G0XA 1E55A 1LCOA 2OO0A 3T4CA 3THUA 3UGVA 1S38A 1ONRA 4TMBA 3OZYA 1HKKA 4BJHA 3G22A 3OYZA 3AXHA 2VCAA 4ROQA 5A95A 4PMRA 3TQ0A 4A6GA 2V63A 2JKPA 3MMCA 1U1UA 1LTDA 4N9DA 4LFYA 1UD5A 3HQPA 3ZM8A 1BYDA 4RW5A 4A29A 1REQA 4LCSA 3QHNA 3CT7A 3MMDA 3RILA 4DXKA 3MCOA 5EMYA 3EOEA 3N34A 1QR7A 2VX5A 1XSIA 3H7RA 4NZCA 1B3YA 1KFWA 2XG9A 4Y6GA 5BOFA 1ISYA 3WBYA 4MWAB 4N4PA 1AD4A 1K8ZA 4MNMA 4KMQA 3MCNA 1VBJA 4FNTA 1VB9A 4GBUA 5CGTA 3VILA 3GNDA 1VIZA 4YVXA 4J35A 1TUFA 4MYXA 3BJTA 4AIUA 2VGBA 4JQ3A 3UG5A 4AY7A 5GJMA 1MEHA 4NL1A 3W37A 4QCFA 4XSMA 3MT1A 3WDIA 2FTWA 2R14A 1ENUA 2VX7A 3CT2A 3LNPA 5E0FA 4O1BA 2GDQA 5AECA 4NASA 1EC9A 3E38A 3AUJA 2F38A 4Q8NA 2VEFA 4XIMA 2VNCA 1G7VA 4IF2A 3LB0A 3BXWA 3IUHA 2GZXA 2ZICA 1O12A 3USBA 3AISA 4XVDA 4BF5A 1Q4WA 2WJFA 2VWSA 3LXAA 1XISA 1C7TA 4G1KA 4IUOA 3W2LA 3N4AA 4S38A 3MM5B 1KTCA 2FHFA 1CPUA 1UYQA 1PV8A 1SO4A 2VQUA 2ISWA 4TUFA 1GG0A 4FS9A 3VDAA 4QISA 3U5YA 5FJIA 1R8LA 2OKTA 3L2MA 3ARXA 4LB4A 4DZ5A 1WV2A 3FX4A 4UR7A 1US2A 3CUGA 5CPMA 2WMJA 2P53A 1L6GA 1ITQA 3F4VA 1U5VA 4DYEA 3R8GA 3WK0A 2BWGA 1K7FA 4IXXA 4Y9OA 4QLLA 4HGXA 4R88A 1V6WA 4GC3A 1PE1A 2R1KA 3TOYA 3UXIA 3DEQA 3W02A 2G4JA 2GGHA 2WKGA 1E15A 3PANA 4JIHA 2H90A 3NZ1A 1NFBA 4AC7C 1XDLA 1LOLA 3GH5A 2GOUA 2V3EA 4LUJA 2JIEA 5KZMA 4J3SA 4LUTA 2WAGA 3TYDA 4PL2A 1XUZA 1NY1A 1OFDA 2UY4A 4ZQMA 1UKSA 3UA4A 4QDMA 4YJ5A 3PWAA 2OX1A 4AH7A 4FXSA 3U57A 4QSFA 1LG1A 2WPGA 3BSGA 3OLGA 3GD6A 4EANA 4F2UA 1V0KA 1Q6DA 2W3ZA 2O4QA 7TAAA 5A6AA 4PUMA 4XBSA 3FHQA 3RPTA 3W00A 2IKIA 4PUDA 3QY8A 4AWUA 3FAXA 3BG9A 3FVMA 2GFTA 5T9CE 3I6TA 3BG5A 3A4WA 3GBEA 3DAQA 2J88A 3N19B 1Y7VA 1V6YA 2CWNA 3AWNA 2ZDRA 1JF5A 4KWUA 1MNSA 5AOPA 1Z3NA 2I16A 3S5SA 4EAMA 3S9YA 3ZO9A 2QPSA 2E1WA 2GQ8A 2NV2A 3M7SA 3VKRA 4BFAA 1AQ0A 4AVFA 1FWBC 1PPIA 5GNZA 4LVDA 1JDDA 4IIEA 1OWQA 1U5HA 3MSRA 3GYEA 4NRRA 1XGDA 1SJCA 1PO9A 1QNOA 3IK4A 3DHPA 7PTDA 1KGUA 2PTWA 3ZVIA 2Z1BA 2GVGA 1D2KA 2BY1A 4ZENA 4Y7EA 3L4ZA 1B90A 4MDPA 2GVLA 2DJLA 2XGBA 3M44A 2XFWA 6TIMA 4H04A 1TWSA 2NUXA 3CO4A 2XPKA 4MNJA 5CLWA 2J7DA 2R24A 3A9BA 1EC8A 2QVHA 4Z1YA 2X0YA 4L1WA 4FI4A 4ZXLA 3SCQA 4HTBA 2D24A 3KBNA 2OTDA 2CFFA 2Z1WA 2QEZA 4UTTA 1XBZA 1NARA 4D6HA 1C91A 4IL2A 1KW1A 1Y8BA 3S2LA 1LBMA 1QNPA 2W79A 3F03K 1MO0A 2H8XA 5I5RA 1R5YA 1CB2A 3ME3A 1GOQA 4GX8A 3CPRA 3VOFA 3HN3A 5LA1A 4O18A 1Q66A 2E9LA 2X05A 4HA3A 2A7RA 3V35A 1CWYA 3PUDA 2FZ8A 3LERA 5BXRA 1NIUA 3EYPA 3T05A 4E8GA 1YNPA 4NZ4A 5IBXC 4UTLA 1KFBA 3IIOA 1XYAA 4BZYA 1PXGA 4S3KA 3GTNA 4DAIA 3DFNA 3TUUA 4X22A 3TN6A 1JNEA 1BGAA 1CXHA 1TWIA 3GTIA 4DYJA 4NJJA 2CLOA 5C9RA 3AC0A 1O60A 1D3CA 1WZAA 3TLQA 5HANA 3MBDA 3VYLA 4BY3A 1L0PA 4P7OA 3QC3A 1KQZA 3TZFA 2A1YA 3LI0A 4E6MA 3QV7A 1RA0A 5DBTA 3T0DA 1G4EA 2PP3A 7XIMA 4H9UA 4MUZA 4P8WA 1RVGA 3DHDA 4ZOBA 2Z1XA 1JYXA 1SW0A 5DX7A 1JF6A 2C19A 2C1GA 4IM4A 4HMCA 1UQYA 5I06A 2Y70A 3EWBX 3QW4B 3GXFA 1RR2A 4I5RA 3W86A 2H3DA 1RBLA 1XLFA 2BASA 2Q6ZA 4RE4A 4GUFA 5K4XA 1DQUA 1EYEA 4DF1A 1M7OA 5CSSA 4JTAA 1QUMA 4QNEA 3TROA 4K1WA 3VNDA 3WJXA 1EUNA 3PTQA 6A3HA 1RP9A 1RQBA 4YXGA 3W7DA 2WOQA 2X1UA 1A80A 4AZHA 2E9MA 4HHLA 3RK8A 4X9YA 2OQLA 5ABGA 2YXOA 3EKGA 1UUQA 2PP1A 3PZUA 1UMLA 4RZ5A 1NP0A 1WQ5A 4GJ1A 2BVYA 3NQDA 1C93A 4Q8PA 3TSDA 2YX0A 4MJMA 1KKRA 3UY7A 3H23A 1LOSA 1MUCA 2EG8A 2ZUTA 2W5FA 4Q3MA 1O4UA 4H7VA 1TPFA 4ZOAA 2WHMA 2R91A 5FJTA 3CZKA 1OYBA 4P61A 1NDYA 3SAZA 1LL4A 1JCJA 4HU8A 1XYLA 3CL8A 1C9WA 3CK5A 3WNMA 1Q8JA 3DGBA 1N8IA 4GX9A 4QTGA 4I8DA 4QJ1A 1S3TC 4M6UA 4NZJA 1DXIA 1GYLA 4CCEA 2O9RA 1EQCA 1IEWA 4PMUA 4LC8A 5J5RA 4FALA 2VRJA 1WOBA 4FXJA 2QCHA 3ITTA 1DE6A 1CTNA 3DKLA 3OA3A 1B3OA 1W9UA 5I02A 3UCCA 5A8OA 2HVMA 4Z1BA 3DFSA 4C6FA 4IJRA 4UOZA 3OLIA 3VGGA 4JYDA 4CQAA 4Z2GA 1A0EA 1PEZA 4S3FA 4IJBA 4LV9A 3R2GA 4JKLA 2O7SA 2OSWA 3NEHA 3BAYA 1PTGA 4FXRA 4JEJA 3R89A 2NV9A 4D6GA 3BL3A 3CBWA 4MTVA 3WUEA 4LVFA 4AWTA 2PZNA 2E68A 2UV8G 2RGLA 3H2OA 4DUWA 1XP3A 3WJZA 1HJSA 4BQ4A 2PU1A 5JXQA 1MVYA 5SWUA 2DV0A 4ATDA 4MLJA 1HKVA 5E1QA 4HYVA 4GEPA 4J3UA 5EU9A 3S6TA 3VDCA 1D7KA 4LVBA 1SZFA 3REQA 4O8AA 3W7CA 1XS2A 2EAWA 4O19A 1W6TA 1Q6EA 4UTIA 4JQ2A 1W5QA 5D32A 1O6IA 4GQBA 3TEVA 2VEIA 3L2LA 1WAWA 2NX9A 3Q94A 5F2IA 3OVPA 2X41A 4E2BA 3VO0A 1MXGA 5EBAA 3W22A 5KZ6A 5GNXA 3WLKX 1EGZA 2XIQA 3OBEA 5HNNA 1TV2A 1A5MC 8XIAA 2O4MA 2BOFX 1KGWA 1NFPA 2QV4A 4NQ1A 3URBA 4NNAA 1FDZA 2A3AA 3IAPA 1AD1A 4GO8A 1HKIA 3WLJA 5C70A 2RJHA 3UJEA 4NJGA 1J4EA 1W91A 3EA3A 4L4OA 4XAGA 1XIIA 4AW7A 5HPOA 2A3LA 4L1XA 2YA0A 2WK2A 4JTEA 3TN4A 2XSXA 4GC4A 3FV9A 4P7QA 1UZ4A 3CGTA 3O7UA 4LS1A 1E4MM 1J2WA 2QNEA 4GGHA 3STCA 3SSZA 2Q8XA 3JVAA 5HDRA 2CYGA 3H6OA 3U2EA 1JXKA 3W1TA 5CBIA 1NOFA 2QKFA 4HU0A 2ZUVA 4WKHA 3R11A 3UCQA 1T99A 3S83A 4L4MA 1ZNNA 3SZ8A 3QYQA 4RLIA 5ABFB 1VCFA 3RLVA 1MZHA 2Y61A 5K9CA 3MQTA 3DYPA 4OBSA 7ENLA 4A05A 1XSJA 3K4AA 1JQVA 1YIXA 3PWGA 4AY1A 1X6UA 2G97A 3P84A 2R1LA 5GNYA 2Y8VA 3CWOX 3SBFA 5DQPA 4MYAA 3HTWA 1ZCOA 4YCOA 5D33A 3GXDA 3AXIA 5PTDA 1I2NA 1A5CA 4QEEA 4M56A 4GCAA 3MJMA 2WMHA 4J2PA 4J27A 4NT0A 2OT1A 3NL6A 1ONWA 3AROA 9CGTA 3TXZA 1S5NA 3GUGA 4TXEA 2FTPA 3QF0A 3WN6A 3MVTA 4K38A 1EX1A 1JNDA 3K46A 3MM7B 1A3HA 3ZT6A 2VC7A 3WF0A 4YNGA 4XTDA 2C0HA 3RUBL 3LRLA 4HNOA 1X1NA 1EXBA 1XH2A 1NU5A 3WH7A 4O8RA 4PB3A 3WSUA 2WB5A 4ATLA 1A50A 1GVQA 4AG0A 1KGXA 1GJWA 4XUGA 4QDPA 3AMGA 1ZLPA 1DJGA 4L6HA 3I4EA 4O1EA 3SW6A 5EYWA 1WDQA 3TJIA 1GVRA 4LY4A 3N3MA 2Y62A 3SCOA 1DL3A 1U1JA 1MQRA 3BK0A 4IJCA 3MZ2A 4PMJA 1QPKA 1IGSA 3QH2A 1BPLB 4LAOA 2FPTA 1RAKA 4BK9A 5DY3A 4EOUA 3CIVA 1POJA 3IJIA 3NGFA 1QO2A 1JCTA 3NFUA 4QEHA 3WD3A 1FH9A 3URQA 1EDQA 1KRCC 3DI0A 5DT7A 3W1PA 3W2JA 1IV8A 2VC9A 3G3DA 4V28A 2YCEA 3PG9A 1YE4A 2WMFA 3IV8A 2QDHA 4A8LA 1VHNA 1B57A 4H01A 2VGIA 4NY2A 1QI2A 4Q4SA 4A21A 2GPTA 1W1IE 2CC0A 3RLGA 3TU9A 4AD0A 4C91A 4LGXA 3MUCA 2EQDA 2P8CA 3MMTA 4KF1A 3OHIA 5DCEA 3UJRA 3GC5A 4N0RA 4O0ZA 3OGVA 4HHMA 4X9SA 1AW5A 2HV5A 2EGZA 3KL0A 4KRTA 3U4AA 5HINA 1EJWC 3QYSA 4XISA 2GGJA 3F4WA 1QDSA 1E4NA 2POZA 3VIIA 1W1B1 4E4UA 2ANUA 3AHYA 3LLDA 4H6QA 3A4AA 1FWEC 2EF9A 4C5ZA 3NQMA 2NXIA 3NR0A 1CECA 4INFA 2CPUA 4X61A 8GEPA 5AHIA 4Z2HA 3LTSA 1OC7A 3NM3A 2DZUA 2YFOA 3RJXA 5LIXX 3HPXA 2UY2A 4ZFCA 3AJXA 4JBRA 1Q8AA 4OV9A 4A35A 3QBUA 3H2FA 1QRQA 1NWUA 1XI3A 5JBEA 3V5FA 2JIWA 3MU7A 1QWKA 3K8MA 3QZAA 4U2ZA 2TODA 3VD5A 1UR8A 1W1ZA 3L4XA 1XIFA 3OIHA 4R7JA 1UWUA 3KP1A 1OX4B 2WWCA 1L8PA 1B3ZA 1EJ7L 3C6CA 3LQGA 2Y1HA 3QZEA 4MSSA 5A2AA 3C2EA 5LNRA 3NL5A 2J7EA 3F4CA 4PTWA 3H7VA 1AL8A 4E3VA 1XCFA 3B0VC 4L7ZA 1P6CA 4XTIA 2J66A 9XIAA 1X1OA 3GC4A 3HPAA 2WJEA 2D1ZA 1CXIA 4I90A 4H6KA 2VDIA 3HA1A 4RNIA 1HL8A 8RUCA 2X09A 2INFA 3KUMA 3NOYA 4ZO7A 2CERA 4JICA 3I65A 3GU9A 3STEA 4JTKA 2PDMA 4R5EA 2RAGA 4O52A 3N9KA 4I5XA 4QLKA 2ALDA 1VYPX 2DW7A 2WC7A 3ZLFA 3B0PA 3DZ1A 2B4GA 4FIRA 4HCLA 2FH6A 4ZQOA 2XTKA 1QI3A 5D37A 5AYIA 3L66A 2XSAA 3G2GA 3I10A 2C8NA 5H2ZA 3OPSA 4X0NA 4C6MA 1GW9A 4FO4A 1VZWA 4C6IA 2GQ3A 3NL3A 4OV4A 3MJYA 4JYFA 4DO4A 4PRTA 4PE8A 1OCNA 3VIOA 1O5KA 2QUVA 2AGTA 5J5DA 3AS3A 3W2KA 5KZDA 3WLPA 4N9CA 3WQPA 4O13A 1HGWA 5HNTA 2YKKA 6GEPA 5HMDA 2PDKA 3MI2A 4HPJA 4JKMA 1IZCA 3H2NA 3BAIA 4FZIA 4OUIA 2GVYA 1Z44A 2VCCA 2PDQA 3MMBB 3AIBA 3E3HA 3AHVA 3G77A 4M7TA 1X8FA 1Q6OA 2PRLA 4GJJA 3NPWA 1LP6A 4FOKA 3WNNA 4JS3A 2UY3A 3MP5A 2E8ZA 4YWSA 1DOSA 2P3EA 3SECA 3B9OA 1Q6CA 1CGXA 2D0HA 3G1AA 3VE9A 2CLFA 5CPQA 3TYZA 3T2PA 1YDOA 4MB5A 2Z2BA 5FA5A 2DJXA 3EOOA 2ZC1A 3C52A 4XAZA 2BDQA 2YOCA 4R33A 1ZAJA 4K7VA 3FLUA 4NNBA 4MKVA 5G1MA 2WCGA 1GVEA 3C0QA 3KX6A 1AQHA 4B9YA 4HMEA 1RQHA 2E1DA 4B2DD 2WSRA 1XLCA 2NUYA 2GQ9A 1NP2A 5H8MA 4PB5A 2C7FA 3SRKA 4LNCA 5GEPA 3LS9A 3L9CA 2V2CA 3QSRA 3EGJA 3KWXA 3FGCA 4O0QA 3M0YA 3ZWSA 5LIWX 4NAFB 3OGRA 5C2XA 4U2YA 5AHMA 1YPIA 3IRDA 1QHPA 3NWRA 2C13A 5HOSA 6ALDA 2VZOA 3DFQA 3AO0A 4JIQA 4QS6A 4N4QA 4QJ3B 2JEQA 3S1XA 1W1VA 4E2DA 3ARYA 3TH6A 4Q8VA 3U4FA 3NO1A 5FF7A 4FIQA 3RX4A 3FYOA 4O28A 3CZ8A 3A47A 3FKRA 2X1SA 1R47A 3S9IA 4CLMA 2Y7DA 4GXPA 4IIHA 3T7VA 2E5BA 4IGMA 3E0FA 4S23A 4RW3A 2RUSA 1VCGA 1J0IA 1QXLA 2PRHA 2YGYA 2PTZA 5DCDA 3SFWA 1EPVA 4Q8QA 3ARVA 1POKA 4HYRA 4ONVA 3GWQA 3TJXA 3C0LA 4IHCA 2CLEA 1I2OA 3N2MA 4GE8A 2D20A 2FLIA 4I6VA 1T41A 3N18A 3N1AA 5U4NA 3LPGA 4H9VA 4LNYA 1IGWA 2HK0A 4GINA 5C5YA 2QXWA 3OLEA 5FJUA 4E4FA 4GI4A 1UP3A 4FX8A 4B4FA 4HQVA 4DXXA 5HNRA 1SZRA 2ZZ2A 3KCLA 1M03A 4CVWA 1HP4A 3FXYA 4GYPC 3ARZA 3S42A 2XFYA 2VZTA 4Z1DA 3QMTA 3LCIA 5CZKA 3P81A 1C3FA 4MLRA 1C92A 3RAOA 4G6CA 4JL2A 1SZGA 1M5WA 1ZBVA 2Q09A 1N7KA 2Y7EA 1IEXA 4B5WA 4D72A 2BY2A 4S1FA 2ZCGA 4GH3A 1K77A 1U30A 2FB3A 4PTNA 2G95A 3M5XA 2YBTA 4GH1A 2DZVA 2AOSA 1X7IA 3MW7A 3SQLA 2WM0A 3AMDA 1EFZA 2J9YA 3R0UA 4C6OA 4DQWA 2VUNA 1ZP3A 3LQLA 3TJLA 4XKYB 5LHEA 2BXYA 2CCRA 3NDOA 2I5GA 2HROA 1O7AA 1MQPA 3F2CA 4LVGA 4WY0A 4QHRA 4ZQNA 5CC5A 1J2BA 3OR1B 3PG8A 3L12A 3RCYA 1DV7A 2D3NA 1KM5A 1TA3B 4PMNA 3P3BA 3AU6A 1UD3A 1TTIA 2ZUUA 2HXTA 4ZSTA 2V3GA 3O0KA 1KKOA 2H8ZA 3VCCA 4V1XA 1W1PA 2ONEA 4AIOA 3WD4A 3P8IA 3W7OA 4LRSA 4GFIA 3DESA 4DXVA 4E5TA 2GJXA 1V3KA 5ECUA 2QULA 1RJRA 2B81A 4R9OA 1HTIA 1YNYA 1S1PA 3SQSA 4HZ7A 1D8WA 4U31A 3GLCA 5E9XA 4JIEA 1H60A 2VO5A 4QAWA 3HU7A 3ELFA 3THCA 5D03A 1OFEA 3UWYA 4LH8A 3LCFA 1AFSA 4FHAA 3XIMA 2PDJA 3PK7A 3LRKA 4JIIX 3BAKA 3G18A 1B3VA 2ACUA 4LYQA 2PSNA 4UZSA 2Y8KA 3M6DA 2AOPA 2DEPA 3WD2A 2VOTA 4EK7A 2JEPA 3TTQA 5I2UA 1RJQA 1WDRA 4HMNA 5H91A 3TSBA 3GUWA 1FKWA 1BWVA 3G8EA 1S2CA 4LXFA 3GH4A 3NSMA 3VKCA 4AD3A 3ABOA 1RALA 3WO8A 3UZXA 4TTUA 3S5ZA 3WQ6A 2QCNA 1N55A 2D3LA 4N9BA 1JAEA 3E74A 1TTQA 4ORMA 4QIUA 1DKWA 1TX0A 1TWWA 3GZ3A 3QY6A 3AMLA 4FR1A 1TVPA 5FACA 2FGZA 3PUOA 3VX1A 1IXOA 1DWFM 1FRBA 2GJPA 4QJ5B 5AFDA 3W88A 4JIPA 4PN2A 2XVPA 1XLHA 2XVKA 1J96A 2WV8A 1GHSA 2DT1A 1SMAA 1TA3A 3EKZA 1GOIA 3C56A 5A69A 1E43A 1Y5VA 3I3EA 1IZKA 1AW1A 5D2VA 4M81A 1K70A 1S5WA 4PCFA 3RM8A 2FPYA 1EP2A 4JGDA 1XFCA 3LG3A 1HKMA 1XCWA 5KZEA 4QROA 4NUWA 2FJKA 3NQ7A 2EBNA 7CGTA 3LHTA 4IP7A 2QPXA 3S4TA 3WKZA 4LYKA 3MHUA 3B40A 4XKMA 4CNUA 2NW0A 4LB3A 2XFFA 4LT9A 5F2LA 4IP4A 4ZL1A 5CSUA 1I4NA 1X1ZA 5F1UA 1C90A 3WMSA 2E77A 1H63A 3CC1A 1Z6KA 4ORIA 4K39A 3VZZA 4V15A 3WDQA 1V08A 4MY1A 2HCVA 4E8DA 1T40A 4WDUA 3JS3A 2B7PA 3U0HA 1TPEA 1GEQA 3MKKA 1AG1O 2ZUWA 5CZSA 2RDUA 2QHAA 3S1UA 4GWEA 3ES7A 2WM1A 4W86A 4JHOA 3T6CA 3AIVA 3VMPA 3RO6A 1ZFJA 4O54A 5I00A 5G2HA 3BAJA 4W5UA 3WLQA 5CG0A 3CUIA 3BICA 2ICSA 3ZR5A 1AODA 3WELA 1W8GA 2W66A 2G4FA 4DRSA 1FDYA 4PFMA 1VD6A 4E8CA 4KCWA 4Q32A 3MM9A 4W7VA 3WBWA 4BWLC 3FDKA 3THDA 1EWDA 1BRLB 3KP0A 4LTSA 4LBRA 4BEQA 1PTDA 1K6WA 4J2MA 1CCWB 3AFBA 3B8UA 1BAGA 4OOUA 4DLMA 4GZJA 1YXCA 3HGRA 4TV6A 3WQ8A 3WQVA 1BQGA 1R3QA 4I3GA 2PTDA 1WKDA 2BBFA 1LUCB 1HQTA 2QYGA 2CNCA 2QR6A 3GVQA 4CNTA 1QVBA 3VC6A 1EC7A 2WVTA 1GOKA 4CEXC 1X6NA 5HUPA 1ITCA 4MWAD 3PN8A 4M80A 1R9YA 3NGJA 4F9JA 1DP0A 1UD8A 1SSGA 4PBFA 3V16A 3W71A 1AUSL 3WNLA 1YNQA 4CQCA 1QHOA 3OP2A 3N9RA 4WSHA 1A5UA 2DT2A 2OJPA 3LBMA 2X7VA 3L68A 4CCZA 1YDVA 1HJXA 3BQ6A 4MKSA 2IS7A 4LCQA 4N2YA 4O4VA 1EZWA 2QAFA 3HJZA 3KCOA 3M1ZA 5A6LA 3LHUA 1HG3A 2IMRA 4JXCA 4LBSA 2JALA 1F6PA 1P43A 3ARTA 3GR8A 4UUIA 5DANA 2PD5A 3Q4DA 3MI3A 4M51A 4H9ZA 3QOMA 5CH9A 3PM6A 4MMWA 3TA6A 1ISVA 4HSHA 3SCUA 2ZA1A 3AS0A 4X0VA 1XUUA 4ATWA 3P8JA 2E6DA 1RJPA 3ZJ7A 2Z24A 5DCBA 1MFUA 1BWLA 2DSKA 1NDZA 1SR0A 5G1YA 5HJLA 5CZ0A 4Z42C 3A3XA 1CGYA 1Q6LA 2YA1A 2C1IA 1XLDA 1ZCCA 1CXFA 2DVXA 2A85A 4Y8EA 4HHHA 2YFNA 3UVIA 3BZGA 1T5AA 3U2CA 2ZC8A 2C18A 3EMZA 3AALA 1WDPA 5D8ZA 1BG9A 1LQAA 1V4YA 2EJAA 3NQFA 1XIEA 3VA8A 2QCFA 4DJDD 2GJXB 4WUIA 1R38A 1MFVA 1YYAA 2HNEA 3DCPA 1AK5A 2WNZA 4BCEA 2AKJA 1HJVA 3VIHA 1RVKA 2XIOA 5XIMA 3WH9A 1V03A 4I8YA 4WRHA 3MM5A 2C91A 2J8TA 3CMJA 2VT0A 4JN6A 3LM7A 1VC4A 1R87A 3PTKA 2OCZA 2AGKA 2I14A 3TW7A 2V5DA 3VNKA 2ISVA 3WUGA 3UY8A 3WCZA 4EIVA 4EAYA 4L80A 3QQ1A 4ADTA 1ELSA 3H2MA 5FEWA 1DTNA 3IJLA 3LRMA 2I5QA 2WLZA 5D9MA 1ECEA 3KWSA 2W91A 3Q65A 1R30A 3A23A 4XZLX 3WLOA 3PAOA 4TQTA 3SDOA 2CETA 3W7LA 1RBAA 3DKJA 7REQA 2ZX6A 1MW3A 1TCDA 2FVKA 1G1YA 3M0VA 2ZXAA 2HQAA 4JX6A 4U28A 5EBUA 2B7QA 3V7PA 4MVAA 2BHUA 4GFSA 3EPMA 3GE7A 5MKGB 4LV4A 1RPKA 4OQVA 3LDVA 1SO3A 1E40A 3CHEA 4UBPC 2ACRA 2Z29A 5AKQA 3TAKA 1UH2A 4GD0A 3ARSA 4HPHA 4QR6A 5KETA 3WK3A 1EH9A 1H11A 4B92A 4REQB 2FGLA 2ZDSA 1CLXA 4BF9A 5DMYA 3N2TA 4L9XA 1AW2A 4NHVA 1TJRA 4P8VA 1ESWA 2NQ9A 4HNLA 1LYXA 3S6OA 4S3BA 3CHVA 1IT7A 1I6NA 3HQ1A 4PUNA 4BI6A 1DTUA 1XIBA 3DFPA 1JXJA 2E7FA 1Z32X 2F9RA 3S2CA 5BXSA 5FJJA 3AZRA 2A3EA 2WVUA 4A3RA 3WENA 4GIYA 5E5CA 2D2JA 3RNDA 3BW2A 1ZP4A 2INEA 2WVSA 4US6A 4UR9A 2EKGA 3TMQA 1YDYA 4XZNX 4PMXA 4XWUA 1G4SA 1QPRA 1A53A 4D1JA 1LL6A 3GVGA 3F1QA 3BZJA 3EWYA 3MVIA 1QNRA 1ICSA 3ARWA 4G39A 3G0SA 1W3LA 2VD9A 1VF8A 1UP2A 1V6VA 1U33A 1JPMA 2Y5JA 2AQOA 4JDYA 3UG3A 3SN1A 4W5ZA 1GKQA 3CJPA 2DIJA 4LW7A 2C15A 4X60A 5A3HA 1K1DA 3J7HA 4W8LA 3IUDA 3ZR4A 1DWIM 3KL3A 2PC4A 5AZ0A 3LSCA 3B0JA 4IL0A 2TAAA 3QGKC 5AYBA 4UQEA 1GT8A 4MHBA 4OBTA 1E4LA 2A2IA 1KBJA 4XZWA 3RJYA 5G2WA 2PURA 4RPPA 1TYGA 2JF6A 4J7RA 1O94A 4PSRA 2YB1A 4UCFA 3KLKA 3GNPA 2VZVA 3TLLA 4GXWA 3EPNA 3W9ZA 4ACYA 1PX3A 4C7DA 2WZHA 3CB3A 3VPLA 3H12A 1S2AA 3SUWA 1XLBA 1E72M 5IRPA 3W84A 4C1NB 4FAMA 2TYSA 3FOKA 3L7RA 3A5FA 3AIQA 3W7EA 4L61A 2BB0A 2GJRA 1MQQA 3F5LA 5F2MA 2GVEA 4UMBA 5E9AA 3CWHA 3KZSA 1ALDA 2QVNA 1OT2A 3PNUA 4GY7A 3K5XA 3VLXA 3MBFA 1G4TA 4LBUA 5T9BG 2WW5A 4ZSUA 1L6YA 2PDXA 2AMXA 4NYUA 1ZRQA 4UQ9A 4R27A 2HEJA 1J6PA 3MMBA 4B5XA 4DJED 1QTWA 4QDWA 3TE9A 3H4GA 4IZGA 2FVMA 4UFIA 2EG6A 5D9PA 4HB7A 2O0TA 1JYNA 2P8BA 3RX3A 3G0UA 3HOJA 4L6OA 3UG4A 1F8MA 3LUTA 1OBAA 1UUMA 3GIYA 3H4XA 4DBSA 4JTJA 1KWKA 2O9TA 3WBXA 1R0MA 4CN4A 5D8WA 3B8VA 2F6UA 2VZUA 1A5OC 3OG3A 5CPSA 3WK1A 3PZIA 3T44A 2YL9A 5E93A 1CEOA 3CM4A 1UHVA 3BE7A 2VP8A 1HUVA 2J9XA 3R79A 4GABA 4YN5A 1GGOA 1VBHA 2V9DA 1X39A 3UNTA 5F2GA 1N2VA 1KM6A 1ISZA 3O06A 3ARQA 1W5NA 3W83A 4MZYA 3S5NA 1B2YA 1V3IA 3NQCA 1E6XM 2YL6A 2GYIA 1KD0A 4K3ZA 3SSJA 3I7QA 3EDEA 3RHGA 2CBVA 4K37A 2IKJA 4XZ9A 4O14A 3SUUA 1GVYA 1RH9A 5AHFA 2FJUB 3VGBA 5D9NA 3VTRA 4RE3A 5CPTA 5LIUX 3CQKA 1G01A 1X96A 2X2GA 5CBBA 4H83A 1R2RA 1WDSA 4KIRA 3M16A 1FDJA 1OY0A 1E9ZB 2ZXDA 3QY7A 7A3HA 1EJRC 3PBYA 3SCTA 2O56A 4PTMA 4GQGA 3D0CA 3ECQA 4WDTA 3O8AA 8CGTA 2I1OA 2J7GA 3HQOA 1J18A 3N2CA 4NSBA 1P6WA 5ABHA 3APGA 2CITA 4G1NA 1XIJA 4O1DA 3RDKA 1HX0A 3UFYA 1XLIA 3CMFA 3E9AA 3BCFA 1W31A 3AXKA 2BFGA 4DO6A 4OUEA 1UWIA 4FXFA 4RDVA 4WXYA 1SU5A 1J93A 3IIPA 4IOTA 4JNZA 5HNUA 3FJ6A 5TD4A 2ZUNA 4AFYA 2A21A 1UR2A 4GY1A 1P1XA 9RUBA 4IIBA 4ASTA 3WEZA 3VM5A 3WH6A 5LGXA 4HK5A 4UTFA 2QMKA 4UQBA 4KETA 3NNTA 2OOGA 3E6EA 4HPXA 1X97A 5K4ZA 4MPQA 1OFOA 1NOUA 2YYUA 1QJWA 1R3SA 2JBMA 2I17A 2JQXA 4ES4A 2BHYA 1YDNA 1LROA 3IIZA 4UTWA 1TTPA 3P93A 4RDWA 3DENA 3PBWA 1XDJA 1KFJA 1S1RA 3KBWA 3SN4A 4S3AA 4GYPA 4Z2IA 1TR9A 4ZOEA 4M29A 2GOKA 2QDEA 3VLYA 5ABTA 4CD7A 3MMUA 3KRSA 1VP5A 3AICA 3IEBA 5A8QA 4H2CA 3GH7A 4E2VA 1SO6A 2PLCA 3V0TA 4CVUA 4ERAA 2Z1KA 1TIWA 2HTMA 2BOGX 3F5JA 2EHHA 3M0XA 4WCJA 3WMCA 3UZ5A 1JVNA 4I7VA 5T91A 4NKCA 3SGGA 3PBVA 4UCGA 3PZOA 3OZPA 1RCOB 5G1TA 5LZLA 4AZCB 2DPEA 5H8PA 5GQBA 3LZ3A 3COTA 2XGIA 1M7XA 3QC0A 4BI7A 3ARPA 3WY1A 3W82A 4MIMA 3S9ZA 2YW4A 2D23A 4FK9A 3GDRA 3CHFA 3DBPA 2REQA 2VEKA 5CAHA 4ML9A 3VNMA 3EX3A 1GQKA 1LWHA 4JTLA 3SB0A 3VC5A 4E4PA 3CYJA 3W6MA 4G7EB 3C86A 1DJYA 2CXGA 4I9MA 2F61A 1A3WA 4CU6A 4FR6A 3RXZA 4CU7A 4MDOA 1UKOA 1PX4A 2INZA 2EG7A 4YWIA 2Z28A 1DJHA 5KITA 2GSHA 2FFIA 5A6MA 2VWTA 3ZQ9A 4HTYA 3U2OA 5F4WA 5G4WA 3NQ6A 4CKQA 3AQUA 4GBDA 5A1AA 4JFUA 2PDBA 4QCEA 1R3VA 2XH4A 1A5NC 4HA0A 3GW0A 1M7JA 3NQGA 3GNNA 2CKSA 5I07A 5JH2A 2EPOA 2VURA 1EDTA 2NLIA 3KHJA 3W74A 2R94A 3WNPA 3M5YA 4PSPA 4I7UA 1L6WA 3BDKA 1OIMA 1HJWA 1DJNA 1EZ2A 3DH7A 3FVDA 1VR6A 4HP5A 2ABAA 4JAWA 1FHUA 1TPVA 1V93A 3TC3A 2ZVIA 1WP6A 3W7QA 1FBAA 2D69A 3OVRA 3S8HA 2QZRA 1T96A 4WGXA 5IFPA 3TW9A 3CMGA 4HKPA 1VFUA 3KRZA 2WZMA 3W7GA 3W72A 3KOYA 3BARA 1J5SA 3GKAA 4DEFA 4LX4A 3VNZA 3H2EA 1T7LA 5G4EA 1O95A 4Q33A 4WKFA 3S2MA 1TB3A 5E0CA 3RF9A 2PD9A 5HWNA 3TQVA 3WLTA 2Q01A 3FYYA 3TYBA 4W84A 3SIMA 3GR7A 1PZ0A 2YA2A 1LWJA 5FJOA 4ROPA 3AYVA 2QCGA 3C2RA 5L9FA 3W1AA 3C2FA 1LLOA 2Y5SA 4EWJA 3BLPX 1OFBA 1XPGA 2MANA 1QK0A 1G0CA 4NG3A 3EB4A 1VQTA 1DBTA 3LLFA 1YKWA 3AHZA 4FLQA 4W9TA 1J6OA 1WO2A 3GXNA 5LYRA 3PJTA 1OD8A 1UB3A 1KLZA 1GTHA 1SFLA 3SY8A 4CQBA 4PL1A 4Q22A 5IDZA 1GJUA 3UJFA 5DLCA 1Q65A 1MSSA 5BOOA 4IQEA 3AIEA 4KCVA 2MUCA 2XVLA 4WDXA 2PFHA 3NPXA 4NNCA 4ZO8A 4AX7A 2F2KA 5A8NA 4ZOCA 4LVAA 1GQLA 4FNPA 3OO2A 3REQB 2PU0A 3W0KA 4KFNA 1HP5A 2CLLA 3QLLA 2DUZA 3EKLA 3FS2A 3KS6A 4F48A 5BRQA 4MB3A 4JX4A 1XD1A 4HZ6A 2XWEA 1BVZA 1GOWA 2F6XA 1OFPA 3QRHA 3DG7A 2DZBA 2UWFA 2J77A 3TWBA 4H4IA 2G8ZA 3ZWTA 4AD1A 4DAFA 2DZSA 3B9DA 1WDWA 1EPXA 2EPMX 4QE4A 3T9PA 1BQCA 3EDFA 3R0DA 1HO4A 1ZPTA 3THQA 3XISA 3MYOA 4HPGA 4XZIA 2NWSA 3NSNA 1M53A 2ZRXA 2PWUA 1XLLA 3B0HA 1Y5XA 3AXMA 4XZHA 3RN6A 4UFJA 3DGRA 4IMCA 4NXKA 3NPUA 5F7UA 2VDGA 2DQWA 3FJ4A 5JVLA 4AZ7A 4IUGA 4B5TA 3PHAA 4W7WA 1RQEA 4N02A 4HN8A 1RD5A 5F4SA 3WF2A 2XZ7A 2HBVA 4JQ4A 1R7OA 3W7PA 4IMFA 4HT3A 1PCWA 2X40A 4CQDA 2YCJA 4MG4A 4PBGA 1XRSA 2NT0A 1CYGA 3TTEA 4QE5A 1LM1A 4M0XA 2V2HA 4CD8A 4DF0A 1SMDA 1DQXA 3BGGA 3LV5A 3P0WA 3CWNA 3BSMA 3VIMA 3W87A 2Z2AA 4ICMA 4O53A 3HJEA 4JPGA 3S1GA 4F4RA 3LY0A 3PPGA 4HA1A 5FEPA 1E5NA 4GY0A 5C0QA 1FCBA 1QI5A 1FCQA 3CUHA 3BLDA 3FCPA 5FJPA 1DJXA 1BSLA 3I3DA 2BNJA 2PWHA 1JI2A 3LOTA 5I03A 3S5YA 1ZY9A 1FWHC 1RBOB 3UR7A 3W7JA 5E70A 3VFCA 1R46A 1IZJA 2DH2A 4LAKA 2QJMA 5B7YA 4A3QA 4KKXA 3H54A 4E2OA 1SGJA 4DZAA 2IW0A 3NCOA 5FF0A 4C6BA 3O16A 1VJSA 1UASA 3LMZA 2IQ0A 3IACA 1E9YB 3DU0A 1NSJA 2R8WA 3LPFA 4IMAA 5BU9A 5AHEA 2PDWA 1QPNA 4IG2A 4LUYA 2PDYA 4JTSA 2O9OA 3QVQA 1LBFA 1JZ5A 5LGZA 1XLGA 5H6HA 2NQ5A 1JAKA 1MMFA 3AS1A 4PUJA 3OB8A 2AL1A 1US0A 2WHKA 5BU6A 5BXTA 1M68A 2W27A 1IQ8A 1VHCA 3VM1A 4GQ0A 4O50A 3LENA 4TMCA 3FSTA 4WZHA 3SFKA 4U5IA 2P1FA 1OEPA 1PUDA 2WBGA 4MNLA 3UD6A 2J4GA 1ZS2A 2BSLA 2QCEA 1X98A 3U3HA 1J10A 4L65A 1W8SA 3AMCA 1UPMB 1QBAA 3AXXA 1JDFA 3QSTA 4XD5A 5AC4A 1GNXA 1SZEA 2HSAA 4NI8A 5CGMA 4H1ZA 4GJIA 3VDGA 3AMKA 3LMYA 4NAEA 4QE1A 3CTTA 1W9VA 2Z7KA 1K7EA 4YHEA 1VJZA 1XG4A 2VVNA 1TQJA 3BJSA 4GI8A 2OVLA 1W3JA 3KW3A 4LOCA 2HZGA 3VOJA 4UFKA 2YSWA 1MZRA 2ISFA 4DUXA 4OZOA 3T40A 1GZGA 2EPNA 4OECA 5G2IA 2DFAA 2ZZ5A 4RDYA 1B9ZA 1IWAA 4LY8A 1AH3A 4AZ6A 2J7CA 3KS5A 3APYA 3NDYA 1WXJA 4L4LA 1UOZA 4IMEA 3N15A 4EXBA 2DDXA 1VKFA 4C65A 2PMQA 4DWSA 2C71A 3N4FA 4GI9A 1M04A 1S5VA 1XC6A 1QNVA 3GTXA 1JD9A 2P0IA 3QQ0A 5AVNA 4KESA 2R82A 1TV4A 2SFPA 4UTKA 2B7NA 3N73A 4WHBA 3DFHA 5CZJA 1SPQA 4KEMA 3EEGA 4DWDA 4LEQA 3Q67A 3CO8A 4POCA 4ADSA 4XD3A 2HDJA 3PNZA 1F3TA 2NVDA 4LF1A 3BJFA 3CUXA 4DO5A 4C6DA 1N82A 3HG2A 1LT8A 4KEUA 2W4XA 3PAJA 2VELA 4MOZA 1SZNA 3WDHA 3HV9A 5I09A 2ZFAA 5TQLA 1XH1A 3GDTA 5BWFA 1FHLA 1KXHA 4U3CA 2NT1A 4S2CA 2BVTA 2BLEA 3M47A 4ECLA 4CQ8A 1XLJA 3RMJA 1TPUA 6PTDA 1KV8A 2R1MA 3KBJA 3STGA 4Q6JA 3UYCA 2NVAA 5TF0A 3IARA 4JFVA 3VKPA 1D3GA 1Z9AA 1QNSA 1QFEA 2E67A 1HW6A 4CQ9A 4H8UA 2FZDA 3QXBA 5DXYA 1N8FA 3ITVA 3T8LA 4CD5A 5REQB 2P10A 3W1MA 2V30A 2AQWA 4A8NA 4JQAA 2YZ5A 5HULA 3W7HA 1TR1A 3M6YA 3PWIA 3UA3A 4G9PA 4H00A 4ZA0A 4OJYA 1JYVA 1PB0A 1PBGA 3VD9A 2J47A 5DF0A 1ITUA 2W0UA 5C54A 3HMCA 4WF7A 1CGWA 1GQIA 3GDLA 4O1CA 3TWAA 2Z4GA 4KFOA 3MZNA 4ZB5A 1V3MA 3ZSTA 4AUBA 5LNUA 4F0SA 3MM6B 3GDKA 3P6LA 4C7GA 1J11A 3DFTA 2NXHA 5I3DA 1Q2SA 2BGQA 3B04A 1XGEA 4MJ4A 4AXKA 4J9JA 1SJAA 1D8CA 1K7XA 4EPKA 4DBEA 4UQAA 3OR2A 1J0JA 4FNQA 3B9AA 3NQ8A 2ATMA 4JCLA 4XKYA 2WCAA 3VI2A 3MSDA 4PCNA 4I9AA 4IIFA 3T2OA 1B0IA 2AL2B 1OIFA 5I3HA 1KFEA 3NZQA 4IX2A 2VFGA 4IX0A 1K03A 1VEPA 2PI6A 1TV7A 2R1PA 4GI6A 4TX8A 1JZ3A 1RK6A 1UA3A 5XINA 3S1WA 3K8KA 1CX9A 1VLWA 3IGSA 4UTUA 1VPQA 4WSKA 1DIKA 3GHRA 4L56A 1ITXA 2DT3A 1JR1A 2ZYFA 5BMWA 3MV11 1UJPA 1KQYA 3SCPA 3KDNA 1XLEA 4JTFA 1DWGM 1M01A 4OU1A 3RM9A 1NJJA 1ZBKA 4UR8A 1AJZA 4YS1A 2WO5A 5FF4A 3GEOA 3OQEA 4UOJA 3P5YA 4ZO9A 4PTXA 3CZEA 2JFEX 4R34A 3L4VA 2P88A 1C8XA 3W85A 1WBJA 3E2RA 4RNJA 3UU0A 4QQ3A 2VZSA 4A3HA 1FWNA 3VIPA 2XIBA 5C71A 1GVSA 4XAFA 3OTRA 1FFQA 4DO7A 5EGRA 1KLYA 4C5YA 1XBYA 4FX6M 2D0GA 3MM6A 3WQ5A 1HJQA 2Y8UA 2GGEA 2Y24A 5FF3A 2X30A 3ZR6A 5DT5A 1DIDA 1F3XA 1FQ0A 1XC4A 2BZNA 2RDTA 2BMBA 4RXGA 3NSXA 2V69A 2J62A 3N6JA 3A13A 5I24A 1SFSA 1KO0A 2IXUA 5CSRA 4LCRA 4JQ1A 5L6UA 2JGQA 3TIMA 1B54A 4EPDC 3W2MA 4QAIA 1XKYA 3WQWA 3GNOA 3NG3A 1ZJ8A 2YYTA 4M8UA 4XVEA 2DORA 1JPDX 1DXFA 1THFD 2HPIA 4GYFA 3LM3A 2QUUA 1CGVA 1PX8A 2XWDA 4HK7A 2O7QA 3UG8A 3EMQA 4B2DA 3ABXA 1JIBA 4D9PA 3C0JA 1CNVA 1PKNA 1S39A 2D0FA 3W1QA 1LRNA 4C6LA 5AYYA 1HVXA 4RPQA 1GPFA 4D1IA 2QCDA 4LQ1A 2QJNA 2GJNA 4WSJA 2YB4A 5FSEC 1W1A1 3G1RA 3K30A 4EPBC 4CD6A 5D2WA 6REQA 3WLNA 4DBWA 4AEOA 2FHBA 4LS0A 1IE7C 1R9XA 1WA3A 5CXPA 4LALA 4AZBA 1DVJA 2CESA 3W29A 3RPDA 4MAVA 1UD6A 2V0TA 2VRKA 3QGVA 3N29A 2HMCA 1H7XA 1Q6RA 1W3TA 2Z1SA 2FDMA 2ZXQA 4NIRA 4RNFA 4HNTA 2BY0A 4R7WA 2VCBA 5GJNA 4MZ8A 1JG9A 5HA7A 1J0ZA 1RXOB 1UP0A 3CASA 3RLUA 5BRBA 3C3UA 3H7UA 3UZYA 3G3MA 3QTPA 4QJ4B 3NVDA 4UWMA 1C29A 1WOAA 1C9DA 4UFLA 1VENA 3A4JA 3CLMA 2CWXA 4WIWA 3TKFA 2XVNA 3WQDA 2JK2A 3VKDA 2XFRA 4ZVJA 3M07A 5K9DA 4NJIA 5G4HC 4S3JA 3VOHA 1UZ1A 4QBXA 4A4AA 2OU4A 4K2SA 3P0XA 1GKRA 4B5SA 1FCVA 2EPLX 1KCLA 2ZTJA 3N14A 2FYMA 1XLKA 2FDSA 4DBDA 2E6FA 3CEUA 4H7CA 4DHGA 3LI1A 1BLIA 4U3AA 3ZXWA 3E5BA 1QOXA 4Q8TA 2NSXA 1QBBA 3O6DA 3CAKA 3ZT7A 1BF6A 3M0HA 1E6SM 1FXQA 2Q02A 3FW6A 1M6JA 1IT8A 5JIPA 3RU8X 2OZ8A 3IVUA 1H7WA 2R1NA 4Y90A 3QV6A 3DYMA 3IIVA 5FCZA 3MKCA 4K1GA 3BQ5A 5D2YA 3TXVA 4RZ4A 3B05A 4FMVA 1XYFA 3QV9A 4CNNA 4AZIA 4ZQRA 2GVJA 3ZLGA 3WZ0E 5DELA 3ARRA 4R85A 3CQJA 3C4UA 1O5QA 1AVAA 2NX3A 3Q45A 4W93A 3VNLA 4BWLA 1V3JA 3UPMA 5AC6A 1F07A 1W2PA 1KWGA 5D30A 1AQMA 1UIPA 1HFBA 1ONEA 1P0NA 2YXGA 1TMHA 1E6QM 1B1YA 1V3LA 1H5YA 3CAVA 1KFCA 3QLDA 2CLMA 5IBXA 1WZKA 2QDDA 3TAOA 3CTLA 4B5VA 5F1VA 4UTWC 4QG8A 3IJ6A 4IGNA 4D8LA 3GZAA 4GUJA 3MS8A 3ALFA 2DVUA 5DXXA 1X38A 1WAUA 1WUEA 1FWSA 1E9IA 5C9XA 1XRFA 1MYRA 5C55A 4CGTA 1TWZA 3UXKA 1QT1A 1ZZMA 3MWAA 2P0OA 1XJBA 2OO6A 3WJSA 5DN1A 3PY2A 2XU2A 7TIMA 3P82A 2PRMA 3A22A 2W62A 3OODA 3B0UX 3VDHA 5CQ1A 3NPVA 3O3RA 3GXMA 3UXDA 1IXQA 2QJGA 4DWSC 3RPMA 4DUVA 4W89A 1WZLA 3BANA 2FMOA 1K8CA 3FY1A 3SY5A 3S0CA 4D6FA 2FB2A 4ML4A 1WUFA 2C16A 1I45A 3TCEA 2YXXA 1JCLA 3IPWA 4HJWA 1EHAA 2P50A 4Q6XA 4DX3A 1CENA 3GW3A 1XGZA 4J3ZA 1R9ZA 1CGUA 3GC2A 4D6DA 5FAGA 2NSOA 4NI3A 3AAMA 2FH8A 1H62A 5HPCA 4V27A 3N6HA 4CNPA 4H7ZA 2PC8A 4L1GA 2YLLA 1GOXA 4GNVA 4KIEA 4ICNA 1OVDA 3U2ZA 2WSPA 3T2QA 3ITGA 4AZ5A 1WE5A 1E3XA 4U10A 5CC3A 2QCDB 1ZHAA 1YADA 4PCSA 1GK8A 4LC6A 5I23A 2PP0A 3W27A 4IFOA 4ZODA 4ZB2A 3M0JA 2DSWA 2CZVA 4LUIA 3N13A 5A6BA 3GU1A 2WXDM 3FA4A 3O6YX 3SRDA 4YU1A 4DWSB 3AYSA 2D2OA 4OHQA 4QP0A 4LWWA 5HJXA 3VINA 4A8RA 1Q3NA 2YL5A 3AYTA 4JHZA 1VAHA 1Q7QA 2VL4A 4CNSA 1ADSA 1VH7A 1QHZA 2EO7A 1YTEA 1PS9A 4RE0A 2NV1A 3SRFA 3B4YA 3NXLA 4DVOA 2IPWA 5D05A 5H8UA 4ZBCA 1MW0A 2G0WA 4TOQA 3H2CA 3MI6A 3M64A 4QGCA 2DVTA 5BROA 5EMJA 1EJXC 1UKQA 2J24A 3KLLA 2QDGA 4LRTA 3B0XA 4GKTA 1UWSA 5JU6A 4GLEA 1DIEA 3BG3A 5FSDC 2QW5A 3W07A 4US5A 5EB8A 1JGMA 3DXIA 4GZ7A 4BS0A 4XO6A 1VIWA 1TZ7A 4TX9A 3WLLA 2W61A 4X63A 3QPYA 1EF3A 4PMVA 1IHIA 3WJYA 2YCLB 3IJDA 4IXHA 1BKSA 2PE4A 1EIBA 1W32A 1A5KC 4K8GA 5T8GA 5DRCA 4I7WA 3UNDA 3B8TA 4Y9PA 1HIZA 2ZUSA 1OABA 2WSQA 1PHWA 1GONA 3E2VA 3A6OA 3ES8A 4RUBA 3WF1A 2WWDA 3EEZA 1E0WA 3TR9A 4JL1A 1TE6A 2NXGA 1V7AA 4XAYA 4F0MA 1TCMA 2VEMA 5IHRA 1KBKA 4UZUA 4DZIA 1JZ4A 3QOKA 5DMMA 2XZ9A 2POTA 1TPB1 1T8QA 4CUCA 2PAJA 4UNLA 3TVAA 4M1BA 4NILA 2HXUA 3H55A 4FPSA 4HJFA 2E0PA 2E6AA 4PA8A 3W25A 2W63A 3EMCA 4FLOA 4KERA 3GTFA 4NRSA 2V5KA 4PODA 1XSKA 2ZRVA 2VM8A 2MNRA 4DBUA 4UFMA 4KQNA 4B16A 3P2VA 3LCGA 2D22A 2I56A 1UJQA 1F3EA 2JKAA 2VX4A 3RCMA 4FOJA 1A5SA 3AZTA 3UVAA 4ZTYA 4AY8A 4EXQA 2J7FA 1M65A 4JX5A 3FN9A 2C14A 1WXYA 2GEPA 3EOLA 2V5LA 4NJHA 1JEZA 2ZWZA 1FWAC 4PR4A 4Z0JA 1B5TA 1EGVA 4UQDA 2Q3OA 2WSKA 4PZVA 1EKOA 1DORA 4L64A 3MC5A 3FAWA 3OU8A 1RY0A 1IT0A 4G56A 3BV7A 1OM0A 1K9TA 3FJNA 1EBHA 1LJYA 2YBUA 2PGFA 4RL3A 3HBLA 2G3IA 1TTJA 3W38A 2BY3A 2H3BA 3D6NA 3GAKA 3CV1A 3L5MA 4WLCA 1W3IA 2AQVA 2EEXA 3W7NA 4K8EA 3ZSSA 1MUMA 3P60A 4UMCA 2EXOA 2Y7FA 4JN7A 1UA7A 3BMVA 2GSEA 2DT0A 3POHA 1M7PA 2JE8A 3TTYA 3ZJ6A 1NWRA 1KV5A 2W92A 3BMXA 3EXTA 2WZTA 3P80A 3E0IA 3GM8A 2ISSA 4R9XA 4DNHA 1GW1A 3FJLA 3QPEA 2ZUMA 4RZ6A 2XSBA 3O0FA 3PBMA 3KTXA 1LG2A 3GNXA 1XYZA 2YR1A 3C8NA 3KM8A 1UQZA 2XVGA 2JGYA 2PPGA 3D3FA 2PWGA 1JQXA 2CIPA 4D6EA 1ICPA 3EXRA 1BTMA 3GIPA 4AX6A 1MEIA 1KC7A 4HSOA 4ZTXA 4C7FA 4L9ZA 1DHKA 5M2FX 3TFCA 3R58A 2IPGA 2Y2WA 1OX6A 1VBRA 5LIKX 4BI5A 2W67A 2Q8ZA 3PFRA 2X2YA 4Q8MA 3CIXA 1K8YA 1UKPA 1PZ2A 5J04A 3ZJKA 4D6CA 4G5DA 2WBKA 4AYGA 1FHDA 3HF3A 1UD2A 1V0MA 1NDWA 2OR2A 5EY5A 2ATSA 3QHOA 3IWPA 1I1WA 4AHPA 3ZS4A 2PBOA 4MNKA 4NF7A 4IH3A 3SGZA 4A3YA 4V1YA 1TREA 4BEUA 3GDMA 6XIAA 2VFDA 3F2DA 2V67A 4GACA 3UT0A 2D2GA 3FFSA 4M3PA 3ERPA 1HVQA 4XK2A 3H2AA 3PPFA 5AYXA 5D2TA 2DW6A 3PZVA 4GUIA 3PZNA 3MHGA 3N3TA 4J4KA 3B8WA 4S39A 4EWND 2WHLA 4S2BA 1XXXA 3THAA 3VIJA 5LSMA 2DGAA 4FEZA 4EACA 1REQB 1VFLA 2E6YA 3S2NA 1FWWA 3UW6A 2OYMA 3T1GA 3TYCA 1IIGA 4YYCA 3UF9A 2IPFA 1Z48A 1MI3A 1BSIA 3T8QA 5XIAA 3ENLA 3SUVA 5CLTA 3OEXA 4DPPA 4Q4MA 1A0CA 1XR2A 4JTHA 3VOCA 2RFGA 3LV6A 1PZ1A 4RXFA 3VU2A 4MB4A 4DWSD 4GQRA 3SCSA 2WCSA 1RD6A 3WLRA 2XINA 3FHAA 3CZJA 1UH4A 3KVMA 3QGAC 1ADDA 5FEZA 3R94A 3GRIA 1P1MA 2E09A 2PF0A 2DIKA 4IQDA 2ADAA 3NAVA 3UR8A 4PUKA 3LX9A 4I5UA 3IJ7A 3AI0A 1F61A 2PCEA 1JDAA 3O6CA 1GVFA 3VDBA 1Q6GA 4BQ2A 1HXJA 4G7EA 5EMUA 1F4AA 2DUAA 4AZCA 1WKEA 1IR1A 5IHSA 1JCXA 4RKAA 2DIEA 1JRBA 1KM0A 1LF1A 3FNDA 3GK0A 4GUHA 3BSHA 3P7YA 5HAOA 2Y5EA 8TIMA 3KVLA 1CI1A 1SJDA 1UC4A 4A8IA 3O07A 1SR9A 3K4DA 3PZMA 1YW1A 3KZPA 3N17A 1W37A 4DJDA 2P76A 3ZVHA 2X1RA 4CN1A 4DY1A 2V4JA 1PTAA 2GK1A 2PF8A 3DIPA 1AJ2A 5EKYA 3NQVA 2WKLA 3H26A 5TNVA 3SI9A 1R3WA 3MANA 2REQB 4YTQA 1OX4A 1JUKA 2PLMA 4M6PA 4P8UA 5FJRA 1UR1A 4AIBA 1B3XA 3MUY1 4IFRA 1JD7A 1Q7MA 1JI1A 5K2ZA 1FUYA 1U22A 2E40A 3BW3A 1JUEA 3UERA 3MKVA 4UTMA 5AC7A 1PKMA 2ZZ7A 4OE7A 1GTEA 2YDQA 1R3TA 2DZXA 2E3ZA 2NWRA 4AD4A 4HNVA 1DJZA 3VKBA 1KNWA 2OLSA 3ID7A 5HR7A 3B8SA 2YDSA 3KOFA 3ITYA 3RR4A 4LSBA 3B8DA 4NX5A 1EO5A 3L0KA 3PBGA 5M17A 3S6DA 2FZMA 2NX1A 3FDGA 5CPLA 3G1XA 4RV8A 4MFEA 1DJQA 4CN6A 4KT2A 1W0MA 1FCUA 4GK8A 4J28A 1TMLA 3T78A 1LQ0A 3AS2A 2GWGA 2WC3A 4OWGA 3HQNA 4KS0A 3KRBA 2PDLA 2WVVA 5BZAA 4RDZA 4MM1A 1V3HA 3BOXA 4B3LA 4JHMA 4CU8A 1U2YA 5LA0A 2HK1A 2VDHA 1J0YA 3PBUA 3UEQA 5A8GA 3IJQA 1UWQA 3TX9A 5IM51 1KXVA 1H1YA 3L23A 4US5D 1YX1A 1VJIA 3E2QA 1BTCA 4XIAA 4O0KA 3T55A 3MPGA 1RHCA 3TYAA 1PWMA 2XN2A 1WCGA 2OLHA 1H1ZA 2ZX7A 3OZOA 3UWQA 4KEVA 1BVNP 1OCJA 4A2SA 2FZ9A 1UH3A 2AAAA 2QPUA 2ACQA 3WFAA 3GAYA 5KSWA 4P8XA 2Z25A 2AAMA 3KVJA 4UXDA 1NEYA 3IGHX 3W75A 2ZRYA 1Z7AA 3VAVA 4M6VA 1VGAA 4E38A 4QG6A 1OK6A 5LXXA 3AUOA 3TV8A 3HPFA 3A21A 3MY9A 2Q8LA 2PDIA 4AIEA 1A5LC 1LDCA 1HKWA 3VFLA 2FZNA 4H19A 1E1EA 4O11A 3QMSA 4MPKA 4DJFD 2C0AA 2E5CA 2HBXA 4EE9A 1ZAHA 1QW8A 1UWRA 3NO3A 2EPHA 2IKGA 5I6SA 1E6RA 4MKNA 1YBQB 1JRCA 1E3ZA 5J8LA 2YCIX 2FPVA 3I68A 2WC4A 3IANA 3P62A 4TR9A 3B0LA 4IIGA 4HMDA 4AHQA 4HNUA 3LZ5A 3MSYA 3SJ3A 1FWJC 5HK4A 1ZALA 5JUVA 5M5DA 3IAQA 1XINA 3GYCA 3WMLA 1ME9A 2A6LA 1UBSA 4ZE4A 1VRDA 1G4PA 7REQB 2XDFA 4B91A 1DIOA 2YLAA 2XM1A 3CHCA 1P4CA 2V3DA 3JU2A 3NQEA 4MAZA 4S3CA 2X1IA 4IFKB 1OFQA 3S47A 3UZWA 1TQXA 3PFMA 1FKXA 4ADUA 4PMOA 4FNUA 1EX5A 1R86A 1XL9A 2FVLA 3V5OA 3I6RA 4OBRA 3YPIA 4RV3A 3WH5A 3V0SA 2NQLA 3NJ3A 4WOZA 1LUCA 5A5WA 5C8BB 1I9CB 1SJBA 1E5JA 3KCJA 1WYIA 3NUKA 2QJHA 4AF0A 5I7GA 4D8AA 2J27A 3TMLA 3W26A 1UUOA 2ZX5A 5EA9A 2RKXA 4ZGYA 1HGYA 4PH6A 2V5JA 2A79A 4WOQA 2OKOA 2Z2UA 1T8XA 1VS1A 1CXKA 5HMSA 1HO1A 3WBEA 3CPUA 1TVNA 3WL0A 1R7AA 2DUXA 4DPQA 3TNBA 4Q8OA 2ZRWA 3LSBA 5D4YA 4AYSA 5AHLA 4O1AA 3GHUA 2Z0IA 4L4PA 5FI8A 3JR2A 4QRNA 2AL2A 3M46A 4WJXA 1CGTA 2J25A 3IRSA 2HRWA 1YXYA 3EPOA 3BWWA 1JCNA 1LL7A 2C3ZA 3CZGA 3T42A 3MSGA 4F2TA 2GQAA 1MXDA 3V4BA 3A64A 1ZENA 3UZJA 1FFRA 1B31A 1Q45A 1F05A 4J3TA 1EEXA 5FL0A 1QPQA 1QI4A 3ITOA 4DJFA 3OR2B 1CXLA 3DC8A 3CNYA 4M82A 4O17A 3CL6A 1H3GA 1K9FA 3WYZA 3VUSA 2TRSA 2V68A 1DEDA 3JZUA 4HA4A 2WMKA 4W4QA 3FIGA 2G3FA 4JYEA 2GLKA 4ZQCA 4KH2A 1YQ2A 3T0CA 3VKQA 1KTBA 3E02A 3SEPA 1E0VA 3TA9A 3L4YA 3WQFA 2VC6A 3KBVA 4OTKA 3VVGA 5BNKA 4G2DA 4PULA 4YYFA 2V4JB 2E8YA 5LHFA 4RZBA 1FXPA 1CW2A 1BGGA 4J3XA 4IQJA 1V6XA 1PWLA 4H9TA 3GIQA 3P14A 1V5XA 4MUPA 2G3NA 4ZXOA 1P0DA 1Z41A 1TX2A 1KBLA 3L67A 2NQHA 3CZLA 4TVCA 4NAFA 3URNA 3JUGA 3VMNA 2OZ0A 3LHZA 3BCJA 4W85A 2ZA2A 1JDCA 4YL2A 1XHGA 3VD7A 3WQ4A 3T0AA 3KTSA 5AHNA 4J40A 1WZMA 5IFTA 2ACSA 3RR1A 4ERGA 4EP8C 1TFVA 4N9EA 3DI1A 1MXSA 2OQHA 1EP3A 1EJUC 1R3YA 2ZOXA 3LXBA 2J8GA 2F6KA 2GGGA 4WDWA 5HMFA 3VNJA 1P0EA 2E4TA 4KWSA 4QM1A 2HJPA 3FK4A 2WVVB 1TJ1A 2A7NA 2XN0A 1XLMA 1AH0A 1E0UA 4RJEA 4WX2A 4H3DA 1PVNA 1SSDA 2Y89A 3VOGA 3GG7A 1F2JA 2KAUC 3C0SA 4F0LA 1OZQA 3VOIA 3GDBA 2ZADA 4Q8WA 1A49A 2BGNE 2DH3A 1VYRA 3IK2A 3HB9A 2VHLA 1HKJA 4PEKA 3VD4A 4X2PA 3N2BA 1XFBA 2Y7GA 2FZBA 3Q37A 3TTOA 4MY8A 4ICCX 4ACZA 4UTHA 3C2OA 3D3AA 3AJ7A 2XJ7A 4NZ1A 1V02E 4YLWA 1QWGA 3SJNA 4H9MA 1YBQA 2ZTKA 4Q4QA 1F5ZA 2H6RA 1CLKA 5I0DA 4E0CA 3ANUA 3SADA 4DIAA 3TJ4A 2HPMA 4H2HA 3LA4A 3QEZA 2DQXA 2XUCA 3O2LA 3PTMA 5M3WA 3EB2A 4JIRA 2I57A 1VFTA 3PZQA 2YZRA 1GPWA 3MMWA 1TG7A 1KM1A 3BLKA 3R6IA 1N8WA 2BP1A 3DFYA 1BVWA 4PUEA 1V02A 4BR1A 2DU2A 5B80A 3GO2A 4W8BA 1TV3A 1BD0A 1HN1A 1O66A 1QW9A 3TONA 5KTLA 3FSUA 1J5TA 3M43A 4LPCA 2CZEA 1AOPA 4GKLA 3PPCA 4AEEA 3PSVA 3R12A 5AC5A 2PCQA 1F74A 2Z6IA 2GUYA 4LUTB 2OQYA 2NVCA 1A3XA 2G37A 3TZNA 5DY2A 3UJSA 2F2HA 4Z17A 4JZ5A 1VEMA 3CHDA 4GGBA 4M1RA 3L21A 4H9YA 1MW2A 5ABEA 1TJ0A 4PMZA 3UPBA 3ZIZA 1QU4A 1EB3A 2PDNA 1JCMP 1OHLA 2ZX8A 3OOQA 4IIDA 1H5VA 2OT0A 4PUUA 1V0LA 4PFHA 5CC7A 3VIKA 1DWAM 3N4EA 3OW1A 3O63A 3LD5A 1VLIA 3CU2A 1D9EA 3NZPA 1OD0A 1Z42A 4NZ3A 3PJUA 4FF5A 4IPJA 4Y8FA 4GPNA 1G6CA 5DBUA 3WF3A 5CGQA 3P67A 3RU6A 3B06A 1DYSA 1MRAA 1W5OA 3UCDA 1KFKA 5DMNA 1NF0A 3QZ6A 3HIJA 3PZTA 4JNMA 3EWDA 2D2HA 2XH0A 4MY9A 2ZIDA 4U33A 4Z2KA 3H53A 1FH7A 3WQCA 1Q2RA 1OB0A 2OSXA 3N11A 1MEWA 1US3A 2OLAA 4ZEPA 5ENLA 4TV5A 2O92A 4JOMA 4OFCA 2GDVA 1OSEA 3DYOA 4CEUC 2ZZ4A 2CLPA 4HPNA 1WBHA 1EF2A 1NAL1 2PDHA 1FWDC 1FX6A 1UW9A 2IQDA 3UYIA 3HG3A 1AQFA 2HE8A 2DSVA 3G1FA 1JPIA 4XZMX 2X7WA 1BKHA 1DWJM 3HMJG 3F4DA 3VCRA 4MF4A 2PLKA 2WHJA 2PWEA 1S2VA 4MADA 2DY3A 2VD8A 3EWXA 2NZLA 3P74A 1ZJBA 3A9IA 4YVVA 1A5BA 4MB1A 4PYSA 5AY7A 1UWTA 3WFZA 3NQBA 1BXBA 1QI0A 2G5WA 2OYKA 4LAZA 3Q2DA 5A8MA 3MM7A 2WQPA 3EXSA 5BMXA 1LLWA 4C6CA 3NYZA 1S2TA 3MMAB 1UR3M 4R3UA 2J6XA 1XPYA 1E73M 4AAJA 3B0GA 3MYPA 1GOMA 2VTFA 3T0TA 1LOQA 1G9HA 4HOXA 1Q5MA 3QR3A 3G6LA 1SM9A 2WJZA 2WNNA 4LYPA 3KEHA 3TDFA 1ZTVA 1S5MA 4ZB0A 4B3KA 2XH2A 3EX4A 4H8NA 1U5JA 1LORA 4JEQA 3UBPC 2QUNA 3MB9A 3OVGA 3TNOA 4HU4A 2BOEX 2PS2A 1EJTC 3GVRA 2XM2A 4KFPA 4UC5A 1OQFA 1EDGA 5LXEA 3QHMA 3NL2A 2ISDA 2VUYA 3URAA 4NU7A 3VM7A 2HWGA 3R0KA 3WNOA 3LGGA 1KB3A 1ZBWA 3UR5A 1GJPA 8A3HA 2Q71A 3OJGA 1UBPC 3M7WA 1YHTA 2OWXA 3G1SA 2YDAA 3EZ4A 4B9ZA 1P6BA 4M24A 3E12A 4RX0A 1H09A 5EFFA 2QF8A 4DI9A 3DERA 3RRXA 1UOKA 3KAOA 3UPWA 1LRTA 4HVXA 4F0KA 1ISWA 3GXTA 3WLMA 4ERIA 5C9ZA 4WJ8A 3NXFA 3LHWA 2ZWYA 1PIIA 1O68A 3VIGA 3CUJA 1KRAC 3ZFHA 3G1VA 4JFTA 3BLIA 5LKYA 4WY0B 4DJDC 4P5UA 1R6WA 5FIPA 2Q3RA 1TV5A 2IPJA 3HG4A 2WZEA 3GR4A 4BQ3A 3K2GA 1GYMA 5C7HA 1EYWA 1K3UA 1MDRA 3GVWA 5EFDA 3CS2A 1QATA 1E70M 1EBGA 1Q6QA 1L2UA 3W7MA 3BCDA 1JFHA 3B0YA 3GX9A 1GUVA 3QV8A 4FA3A 1YTDA 2CEQA 4QSHA 3WDRA 2V8ZA 2XIMA 4C6JA 1XWYA 3BLLA 5I78A 4Z08A 2D73A 4V2XA 4DF2A 3BLEA 1W3HA 3NIYA 1VPXA 6XIMA 4W88A 1IXPA 5AZ1A 4XO7A 3HM7A 4X3ZA 4PGLA 1DQWA 2R6OA 3NEVA 1H7OA 2GL5A 4ALDA 4ZCWA 1LT7A 3VIFA 2OEKA 1W3NA 2X0HA 4IQLA 1CBGA 1E0TA 2ABBA 3M5ZA 1RV8A 1XF0A 1ZUAX 3CUZA 3VLZA 3VNYA 3LHYA 4NP7A 3CYVA 3KL5A 4R7OA 2CXEA 3DHFA 5CC6A 1QW7A 1FY6A 4OIFA 2OB3A 2QCLA 3PS7A 5CKSA 1KRBC 3RLHA 3K4WA 3ANYA 3SRHA 1ODUA 4BQ5A 3C2YA 3B0MA 4C6PA 3TW6A 2J78A 3GXIA 5TIMA 1S2UA 2VR4A 4HNCA 1IR2A 3I7SA 4AXNA 3KBMA 5CJ5A 2YCLA 3NQAA 3W1LA 3M9YA 3VCNA 2QV5A 4PRRA 3E5PA 1AZ2A 3AHTA 2CZDA 3ZT5A 1XIDA 1J8VA 2YPIA 4GUGA 3FA3A 3FEMA 4O12A 2PZ0A 2CW6A 3IGUA 2F7FA 3MA8A 4BKNA 1PAMA 3TK7A 1GWJA 3LNMA 4HCHA 4HNNA 5HQMA 2CLKA 4F9DA 3TC6A 1AZ1A 2ZRZA 3MUXA 2ON3A 4KWVA 2QF7A 1OT1A 2A6NA 3BMWA 3L5AA 2PGRA 4EX4A 5D2XA 3VZYA 4JTUA 2KZHA 2A0NA 4B5NA 3ITLA 2E9BA 4PRWA 1JL8A 4XD4A 4MWAA 4IG2B 2PWFA 5CPOA 3C8FA 1VFSA 4K7YA 4GZEA 4RK8A 5C2CA 1L2QA 1W54A 5REQA 1Q13A 5A6SA 5AYZA 3VNIA 1K4GA 1NWSA 4AHOA 2C6QA 3KTCA 1R2SA 1PL9A 4KBXA 1XKJA 4HN4A 3KHDA 1AMYA 3CH9A 1TPC1 1OGSA 1G5AA 3WH8A 2FFCA 1XG3A 3C61A 2ESCA 3TQKA 2G3JA 4JTTA 3AWOA 1CB7B 2WLYA 4PCTA 3W7RA 1W9XA 4YMZA 4O4WA 4TU1A 3VKJA 2CU0A 2QIIA 2Y63A 1JZ7A 3QR1A 1ME7A 3GG8A 1ZSXA 3PUEA 1TVLA 5F4XA 4LS2A 4MWAE 4HIBA 1XV8A 3B03A 1W3KA 4IMGA 3B3DA 5I3IA 1HT6A 2TSYA 3CQHA 2B7OA 3R10A 3ABQA 1J79A 1W56A 3CQ0A 2YCKX 3QJAA 2VFIA 2Y85A 2ZZ1A 4B5UA 4NZFA 3W76A 5JIWA 3HPZA 1I2RA 4O16A 4QFUA 5H1WA 4GQQA 5DO8A 5U7SA 1XICA 1FWFC 2E5DA 5HMEA 1JJKA 3PULA 1JZ2A 3T09A 3WX7A 1PYFA 1S46A 1U83A 4J1OA 3SR7A 4EF8A 3BLOA 3GKFA 3VX0A 1TKKA 3LBCA 3LBOA 1OYAA 3OR1A 4YPJA 1W9DM 1WB0A 2X16A 1SO5A 1MRQA 4AD5A 1OGGA 3O15A 1VFFA 2HVOA 1K02A 2DZTA 2R9RA 1S3HA 3LPOA 1SVDA 3GFZA 3OG2A 3AOPA 3S3GA 3A3WA 3WG6A 2F8QA 3MUZ1 2GGIA 1V6TA 1U1HA 3IJ9A 1E1CB 1HF6A 3GB6A 5JQ9A 2CLIA 2IUZA 4GIRA 4DJFC 3GG0A 4UOQA 1EL3A 3U7BA 5HUOA 2CKRA 2GDUA 1E6ZA 1ZJAA 3GY1A 5I79A 5A8PA 1OFRA 3A4XA 4PC8A 5A6TC 1Q4NX 3OBKA 4RR4A 5IXEA 3UWVA 3CAQA 3TYUA 4QQUA 1I0DA 1WNOA 1SFJA 1W1TA 4UIOA 5FAJA 4KGLA 2RH9A 5IOBA 5EMKA 2PGWA 3IJ8A 3CEPA 4HBKA 4OOZA 4EF9A 3BUVA 2BS9A 4QITA 3W1NA 5JBDA 4NXSA 3WLHA 2XIIA 4B4HA 4FF7A 3HG5A 1PDYA 1EEPA 4JTGA 3HPSA 1EIXA 1HJUA 1P5BA 4D2JA 2OGJA 2GWNA 5M1TA 1KCXA 1TIMA 1F4HA 3KE0A 1YTKA 2YDRA 4F8XA 1P7TA 4AEFA 1I0BA 2IXVA 3CV7A 3L4TA 3L5LA 1EA9C 3GHTA 1A4LA 1R2TA 3W73A 2BXVA 1OFAA 1EGMA 1MWOA 4FNSA 2BTMA 1G69A 1RSCA 2P5NA 3DOPA 3PZGA 2P3ZA 2QAPA 3C2VA 2RHGA 1VBGA 1XQKA 3WK2A 2VQTA 2BX7A 1E0XA 3R1ZA 4H8HA 1LBLA 5HBFA 1RPXA 3XINA 1BFNA 2HS6A 4X2RA 3GHSA 2I7GA 3VKTA 1RY8A 3TCSA 1NDVA 1F7BA 2A5HA 5TAOA 2B31A 5CPNA 1J9YA 4KWOA 4U4MA 4UB9A 3JRKA 2PTYA 4HCDA 2Y6ZA 2EJ1A 3KDOA 3GBDA 4GVIA 3HZ3A 3EDJA 4GZIA 1W9BM 1HL9A 3CXOA 3LTPA 3LYEA 3ZMRA 3WQGA 1V8EA 2RJGA 4P7LA 1IXNA 3DG3A 4C6EA 1RCXB 2J79A 3CAWA 3UWUA 3OGSA 3GXPA 1ZJHA 5AOUA 4DELA 1VBUA 4WXZA 3E96A 1OZMA 2HVNA 1G7UA 1DE5A 3GSMA 3WL1A 2BV9A 5C6MA 2ZRUA 4LUSB 4DM2A 5HJYA 3H4WA 4XZBA 2W9MA 1MDLA 1UWAA 2FIQA 1XYMA 2CBJA 5HQLA 4Y9AA 4UTJA 4AOPA 3Q58A 1NTHA 2DZAA 4G8TA 2OZTA 3SGUA 2VEPA 4WY0F 4IISA 5KEZA 3GVVA 1YEYA 2NQZA 3STFA 3LCXA 3U9IA 3W7KA 3G6MA 2I9EA 4QS5A 6TAAA 1LWIA 5HQEA 2OFJA 3V1HA 2J75A 3RITA 4PMQA 2ZX9A 5DFAA 3R8HA 4XB3A 3RMEA 3DBNA 1OADA 2BVDA 2I5IA 3KRUA 3W23A 5FESA 3H24A 3S46A 2CBUA 3B9NA 3R4IA 1Z89A 3EDDA 4YVPA 1Y0EA 3BOFA 2J8FA 3B8IA 4DZHA 4BA0A 2E28A 3LCLA 2ZQ0A 3E0WA 3LLXA 4Q7BA 1IEIA 1WKFA 2VMFA 3MO7A 1Y5WA 4KRUA 4N7QA 3HGSA 2OELA 3TSMA 3F2BA 4WQ6A 5HR6A 5T26A 1GHRA 5RUBA 3MMAA 2PGEA 1V6UA 3EX2A 1C8QA 4GO9A 1Q85A 5E6YA 3GQYA 3HO8A 1JPHA 4GYKA 4YTTA 3DC0A 2WKJA 1EOKA 2XYLA 4LAMA 1GORA 4D6IA 3P61A 4H41A 1UR9A 4GMEA 3WUBA 1GOOA 1AMKA 1YRRA 1SUXA 4LEFA 1L6SA 2ZA3A 1RK5A 3L2IA 3NQ2A 1B9BA 2X42A 4XQ6A 5HXMA 1XDMA 2B0MA 3W24A 1OG6A 3USZA 2FTYA 2G96A 2VGGA 3V1PA 3E49A 1V51A 3W28A 5BOEA 2NQJA 4GOAA 1XW8A 3QKEA 3AU2A 5AC8A 3PJXA 1J0HA 3B9EA 1RCQA 4G38A 4ZO6A 3PJWA 2OWWA 5BRPA 3O6AA 4TX6A 4Y9NA 4QLJA 1DWHM 3LTYA 2AKMA 3HFYA 5FD0A 1SQ7A 5B7ZA 1PDZA 4RNHA 1KCZA 1MW1A 4C6NA 1ME8A 3C3NA 4FNRA 5I3GA 1PIGA 3AIRA 3ARUA 3UXAA 1V0NA 3T0BA 3SQMA 2YBVA 4NVTA 3T08A 1UPPA 2GSJA 4C1NA 2ZZ6A 4P2VA 5HWJA 2FKPA 3VKSA 5EPDA 1ZB5A 1QAPA 1VYSX 2AMGA 3ORWA 2TPSA 3OVQA 1HZYA 1L6FA 5C9UA 1BYBA 1BYCA 3WEMA 2XSJB 4LYRA 1PJ9A 3EB3A 3ABSA 1E6PA 3NZGA 4DB7A 1TZZA 3U7VA 3G1HA 3BO9A 1YPXA 1J12A 3W01A 1UROA 4M7SA 1BEUA 2Z00A 3PUGA 1Q63A 3MP3A 4F66A 3FXGA 3LN3A 4DLFA 2H9AA 3K1DA 1IYXA 4AVOA 3M0MA 1XD0A 3G1DA 4DJEA 3QQWA 1ECQA 1LLZA 4MFDA 5CCZA 4O10A 3BC9A 4G7FA 1IWPA 2QUMA 3BV4A 3FEQA 1KFLA 1P48A 4TO8A 3OZMA 3POCA 3WLIA 4REQA 4PBEA 5BYWA 3LXCA 4C1LA 4K8HA 1QCWA 2VENA 1O5RA 4GG9A 2G3MA 3O05A 2EPKX 2WYSA 4F0RA 7GEPA 4WVXA 3VGEA 4AQLA 5CAKA 3KXQA 1H7NA 4M5PA 3PF3A 3KFTA 3GFYA 3ANVA 1XH0A 1F6YA 3P5ZA 4IT1A 1ZJIA 4IGHA 2XH7A 2VKZG 3PTDA 2OX4A 2FQIA 2WMGA 4LAUA 3PZ9A 1GQJA 3WFLA 1KR0A 4TVUA 1A4MA 4F2BA 3VGDA 2V81A 5BXPA 3B4UA 3CLWA 2V5BA 4JCMA 2WMIB 2PLJA 3UWWA 2CBIA 1GVOA 3EX1A 3UXLA 1ZU8A 2PUZA 3RRAA 3BGJA 4Q4OA 1KRMA 1KXQA 1M41A 4HTRA 3ONBA 1RLCL 1NVMA 3ZYZA 3K1GA 3R7MA 1QK2A 1PCKA 1ZAIA 1ZL1A 4NZ5A 4ILSA 4I9JA 4JR5A 4DN1A 3BGAA 3T07A 3VE7A 1L9WA 2F84A 4I9TA 3PPHA 2XN1A 3OLDA 1SYTA 4U5KA 5D04C 2WZIA 1G67A 3HFTA 4P7NA 4EVZA 2V38A 2NLYA 4Z1CA 2PDGA 4J3VA 4OGZA 1XIHA 1V77A 2OG9A 4JFWA 3QPZA 3EOSA 2ZZ3A 3K13A 1KTNA 1VFHA 3EAUA 1S2WA 4KEZA 3NOEA 5M03A 3RO8A 4IGSA 3WD0A 5HWMA 4CCDA 4Q4KA 1ISXA 1Z8AA 3MM8B 2IKHA 1IWBA 3BURA 3VK5A 2QT3A 4Z1AA 3H70A 1AH4A 1ZQ5A 1XBXA 4EXAA 3TOPA 4LU0A 4MWAC 1GG1A 2FGBA 3ZOAA 4AVNA 2V6AA 5CSYA 4N6EA 1FTXA 4GRSA 3W6YA 3EOUA 4OKDA 2C1HA 3L0GA 2Y0FA 4JTRA 1J0KA 3NVTA 4ZMGA 4NAEB 4FOUA 2VFEA 4MGGA 4EKJA 3V5CA 1KM4A 2HNHA 2CZFA 4PMYA 3F5KA 2RDWA 1VEOA 3NDZA 9XIMA 6CGTA 4S3DA 4JTCA 5JH1A 2PBGA 3MUAA 3V0UA 2OXNA 4HHPA 1UC5A 3U5UA 3HV8A 1L8NA 1PSCA 1QASA 4WKAA 2J9ZA 4F3HA 1OG0A 1O1HA 2A3BA 3CL7A 3QKZA 4ENLA 1OCQA 1BG4A 3B0NA 4JTIA 2J13A 3IGXA 1JDEA 2CHRA 3VGFA 1JZ6A 1GVIA 1OYCA 1TJ2A 2J74A 2ODOA 4IWWA 2WJDA 2CHNA 1NQKA 1FP8A 2PTXA 5C9WA 3WBAA 4JFSA 3BAXA 2BXZA 3W2UA 3M5VA 3WUFA 1XYBA 1TE1A 3F4NA 4XUYA 3W70A 3I3BA 1MUWA 2V2DA 3R5EA 2VR5A 5D02A 4BHYA 4QXIA 4JD4A 3APTA 2VEGA 4KGJA 1TWDA 3U8GA 2V82A 2ZE3A 3OQ8A 2PB1A 3N6QA 5C7VA 1E71M 4GYJA 4B90A 5LNVA 2BHZA 3ABRA 1NFGA 2HE5A 3PC0A 1H7PA 4AB4A 4DI8A 4J3WA 1E56A 1Y65A 1JUBA 4XD6A 2KX9A 4HZMA 3ITCA 2VC5A 1DHPA 4UNKA 4ZE5A 3HGOA 4AWSA 3KOZA 4H9XA 3L4WA 1FWCC 4JN8A 2PDPA 4LF2A 1QNQA 1W2VA 2G50A 2VI0A 3KVKA 4NJKA 2A4AA 1B30A