4S3AA

Ispg in complex with intermediate i
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 137
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3aA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3aA02
3TZNA 3VLYA 3TYAA 4DAFA 4DJFA 1TX0A 4MWAE 6GEPA 3TYBA 3MMCB 3TR9A 4S38A 4O1FA 4C1NB 4DJEA 4S3BA 2YCLA 1Q7QA 3NOYA 1EYEA 3MM8B 3VKSA 3VKRA 3H2NA 3H2CA 4G9PA 2XSJA 2VEGA 3BOFA 1Q85A 4DJDA 2YCKX 4S3CA 3B0LA 1ZJ8A 4S3AA 3VKPA 3TYDA 3MM7B 1AD1A 4S3DA 4S39A 3MM9B 1F6YA 2AKJA 3VM1A 3H2FA 3GEOA 3MM6B 2OGYA 3H2AA 4D8ZA 1AJ0A 3H2MA 3MCMA 3B0HA 4G38A 2E7FA 3V5OA 4D8AA 2H9AA 3OR1A 2AOPA 2DZAA 4MWAB 4G39A 3VKQA 3MCNA 4O1EA 3H26A 3MM7A 3TZFA 2YCIX 1AOPA 4NHVA 3MM9A 3B0GA 3TYUA 2YCJA 3TYCA 4C1NA 3OR2B 4MWAC 4NL1A 4DJED 3B0JA 3MMAB 2GEPA 2Y0FA 2VP8A 4S23A 3OR1B 2DZBA 3H2EA 4NILA 3MM5A 1Q8JA 3B0MA 1Q8AA 1TWZA 1TWWA 1TX2A 4DJFC 1AJZA 4S3EA 5GEPA 2Y5SA 3K13A 4DJDD 3H24A 4S3FA 2YCLB 3OR2A 3MMBB 3TYZA 2V4JA 3H23A 7GEPA 2Y5JA 4O0QA 3VLZA 3AOPA 4AOPA 3MCOA 3B0NA 1AD4A 2XSJB 3VM0A 4DJDC 2VEFA 3H22A 1Q7MA 4MWAD 5JQ9A 4DJEC 1TWSA 1ZJ9A 4DJFD 3MM5B 4DAIA 4DB7A 4NIRA 8GEPA 4HB7A 3MMCA 3BOLA 3MM6A 4HTRA 3VKTA 3MM8A 2BMBA 1Q7ZA 3TYEA 4CCZA 3MMAA 3MMBA 5AOPA 2V4JB 4PZVA 3H21A 4D9PA 1AJ2A 2H9AB 4GEPA 2DQWA 4MWAA 3H2OA 3VLXA
chains in the Genus database with same CATH superfamily
1OFOA 3GIQA 2GVJA 1ICQA 2UV8G 1ZENA 4U3AA 1ELSA 3FHAA 1C8VA 4RK8A 3PM6A 3B8WA 3W38A 3GVQA 3MMUA 4H2CA 4S3BA 3GBDA 4L7ZA 3W25A 4QE1A 3CUZA 3L5AA 3LXCA 2QCMA 1QO2A 1EX1A 3UXLA 3JZEA 1JFXA 5C0QA 3P8JA 1YYAA 4D8ZA 1GG1A 1RSCA 3LPGA 3UPBA 1FTXA 3U4FA 2E67A 4ZR8A 1D8WA 1XIIA 2GJNA 3WH6A 2WKLA 3SY8A 1U5HA 2P5NA 3KX6A 4K68A 1J79A 2NSXA 5HUPA 2ZX8A 4Q4KA 4B5XA 2QS8A 1UH3A 3CUFA 1IEVA 2NXIA 1PX8A 3ZJ8A 4DN1A 3EX6A 3EEGA 1F6KA 1AQFA 4BQ2A 3SIZA 4D8LA 2YDQA 2VGBA 2YCLB 4PUMA 1NELA 3WBWA 4Y9MA 4DBUA 3CB8A 1ZTVA 1J5SA 2CYGA 2YFOA 4B5WA 2PEVA 3A9BA 3QC3A 1R9YA 3KZPA 1RV8A 1CDGA 2OGJA 1XIEA 3WD2A 4MB4A 4RNFA 1TIWA 5A8OA 4OIFA 3B04A 4UTFA 4OECA 3WKZA 2PWEA 5DQPA 4H41A 2D20A 4AQLA 3LZ3A 5CPNA 5HATA 1HVXA 1GCYA 1IXPA 3NDZA 4ZO8A 4KIEA 1EHAA 2DJXA 3TSBA 4JFVA 2GQ3A 3WLTA 3QTGA 2VEGA 1F7BA 1HGWA 2WMHA 4LUTA 3CQJA 3H7RA 4CNOA 3I68A 3VDCA 1BXNA 2G95A 2X1UA 5G2IA 4HN8A 3THQA 3E5BA 4LS2A 1W1YA 1F3EA 1TSIA 4V15A 5CJ5A 1XLKA 4W8LA 4LC8A 1GKQA 4YU1A 5IDZA 2IQ0A 4IJRA 2W9MA 1L8PA 4NHVA 4EANA 1GEHA 1BF2A 4DWSD 5FEPA 4HJFA 4DHGA 1E4LA 2CERA 3PN8A 4H9TA 3ATZA 5DCEA 5I6SA 3EKZA 1RQEA 3TX9A 3PTQA 4JICA 1IXOA 3C2RA 4B2DD 2OU4A 4KW2A 4MPKA 1VCVA 3DZ1A 1TV7A 4Z1DA 3DYOA 3CHEA 1SJCA 3R89A 3WBXA 3O6YX 1KCLA 2C18A 3VZXA 2VO5A 3BMXA 3BW3A 2PDCA 1R8LA 2VXNA 4X63A 8GEPA 3GBEA 2PZ0A 3T81A 3ZSSA 3MUIA 1X1NA 3PPHA 3W82A 3AISA 3O07A 1UIPA 5T26A 1G4PA 4H9UA 4HCLA 1M5WA 1E0VA 1PWLA 4C1NB 2YL8A 1XDJA 1HJWA 1CX9A 2Z1BA 3ES7A 1GHSA 2P0OA 3VOFA 4QAIA 2VL4A 1XBYA 1XCFA 4Z2KA 3U2ZA 4IIDA 3ABXA 4M6UA 4ERIA 2OWXA 1JZ4A 2R91A 5AYIA 4LC6A 4HA0A 4F0RA 1DJZA 1IGSA 5A3HA 2PDIA 4KMQA 3CHDA 4O1EA 3XISA 4MF4A 4W86A 4HP5A 1JR1A 1PTGA 3UT0A 1WDSA 4DM1A 4IJCA 3D0CA 2GJLA 1HKMA 4JDYA 2WMKA 2IS7A 3DCPA 4NILA 1S38A 3MBDA 4NI8A 4JNMA 2R1MA 5I02A 3AIEA 3SUWA 3BO9A 3TTOA 2J7FA 1V03A 3JW7A 1SFLA 1Y0EA 2REQB 1I0BA 3LCFA 1W1B1 3RR1A 2XDFA 3MHUA 1J2BA 2YPIA 4JTSA 4E38A 1IEWA 3WDPP 2QV4A 3R0DA 2EEXA 4S2CA 1FWBC 2XWEA 3LMZA 3S5ZA 1PHWA 4FSAA 2JF7A 4BI5A 3RR4A 5BWAA 3IGUA 3NVTA 1M7JA 1UZ1A 2J8TA 3NQGA 1PX3A 1SUXA 2F38A 4Y9OA 4JIIX 4LVGA 4I8DA 1XKJA 1JL8A 2C14A 3CPGA 2XSAA 3LGEA 1ITUA 1R3QA 3VMNA 4IOTA 4MFDA 3VTRA 2C91A 1RA5A 1V51A 4O53A 2XGZA 2FB2A 4US6A 4US5D 3GQYA 4DZIA 4MAVA 3NO1A 2UY2A 3UY7A 4MSSA 3GDMA 1K9DA 4LCSA 3CWNA 3HIJA 1IF2A 1CIUA 3P14A 1OK4A 4YVPA 5A1AA 4H01A 4R27A 5EFDA 2Y7GA 1LORA 3KL0A 1O1ZA 3ZOAA 4XKMA 3UWEA 5D09A 1TX2A 4LT9A 3QM3A 1Q13A 4XUYA 1YTEA 3GXPA 4L9ZA 1NF0A 5HPCA 3U6WA 1NWTA 2OWCA 2CBVA 4BI7A 1IXNA 3HZ3A 4CD8A 1H7NA 3GR8A 5C9XA 3TKFA 4NAFA 1GOKA 4QTGA 4C7GA 3SRHA 1F8IA 4GA8A 3PBMA 1HJSA 3FX4A 3UG8A 4I9JA 3WLPA 2QJHA 4XAFA 1DYSA 5IHSA 4XD4A 3QV8A 3MZNA 3H4GA 5K2ZA 3GS6A 3A21A 3QKZA 2BOGX 3MM9B 2WPBA 1C3FA 1QOPA 4WVXA 1P1MA 2WVSA 4XVEA 3W1QA 2ZKMX 3AIRA 1SFSA 3A9IA 3VKBA 1X39A 3RO6A 1EZWA 1Z9AA 3UETA 3FA4A 4MWAB 4HYRA 2DVXA 3F5JA 2FPVA 2KAUC 3BQ6A 4N4QA 3R10A 5A6BD 3PZVA 3ZT5A 3GZAA 2CKRA 4V1YA 5DBTA 2F6KA 1B2YA 1FXPA 4PRRA 3OGSA 1TV5A 4TVUA 2VZVA 2A3LA 1EEPA 3TN3A 3WG6A 1YIXA 1JDAA 3N6QA 4HNCA 1EFZA 1S5VA 1GOOA 2WVTA 1VS1A 2CXGA 1KTBA 1Z69A 9XIAA 3PBYA 4O11A 4C6EA 1R46A 1F3XA 3KL5A 1PB0A 3DFSA 4QRNA 3U2OA 3TLLA 3HB9A 4XZNX 3LG3A 3QPZA 4LWWA 1K9FA 3BW4A 2HPMA 2YA2A 1GZJA 1A3XA 3G5EA 1OIMA 1MW1A 3TN4A 2E9MA 3EWCA 3EWBX 4RPQA 1KFEA 2IKGA 3W84A 3GG8A 5KZMA 5B7ZA 2FVKA 4DQWA 3WQ4A 3W7EA 1RAKA 5I2UA 2MANA 1E9IA 4WIWA 1YE4A 3N34A 1Y5XA 2B81A 2ZA1A 3LI0A 5T91A 5IFPA 5CH9A 5DY3A 4XZHA 3MY9A 3VM1A 3G2GA 4KKXA 2VOTA 3SQSA 1WX0A 1FDZA 1Q6FA 2EAWA 4JAWA 3C8NA 4GZ7A 1KW1A 4B3LA 3O6AA 3UG3A 3RM9A 4IUOA 4FX8A 2YSWA 1S5NA 3SUSA 1P0EA 2EBNA 2Z29A 1VPYA 2E3ZA 3WY1A 2AL1A 3T55A 1OT1A 3CH9A 4HA1A 3W7OA 3VFCA 3NIYA 1TJ0A 3BGAA 1WOAA 2I14A 3WLRA 1ME7A 2OYLA 1GYMA 3SGGA 3ARSA 4MY9A 3CU2A 5LXXA 4UQDA 2G3IA 3FJ6A 4E2DA 3PS7A 1T8XA 3A3WA 3K8KA 1LZOA 4ZOCA 5C9UA 4GRSA 3RPTA 3TCSA 1H0GA 1PJ9A 1RCQA 4H7ZA 1YPXA 3L9CA 4AOPA 3MCOA 8A3HA 2CXEA 4MWAD 3H7VA 3GUWA 1PBGA 1A5CA 3VIJA 2J7BA 2YBUA 4UFHA 4GY1A 3WLHA 1KFJA 1HKWA 4WLCA 2C15A 5DCDA 3T2OA 2QYGA 1X1ZA 4B4HA 4JHZA 2WHLA 3P81A 5FJJA 4F40A 1UMLA 4UCFA 3AOFA 2O9RA 1KRCC 2XHYA 3VVGA 2HBXA 1TE1A 3GM8A 3KEHA 2Y63A 3MKCA 1O68A 2AQOA 4WCJA 3GX9A 3DIPA 4S39A 2AQWA 1OG0A 2GVGA 2CZFA 3CUXA 5EL1A 1N8FA 4FK9A 4NRRA 3MCMA 4GBUA 2PF0A 1Q6DA 3A4AA 3RU8X 4UIOA 1TPWA 2EPLX 3UJSA 4QROA 3H4XA 1SJAA 3N9SA 4KFNA 4R7WA 3GVRA 3T7VA 3TYUA 4EP8C 1XCWA 3MT1A 1TJ2A 1BQCA 4G56A 1RLCL 1YDVA 1GW9A 3K8MA 3VZZA 2ZUSA 2VR4A 4X60A 3W27A 1VBRA 2EHHA 4HMDA 4S3EA 4PMVA 3VGHA 2FIQA 1OCJA 1XCXA 2GWNA 1Y65A 4W5ZA 1OC6A 1W9UA 3LMYA 2DZSA 2PDPA 3H22A 4GYJA 5AC6A 4LUSA 1T8QA 1OINA 3UXKA 3ECQA 4NNBA 4E8DA 2VT0A 3VGBA 4TMCA 3PJWA 5AC4A 2J24A 2JIWA 3EA2A 5F2GA 4L6HA 1B3WA 2OKTA 2I7GA 4FXSA 1RLDA 4S2BA 1CGYA 4HZ8A 4QHRA 2I1OA 3B9NA 4UCGA 1ZLPA 3LV5A 3GKAA 4AD5A 2J9XA 1GQKA 2RJGA 1XLEA 2INZA 4N42A 1YDOA 1MI3A 1DE5A 4UNIA 4KWOA 1RA0A 3SY5A 5BXTA 3TR2A 3GEOA 4F2BA 5K4ZA 3H2AA 4PCPA 3EMZA 1HJQA 1HQTA 2QDHA 3FGCB 1TG7A 3NXLA 3ITVA 2QJGA 1UKTA 4MJ4A 3A4JA 3N04A 4AZ5A 3H55A 3LHWA 5D2VA 4JTCA 4GACA 3OB8A 4GPNA 1C9WA 1F4AA 3BQ5A 2QJNA 1M04A 2GYIA 4OV9A 2R1KA 2EG7A 3BAKA 4HU3A 1GUVA 2QMKA 4TMBA 1RQBA 3THDA 1UCWA 1VFHA 2EXOA 3FYOA 2NUWA 1WAUA 2KZHA 3CIVA 2OO6A 2VR5A 1W3LA 4FNTA 3W85A 2WMIA 2VEFA 3MJMA 4ZE4A 4HKPA 3D46A 1V4YA 3RJXA 1H60A 3I10A 1NJJA 3DHUA 2ZRUA 4MVAA 1O95A 1CI1A 3PSWA 3VNIA 2OVLA 3NTYA 4Z1CA 1EC9A 6XIMA 4Z42C 1MO0A 5D8ZA 1PDYA 5BOEA 1F6PA 3PJUA 1D7KA 4FP1A 3UBPC 1JUKA 4IIEA 2VCCA 2DT1A 3MYPA 1CLVA 4PTVA 2VGGA 3GAYA 4AXKA 4PMDA 3LBCA 5DMLA 1F61A 4GXPA 4Q6XA 5TNVA 2PI6A 3HA1A 4BEUA 1E0XA 1H49A 1PZ0A 3R43A 2JE8A 2H9AA 3IK4A 1XINA 1CXIA 2WM0A 4GQ0A 2C8NA 4E2BA 4PTNA 2BOEX 3T6CA 5HNRA 4CU8A 3QLDA 1JRBA 2FFIA 4ORIA 3OBKA 2PF8A 4H9ZA 3OR2B 3ABZA 1AW5A 4E4FA 2FKPA 1SM9A 2OFJA 1G9HA 1RK5A 2VWSA 5HAOA 1X6NA 3NG3A 1ME9A 1Q63A 2WC7A 3NYZA 1PIIA 4UMCA 3N2BA 3QC0A 2GVEA 1TE6A 3ITCA 2R6OA 1WUFA 2VEIA 4UTWA 2PA6A 5T8GA 4ZL1A 5IM51 3UYCA 5KTLA 2NT0A 4NZ3A 3JVAA 2X41A 4YLWA 2VEPA 3PG8A 1OGSA 1XUUA 2YLAA 3ANYA 1Q6CA 3APYA 3R58A 1SZGA 5B80A 2IPWA 3VLXA 1EZ2A 3VNJA 1E4MM 3QQWA 1OADA 1YKWA 3PF3A 2ZC8A 3ONCA 2CLIA 4RKAA 1BG9A 1JAEA 3GTNA 3QW4B 4HPGA 4MYXA 3WNPA 1XRTA 1IT8A 1X6UA 2YX0A 3CUJA 2GGHA 4P7QA 4CNPA 3EEZA 1L6YA 4AHOA 1OVDA 4CQCA 1BF6A 4N6EA 4DRSA 1TZ9A 3ITTA 1B54A 1S2TA 1HKVA 1BTCA 2YCJA 4FLOA 4RL3A 3VPLA 1MRQA 3MMAB 2J7GA 3VE7A 3OR1B 2GDVA 2DIEA 3LYEA 1WUEA 3E0WA 2QDDA 3N4EA 3K13A 2C1IA 1ISZA 3L65A 3QMRA 2EO7A 2Z1KA 3UXDA 1THFD 3RLGA 2H90A 2CC0A 4CU6A 1E4IA 3T0BA 1TV4A 4UFKA 1ICSA 4DZAA 4CKQA 3WMSA 1BXBA 1XIBA 3P93A 1W31A 3G22A 4XZBA 4BF7A 4XWUA 3MMDA 5FAJA 3PPCA 3WX7A 3NA8A 3H4WA 3P8IA 1W91A 1Q66A 3CV1A 4NQ1A 3S1UA 1OD8A 1FWCC 3HV8A 4NZ5A 3HPFA 1EB3A 1R7AA 1K77A 3W2JA 1GVIA 1L6FA 1J10A 2Z26A 3UPWA 1E9LA 2V38A 3DFQA 2ZICA 4E5TA 4GQRA 5FI8A 4Q8MA 4NJIA 4PC8A 5U7SA 3K2GA 3VK5A 2HE8A 4G1NA 1LLWA 2HBVA 4DZHA 3N9RA 1E6XM 4GJ1A 3KWXA 8XIAA 3WH8A 2AGTA 4GXMA 1FWNA 4LVBA 3UYIA 4CNUA 4NYUA 1UB3A 1LG2A 3VUPA 2HEJA 1BYCA 1WCGA 2PBGA 3PTDA 5HANA 4J35A 1B4EA 1TR9A 4RNHA 5XIAA 4GKTA 1LRNA 3G1DA 3NAVA 2WSKA 1Q8AA 1DTUA 3UR5A 3V18A 1IEIA 1QWKA 3W2LA 3WF1A 2KX9A 3W70A 1IHIA 2XH4A 4R53A 2QAPA 1W5NA 1KM1A 4DPQA 1GVEA 1TKKA 3TTQA 4LVDA 3VNDA 3CZ8A 4IHCA 1WKYA 1L9WA 1TIMA 1NDZA 1KLZA 4IIHA 2BTMA 4B2DA 1QU4A 3TP4A 1ZSXA 3VLYA 3GC2A 3GB6A 3WLKX 4J3SA 3S2NA 4HK5A 4E4PA 3G1FA 2G97A 4FO4A 4W4QA 3O0FA 1WV2A 5C70A 1F73A 4AZCA 4PH6A 3WFAA 3VC6A 2PGEA 3OJGA 1B0IA 4L6DA 1UBPC 4F0SA 2DVUA 1YBQB 2XIBA 2O9TA 3MUCA 2QVNA 4EAMA 2ADAA 4W8AA 1T96A 5I3IA 4PULA 3FLUA 1I1XA 1HFBA 1NIUA 2QW5A 1R47A 4F3HA 3H53A 4P8UA 1J01A 2GUYA 5D02A 5LNRA 1KGUA 2VENA 4MB1A 4GUJA 8RUCA 4WY0B 1HZYA 3LCHA 1QI2A 2AKZA 3K4DA 1VHCA 1A0DA 3I6TA 4REQA 1HN1A 3L0NA 1S2CA 1LQ0A 2VFFA 4A8NA 4MADA 4MPQA 2RDTA 4XBSA 4JD4A 2WNWA 2V3FA 3FFSA 5I09A 1YNQA 1PUDA 3FOKA 1R6WA 3UZZA 1R3SA 1RXOB 4W7UA 1BVZA 2R94A 3CTTA 1CLXA 1LF1A 4QG9A 2YKKA 1IEXA 3U7BA 2QEZA 3UG5A 1XBXA 1TPEA 3WJZA 3NQ6A 2WOQA 1YEYA 4U10A 2PTZA 1B3YA 3NQ7A 4C6CA 4BK9A 3B0LA 1SW7A 1W56A 1MSSA 3KCOA 4EIVA 3NL3A 1UJPA 3L7RA 4NRSA 3IJDA 4DO4A 1P4CA 3PNUA 3H6OA 1GQIA 3OHMB 4ZQMA 2ZX9A 5E9AA 1XBZA 1K1DA 2XIQA 4R34A 3KVJA 4RDVA 1WBJA 3RXZA 1OJXA 1US3A 3AAMA 3ARXA 1UASA 2NQ5A 1G69A 5EA9A 1XDMA 3ZR6A 3S5OA 3N11A 1YE6A 2X7WA 2Y8UA 5D9PA 3F4WA 5CPOA 1H3GA 3WYZA 1J96A 5IBXA 3MV11 3MI2A 4C6PA 1DXIA 1XS2A 4PODA 4RZ5A 4A3QA 3SJ3A 2JBMA 2QCCA 3M0LA 4Y90A 2QULA 1DXEA 3RX2A 1H41A 1IIHA 3STPA 2QUUA 1JD7A 3AMKA 5CCZA 2ISFA 4IFKB 1W8GA 4ADTA 1KBLA 1S39A 4JTAA 3MWAA 3RCYA 4CQAA 4U5IA 3W1NA 1RH9A 3GNDA 4I6VA 3WQPA 1A49A 3P82A 3B0PA 1UR1A 3NSXA 2HQAA 3IJ9A 1W6TA 3THUA 3VMPA 3H2NA 2Y7FA 1MXSA 3OP2A 2PDYA 3BLFA 4Q3MA 2BASA 1P6BA 1FWFC 2ZWYA 3G8EA 4OZOA 1B30A 2POZA 3CB3A 5ECUA 1JNEA 1EC7A 3CYJA 1XQKA 4LAMA 1UZDA 1DJWA 4TUFA 5H1WA 4OGZA 1E6RA 3KRZA 3ISIX 1NVMA 3TSDA 4BA0A 2DP3A 2PDBA 4XIMA 2NZLA 1QBBA 3VOCA 2D2GA 1WE5A 1XYFA 4FNPA 1FWRA 1EO5A 1ZJIA 2GOKA 1PXGA 3XIMA 1Z32X 2POTA 4ONVA 3O9NA 3RITA 1XIMA 5GVJA 1J2WA 3WQ5A 1QJWA 1QNPA 2AGKA 4GY7A 3V5CA 1FVPA 4UOZA 1MEHA 3LCLA 2OQLA 3KDOA 2PTXA 3MHFA 3WSUA 1B9ZA 1R3TA 4JHOA 3V16A 3RM8A 4H04A 3C56A 2VD9A 2ON3A 5BRPA 3NQ8A 3CH0A 4QJ5B 2WM1A 5KSWA 2V2DA 4NUWA 1ODZA 3P67A 5ENLA 4INFA 3NZGA 3FVDA 4ZFCA 4DBEA 3AI0A 3POHA 2TYSA 4YS1A 4UFIA 3H2CA 2NLYA 4ILSA 4IIBA 3O6CA 1RHCA 4LBUA 2FHCA 2QCNA 4IFKA 3DECA 4Q8NA 2QUNA 3G0XA 3WJXA 4O14A 1UZ4A 3WDRA 2CLPA 5FIPA 3VOHA 4R7JA 4LOCA 1EXBA 1VYPX 3AXKA 3G1VA 5FJTA 3ZQ9A 2VC6A 4GIEA 3VM7A 1R30A 4WR3A 5FL1A 2GGJA 4TVCA 1R3WA 2VDGA 4QE5A 2WSRA 3SY1A 2BHUA 3WF4A 1VB9A 3ELFA 4KEMA 3L23A 2Q3OA 3OVQA 4C6MA 5HQMA 1RPXA 5HWJA 1J0ZA 1J0HA 3IVTA 1GJWA 4FOJA 1EPVA 1H7WA 3KXQA 5TF0A 1UBSA 3AJXA 1R3VA 1CEOA 1JCMP 4FR6A 4YTTA 1OF6A 4LF2A 1M03A 4DBWA 1TRIA 2DGAA 4UTTC 1UWAA 1QVBA 3LEPA 4JQ2A 1EDTA 1GVSA 1QOQA 1ONWA 3CZLA 1JVNA 3H7UA 5IBXC 2QNEA 3ARPA 3MO4A 4AAJA 4B90A 4X9YA 4FNSA 1X7FA 2CLLA 1H1ZA 1AODA 2AAMA 2CPUA 3LNPA 1JF6A 4FX6M 1FKXA 1DHPA 7PTDA 1JZ6A 1LOLA 5LIYX 2EPMX 4IP7A 4ZB5A 4B5NA 3DG6A 4JXCA 2VX5A 4O17A 4EK7A 2RFGA 4UB9A 4LSBA 3W7MA 4D1IA 2E0PA 3PFMA 2EF9A 5AHFA 4WF7A 3JR2A 3W01A 3T8LA 4DLFA 4ACYA 4J3XA 1MQRA 1UKOA 3NSMA 2DW7A 1GVFA 1KKOA 3N12A 7TIMA 1VC4A 5FF4A 5HR7A 4FXJA 3BMVA 2ESCA 3ZS4A 4JZ5A 5A6BA 3B0GA 5FL0A 1IQ8A 1JI2A 4A3YA 1U2YA 3DENA 1XM3A 1W2PA 4IIFA 4XBJA 2Y0FA 5CBJA 1QDSA 1KXTA 2J13A 1GOWA 1H7RA 4AB4A 1SR0A 2XFRA 4MDOA 3DYMA 3GU2A 1R87A 2CZ5A 2FHFA 3CMGA 4XTIA 4XD5A 3TCEA 3TSMA 4MNJA 1KM3A 1EWDA 3SCQA 4YWSA 1YPFA 3GTHA 3SZ8A 4PUEA 1TREA 4QSFA 1MDRA 3KRBA 3IIZA 2HVNA 1QNQA 1G5AA 4KPLA 2G41A 1NOWA 4KWUA 4ATLA 1E1CA 4UR9A 1TPUA 3UJEA 2JGQA 4I7UA 3CL7A 3PR2A 4EPEC 2BGNE 3OBEA 4XAZA 5FEZA 3MZ2A 3G3MA 2OCZA 3CAKA 3CEPA 4S38A 2XU2A 4W7WA 4IG2B 4FLSA 3RGTA 3IWPA 1YBQA 1FCUA 1ZBCA 3BOFA 3UEQA 2GUUA 4L1XA 5CG7A 3WD0A 1ZP3A 1J5TA 5CZKA 4EWJA 3VILA 4FEZA 4KCWA 3QY8A 3P2VA 3C61A 5BYWA 3IJQA 5D05A 1LRTA 4H7CA 1UR9A 2WMGA 4FA3A 3VOGA 5JH2A 3KRUA 3SUVA 4CD6A 2JEQA 4O0ZA 2CEQA 2VQTA 1W1PA 4QISA 5FF0A 3M41A 2HVMA 4JOMA 2ZC1A 2OLSA 3FDGA 4QG6A 3TYCA 2PTDA 1V6XA 3SCOA 1JIBA 3TTSA 3W1PA 1KFBA 2D1ZA 5HUOA 3CZKA 3KLKA 1XRFA 4LRTA 5L6UA 2QT3A 3WELA 2WW5A 4YVXA 3NQAA 1AJZA 3FAWA 3AIBA 2CBUA 3BCJA 3W76A 1EUNA 4JEQA 4YVVA 3SFWA 3QW3A 1JDDA 1H1YA 5XINA 4LANA 2RDWA 2GGEA 5DCBA 2VQUA 5EMKA 1E6ZA 4N9DA 5DANA 3W7DA 4R9XA 1QPKA 3EWUA 2HPIA 1JAKA 3W72A 5T9CE 3O63A 1V6VA 5KZ6A 1E4NA 2DFAA 2OSWA 3AJ7A 4DJFA 2Z7GA 1K02A 5A6TC 2VVNA 3LV6A 1OC7A 3A5VA 5G5IA 4DVOA 4E8GA 2FTWA 4JQAA 3MB9A 5DT7A 4OOUA 3WQCA 1X8FA 2DSZA 2ACQA 1XLJA 5IRPA 1BAGA 4A8IA 1H62A 3DKLA 4UXDA 2ZIDA 3AMLA 3VD4A 5T9BG 4L9XA 1SJBA 4M1BA 1KRMA 3CHFA 1WQ5A 4F0KA 3IRDA 3EX4A 2YDSA 3W07A 1GWJA 2VP8A 4O1CA 4ZGYA 3WEMA 2A4AA 5HOSA 2XN0A 3AYRA 5G4HC 2P1FA 3E6EA 5F4WA 3AICA 1QNVA 1AQHA 1E6QM 1JNDA 4OOZA 2ZQ0A 4AEFA 4BI6A 4HNTA 3NZQA 2J79A 4PCSA 3GDRA 3W6MA 3VKCA 3RLHA 1KM4A 4V33A 4FZIA 3ARZA 3WQVA 2YA0A 1LUCB 1XIJA 3LHZA 2VHLA 3QSTA 2NVAA 4Z17A 4HTYA 1TCMA 4HGXA 1WXYA 1G4TA 3ENLA 4W88A 3CUIA 4GO8A 3KBNA 1JUEA 1DJHA 4L4OA 1GYNA 4E6MA 1OWQA 2OEKA 3VNMA 1Q4WA 3C0JA 5AHLA 3W2UA 1NH6A 4KQNA 1I9CB 2Y7DA 4AF0B 3HPXA 5BW6A 3L0GA 4NU7A 3S2MA 5IXEA 5CZJA 7ENLA 4JIQA 3BVJA 2ZADA 4POCA 3CL6A 1F9CA 2HZGA 1P48A 2ZZ5A 1A0CA 4O12A 4LYQA 4DWSA 2WJDA 4HSHA 1M3UA 1HF6A 4RNIA 5EMJA 2OX1A 2Q8LA 2TAAA 4AYGA 1QUMA 2GEPA 2G3JA 4Q6JA 5G4EA 1XYCA 4XQ6A 2O4MA 2GLKA 1B4KA 2DZBA 1GTEA 4UMBA 4I90A 1FWSA 3QZ6A 1WOBA 1QPNA 2FPYA 5K9XA 2DPEA 1FQ0A 1JRCA 3RM4A 4J2MA 1ZUAX 1KFWA 3LCGA 2G4JA 3PWAA 3W1UA 2D2JA 4ZENA 3S1GA 1E73M 3ID7A 1XHGA 4HB7A 2DVTA 3EPMA 4GI6A 1JDEA 1K7FA 1SO3A 2BY3A 4N0RA 3FEMA 3UR2A 3S9YA 3LTSA 4PFHA 1FP9A 4TVDA 3CWHA 1KXHA 3GXDA 1VEPA 1RZMA 2WCSA 4RLIA 3CQIA 5DRIA 4GHRA 2QGYA 3TJLA 2OB3A 1CGXA 4NYYA 2ANUA 1E6PA 4PB4A 3RHGA 4WX2A 1QCWA 5D2YA 4JX5A 4MKSA 5I3HA 3S1WA 5H2ZA 2R24A 3V4BA 2DZTA 4FLQA 4AY8A 4DI8A 2XWDA 3DKJA 1J4EA 3IAPA 3EWXA 3N13A 2E09A 3IS4A 1R2SA 1CECA 1D2KA 3ZLGA 3RNDA 1BG4A 1NM9A 4ADSA 4I9TA 4QAWA 2HXUA 5FF2A 3W7KA 1W5OA 3RMJA 1U1UA 3N29A 1CB7B 4M8UA 1EQPA 2OLAA 2J75A 7CGTA 3F7JA 3FCPA 3O2LA 4JS3A 3M5XA 2ISVA 1XQLA 1UWIA 2ACSA 3QYQA 3UZWA 3PVFA 5M2FX 1R7OA 2XYLA 3URAA 2DSVA 4WY0F 2FGLA 4KT2A 4P7OA 5FD0A 2Z1WA 3R7MA 4IZGA 5K9DA 1IZCA 2IXVA 3SW6A 3W1RA 4MG4A 4GQQA 4IQJA 3K1GA 1KWKA 3MMBA 3SIMA 4O50A 4WRHA 4E3TA 3W29A 3L2IA 4GFIA 1G67A 1QHPA 3P84A 5BCAA 3F4DA 1PTDA 3N6JA 3K46A 1AZ2A 2PCQA 2VM8A 3N3TA 4H6KA 4A8LA 2BLEA 4FF5A 2Y61A 1ISYA 1EYEA 1ZU8A 1H7PA 5DY2A 4AXNA 1HGYA 1QNOA 4M6PA 4HHLA 1Z44A 1SSGA 1PHQA 4KGJA 1S2VA 4PMZA 2Y70A 4HNNA 3VGGA 4JTQA 2BGQA 3WFZA 3VDBA 3WN6A 4C7DA 5JIWA 1KFCA 1TWIA 3CBWA 1UC4A 1YRRA 3WL0A 2IPGA 1IGWA 2CBJA 1T99A 1H5VA 3W4RA 2QZRA 3NL2A 4Y9NA 4BFAA 4DYKA 3K4AA 2WZIA 1TTPA 1XGDA 2PCEA 5A6MA 4IH3A 1KNWA 3LTYA 4EOUA 3TLQA 1H7OA 3HG3A 4DJDD 2PD5A 4IPPA 4PTXA 3VE9A 1GQJA 4J1OA 1ADDA 1J6PA 2QHAA 4F0HA 4AZBA 1V6UA 1KRAC 4O28A 3N2MA 2XSXA 4RJEA 3MM5B 3HGRA 5A6KA 3MP3A 4D6IA 3HURA 1I2QA 3TVAA 2RDXA 4OKDA 5FF3A 4CQDA 3P5YA 1MNSA 1L8NA 4EXBA 3LPPA 1RY0A 3ORWA 3U8GA 2HV5A 4MWAE 1KXVA 3G24A 2P8BA 2W67A 4UTIA 4OUEA 5FCZA 1AW2A 1JPMA 3HFTA 5FKYA 4ERAA 2B4GA 4Q8WA 2BGSA 3NM1A 2J7CA 1NWRA 1HXJA 1EGMA 3SM0A 1TPVA 1AJ0A 4NJKA 4PTMA 3FAXA 1S3TC 3NJ3A 4KCTA 3MDWA 2YJQA 1WBHA 2D22A 1M7OA 2Y8KA 4ZOEA 2YL9A 3DAQA 3GXNA 4IL2A 2IMRA 3FK4A 3CM4A 3DI0A 2J88A 3PZOA 5LYRA 4QLLA 1W8SA 1EJ7L 3AS0A 2ASHA 4B15A 3C2YA 3GR4A 3CZGA 1JXKA 3EWYA 4J3TA 1H50A 3IEBA 3KBMA 2Z2UA 3TYZA 1E5NA 3SADA 3FIGA 2INEA 4OU1A 2DT0A 2V5BA 4J4KA 3VIOA 2BG5A 1V79A 1QO5A 5KMYA 4RNJA 4A3HA 2FH8A 2VFDA 4K39A 3BANA 2VCAA 4IP5A 3GE7A 4LYRA 3MMTA 4PUWA 1UR2A 3CZEA 2GFTA 2ALRA 3PZTA 1NY1A 3GG7A 2W62A 1ZPTA 4LALA 5DX7A 4B92A 4WKHA 3EWZA 4HPNA 3QOKA 3VGDA 5LNWA 3VYLA 4JIEA 1E5JA 1QI5A 3AFBA 1Q6RA 3EWDA 5FF7A 4M24A 1UPMB 4AY7A 4WDWA 2A0NA 3ZSTA 4I7VA 3VKPA 2Y1HA 1SZNA 1K70A 3W7RA 3VD7A 3FYPA 2Z1SA 2VELA 2VJXA 3LRKA 3SN1A 5CKSA 2WZMA 4ICNA 4X0VA 2WMIB 5BZAA 4H6EA 1S1PA 3VM5A 3PC0A 5CPSA 4DF0A 5JXQA 4AC7C 1CT5A 3EDFA 9RUBA 4Q8UA 3IJ7A 3HPZA 5CAHA 1VGAA 1O60A 3UCDA 3SEPA 3F5KA 3NZPA 3UESA 3I65A 2GZXA 1EQCA 4D6FA 3ONBA 4GXWA 4PYSA 2UWFA 4GY0A 1TTQA 3U7VA 4Q8VA 1GJPA 3PUOA 2J77A 1TWSA 3W22A 4D2JA 1FWHC 3P7YA 4HYWA 3VIMA 1S2WA 2CZDA 2J8GA 3QVQA 4MNMA 5HNUA 2XVPA 1OFRA 3HMCA 1TZ7A 5G4WA 1FFQA 4REQB 4HD5A 1XYLA 2J9ZA 5DELA 1JJKA 3T1GA 4ALDA 1XFCA 4AUBA 3T4WA 5LNVA 1EDQA 5HQEA 3VI2A 5A69A 1OD0A 3BW2A 1BGGA 2Y85A 3HJZA 4KRTA 1MMFA 1X98A 4XO6A 2VUYA 4RPPA 4B3KA 4J5NA 1DWJM 1T6MA 3IV8A 2YCKX 2NV1A 1ZHAA 4JKLA 4LH8A 3CUGA 1C8QA 1W1IE 3EXTA 3PZGA 2Z28A 3MWCA 4C6LA 3CGTA 3GH5A 3KTCA 2AOSA 3PBUA 3OHIA 3F2DA 3T0AA 3K1DA 2CKSA 1A53A 1QFEA 1AOPA 1XLGA 1S1RA 2DZXA 2Z6IA 2O55A 5F2LA 1JCJA 4H83A 1KB3A 3FA3A 3KZSA 3VC5A 4F48A 2GGIA 3R11A 3QBUA 3S6OA 3BGGA 4RDYA 1O12A 1XRVA 4IMDA 5A8QA 4UZSA 1O1HA 4WDXA 3VDGA 1U1JA 1PYFA 4DPPA 1EBHA 4RW3A 1Q7MA 1EWEA 3T42A 1HKKA 2X2YA 3GNNA 2D0FA 2GSHA 5H6HA 3AO0A 2P3ZA 1KLYA 2ZE0A 4GH3A 2PDMA 4CCZA 5F7UA 2A3AA 4QDWA 2HWGA 2ZUUA 1KQZA 3Q58A 3QGAC 4LUJA 3WK1A 2NQJA 4CNTA 2XGIA 2XTKA 4U3CA 4PEEA 1UQYA 3LRMA 1ESWA 2FGZA 2EQDA 5CZSA 1FHVA 4RZ6A 2PB1A 2NLIA 5D33A 3W83A 2FDSA 4Y96A 3B97A 3QH2A 1AZ1A 3GWQA 3UWYA 2Q71A 5CXPA 2PRHA 3GTFA 4DF2A 1WA3A 2PU1A 3AMGA 4WJEA 2PWHA 3NPXA 2I5GA 3DFTA 1HJXA 5ABHA 1SR9A 4MYAA 4BHYA 1NF7A 3CIWA 1X1OA 4UOJA 1AH0A 1O5XA 5CPQA 2PUZA 3LDVA 1DJGA 1QXLA 3CJPA 3HF3A 3FJLA 4HIBA 2P10A 3QY6A 3SCRA 3KOFA 2X0HA 1DP0A 4ACZA 1VFLA 4YL2A 5DMMA 2FHBA 1K03A 4AC1X 2E4TA 2XVLA 2G3NA 3MMBB 1LG1A 4D1JA 1TCDA 2HXTA 2WO5A 5GJNA 3BARA 4EACA 1I2OA 5C2CA 3AUOA 3AALA 2ZVRA 3G1XA 4LRSA 1US2A 4MDPA 4DI9A 1E6SM 6ENLA 1V3HA 1DHKA 2YXXA 3B9AA 3FW6A 2C0AA 4L5ZA 1ITXA 2BHZA 3F2BA 5EY5A 3RN6A 3KCLA 1YDYA 1KGWA 4TV5A 3LGGA 2DDXA 1OFDA 2ZZ7A 4IMEA 4KCUA 1ADSA 2PZNA 3BGJA 3W7HA 4JN7A 4ZOAA 3CWOX 3R94A 4HNLA 5E6ZA 4QQUA 1XIFA 1UD8A 5HULA 3LCWA 2YW3A 1JEZA 3L12A 3CIXA 2ACRA 3KUMA 4ZB0A 3K5XA 2VMFA 4HYVA 2Y24A 1DWHM 3CT2A 2YL5A 4GUIA 1QW7A 2P53A 3GIPA 4US5A 4Q22A 4YTSA 1MYRA 4DO5A 1E0TA 3GZ3A 4QJ4B 4F66A 1BFNA 1LLOA 2E5BA 3WLQA 2JKPA 4DJED 2Y7EA 3ARWA 2Z00A 2BX7A 3BSHA 4C6QA 3NYDA 2QCEA 5JUVA 5EGRA 3RF9A 1QBAA 1UJQA 2GQ9A 5H91A 4MKNA 2DJLA 3AMDA 1C7TA 1J6OA 5CSRA 4LEFA 5LIUX 3W7JA 1OM0A 4U33A 2D0HA 4XIAA 4ZA0A 5I3FA 2VFIA 3TWBA 3WNKA 3CHVA 5D8WA 3OOQA 1RP8A 3ZO9A 1YXDA 5D2WA 2EG6A 5A8PA 1PVNA 5CG0A 3AS3A 3LSCA 4JTTA 3I3DA 4C6KA 4DXKA 4N7QA 3SJNA 2ISWA 3TR9A 4I5UA 5BXSA 2XIIA 2IKJA 3GDBA 3AUJA 3MUXA 3TFCA 1NOFA 2E77A 3UD6A 1O66A 4L4MA 4S3DA 2WNQA 3FVMA 5CEWA 1QRQA 3CLWA 2GJRA 1MEWA 5M3WA 3DH7A 3EOSA 3U9IA 3FN9A 2HK1A 4IX0A 4MAZA 1NFBA 5IDIA 4M80A 4KFOA 2WZHA 4YXGA 3C86A 3T78A 1K4HA 3TA6A 3P3BA 4NX5A 5HMDA 4IWWA 1OSEA 3LTPA 1TTJA 2R9RA 3T0TA 2WVVB 2XISA 3N4AA 3LU2A 1FWDC 2B31A 1TTIA 1PCKA 5CC7A 4AD4A 2FQIA 4GVIA 4DF1A 3TOPA 4HN4A 3QQ0A 2Z1XA 2WWCA 4Z2IA 4I9MA 4WSKA 2YB1A 2H6RA 1DJNA 2J7DA 5TQLA 4U31A 1NQKA 3W75A 4DUVA 6A3HA 1Z3NA 2OQHA 2PLCA 1UWSA 1QK0A 2J7EA 4J3WA 3KBWA 3DXIA 3MMAA 3TNOA 3G1YA 2QQ6A 3BE7A 5AZ0A 2Q02A 2ZRWA 1VFUA 2RGLA 1UUMA 1I45A 3FSUA 3NL6A 3PUDA 5DF0A 1M9HA 4JTHA 3KHJA 2F7FA 4GG9A 4K38A 2NW0A 2XVGA 2FJUB 3PTMA 2E6DA 3OEXA 3L4ZA 4LQ1A 3CV2A 1DWAM 2X1IA 4NZFA 1QATA 1SJDA 4JTLA 1GONA 4QS6A 1F3WA 4D8AA 3AIVA 2BVWA 3TA9A 1PIGA 1TQJA 5EYWA 3NNTA 1D3CA 1E51A 1XIGA 1RR2A 4L4PA 2ZXDA 1FWJC 2VRKA 3KOYA 3PPFA 3N6HA 4IGNA 3K8LA 1A5NC 1XRSA 3GG1A 3B8DA 3ARTA 3W53A 1Q45A 5JBDA 1GGOA 2V5CA 4B16A 3ZXWA 3P0WA 2D23A 3KFTA 5A95A 3N4FA 3AZTA 5EMYA 4NNCA 3GHUA 3PB0A 4H3DA 1R9XA 1PKLA 2HTMA 4DB7A 1C93A 3S1XA 2G4FA 4P8VA 2BVDA 4PCTA 3B8SA 3CPUA 4GNKB 5E0FA 2I16A 1KQYA 4EX4A 4BR1A 4CD7A 3S5NA 2V3GA 1HL9A 2HJPA 1V0NA 4BF5A 3BURA 3A3XA 2VCBA 2Y8VA 3N25A 3DERA 3IANA 2GK1A 3AYTA 4GCAA 3TEVA 1J0JA 3ALGA 2V3DA 3AXXA 4UTHA 2FMOA 3BAYA 4I8YA 3UW6A 5E93A 4H1ZA 3SCTA 1V02E 1XLMA 3I3BA 1DPMA 4J9JA 4IXXA 1EJUC 3KOXA 5REQB 3WDHA 4PRWA 2G8ZA 4DWSC 3ZJKA 5LIXX 2BXZA 1O4UA 4MLJA 4DUOA 4N2YA 1XLFA 3BJTA 5D32A 2H8ZA 4WK9A 4LEQA 3UNTA 2OZ8A 1B3OA 5IOBA 2ZDRA 3VX1A 1HW6A 1JXJA 3WENA 5MKGA 1VAHA 1REQA 2YZRA 4ASTA 3KLLA 2A7RA 5CSYA 1TWDA 2O0TA 1QHZA 3UXIA 2XIOA 7XIMA 2VGFA 1DIOA 2GDQA 1XG4A 3UNDA 4AY1A 3N18A 3WNOA 5JH1A 3BL3A 3E12A 4S1FA 3H12A 3EX1A 5D30A 4N4PA 1GG0A 2F9RA 2G5WA 2C6QA 4YCPA 4JTFA 3H21A 4W8BA 4HVXA 1V08A 3V0SA 4ORMA 2ZXAA 1LYXA 5FJOA 4J28A 1FUYA 3KBSA 4HBKA 1QWGA 4HNVA 3NO3A 3DC0A 1A0EA 1FDJA 3GD6A 3O8AA 2V6AA 1AMKA 3T2QA 2NQHA 1T0OA 2WHJA 3QPYA 4Q7BA 4GINA 3SUTA 4IMFA 4RUBA 1Q2SA 3HG2A 3HBLA 1ISWA 4JFSA 4NAEA 4C7FA 4GK8A 3P5ZA 2VDIA 4O8AA 3UG4A 2RJHA 1XLHA 1CGWA 3OYXA 4KETA 3U4AA 3CASA 4W87A 2XVNA 2XG9A 4QLKA 7ODCA 3GXMA 3B0JA 3E0IA 3RUBL 3UZXA 4G7EB 3FNDA 4GJIA 4XZMX 3LPFA 5LIKX 5CSUA 3A4XA 2D69A 1O6IA 3II1A 2XH2A 4QNEA 4E0CA 3EBVA 3PPGA 2FTYA 2X0YA 3T05A 4QM1A 1BVNP 1NOUA 4D6GA 1EEXA 4YYFA 5A94A 3HJEA 4PMYA 2BDQA 2Y4SA 4DBSA 1UD2A 1FKWA 2HE5A 4C5YA 1XLIA 4FB7A 2DZUA 1I2RA 4DO6A 4M81A 5XIMA 1IT0A 4Q8OA 4LUTB 1WXJA 1LM1A 2YZ5A 2DIJA 2PDHA 2JIEA 3TYAA 4Q4SA 1RVKA 1BWLA 3TYBA 3W28A 2ISSA 4DXVA 1D8CA 3GXTA 2OYKA 5LA2A 1EIXA 1W5PA 3QR1A 4CLMA 1Q85A 1R3YA 3C5QA 3E2VA 4HU0A 2NT1A 1XG3A 3GLCA 5DRCA 1YTKA 1ONXA 2WVUA 1GQLA 3QMTA 3NWRA 2O9OA 1TV3A 2ZXQA 3WO8A 3OR1A 1FFRA 3TW9A 3WBYA 4AZCB 2GDUA 4MGGA 2ZX5A 3A22A 1A5AA 3MS8A 2QXWA 3LERA 3ANVA 2Y5EA 3S9ZA 2QCLA 4FALA 3WDQA 4H8VA 4UBPC 4Y9PA 3LLDA 1UUOA 5EU9A 3WDIA 2PDFA 1XYZA 4MY8A 5CC6A 3RFAA 4EF8A 1U22A 4Y8FA 3VCCA 3L2LA 1SQ7A 1UWUA 1W9XA 4R33A 5EKYA 4ML4A 1VEMA 1RK6A 1IWAA 2Z2AA 2NSOA 1VBJA 4GYPA 2WB5A 3PULA 3MO7A 3KTSA 3VO0A 3OLEA 3Q67A 3M1ZA 4DLMA 5M1TA 3RLUA 2PDWA 4MKVA 3VNLA 2R1NA 3L4XA 4DY1A 5D9OA 4QLJA 1SFTA 4RV3A 4XAYA 3GYEA 3AS1A 3MP4A 1ZJAA 5I06A 1A5SA 4RW5A 3DX5A 5F2MA 2A3EA 3QFWA 4RDWA 4D6HA 2ZUVA 3THAA 4R88A 2ZA2A 4LV4A 4GVHA 3R25A 3OLIA 3NOYA 4DYJA 1C7SA 1UA7A 3UZ5A 3KP1A 4PMNA 3CQKA 4RE0A 4DJDA 3QOMA 5LHFA 4CUCA 2XZ7A 4TU1A 1VR6A 4GMEA 4AIBA 4FIQA 1LLZA 2AKJA 3S46A 2ZTKA 1OB0A 5GJMA 3TW6A 3BK0A 4JFWA 1JCNA 2DZAA 4Q7IA 1SYTA 1GVYA 1O7AA 3GW0A 4FF7A 1BYBA 1FH8A 3M7WA 3MM9A 5F1VA 4C1LA 4PL1A 3T9PA 5FSDC 2G3FA 3PB2A 1UP0A 4HZ6A 4O1AA 1XH0A 1KGXA 1FRBA 1WDPA 2X7VA 3E3HA 4A05A 1PV8A 4UFJA 5G1TA 3KE0A 4U28A 3L68A 1KV8A 1L2QA 5TBOA 2ICSA 3WZ0E 5GEPA 2IPFA 4OUIA 3OYZA 4ROQA 1EH9A 2YL6A 4UQ9A 3AZRA 2QCDB 3M9YA 3TE9A 3HQ1A 3LNMA 4JL2A 4UZUA 7REQA 4EPBC 4O13A 2YB4A 3QHNA 1YTDA 4MUZA 3OZPA 2J27A 4UTTA 3KBJA 2CITA 1HX0A 4L65A 4XSLA 5ABTA 2QR6A 4L56A 5G1MA 3ANUA 4PSPA 5E09A 5FAGA 4WXZA 2W5FA 4MHBA 3UJ2A 2VFGA 5FOOA 4ICCX 4GQBA 2OPJA 1TX0A 1OFEA 4ZZ9A 4ZXOA 3F4CA 4MJ2A 2WMFA 1LTDA 2A21A 4AD2A 1EKOA 3RIKA 3ABRA 1YNYA 3WL1A 3DGRA 1DJXA 4DBDA 4XZIA 1BSIA 4AMCA 3L4WA 2Y89A 5BXPA 4ZBCA 3B4UA 2C13A 4WHBA 2BVYA 2NXGA 5ABFB 1CGUA 3WD3A 3ZFHA 3B9EA 4R5EA 1ME8A 5DEZA 1VFSA 3QTPA 4I9AA 2ZDSA 3P6LA 1BWVA 4XD6A 1BYAA 5ABGA 2D73A 2B7NA 4BS0A 4M6VA 2YDRA 2O7SA 1KCZA 3NQ2A 2PC4A 1P43A 4N6FA 4QCFA 5AVNA 2DW6A 3T8QA 1ENUA 4MB3A 3H2EA 3KOWA 1KD0A 3EAUA 4CD5A 1JUBA 1LROA 3KCJA 1R9ZA 5K9CA 1LL4A 1W3KA 3BG9A 4LYKA 1Z42A 3NCOA 3NPVA 5HDRA 2AKMA 2FZMA 3WQGA 1O94A 3WJYA 5CQ1A 1JCYA 1T41A 1PL9A 2B0MA 3QHMA 4JNZA 3MU7A 3LQGA 4UMAA 3BUVA 3ITLA 3ZZ1A 1JDFA 4Y2WA 2PDJA 2R1PA 2WLYA 3UR8A 2QDGA 4TOQA 3W1LA 3N3MA 5REQA 4CEUC 3VOIA 2MNRA 1LWIA 1XICA 5I7GA 3RO8A 4GI8A 5IFTA 2QAFA 3HPAA 2VRJA 2ZBTA 1I6NA 4I3GA 5I03A 1VZWA 2E9LA 1YADA 3UGVA 2OO0A 3ITGA 1L6SA 3GVVA 3DESA 3FYYA 2Z7KA 3WH9A 3G0UA 2QDEA 2PPGA 3PZQA 4TQTA 4AVNA 3AIUA 3MJYA 4KWSA 5C7HA 2OOGA 4MZ8A 2RH9A 3GW3A 2J74A 3AHZA 1YQ2A 2JALA 2D2HA 4M19A 2TPSA 3NURA 1UIOA 2PWFA 1HIZA 3PANA 4XG1A 1IYXA 3MM5A 3VD5A 4G1KA 3U2CA 2D3LA 2OT1A 3TTYA 1S2UA 1X8CA 3JZUA 1NEYA 3GTXA 1K3UA 3IIVA 4HZMA 2AAAA 1W3IA 4R9OA 2EPOA 2WYSA 3PY2A 4O57A 1BLIA 4HOWA 3LLFA 1ZL1A 4V27A 4LBRA 2HMCA 1AVAA 2GJPA 2ZE3A 2A7PA 3LLXA 3NQEA 3NOEA 2DZWA 4U4MA 1W9VA 2BMBA 1Q7ZA 2TRSA 2H3BA 5FEXA 5LIWX 2CLFA 3M0ZA 2XIMA 3F4NA 1EJVC 4R7OA 4IPIA 1UD4A 3BPWA 3N9KA 1ONRA 3S2JA 1JULA 3ZLHA 4XSMA 1JCLA 2C79A 4AHQA 1UZHA 2GUBA 2YCLA 4ZODA 1ZJHA 4GH1A 1FWAC 2EG8A 3TC3A 4X22A 2P8CA 4C6NA 4G9PA 4X2PA 1E3ZA 3LPOA 1V0KA 1RQHA 3NL5A 1PTAA 1KCKA 2YYTA 4AX6A 1JFHA 3NQFA 1NU5A 5I5RA 5CC3A 1JG9A 1B57A 2WPGA 3GK0A 3GY1A 1Z41A 4JR5A 1FH9A 3AHXA 3ZWSA 1PE1A 3MCNA 4IL0A 5D03A 1XSKA 2QF7A 1FCBA 2CU0A 2O92A 3SRKA 1TR1A 3UWVA 1M7PA 2W63A 3SN0A 4RR4A 1NTHA 2CHRA 3WNNA 3QGVA 4JL1A 2QV5A 4CCCA 4Z0JA 1OCQA 5D9NA 5A2CA 3OVPA 1UOKA 1MRAA 3U5YA 4PBGA 2J7HA 4W93A 3KVMA 1VCFA 3VNZA 3T0DA 3CUHA 5E6YA 2VX4A 3V75A 2OZ3A 2NVCA 5CZTA 5KETA 3O05A 1BD0A 1HVQA 5JIPA 4DJFD 3MVIA 1U30A 2C1GA 3UZJA 2DH3A 5AYXA 3EDEA 3MM8A 3TYEA 4K6AA 1ZCOA 4PEKA 3GH7A 4JDBA 1UROA 4MWAA 4K8HA 1NWSA 2W91A 3QFEA 3LRLA 3ZR4A 1N8IA 3VKDA 4LS1A 1A5KC 4IFOA 1RY8A 2VR2A 2VI0A 5K3VA 2CLOA 1SSDA 2FJKA 4HPJA 5DBUA 3RCNA 3F5LA 2V68A 1W9DM 1UPPA 5C9WA 1DJYA 4AZ6A 1O5KA 1PCWA 4M82A 4G38A 5HR6A 3EXRA 3BG5A 2R14A 1XWYA 3TWAA 2F6XA 3VA8A 5FA5A 2OSYA 3STGA 4GLEA 3E2QA 2QJJA 3RMEA 2YXGA 3S5SA 3U3HA 4C1NA 2DT3A 1MWOA 3CO8A 3EPNA 3SURA 4ZQNA 1V8EA 2Z2BA 2A79A 2BVTA 2HNHA 1HL8A 1ZP4A 4XK2A 3HN3A 4DJFC 4HOZA 4E2OA 1TZZA 4OBSA 4JBRA 2DZPA 3W6YA 1VJIA 1DQXA 4MNLA 2J78A 1JQXA 2GL5A 4ACZB 2I17A 2O9PA 3BOLA 5C54A 3RX4A 4WKFA 1DJIA 4PUKA 2FTPA 2TMDA 3OG2A 1K6WA 1AQMA 4NAEB 5G2WA 4HHPA 3SCNA 3IUIA 3R8RA 4IXHA 4W85A 1PKMA 1F8MA 4L9YA 4LPCA 3WBAA 3W26A 1N2VA 3L67A 4HHMA 1WXZA 3WMBA 1F74A 2REQA 2FDMA 5K4XA 1ZJBA 1JZ5A 1P0KA 1W3HA 3UJRA 3CTLA 4PUNA 2NQ9A 3DC8A 2FH6A 1EUAA 3M0HA 4IGSA 4NJJA 4ZB2A 3D47A 5H8PA 1L6WA 4ERGA 2WZEA 3NR0A 3ALFA 2E7FA 1BGAA 3UA4A 1WKEA 5EB8A 5FEWA 5AHEA 2XFYA 4H2HA 4G39A 2WKJA 3W37A 2BY2A 3MV01 2BWGA 1K7XA 1VRDA 5EMUA 4HSNA 1CXEA 1ZAJA 4JTJA 3MP5A 4AWTA 1QPRA 4TIMA 2W4XA 4JY8A 4KF1A 5GPRA 4FAMA 3TAKA 4LUIA 3STFA 1UUQA 2JKAA 1W5MA 1V3IA 3OU8A 1J0IA 2JGYA 3OTRA 4LAUA 4WOZA 2BY1A 1J0YA 3OZYA 4WJ8A 3MA8A 2MUCA 5JMUA 2W61A 5HBFA 5I3KA 1U1HA 4XISA 2DORA 1DWIM 3MBFA 1MUWA 4FOUA 3QLLA 1XC4A 3UCCA 3M0YA 1LOQA 3I6RA 3UR7A 5HNTA 1EO7A 1A5UA 3GXFA 4QR6A 2OEMA 2XN2A 2FZNA 1KBBA 1LUCA 3TMQA 1GTHA 3R0UA 5D2XA 4NZJA 1QT1A 2E8ZA 4LBSA 5HJXA 4E8CA 2UY3A 3VU2A 5D38A 3ERPA 2PWUA 3SO7A 2HVOA 2ZZ6A 4ATWA 1JPKA 3KS5A 2WCGA 1VJSA 2BS9A 4I6KA 2G50A 4Z0SA 4X0NA 3FY1A 1PIFA 3DFYA 3B03A 2FMNA 1CXKA 2NUXA 3GHSA 1BHGA 4PB3A 2C71A 2L5HA 1E6NA 2XSBA 3AMCA 2A85A 1B3XA 1ZGDA 5I00A 2NQLA 3V0UA 3WK0A 3NVDA 4DUWA 4QJ1A 1PAMA 2V9DA 3AQUA 2PLJA 3IGSA 3QEZA 2PTYA 2Z24A 4QP0A 4J7RA 1X38A 2VYOA 4JTIA 3ZM8A 4QFUA 2VZUA 3M16A 4P8XA 3ZWTA 4NASA 1XC6A 4ADUA 1POJA 5DMYA 5JVLA 4YNGA 1LBFA 4K2SA 2JFEX 1A3WA 1RCOB 1A47A 2YLLA 3FHQA 1D3GA 2GVYA 3WLLA 2X42A 1XW8A 5FACA 5LNUA 4A4AA 4EXAA 3ZMRA 3GIYA 1W9BM 1ZBVA 4H8UA 3WQ8A 1VFTA 1EPXA 4AW7A 4ICMA 4H8HA 4Q8QA 3E0LA 1DWFM 1GJUA 2HS8A 3GTIA 1EA0A 1Q7QA 4EVZA 1X97A 4CN1A 3BDKA 3M0JA 3ITYA 4GABA 3DBNA 4WUIA 5DO8A 5SWUA 3IAQA 1ZJ8A 5A8MA 2ZCGA 5D37A 1MUMA 4HTBA 1XLAA 4AIUA 1OK6A 3CV6A 3GH4A 1B31A 2OR2A 4YHEA 3ARRA 3JS3A 2QGHA 2ACUA 4H9YA 3CQHA 4WSJA 4AEOA 3J7HA 4FNRA 3INPA 4F8XA 2HISA 1K9EA 4PMJA 3PUEA 9CGTA 3CT7A 1Q5MA 4RE3A 1OYAA 1CB2A 3UP8A 2BBFA 3RPMA 1G6CA 1E1CB 2PD9A 3CC1A 2OLHA 1GOIA 4H00A 3WQDA 3AHTA 1F07A 1XI3A 2YIHA 1TWWA 3SQLA 1PX4A 5G2HA 3TV8A 1YXCA 2ATSA 3L5MA 3WUBA 1M1BA 3KWSA 2CBIA 1F76A 2E28A 2GPTA 4U2ZA 2D24A 3NDOA 1G7VA 1EDGA 3SBFA 3MW7A 1J0KA 2V30A 1LWHA 3LA4A 4AX7A 4UFLA 2J4GA 3N2TA 1XLLA 3LBOA 9XIMA 3U57A 3M0XA 3TUUA 1I0DA 3GYCA 3IVUA 3I7QA 4AVOA 1Y7VA 3UF9A 1W3NA 5IHRA 1N82A 1E72M 1E9ZB 1L0PA 4BCEA 3HGOA 2BY0A 5LGZA 1WDDA 2GVLA 1MW3A 1V6WA 3TOYA 1JZ3A 1FY6A 1XX1A 3FEQA 1VIZA 2PFHA 3C0SA 1H7XA 3IK2A 4NSBA 1OX6A 4M7TA 1FHUA 4Z1BA 4MOZA 1SMDA 2IW0A 2RGMA 3ES8A 2ISDA 3HPSA 2A3BA 3DYPA 1FA2A 4YIWA 3W86A 1HP4A 5HINA 1W54A 4J2PA 1EC8A 3RPDA 3LXAA 3R79A 4QXIA 3G3DA 1RBLA 4XO7A 1IR1A 3MMWA 2Z0IA 3HFYA 4OT7A 3D6NA 3GNOA 3I7SA 8XIMA 2HK0A 2NVDA 1XJBA 3GKFA 2WNZA 5A8GA 3LS9A 1EGZA 4GUFA 3ZVIA 3TN6A 2X09A 1LRQA 1IIGA 5D4YA 3M5ZA 2IKHA 5CSSA 4ZO9A 3R1ZA 3VINA 3UGRA 1DIEA 3H23A 3WIJA 2J9YA 5CBIA 4JTEA 4OFCA 2PDQA 1KM6A 3HV9A 3NQMA 6ALDA 4ZQPA 5B7YA 1S3HA 5E70A 1JYWA 4Q7NA 4CU7A 3LI1A 2V5KA 2B7PA 4HMNA 3E74A 2PS2A 2Z6JA 1OGGA 3GFYA 4CCEA 3CNYA 4DIAA 3DFHA 2QCHA 4DM2A 4PMXA 3AIQA 2GWGA 4IPJA 1K9TA 2HS6A 3BV7A 1UHVA 4P5UA 4AD3A 3EMQA 2O7QA 4FHAA 1XISA 4AIOA 1FHDA 3USZA 3TAOA 4CCDA 2EKGA 3MQTA 4XZLX 1YNPA 5FJRA 3CXOA 1A5OC 2V5JA 3WFLA 3L5LA 4EF9A 1JYVA 3UPMA 1JGIA 4Q4PA 1LP6A 3QPEA 4WQ6A 4YJ5A 3TONA 3AHVA 1VYRA 3C2VA 4MMWA 3SR7A 3TQPA 3OGVA 1FXQA 4A21A 3UCQA 3REQB 3KL3A 4WY0A 4DEFA 4OQVA 2P50A 4P7LA 2QUMA 2Y62A 1VFMA 4EAYA 3UVIA 4O1DA 3HQNA 2WSQA 1PS9A 2V81A 4BQ4A 1XLCA 5BMWA 2AMXA 5CJNA 4G7FA 3W2NA 2PDNA 1T40A 3EYPA 2AL2B 4RZ4A 1QNRA 3ME3A 4YTQA 1VRXA 5LNSA 2W79A 3CPRA 4AF0A 1RPKA 4Z08A 3MI6A 3EB3A 4GVGA 1AFSA 4WJXA 2PU0A 3A13A 3M44A 5BOOA 2SFPA 4UQBA 3B4YA 1OCNA 5E5CA 4LGXA 3MM6A 2FZ8A 1VP5A 3N2OA 3KS6A 4HK6A 1HJVA 1FP8A 4D6JA 3OLGA 1R2TA 3QHOA 3AU2A 1W17A 2AMGA 4M29A 4F2UA 2BXYA 3PAOA 3B8VA 4TX9A 4JQ4A 4UC5A 4RE2A 4R3UA 3WF2A 3GFZA 1I2PA 3S42A 6PTDA 2YFNA 4E4UA 1F6YA 3OGRA 1DIDA 2CIPA 3MI3A 3NEHA 4GC3A 3SSJA 3KDNA 1H4PA 2AOPA 1LT7A 3G6LA 1W1VA 2Q6ZA 3RK8A 4JTRA 1VQTA 2X2GA 1J9YA 3EGJA 4AZGA 3L4YA 4GISA 1EOKA 1BSLA 2PRMA 3HG4A 1OFBA 3JU2A 1GVOA 4YN5A 4C60A 1G4SA 3A5FA 3DFNA 4S3FA 1VKFA 3B8TA 2QVHA 1A4LA 1MQQA 1CXLA 5JQ9A 3UFYA 3RU6A 1NP2A 5DXYA 5FESA 1K8XA 1KA9F 3LOTA 3C6CA 2WBGA 4FNQA 1NARA 1XYMA 1ML1A 2PWDA 1W1TA 3AROA 3ZVHB 1WO2A 1QAPA 5DMNA 3AXIA 1GKPA 3BWWA 4NF7A 3W1XA 4CNSA 4QDMA 1TVLA 2AL2A 3KP0A 3B05A 1NDYA 2ZRVA 5KITA 4BWLA 3ZJ6A 8CGTA 4MFEA 2ABBA 3LSBA 4RDZA 1F3TA 3QMSA 4ZOBA 3EXSA 1JCTA 1WAWA 3MM6B 4F9DA 1OFPA 3BLIA 4NY2A 4F4RA 4GC4A 4AZIA 1GEQA 1OYBA 1UKPA 1QMLA 2HSAA 4XX6A 3O06A 1TJPA 2VKZG 1XF0A 2E6FA 3MM7A 5JBEA 4FX7A 3EOEA 4QSHA 3SSZA 4NL1A 1Q2RA 1HNYA 2DT2A 2DSUA 2FFCA 4WD0A 1DV7A 2E6AA 4JGDA 5I77A 5BWFA 3GG0A 1RJRA 2WV8A 2GK1B 1JYXA 3C8FA 4O19A 3OQEA 1E55A 2VOMA 1ZY9A 3F03K 3STEA 2Z4GA 3C2EA 2OOFA 3LB0A 3R12A 4XV0A 2WHKA 2ZRXA 1I75A 2X40A 4NIRA 2CLHA 4QJ3B 4JX4A 2ZXBA 4B5TA 3BICA 3AZSA 2XPKA 3DUGA 2H8XA 2V4JB 4K8EA 1UWRA 4LY4A 1OT2A 1W9PA 2WKGA 4PMQA 3W1AA 4A2SA 1MFUA 4L4LA 3E2RA 1J8VA 4O54A 4AWSA 1RJPA 2EPNA 1LJYA 1E56A 3N17A 5EPDA 4YYCA 5FJPA 3QJAA 4YTRA 4O4VA 4FOKA 2PODA 2Z25A 3SCWA 4J3VA 5AOUA 1Z8AA 1REQB 3IJ8A 3COTA 2WK2A 4FR1A 3POCA 4GIAA 1FHLA 3L0KA 1K8YA 3PUGA 4MB5A 3KW3A 4FMVA 3MVTA 3G1AA 4H6QA 5KZDA 3ZIZA 1P5BA 7A3HA 1TV8A 1LOSA 5JU6A 4FNUA 1CCWB 3B0YA 4DNHA 3G77A 2YCIX 4ZE5A 3BZJA 5I24A 2XINA 4HNUA 1JPIA 2D2OA 3LUTA 3NPWA 3BSGA 5HNNA 1YLVA 1HP5A 4XAGA 4NXSA 1R2RA 4PBFA 4UTJA 3RG6A 1DWGM 1OZMA 6REQA 4H9XA 4GNJA 1V02A 2DIKA 4ZTYA 4HOXA 4AG0A 2VD8A 2W92A 3WUGA 2QKFA 4AMAA 3P62A 2V0TA 1MZRA 1W1A1 3P60A 1MEIA 4JFTA 4HU8A 4XTDA 5CGMA 4F0LA 4JPGA 3WH7A 4CNNA 1E1FA 2ZX6A 4EKJA 4HMEA 3GNPA 2WQDA 4UTUA 2IKIA 4XBKA 3BV4A 2ZA3A 4PCFA 3WEOA 1OF8A 3WMLA 1S5MA 1TJ1A 3BLPX 1HJUA 2F61A 4GCXA 4IQLA 1XYAA 3OQ8A 1RD6A 1OIFA 1XH2A 3ZYZA 4C91A 3E1F1 5HQLA 2V8ZA 5FSEC 4JN8A 3WLJA 1ZB5A 4Z2HA 2UY5A 3DI1A 4O10A 3TN5A 1EGVA 4UUIA 2BHYA 4IFRA 4L6OA 4W89A 1V93A 2V63A 4IPNB 3LBMA 3EB2A 4XKYB 3YPIA 2Z1VA 4NT0A 3WLIA 4C1KA 4G2DA 4IF2A 1KWGA 3TU9A 1ECEA 1UW9A 3ARQA 1H61A 3I7RA 3M6DA 1M01A 3NO5A 2PDLA 4KWWA 4PUJA 5A6AA 3CMFA 7REQB 3TQKA 3I3EA 2E8YA 1N55A 3PWIA 4L64A 5A2BA 3W87A 4GX9A 3LQLA 3WJSA 1GKRA 3V0TA 2DEPA 5A2AA 4I5RA 1LCOA 3DBPA 3VM0A 4ZVJA 1OX5A 2A7NA 4DJEC 5DLCA 1KO0A 3UQNA 1OYCA 3TQ0A 4A29A 2E1WA 3GRIA 1DE6A 2IQTA 1TA3A 4L1WA 4R85A 1DKWA 1KM2A 2D0GA 4GYKA 6REQB 1V6YA 2XN1A 4LU0A 4DNMA 1I60A 3WNLA 2HNEA 3G1HA 4PUDA 4GO9A 2PWGA 2PLKA 3Q2DA 1B3VA 2R82A 1V6TA 3MC5A 2QIWA 3GNXA 1RBOB 5E0CA 2YYUA 4B4FA 3LGDA 1VBUA 5MF5A 1WKFA 3FA5A 2PGWA 4K36A 5AC5A 1K8CA 4Q4RA 2VC7A 4KERA 3W1TA 2F6UA 3B0XA 3M07A 1BXCA 1JZ8A 3OW1A 1FWTA 3M0VA 4S3GA 5AC7A 2I5QA 4HQVA 3VGEA 1S5TA 4PFMA 3HGSA 1E43A 4S23A 1MUCA 1UR8A 2VEKA 4DWSB 1PO9A 3O15A 1Q8JA 2WQPA 2QPXA 5TD4A 3WQ6A 3W00A 3H70A 2NX1A 2XVKA 3DN5A 4KRUA 1KFLA 2YDAA 2WHMA 1GW1A 1W32A 4A22A 1VCGA 3DEQA 3I6EA 1WZMA 2NX3A 3SGZA 3B0VC 1KKRA 4GKLA 4DAIA 2YXOA 3M0MA 2ZZ3A 3BC9A 2YBVA 4D72A 3CL8A 3QV6A 5C9RA 4MJMA 4Z2GA 1V3JA 1P1XA 2J66A 2OMAA 2ODOA 1OBAA 1NDVA 3SB0A 5HMSA 4YHGA 3UA3A 3LN3A 1XD1A 4K3ZA 4X3ZA 3VFLA 4WOQA 3EB4A 4C6BA 3M64A 4GBDA 3I4KA 4J3ZA 4E3VA 4IPLA 4PUUA 4IQEA 3GVWA 2X1TA 3RCMA 3U5UA 2WSPA 3GC4A 1O5QA 1AD1A 1JCXA 3W73A 4GD0A 1XSJA 1UH4A 4UOQA 3SGUA 1AH3A 2VDHA 4Y7EA 1XGZA 4PMOA 3S47A 2VX7A 3IUDA 2F2HA 3ITXA 5HWNA 2OWWA 4QX4A 2C3ZA 4CGTA 1ONEA 4WKAA 1C29A 2PP0A 1KM5A 3W6LA 4LTSA 3APTA 3EA3A 3CS2A 4Q4MA 1TA3B 3APGA 3GHRA 1VENA 3VMOA 3S1VA 1OCBA 1N8WA 1H11A 3TTEA 1H2JA 3T08A 1JZ7A 4I7WA 3OIXA 1QI3A 4GYPC 2X16A 2V5LA 1SPQA 1GNXA 4DO7A 5BROA 3W7NA 2QUVA 4C5ZA 3ZVHA 2PE4A 2HDJA 5LXEA 5J5RA 2E5DA 1KRBC 2CHOA 4UTKA 4MZ1A 2BOFX 5TAOA 1V0LA 1E1EA 3WQWA 2FVMA 1AW1A 2H9AB 1CNVA 5J8LA 3NGFA 4B9ZA 1CGVA 3TZNA 4N9EA 3KRSA 3TW7A 3E38A 3FKKA 2CWNA 3CO4A 3BLKA 2DUXA 3CZJA 2R8WA 1KR0A 1MXDA 5I3DA 4S3AA 2NUYA 3EDJA 1W3TA 3TIMA 4E2VA 3FV9A 5A5WA 1OHLA 4JTGA 4C65A 1FCQA 2OGYA 1AH4A 2QF8A 3BMWA 1UWTA 4AZHA 4Y8EA 2NV9A 1R86A 3F4VA 5CC5A 1L2UA 5EFFA 3FJ4A 1OC5A 1NQ6A 2A3HA 1QI0A 2EPHA 1TELA 3WH5A 4CN4A 3W3OA 3URBA 5K7JA 3QGKC 1Q6LA 4ES4A 1S5WA 5JBFA 4TX8A 1MQPA 4AHPA 2NWRA 2GQAA 1ZRQA 3USBA 4LXFA 4N9CA 4URIA 4IQDA 3EWWA 1U5VA 2W3ZA 2PC8A 2EJ1A 1VLIA 3AOPA 3RLVA 1AD4A 4FXFA 3ATYA 2VZTA 4B5UA 3HOJA 1EOMA 4TTGA 3DHFA 1C90A 4IMCA 2X05A 5DFAA 3B0UX 2ZZ2A 4DZ5A 2PP3A 4RXFA 3NEVA 1Z6KA 3VCNA 2QJIA 3CQ0A 4Z1YA 3UWQA 5FJIA 2OXNA 2VX6A 3WNMA 3ZJ7A 3E0FA 1ZAIA 1LQ2A 1RALA 3EKGA 4FS9A 1VPQA 1O5RA 1WYIA 3IJ6A 5LSMA 1SFJA 1GQNA 4LX4A 3VIIA 3KHDA 5AYYA 1E40A 1AUSL 1P7TB 1PZ2A 1S2AA 3C2OA 1ZQ5A 3PWGA 2ZYFA 3R4IA 4LCQA 3IACA 3E9AA 1VBHA 4EXQA 2CLMA 1A3HA 3N2XA 5CLTA 2OSXA 1KFKA 3NSNA 1Q4NX 5HJYA 3BSMA 4ZSUA 3RRAA 4XZ9A 1DQWA 2CETA 5I3JA 4IIGA 5AZ1A 1W1ZA 4BZYA 3BLEA 2QMJA 2NWSA 1QASA 5LA0A 2Y5SA 3PFRA 3WDJA 3F1QA 4GNVA 3IRSA 1M6JA 4UQEA 1TO3A 1VJZA 4DX3A 1PKYA 1HUVA 4QCEA 3FJNA 4ATDA 3THCA 4WDUA 4LV9A 2QUTA 1EP3A 2A3CA 2J6XA 5ABEA 2UY4A 4C90A 1IE7C 5HMEA 1G0CA 3SRDA 3QV9A 3S2LA 5GNZA 2BSLA 4Z2JA 1NFGA 1VF8A 2DQWA 1LQAA 4UWMA 3V1HA 4AD1A 2ZFAA 4YMZA 3DU0A 3IARA 4N02A 5C2GA 2WVVA 5M17A 4D6DA 3QSRA 4QE4A 1GZ1A 4K1GA 2DZVA 1P6WA 1WDRA 1GZGA 3IGXA 1FH7A 4JHMA 1WZKA 1TRDA 4JFUA 1R85A 3BAJA 5AVHA 1EL3A 1UD6A 1RVGA 1RUSA 4LCRA 4P8WA 3H2MA 1CWYA 3PZUA 3EKLA 1P0DA 2XH7A 4TR9A 5C7VA 2ZUMA 2WJEA 4ZQCA 1BYDA 3L2MA 4LAKA 1LDCA 3V35A 4Y6GA 3G1RA 1DBTA 2ZX7A 3N2CA 1Z48A 3MUAA 3SECA 1UKSA 2DQXA 1E70M 1GOMA 4O18A 3UZYA 3HMJG 3GAKA 2ZUNA 4UTMA 1GORA 3BH4A 3BCFA 2F84A 2X1SA 1NAL1 4J40A 4M51A 3AXHA 1J12A 1FWWA 2PDXA 2VTFA 3FXYA 4DJDC 3C2FA 1FCVA 1F2JA 3VX0A 2QPSA 3BLDA 4AWEA 4M56A 4MY1A 4XUGA 3VKTA 3E02A 2BODX 1TB3A 3EZ4A 4KFPA 3EX2A 4ROPA 3OA5A 1TV2A 3DG7A 3OVGA 4GEPA 2CLEA 2OYMA 3NQDA 4FI4A 4P61A 1AG1O 3IIOA 2PMQA 3BCDA 3UWUA 4V2XA 4IMGA 4HJWA 1ALDA 3IPWA 2FPTA 3WQFA 1KTCA 2A2IA 1W0MA 4NVTA 1OZQA 2IPJA 3QKEA 3TQVA 3VIFA 3PHAA 4QEEA 2VZOA 4DELA 3AXMA 2OEJA 3BJSA 1FWGC 4Y9AA 2F2KA 5HMFA 1M68A 3O6DA 2EKCA 4G5DA 1MVYA 3GNRA 4IM4A 4H6RA 5KZEA 4MWAC 3RX3A 1UH2A 3W74A 1G94A 3NFUA 1T7LA 3O0KA 3PJXA 2QCFA 3HU7A 3B0MA 1D9EA 4XD3A 1EA9C 5C8BB 4GQGA 1WZLA 1CBGA 3QV7A 5BRBA 1LL7A 1DVJA 1XYBA 2CCRA 4M1RA 3AC0A 3S2CA 3AU6A 1XPGA 2EPKX 2VFEA 3S9IA 4Z2LA 3HQOA 2ZRZA 3KOZA 1JGMA 1Z89A 3QXBA 3W71A 4ZCWA 2WCAA 1K8ZA 4HTRA 2V3EA 2Y88A 3LM7A 5BU6A 3UWZA 4HA3A 1OEPA 1A5BA 2QCDA 5HXMA 3A24A 4KH2A 5E9XA 3ABQA 3QY7A 3W88A 1FWIC 4KGLA 4DJEA 3R0KA 4B91A 4JKKA 3VKJA 3WBEA 2Y2WA 2XSJA 1PZ1A 4GZJA 3BAIA 3L4VA 1GHRA 1A5LC 3Q65A 3U48A 4AH7A 4TV6A 2I9EA 3H2FA 4KBXA 1DXFA 1UMYA 1IV8A 4IJBA 2BP1A 4AFYA 4JEJA 4LB3A 1ITQA 5A6LA 4WEVX 3URNA 1JPHA 1PSCA 1H1NA 1BEUA 3VXGA 4KWVA 2J47A 3M0KA 4NZCA 4OHQA 5DN1A 4C6OA 2WJZA 1Q6QA 3EOLA 3QRHA 4GUHA 1RD5A 1P7TA 4CD4A 2G3MA 5AHMA 1US0A 3LM3A 1TJRA 5C71A 3PBVA 3LHVA 2XH0A 1YXYA 3B3DA 5J5DA 2BFGA 4OTKA 1SGJA 2BXVA 4QNWA 1TMLA 4IP4A 2Y5JA 1B90A 1XR2A 1IZKA 1J93A 4NJGA 3RAOA 1WDQA 3WUEA 4TTUA 3OLDA 1SZRA 1UR3M 5GNYA 4WXYA 1VHNA 1IWPA 1UKQA 3EA1A 2XIJA 2XGBA 3IJLA 1QTWA 1ZAHA 3HTWA 5I07A 2V69A 1BPLB 3B8UA 4MZYA 2NQZA 1BVWA 2FLIA 4M5PA 5ECVA 4JIHA 1QR7A 3CYVA 1ZNNA 2A1YA 5EMLA 3MMCB 1BWKA 4PA8A 1I1WA 4IICA 1IR2A 2C19A 1F5ZA 2OODA 4KS0A 3TNBA 1F4HA 4JTDA 4OJYA 3OBAA 5I23A 4O16A 1D3HA 4XZWA 2E1DA 4GI9A 3EOOA 3QZAA 4LAZA 2X30A 3O16A 1WNOA 5DT5A 1TYGA 1L6GA 2E6YA 4RE4A 5G1YA 1QOXA 3AYVA 1U83A 3VUSA 4BKNA 2VGIA 3B8IA 2ZVIA 1EF2A 1X7IA 3PJTA 1RJQA 4Q4QA 3OO2A 3Q37A 4WSHA 1LT8A 2X0SA 1VLWA 4GIYA 3QYSA 3LZ5A 3LHTA 4TO8A 4ZSTA 3GVGA 4H4IA 4GWEA 3VD3A 1HTIA 2X8RA 2O56A 1X6LA 1POKA 4OBTA 1BTMA 4MLRA 4TXEA 4IT1A 3W0KA 4OV4A 1VYSX 5BU9A 1K4GA 4P7RA 3M4HA 2DUZA 3S83A 3OG3A 2IQDA 3V3WA 2VUNA 4NX0A 1XSIA 1XV8A 1HO1A 1UOZA 3E49A 6XIAA 3VKSA 1PPIA 2Y6ZA 1B3ZA 4AZ7A 4FPSA 4QQ3A 3F2CA 1EBGA 2YCEA 4JN6A 1NWUA 3FXGA 3V1PA 1QI4A 1OG6A 1CLKA 1CXHA 3M7SA 5M03A 4KEZA 1EJWC 3P80A 5AHIA 3C0LA 3U0HA 3EDDA 3R5EA 1LBLA 2RDUA 1TVNA 3UWWA 5J04A 2E5CA 4K1WA 3PZNA 4PMUA 1KV5A 3PG9A 4DXXA 4IISA 3WJWA 4NG3A 1NFPA 2ZZ4A 2JKEA 4ENLA 3GHTA 3PTKA 4D71A 1C9DA 1BQGA 4YTUA 1EYWA 3DFOA 3H8AA 1CZ1A 1FOBA 2WJFA 1UG6A 4ZQRA 2G0WA 4O0QA 3O7UA 5CPLA 3A6OA 3VIGA 1B1YA 3S4TA 3W7GA 4W5UA 1ZS2A 3TJ4A 1EF3A 1MZHA 5F4SA 1MDLA 3H54A 4F79A 4NJHA 3WD1A 2WANA 3W23A 4DYEA 3VIKA 4PL2A 3UERA 1ISXA 1G1YA 4MUPA 5BNKA 3AYSA 4UQCA 2J8FA 2XFFA 1XL9A 2CFFA 2RUSA 3VNYA 5H8MA 3C3NA 1CPUA 1QW9A 2HROA 1V3KA 1V3LA 3MM8B 1H5YA 5LA1A 3V7PA 2A5HA 2EGZA 5CBBA 1XLDA 1CW2A 3E0VA 1HT6A 1WPCA 4PB5A 5CPTA 5E1QA 4ZTXA 2VRQA 4P2VA 3S8HA 2VZSA 4XVDA 4IGHA 1AL7A 4JY9A 3D3FA 3TXVA 3HM7A 4DUXA 4M6QA 1VBGA 4X9SA 4C6FA 3N14A 4LVFA 2G37A 2WAGA 3SQMA 4NXKA 5U4NA 4JIRA 3BZGA 4RV8A 2INFA 4GVFA 4K37A 3A12A 4AIEA 3BLLA 1M53A 1N7KA 3EPOA 4XB3A 4A8RA 3URQA 4BQ5A 4JQ1A 1DJQA 2DUAA 1BKSA 3GXIA 3ZLFA 1OQFA 3LK6A 1HL2A 4FXRA 3MANA 3HGJA 4HPHA 3TK7A 1JI1A 3QR3A 1XGEA 2CZEA 4GZIA 3B40A 5AN7A 4IG2A 2A6LA 2VC5A 3WQEA 1Y5VA 4JYFA 2W66A 3VIPA 4J3UA 3GR7A 4MJZA 1DEDA 1ZJ9A 3L4UA 2WC3A 5I3GA 1JD9A 1UR0A 1TMQA 3A47A 1WP6A 3LHYA 1V77A 4ZFMA 3W7LA 4WGXA 1LBMA 3W02A 4AU0A 5F1UA 1W2VA 4ZO7A 5EBUA 2C0HA 1RCXB 4O52A 1Y8BA 4WZHA 1XH1A 4O0KA 3T4CA 1UC5A 1VFOA 3REQA 5C9ZA 1XKYA 2PLMA 5F4XA 4Q8TA 2PP1A 3QN3A 2HCVA 3VKRA 2I57A 4YPJA 4X2RA 4AYSA 2YGYA 1KBIA 1ADOA 4GZEA 2V2CA 1E71M 5GJPA 2HRWA 3MM7B 2YR1A 1G01A 2ZWZA 1R5YA 1YHTA 2B7QA 1DORA 3SI9A 2VEMA 2WSYA 2NX9A 1SU5A 3MSGA 3MSYA 4L61A 4PMRA 1IXQA 3B9OA 3WCZA 3SDOA 1HKIA 3LD5A 1TUFA 4EE9A 4ZEPA 4M0XA 5AYZA 2FB3A 4UNKA 4TX6A 3SUUA 1IZJA 2CZVA 1GOXA 5F2IA 5LZLA 2ZOXA 5AKQA 3IUHA 4HCDA 3K4WA 1Z7AA 1GPWA 1TPC1 2GSEA 1TPB1 3M43A 5I0DA 3MSRA 1BRLA 1T5AA 1XP3A 4KCVA 3P74A 4YCOA 4Q32A 4G8TA 2P88A 1H63A 3KVLA 4EPDC 2V4JA 1MFVA 4BF9A 4AISA 4S3JA 1B9BA 1YX1A 3MKKA 3G1SA 3U2EA 2WBKA 4F9JA 2I9UA 1KR1A 2QPUA 2Q8ZA 3GFXA 2Q8XA 2NXHA 1M65A 3FKRA 3P61A 2PGRA 2GJXA 4A3UA 1QPQA 2IUZA 3GU9A 3M46A 4HHHA 4DAFA 1Q6OA 2OG9A 4CQBA 1Y5WA 4LNYA 4K7VA 2W6RA 4Z1AA 1WZAA 1XPYA 3CEUA 3A3HA 2DY3A 3CK5A 1ZCCA 4ZQOA 2G96A 1TVPA 2IXUA 1JQVA 3O1NA 3W7CA 2C1HA 2BV9A 1GK8A 4PSRA 4LJ3A 4K7YA 2DV0A 3RDKA 3PP7A 4L80A 3VDHA 5CLWA 3SFKA 2XJ7A 1UWQA 4UQAA 4A35A 1D7FA 3KTXA 2JK2A 2ONEA 1UR4A 2TSYA 5DXXA 4JCLA 3RJYA 4NZ1A 2VFHA 1W37A 4LF1A 1SZFA 2P76A 4O1BA 3T44A 1DL3A 1CTNA 5EMMA 3SCPA 5HA7A 3VZYA 3TC6A 2J62A 1MW2A 3UJFA 2CLKA 5D9MA 1QK2A 3CLMA 4GUGA 3NUKA 3WK2A 8TIMA 3MMCA 3AHYA 4H9VA 5AB3A 1MNZA 3OA3A 2ZUTA 1ECQA 3NDYA 2DSWA 5AC8A 1ODUA 1R0MA 3JUGA 2FZ9A 5LGXA 3GDKA 1YW1A 3Q45A 3VOJA 4U2YA 3BAXA 2W27A 1EJTC 3RYSA 3ARVA 1QNSA 3UXAA 3WLMA 4ZO6A 3G8RA 2VURA 4CQ9A 1U33A 3GSMA 1ZALA 4KRZA 4GIRA 3M5VA 3N73A 1DOSA 1KM0A 2I56A 5M5DA 3FS2A 1CENA 3DGBA 1Q6GA 4WDTA 3NGJA 3NXFA 3S5YA 2Q3RA 4H7VA 2UBPC 2V67A 3V5OA 2OX4A 3S0CA 1EJXC 1E0WA 2CNCA 4IX2A 4LB4A 4A3RA 3T2PA 2P3EA 3KBVA 3A64A 2GOUA 4Q33A 3S6TA 1ICPA 2E68A 3W7PA 1I2NA 4ZXLA 4LVAA 2D3NA 4HK7A 3CAQA 3N19B