4S3AA

Ispg in complex with intermediate i
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 137
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3aA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3aA02
3B0MA 4MWAA 3H2OA 4CCZA 2YCJA 3OR1A 1Q7MA 4MWAD 1Q7QA 3B0HA 1TWWA 4S38A 2VEFA 1Q8JA 3MM5B 1Q7ZA 3MMAA 4DJFD 3MM7B 1AD4A 3MCNA 3K13A 3B0GA 2Y0FA 3VKPA 3MCMA 3B0JA 4NL1A 3H2CA 3MMBA 4DJEA 1TWZA 3MMCB 4DJED 4G38A 4PZVA 3H2EA 3TZFA 4D9PA 2DQWA 3VLZA 4C1NA 3TYZA 2XSJA 4S3DA 3MM9A 2VEGA 3MM8A 3VKQA 4S3EA 3H2MA 4MWAC 3BOFA 3TYCA 4DJDA 1ZJ8A 4NIRA 4DAIA 4DJDD 3GEOA 3VM1A 3H24A 2YCLA 3VLYA 4DJFC 3TYDA 2DZBA 3MM6B 1AJ0A 2OGYA 4MWAB 3OR1B 4NHVA 8GEPA 5AOPA 3H22A 4DJEC 3MMAB 4O0QA 3NOYA 6GEPA 4G39A 1Q8AA 3OR2A 2DZAA 4DAFA 3TR9A 2AOPA 3B0LA 2VP8A 2V4JA 4S3BA 3AOPA 4S3CA 4S39A 3MMBB 2BMBA 3H2AA 3TYUA 4D8ZA 7GEPA 1AOPA 3MM5A 3H2FA 3B0NA 2YCIX 3H23A 4DJDC 1AJ2A 3MM7A 3BOLA 4HTRA 1ZJ9A 4C1NB 4D8AA 2XSJB 3VLXA 3H21A 3MM9B 1TWSA 5GEPA 3MM8B 2Y5SA 4G9PA 2GEPA 2V4JB 3H2NA 3TZNA 3MMCA 4NILA 3VM0A 4HB7A 3H26A 4O1EA 1AD1A 3TYBA 3VKRA 4MWAE 2Y5JA 4DJFA 2YCLB 1AJZA 3TYEA 2H9AA 1TX0A 1TX2A 1EYEA 1Q85A 4AOPA 3MCOA 4GEPA 2AKJA 4S3FA 3VKTA 4S23A 1F6YA 3V5OA 5JQ9A 4O1FA 2E7FA 3VKSA 2YCKX 3MM6A 3OR2B 4S3AA 4DB7A 2H9AB 3TYAA
chains in the Genus database with same CATH superfamily
2WC4A 2V5CA 3GAKA 4Y9AA 2JE8A 1W3HA 4R9XA 3LHTA 4YHGA 3RDKA 5H2ZA 3B04A 1ITCA 4C60A 4M81A 3WDIA 2XGZA 3N04A 3PB2A 1XRTA 4CEUC 1GHSA 4WGXA 3YPIA 1AW1A 3OJGA 4HGXA 1OCJA 1TMHA 4UR7A 3CL7A 4Z1CA 4AWEA 3A12A 1J0ZA 1U33A 4E0CA 3RRXA 1W1YA 1O94A 1Q45A 2W67A 1LOSA 4CN1A 1FDYA 3H22A 3HGRA 2FTWA 1FWEC 3CTTA 4JS3A 3KXQA 4KT2A 3N9KA 2BOGX 4D8ZA 1QRQA 2QUNA 2J4GA 3OVGA 2V67A 3T4CA 4JN8A 2J7EA 5M17A 1JUBA 1BG4A 2PWGA 3WBXA 2INZA 3I6TA 3KVLA 4Q4OA 4LGXA 2YA0A 1KWGA 2OZ3A 3GHSA 4LY4A 1H7PA 1JDAA 4HA1A 3VOIA 2E8YA 1CCWB 2WVUA 2NUWA 4MJ2A 5DT7A 3NEHA 3FY1A 3DZ1A 3URAA 3T9PA 3A4JA 2AQVA 3VMPA 5K3VA 1CBGA 3KRUA 3F4CA 1Q7QA 4L1WA 1FXQA 2Q71A 4H9XA 4N0RA 3UWEA 4D2JA 3MZ2A 4MNKA 4NZCA 4O14A 1XRSA 5CZ0A 3KOXA 4E6MA 1QT1A 3T2PA 4UNLA 4YU1A 3BLFA 4CD8A 3WNNA 4IIHA 1W5QA 4X2PA 2DT3A 1XQLA 4UTIA 1VFHA 2O9PA 3P8JA 3W3OA 4DJDD 1IT7A 5HUOA 1CGUA 1H49A 1A5LC 1U2YA 3MHGA 4KW2A 2FB2A 3KWXA 4JN6A 2J7HA 3H6OA 3MI6A 5FSDC 1MSSA 3LTPA 3BE7A 4DWDA 3VNJA 3STEA 4G39A 4TTUA 3THAA 3S1VA 4Q8MA 4NJIA 1EC8A 1BTMA 1J5TA 3EOEA 2BMBA 3PZUA 2CLHA 1F4AA 4CD7A 1X38A 4HJWA 1P7TB 1OX4B 3NDYA 4ZENA 2A4AA 1W8GA 4L56A 3ZSTA 5GPRA 3VIIA 3DKLA 4GOAA 4MY9A 4DO6A 3V35A 1UPMB 3N15A 1BWKA 4XD6A 2ANUA 3R8HA 1DWHM 1NP0A 3ARUA 1F4HA 1X39A 1W2VA 3W70A 2GJRA 3V5OA 5I3GA 3TTEA 1R47A 3JUGA 1E73M 4M6PA 3OR2B 3VCRA 4YTTA 3GM8A 3M0HA 2J13A 1PBGA 3DAQA 3VIJA 5M2FX 4S1FA 1PJ9A 2YBVA 3QSRA 3VKAA 1ZP3A 4O10A 1Z3NA 4CVWA 1JVNA 2P76A 4XK2A 4DBUA 1KFBA 4PR4A 3BUVA 1RA0A 4ZQPA 5CGTA 2UWFA 3OQEA 1YADA 4QLKA 1YTEA 1IR2A 3S6OA 1W5MA 3M5YA 3B03A 2XM2A 5JH2A 4M3PA 3TSDA 3SI9A 1W32A 2H8ZA 5C5YA 3NQVA 3QLLA 1IT8A 4D6GA 4LV4A 2OELA 3WNOA 1EPXA 4JFUA 3UD6A 3J7HA 2ALDA 3W26A 5FOOA 7ENLA 3E0IA 3GG1A 3W76A 1NJJA 3K30A 3EB3A 1YE6A 2VX6A 3UG3A 2FJKA 4DNMA 3MMCA 2XINA 4QDWA 2NV9A 4HTYA 4Q8VA 1Z44A 1JYWA 2H8XA 3KUMA 5AB3A 3NEVA 4BQ5A 1SSGA 1TTIA 4ZTXA 4J3XA 3SFWA 4H3DA 3VKTA 4AHPA 3NQ2A 5D2VA 1UR8A 4DWSA 4S3AA 3EMCA 3E74A 1KO0A 2YPIA 2WVSA 2WWDA 2ZXDA 3MWCA 5AHFA 5LZLA 3XISA 2OJPA 4NZ4A 1Z9AA 2FPTA 1XF0A 3O06A 4K7VA 2GGHA 2QUTA 3S2CA 3MUCA 3HIJA 5M1TA 2PTXA 2FZMA 4KKXA 2UBPC 1A5AA 1BYBA 1V6UA 4RNFA 1JF5A 1JDCA 3C0JA 2OMAA 3NM3A 5HPCA 2NUXA 2XDFA 4L9YA 3NQAA 4UTUA 5CG0A 1B3YA 2WM0A 3WK3A 3QH2A 3WN6A 3A22A 3UXLA 4F3HA 2OTDA 1MUWA 1RD6A 3GBDA 2CXEA 1JCMP 3ZJKA 5IDZA 1DE5A 1J79A 4A8NA 2E6DA 2QAFA 3C0SA 3DKJA 2XM1A 1VBUA 2IKJA 5AC7A 6XIMA 4UMBA 3MMDA 4Y6GA 3PN8A 1C8VA 3QOKA 4K6AA 2NLYA 4XZHA 3HU7A 4KQNA 1IEVA 3OHIA 4H7ZA 4LBSA 1NIUA 2ZTKA 3C2YA 3G1XA 3I68A 4JQ1A 3N25A 4DM2A 4DI9A 4YTQA 1B3ZA 2A7RA 3NYDA 1IEQA 3UERA 1AH4A 3QGKC 3EGJA 1XICA 3LLXA 4PMYA 3MP4A 3S5NA 1LQ2A 3G0SA 2EPNA 5E70A 3U2OA 3K2GA 4FXJA 5HBFA 1H1NA 3B0MA 2DZPA 2JF7A 2DZXA 5A6KA 4U5KA 3LHWA 4IFKB 3NXFA 3JZEA 3AU2A 3UPBA 2BGQA 2A3EA 1GT8A 2YL6A 3W25A 2YL5A 3E1F1 3IJDA 3NDZA 4XZWA 5JU6A 3SGUA 3GLCA 4C7GA 1U22A 4DO4A 3DYPA 3CASA 1YLVA 2AGTA 1XC4A 2DSUA 2OODA 3PHAA 4F0KA 3W87A 1XLIA 3B06A 4C6OA 4FX8A 3BLOA 2A3CA 2WMKA 1XG4A 3VIPA 2J7CA 3QQ1A 4LTSA 5D2WA 3RU8X 2OOFA 5SWUA 3VABA 1Q6LA 1QPKA 1GEHA 3HMCA 4IIFA 5EB8A 4PCPA 2GSJA 3VE9A 4O17A 3IAQA 5C2GA 4DVOA 2DSZA 4GQRA 4IP4A 3W1PA 5LNSA 4JIIX 7GEPA 4PMNA 2XYLA 3WD3A 2V3EA 4DXKA 3MUY1 4C1LA 5B80A 2ZXAA 3L4UA 1KTNA 3LGGA 1W6TA 2WLZA 1VCVA 2W91A 5HPOA 5HAOA 4IQDA 3GFZA 4DJFA 4FO4A 3FV9A 1DJHA 1XLEA 2WO5A 3CHCA 4M6VA 4PBFA 3N19B 4W9TA 1ZHAA 1CB2A 1YNPA 4QLLA 1VCFA 6A3HA 4X22A 1E55A 3MA8A 3MV11 3M0MA 2AMXA 1R2RA 5C2XA 4DB7A 1AW5A 3MW7A 3WL0A 3FSTA 5A3HA 4AFYA 4GY0A 4UQ9A 5HNTA 1ITQA 4HCDA 4WCJA 4BQ2A 5LSMA 5M3WA 1Q66A 4GQGA 3PSVA 1M41A 1R30A 2CBVA 2J8GA 2VO5A 2OCZA 4M7TA 3W7QA 1DJZA 3RNDA 1PYMA 3DYOA 3KW3A 3MMCB 1K1DA 1NVMA 3W29A 4MG4A 2FZ8A 1PUDA 3WH6A 3AIWA 1XSJA 1TQJA 2HXUA 2ZOXA 4W7WA 1P1XA 5DMMA 3VIFA 2DW6A 1HKIA 1XUUA 1US0A 4DWSB 3NL2A 3N4AA 3JU2A 1TV5A 5U4NA 1LBFA 4B2DA 4NJJA 4LAUA 4HOZA 4Q4SA 4HK7A 4H00A 5HATA 4AZCA 3L4XA 3MHFA 1MUCA 4NXSA 3VIOA 4AB4A 5IM51 1ZJ9A 4CEXC 1P0BA 1QNVA 1KKRA 2Q8LA 4PRWA 1FWHC 2J27A 4J28A 2IPWA 3UJ2A 4GXPA 1TUXA 1H11A 2PTYA 3R0KA 1R7OA 4OBTA 2I7GA 3EWUA 5DMLA 4Z1YA 1O95A 4GLEA 1LBMA 2PGWA 3SRHA 2CHRA 4FX7A 2AKZA 2QLYA 4G56A 1PKMA 4DRSA 1UKQA 1XLLA 2CZVA 1CNVA 3DHUA 1Y8BA 2PA6A 4LC8A 2QV4A 3S9YA 3EA2A 3P3BA 1GKRA 5F2GA 4P8UA 1KGUA 4EXQA 5K4XA 1GGOA 2RUSA 1JCNA 2Q3OA 4QM1A 1Y7VA 2ZWZA 1HP5A 4G6CA 3QR0A 1V3HA 4HOXA 3GXFA 1BWVA 1DJYA 3S47A 4UTLA 4LAMA 3GHRA 1RLDA 2VT0A 7PTDA 2CLEA 4LH8A 3QJAA 1JG9A 4B5SA 1C7SA 3RHGA 1FWSA 1VFLA 1HG3A 1V4YA 3WF2A 4US5A 1E6NA 1WDQA 1S5TA 5HR7A 2X2YA 1TTPA 3T1GA 4DZHA 3B0NA 5M03A 3M0VA 3QKEA 3WZ0E 1T96A 2VL4A 4PL2A 3ITXA 1VHNA 3WMCA 2ZUNA 4LC6A 2Y5JA 1E6PA 1MWOA 4IIDA 1DEDA 1KLYA 3W7HA 3DGBA 2QPUA 4M6UA 1EL3A 5RUBA 3QKZA 4EE9A 3W7CA 4BKNA 5CJNA 5E0CA 3VM5A 4IMGA 2J77A 2PWUA 1YDOA 1HKWA 1V6YA 1FRBA 2JBMA 1SU5A 4HU8A 1GTHA 3EB2A 1M1BA 3WUFA 1SZNA 2V3FA 4K38A 2X1UA 4LAOA 1FX6A 1E0UA 3GNOA 3Q67A 3WUEA 4FNRA 1XFBA 4Y96A 4D9PA 4HQVA 1XYAA 5CEWA 4PCSA 3UR8A 1Q6DA 1U5JA 5LNRA 3AWOA 1KRMA 4XAFA 2V5BA 1RCXB 3OW1A 3I7RA 4QG9A 4QBXA 4PFHA 1MI3A 3INPA 1QPQA 3VD4A 6ALDA 4JPGA 2D2GA 1JRBA 3TX9A 1SFJA 3KRZA 3NO5A 4QCFA 1TPB1 2OO6A 1ALDA 1WX0A 3V16A 4XV0A 4AD0A 1I8JA 2G3NA 4G5DA 5HWJA 1U83A 3F2BA 3EWZA 2QEZA 2INEA 2ZUVA 1PZ2A 1PKYA 1QR7A 1PSCA 3VZYA 8RUCA 4OQVA 2CYGA 1NWRA 3CAVA 4INFA 3RM9A 1UASA 1XG3A 2VR4A 4DY1A 1RP8A 3KCOA 2BXYA 2C91A 4O54A 2ZZ4A 3WQ8A 4FB7A 3IUHA 3VU2A 3PJWA 3EX2A 1KKOA 4JTFA 5I6SA 3DFHA 4K8EA 4AZCB 2JKAA 4IMFA 2QCCA 3AYVA 4MKSA 4O13A 3T0CA 2EKCA 5E93A 3BW2A 5ECUA 4NRSA 3VGDA 3H7UA 4LWWA 3VD3A 3MVTA 4DUXA 2NQZA 1K6AA 4OWGA 3WQDA 5CAHA 4CNSA 1N8IA 1DJNA 3JR2A 1WQ5A 1K9FA 4AEFA 1BSIA 1IXPA 1K7XA 5KZDA 3DERA 5FF4A 3BAYA 3VCNA 1BSLA 1L2QA 3HZ3A 1V0KA 3PSWA 2PP3A 2WZMA 1Q6FA 5C9ZA 1XCFA 2EGZA 3TWBA 2VFHA 5KSWA 1DQWA 1ADOA 4ZODA 4L65A 2UV8G 5I09A 3MM7A 4YN5A 4D71A 3O2LA 3UW6A 1RPXA 3WNLA 2YYUA 1TRDA 3FA5A 4QSFA 3SN0A 1G5AA 4CGTA 4NSBA 1AD1A 5G2WA 3AMDA 4O18A 1N8FA 1BD0A 1XCXA 1OFEA 4ZE4A 3G1YA 1RV8A 3N11A 3CU2A 1WOAA 3VK5A 3B0UX 1BVWA 1XQKA 2PDUA 3U6WA 4IICA 1TWWA 3RPMA 3B97A 3P6LA 4XZIA 5E9AA 2NVCA 3VOHA 4GINA 3T40A 2J79A 2F7FA 2OXNA 5I3FA 3VKKA 1DHPA 3ZJ6A 3V0TA 1M7OA 2HRWA 1WKFA 1FWCC 3QGVA 1QASA 3T0TA 3RCYA 4A3HA 3U48A 4QQUA 3H7VA 3BJSA 5DLCA 2YW3A 3SADA 2O9OA 1ELSA 4HSNA 1ONEA 1C9WA 4URIA 4HZ8A 4NUWA 1T0OA 4UR8A 2VQTA 3C5QA 4RR4A 5DMYA 3BGAA 1H3GA 4QR6A 3KM8A 4J3UA 1OSEA 1PZ1A 3GG8A 2GQ9A 1DTNA 3VX0A 3GYCA 1KCKA 2ZZ2A 4BQ4A 5HWMA 2A1YA 4HYWA 5AC4A 5CH9A 1JFHA 1VJSA 2IQDA 4ILSA 2P53A 5HA7A 4WKAA 1OYAA 4NU7A 1TV2A 3AU6A 2I16A 5EY5A 3AZSA 1FWDC 2TAAA 3WIJA 2B7OA 5BU6A 5CSUA 6TAAA 1EQPA 2ZUWA 2AAMA 1POJA 3PK7A 1H41A 3QV9A 3IK4A 4Q4KA 1VLIA 3UJSA 2WBKA 3ZVHA 2SFPA 2XU2A 3TN4A 4QE1A 2A6LA 2GJPA 5EMYA 5FJPA 1KFWA 4L9XA 3GTNA 1T6MA 3FJ4A 3QOMA 1VGAA 1QNSA 4M1RA 3C2OA 3BG9A 3CB3A 4GFIA 1EJVC 3GZAA 3VD5A 1U1UA 4AU0A 4V33A 4ATLA 3JS3A 1RBOB 1R2TA 3TJXA 1YNQA 1TVLA 1QHZA 4GZ7A 3WK0A 5HMSA 4DF0A 9XIAA 1G4PA 3VMOA 1EWEA 1A3WA 1MZRA 3AS0A 4IXXA 1HTIA 4QAIA 2OEJA 4GACA 2VR2A 2NWSA 1UZHA 5HDRA 3BAIA 3W72A 1DQUA 1TZ9A 1F7BA 3HG4A 3TR9A 3PP7A 3N17A 3KAOA 2QAPA 4O53A 2WKJA 2VZOA 3E5BA 3VNZA 1K7EA 4BS0A 1MW3A 2WB5A 3NUKA 2GVJA 1REQA 1SZFA 3WQ4A 2FGBA 1NF0A 5E0KA 4HMEA 4BEUA 5GEPA 4CKQA 4G9PA 3RX4A 1R8LA 2IPGA 3MI2A 3VE7A 3NL5A 4IPPA 1KXQA 3MBDA 4CD5A 2Y85A 1YNYA 1SVDA 5FI8A 3TTQA 4OT7A 1VD6A 2KZHA 3SUVA 4H8VA 1XH0A 1OFAA 2GJNA 3GR7A 4JNMA 2ZX9A 1QW7A 2WSQA 3W38A 2Q6ZA 3HV9A 3BMVA 4OIFA 3VDCA 2X1SA 3GW0A 4BCEA 1LZOA 5A6TC 3SUTA 1PDYA 2FJUB 5H8UA 1G01A 1NARA 1W1B1 3KTSA 5FEXA 3MM7B 4KRZA 5J8LA 2XVPA 4AH7A 5BROA 3F1QA 1EP2A 1EB3A 3G8EA 3HPAA 3GDLA 1V0LA 6ENLA 3B05A 1G4EA 1FHDA 1UD5A 1G9HA 5CZTA 1HGWA 4UNIA 3VDHA 4AEOA 3WH5A 3SJNA 1UWAA 1XXXA 3PF3A 2VTFA 2FQIA 4GE8A 4CCEA 1M7PA 4NQ1A 1D3CA 3KRSA 1HQTA 3FCPA 3NO3A 3C3NA 3VCCA 1U1JA 3GXNA 5JH1A 3VC6A 3FAWA 2GLKA 3WFAA 2V5DA 4QX4A 3PAJA 2YOCA 1JULA 1I1WA 1G7VA 2HTMA 4HU4A 4QS6A 3FXYA 1KXTA 4S3KA 1QK0A 1SYTA 3MYPA 3HTWA 4LAKA 3AXKA 1TIMA 2VGBA 4ZO9A 2YXGA 4Z1BA 1R3RA 1HJXA 2UY5A 4L80A 4B3KA 2POTA 2D1ZA 1I4NA 1A53A 4YWSA 3CQHA 3LCLA 1QK2A 3KL0A 1GOWA 2Y7DA 1JD7A 1J0KA 1YXYA 5AC8A 1UKSA 3I3DA 3HN3A 1FWBC 4YVPA 1JZ6A 2QZRA 1AQHA 2J25A 1PTDA 4O28A 1S5NA 3OVRA 4AIUA 3WDJA 1TTQA 4Y9OA 3RO8A 1K4GA 5EKYA 5I3HA 2BVWA 1Z89A 5T26A 1FVPA 1QI4A 4S38A 1KM4A 4F40A 3CTLA 4AC7C 1F3XA 2VZSA 4JQAA 3WF3A 1LOQA 1FWJC 1W2PA 3U9IA 3B0JA 3UWQA 3QR1A 2AL2A 4AZGA 1TB3A 2OEKA 3OYZA 1CI1A 4XD5A 5D9NA 3UR7A 2I9UA 1VBRA 3BAWA 2OZ8A 3B0XA 2FMOA 3DN5A 4LVFA 4LXFA 1ONRA 5DY2A 5F1UA 2CKSA 3KLLA 4X9SA 3OBEA 4AMCA 1C8YA 3ZVHB 4K8HA 5C54A 4AZ5A 4GI4A 1ZLPA 3UNDA 3EDEA 2DFAA 2HV5A 4Q4QA 3WLSA 2D2OA 2GJXA 4LYKA 2W3ZA 5DN1A 1M03A 3MJYA 3TC7A 5D2XA 5BWAA 3LBMA 1MFVA 4DLMA 1POKA 2R91A 4FXFA 1AJZA 2GYIA 8XIAA 4PGLA 2Y8VA 2QUMA 4HPJA 1THFD 5FL1A 3N2CA 2GDUA 4FMVA 5ABEA 4R85A 1VFOA 3RXZA 1WV2A 3WLOA 2DUAA 4QE5A 3G18A 4PUJA 4I6VA 2NSOA 1WNOA 3W7KA 3VNLA 1V0NA 1K70A 4IOTA 2GZXA 2BV9A 1S2CA 3PFRA 4CQ9A 3RJYA 4HHMA 3QRHA 4NZ3A 4CNNA 4M1BA 3VNKA 1UBPC 4YLWA 5U7SA 4H4IA 1OFRA 2XSAA 4PZVA 2AAAA 1XX1A 3LNMA 1RH9A 4I6KA 1GJUA 2A85A 2E77A 2WK2A 4LNYA 1CZ1A 3TCSA 4JIHA 2NQ9A 3CQJA 1R9YA 3LQGA 3MO4A 5FJOA 3LZ3A 4KIEA 1JD9A 3VKCA 2BVYA 5AOPA 3SRFA 4JTJA 1A47A 1SO6A 4JQ3A 1L8PA 4ZQRA 4CD4A 2AOPA 3QC0A 1R0MA 2V5LA 1T8QA 5TQLA 1A5UA 5AC5A 4JY9A 3TYUA 1FOBA 1GZ1A 3E0WA 3CT2A 4Z0JA 4RLIA 2PDBA 1OFDA 3W1XA 1J6PA 3GUGA 5E9XA 4JTCA 5DELA 3PTQA 1NOUA 1XI3A 3MZNA 1EYWA 1I9CB 3GB6A 5FAJA 5T8GA 3UT0A 3E12A 2DU2A 3L65A 4QROA 5D4YA 1DWIM 4KGLA 4NNCA 3P81A 4LVAA 4ZR8A 1UD6A 3TA9A 4B5TA 3LCGA 3PJUA 3W2KA 1B31A 2BY2A 2VVSA 3MSRA 2VEFA 4N9CA 3SCQA 2W62A 5MKGA 1RY0A 1L2UA 3ZM8A 5C9WA 4MY1A 4A35A 3UY8A 3H12A 3NTYA 3TZFA 3R58A 3AUOA 1BXCA 3VNIA 1F8MA 3AIUA 1Z7AA 4V28A 3ATYA 1AA1B 3W81A 2P3ZA 4YCOA 1GKPA 5BNKA 3T78A 3CO8A 2OQLA 3V75A 2ZYFA 1FWGC 2H3DA 4J2MA 3RILA 4Y7EA 6GEPA 2PZ0A 1UHVA 1TO3A 1OYCA 5AVNA 1VAHA 2PLKA 1FFQA 1I2QA 2XFFA 3L21A 4EF8A 2AL2B 1FXPA 4AD5A 3R89A 4GHRA 1UZ1A 1GVEA 1KBJA 4LSBA 4B5WA 1AQ0A 5HJLA 4UQBA 3N2OA 4JTHA 4WY0F 1PAMA 1W9DM 2IQ0A 2B4GA 1BHGA 3GG7A 4MNJA 4XKMA 4TQTA 1ONXA 4A4AA 1W8SA 3WY1A 3O07A 2R94A 4MLJA 1AZ1A 4L6HA 4PUWA 4KS0A 3QMSA 3BURA 4ATWA 1JI1A 4L9ZA 2FFCA 3AISA 3EA3A 1FDJA 1XSKA 3CHDA 3VNDA 5AYIA 3LNPA 2DVTA 1W3NA 1LL7A 3URQA 3B9OA 3IIZA 1H60A 2GJXB 3UJEA 2JGQA 3OTRA 3RG6A 2FMNA 3LZ5A 4WDWA 2HDJA 1W1IE 1O7AA 3BJFA 4M51A 2F9RA 1E4NA 1SM9A 4TX9A 5HNRA 3UPWA 1CXKA 1BTCA 3V3WA 3H4GA 4JDYA 3OG3A 1JYXA 2C16A 5AKQA 3VZXA 1BFNA 1V7AA 4LVDA 1ZAJA 3KOZA 2OT1A 1KQYA 2ZKMX 1RALA 4NRRA 4MLRA 1KR0A 1OFBA 1UD8A 2ZRVA 3I65A 4F48A 3S1XA 3RM8A 1ESWA 1QU4A 4EF9A 4GVHA 2PDGA 1Q6CA 3EXTA 4S3BA 3TSMA 3I4EA 3TJIA 3WBEA 9RUBA 1CIUA 3FNDA 3ZYZA 5CQ1A 3AOFA 3GTIA 3O6YX 3C86A 1H1ZA 1VLWA 4B9ZA 3U4FA 5F4SA 3RUBL 1XSIA 3BLDA 1HL9A 1LWHA 3VKRA 4JNYA 3PFMA 3DBNA 4HK6A 3SQSA 1LORA 3B3DA 3F2CA 4RDYA 5DCDA 1PCWA 2VRJA 2RFGA 3W75A 3VDGA 4EANA 1ZNNA 3ZOAA 1UP2A 2VENA 3AIQA 2QCEA 3V4BA 1PVNA 1LF1A 2J7FA 5CPOA 3R7MA 3V1PA 4X9YA 1EDTA 1UR0A 1J0IA 1WB0A 2Z6JA 3AMLA 1U5VA 3DFTA 4EWND 3W6YA 3P93A 1IWAA 3BCJA 4P2VA 1M6JA 1LROA 1CGVA 1OFOA 5C71A 4KEMA 3CIVA 3UFYA 1ZY9A 3GBEA 2CZFA 5DEZA 3HG5A 3VTRA 4JDBA 4MFDA 2PTDA 3BCDA 5BZAA 1J9YA 5BOEA 3EX4A 3BLEA 2W63A 3GFXA 5AFDA 4IWWA 4FZIA 3UVAA 2YFNA 2VJXA 4YTUA 1W9BM 4JTIA 4QITA 4UQEA 5A6LA 5MKGB 3R43A 1MEIA 5BW6A 1BXNA 4IJBA 4XTIA 4TX6A 3RCNA 4CQ8A 3DU0A 2GEPA 1FP8A 3LENA 4DUOA 1KRAC 3QM3A 1TX2A 5FA5A 2FZNA 3WDHA 4IUOA 2WVTA 1YTDA 5A95A 2X8RA 2V6AA 2FLIA 2XIJA 2E8ZA 3A13A 3HF3A 3NFUA 5AY7A 4GYJA 4OBSA 3BWWA 4GYFA 4U2YA 1XWYA 4O1CA 4LBUA 2P50A 3PZ9A 3LV6A 4GNKB 3H2CA 1J0YA 1VRDA 1XIMA 4P5UA 2W5FA 3CB8A 1H0IA 4LYQA 1WKYA 2XIMA 3EPNA 4DWSD 4N6EA 3RAOA 2HEJA 3ABQA 1R3SA 1UUMA 3NZPA 2ZX5A 4BZYA 1I0DA 3EOSA 3O9NA 3O05A 3FEMA 1R9XA 4YPJA 3T7VA 1E15A 2RH9A 5AHMA 3UZWA 5H8MA 2PDMA 4U3CA 3L4TA 5J04A 3O6DA 3IAPA 4HYRA 1TV8A 3TFXA 3M5XA 3HURA 4LFYA 4DF2A 3PVFA 2EG6A 5JBEA 3TKFA 1GW1A 4J3VA 3PJTA 1J10A 2I5IA 1T41A 4YNGA 3WFLA 1NOFA 2CXGA 4JN7A 4GISA 4ZEPA 3W71A 3MPGA 4ZMGA 4LRTA 2C8NA 2F61A 4EKJA 3P0XA 1RBAA 5I5RA 2YCEA 4IJRA 3L66A 4H04A 3O8AA 4LV9A 2OYMA 3KBWA 4H6EA 3TK7A 2E68A 3E0FA 3VPLA 4B15A 4PN2A 2OX1A 4NJGA 3U57A 1IGWA 4F0MA 3ZJ8A 2V5JA 1HFBA 1WUFA 1SO4A 2EAWA 1SR0A 1OHLA 3MDWA 4DIAA 1RAKA 4AHQA 2AKMA 2Y61A 3OYXA 2QCLA 3MTWA 3AI0A 2OZ0A 4YYCA 3TYZA 1SMAA 3MM9A 2ZC1A 3KZSA 4ZOAA 1VEMA 2X1RA 3UU0A 3ANYA 1ODUA 4K1WA 3M46A 4DEFA 1B30A 4WJEA 5G2IA 2QGYA 4H9UA 3DECA 1NDVA 1XIBA 5LIUX 4FR1A 4A8IA 3E2RA 3R0DA 2WPGA 3S9IA 1K8YA 2XFRA 4IPIA 5FF2A 1MFUA 4ZB2A 3QYQA 1UP0A 3F4NA 1IIHA 5I7GA 2VFIA 4OUIA 1KCXA 2RDUA 4ERGA 1EP3A 1S5WA 2IKHA 2EBNA 5A2CA 4KEUA 4DO7A 5D38A 1TX0A 1VR6A 2ZRYA 5A8GA 3DX5A 1X8CA 1LCOA 3V5FA 3VINA 1HVXA 3TOYA 1RP9A 3VFLA 4IPJA 1XIHA 4FF7A 1E70M 2GGIA 4IISA 1B3WA 1EBGA 3GKFA 4O57A 1GPFA 3AHVA 4DJFD 2W27A 1QOXA 1XIJA 1WUEA 1XJBA 2J7BA 1MXSA 3UYIA 1FH7A 3WF4A 3NPWA 1MQQA 1R3WA 4RZ6A 1C91A 5XINA 4NI8A 5CJMA 3QQ0A 4Q33A 2Z1WA 3VKBA 1YYAA 3CEPA 3B0YA 3TDFA 3TU9A 4GVIA 4FX6M 2OLAA 1UROA 2CLKA 3UF9A 2J6VA 2VFGA 2ZICA 3WLJA 4Q3MA 4DUWA 1C29A 5BMWA 3GVWA 1J6OA 3WELA 4O0QA 4WVXA 3KBJA 3GAYA 1DV7A 3FW6A 3PULA 2PDKA 4IIBA 2DZTA 4DM1A 3MDUA 4P8VA 3IIPA 4A3YA 2ICSA 2FZ9A 3H21A 3FLUA 2P8CA 2NQ5A 4CQAA 1LT8A 1RJQA 1UA3A 5C2CA 4PMXA 3TJ4A 1A5KC 4U31A 1O6IA 1M7XA 4EPKA 2Y6ZA 1UJQA 3R0UA 4OGZA 3K8MA 2HVNA 1YKWA 1FCUA 2QCDA 2Z7GA 1H7NA 2Y88A 2J8TA 4R53A 5BOOA 2OU4A 3H4WA 1DL3A 1FBAA 4J3TA 3NNTA 2EEXA 4YHEA 1XBXA 4LQ1A 3O6AA 1KFKA 3M16A 3DESA 3TP4A 3E6EA 3RYSA 4CU8A 3MMBA 4QG6A 2P1FA 3ES7A 1C7TA 2A0NA 2Q8ZA 2PTWA 1JUEA 3VOGA 1BAGA 4AIOA 4UNKA 3TN3A 2PPGA 1PIIA 3B40A 4Y90A 2A2IA 1V3LA 3H24A 1B0IA 1Q4NX 4MM1A 3OLGA 1JCTA 4Q4MA 3EMQA 4WXZA 3PBUA 1QI5A 4HU3A 2QVHA 3B9EA 3BOXA 4H8NA 2WMIA 2BZNA 3I3EA 1J2WA 1RZMA 3TFCA 1YMYA 4XO7A 5K9XA 3O0KA 2WVVA 2JF6A 3GDTA 4LANA 1RJPA 3WDQA 3TQ0A 2FKPA 2WSRA 5LHFA 4QISA 2C19A 4EPEC 3W22A 2YCIX 4DJDC 3GWQA 3M6YA 1UJPA 4AZ7A 5CBIA 2ZX6A 4LT9A 3LD5A 3MM9B 1CXHA 4CU7A 1SJCA 3EKZA 2GFTA 4AD1A 1GG1A 3PPCA 4PCFA 3QEZA 4F79A 1P48A 4YL2A 3UP8A 1RY8A 3KHDA 2WCSA 4TVDA 3D0CA 4ZVJA 4GZEA 3RPDA 3BLPX 1CLVA 1AG1O 4Y9NA 1U5HA 1QO2A 4JIQA 3W37A 2QIWA 5FJTA 2YXOA 4UTKA 3M43A 3RR1A 3POCA 2Q09A 2Z1BA 3W1RA 4NP7A 1EC9A 1WKEA 3UBPC 2Z1SA 5D32A 3U2EA 4PB5A 3DC8A 4AXNA 1O5KA 3CV1A 4QSHA 5A6SA 3CQKA 3H2EA 1TV4A 3QGAC 3LTYA 2GQAA 1RD5A 3CT7A 2CBJA 4S3EA 4JD4A 2HVMA 1S5VA 1B4EA 3QHMA 1EX5A 4XIAA 5HQMA 1T5AA 2FVKA 3CNYA 2G41A 5AECA 1XIGA 3VKJA 4AZ6A 3G3DA 2WCAA 4RNJA 1J5SA 5FF7A 2VZVA 2XIBA 4C6JA 4XBKA 4FPSA 3N9RA 4WR3A 3BICA 2XTKA 2RGLA 5BRQA 3PTKA 1FHVA 2D2JA 1NH6A 3EBVA 3UG8A 3E96A 1LT7A 4QJ1A 4XKYA 5EGRA 1ITUA 1R7AA 3JZUA 5CAKA 2GVEA 3T08A 3CUHA 3LBCA 1OG6A 3AIRA 1VP5A 2PMQA 1UWIA 2J9XA 1HF6A 1G94A 3ZWTA 4AXKA 1KFEA 1UR2A 3R2GA 1CENA 1XIFA 5I78A 2WKGA 1TE6A 1B54A 3ONCA 4I8YA 4GJJA 3EX3A 3OA3A 4ZQNA 2AOSA 2X0YA 4DNHA 3LGDA 4CCZA 4LX4A 1NFGA 4NXKA 4KRTA 4ZQOA 2C79A 2OPJA 1PPIA 4Q8WA 3N13A 3WNMA 5I00A 4PEKA 3BO9A 1WDSA 2OEMA 3VMNA 2ACRA 3MYOA 4QRNA 5HXMA 1RLCL 2LLEA 2WV8A 3QTPA 1IGSA 4CVUA 3P84A 4NNBA 3WLHA 3IJ9A 3PZIA 2CBUA 3BOFA 1BQGA 1OF6A 2V81A 2QCDB 2WJDA 1QVBA 3WD0A 1IT0A 4J2PA 5EMJA 1KM2A 1JQVA 2WHLA 4KFNA 1QBBA 2GSHA 2WCGA 4JIRA 4GKLA 4C7DA 3UCDA 1XW8A 2C0HA 2CETA 3N2BA 3G1HA 3H55A 3EWXA 1QATA 4D6EA 3N2XA 3B0LA 1E6SM 1XGDA 4PUKA 2WMFA 4UOQA 3T0DA 1UOZA 3MMBB 4NX0A 1GVYA 3L4VA 1OC6A 3K4DA 3V0SA 3T05A 2X2GA 4A2SA 4ZOCA 4FHAA 2OGJA 4UUIA 3ABOA 2V4JB 2PC8A 3VDBA 3TYBA 1OX5A 2BWGA 3NPUA 1SO3A 5DT5A 4JY8A 3IRSA 3FXGA 3VM7A 1E3XA 1JF6A 4MOZA 5I23A 4S3FA 1XR2A 4GYPA 3Q37A 1JDFA 2WVVB 1CXIA 1M53A 9XIMA 4RXFA 2D2HA 3VYLA 1GWJA 2E5DA 3OP2A 2DUXA 4P7NA 4MJMA 3ARPA 7TIMA 1NF7A 3VOJA 1CT5A 2J74A 1W56A 3NSXA 4W8BA 4GMEA 1Q4WA 3AUJA 2CLMA 2CPUA 4RE4A 1NTHA 1S5MA 1OGGA 4C6CA 2ASHA 4PBGA 1KB3A 1ZCOA 3UCCA 2VC7A 1UWRA 1IXNA 4RCXA 1FKWA 3ZWSA 1YEYA 3WH8A 3TCEA 2QUUA 4HT3A 1K77A 2VMFA 2Z1VA 3GC5A 3IJ7A 3LU2A 3IVUA 2MUCA 3VGFA 2Z28A 1W91A 3WNKA 1I2RA 2ZWYA 1QNOA 1SUXA 4UCFA 4LPCA 1OC5A 3BXWA 4IIEA 4O12A 1O4UA 3W1QA 1AOPA 4BEQA 2JEPA 3OO2A 3UZJA 3EYPA 2PE4A 1EFZA 3M1ZA 5HULA 4ERIA 2E5BA 2PEVA 4R7WA 2ZA3A 4S2BA 2V3DA 3VD7A 5CLTA 3KOYA 4O16A 4R9OA 4L7ZA 3F03K 1KM5A 4C6IA 2AKJA 1KFLA 1V3MA 2ZIDA 4F66A 1KFJA 4N9EA 3SJ3A 1XRFA 2VEIA 4WKHA 2DJXA 2V38A 3FJ6A 4Z08A 4LCSA 4MWAD 2CWXA 3WK1A 4XB3A 1FWAC 4ECLA 4LVGA 3Q58A 2ZFAA 3W73A 5HK4A 3AALA 5HOSA 3NZ1A 3MJMA 2FH8A 3STFA 2NQHA 4HA4A 5TD4A 3PZVA 3AICA 5AVHA 3LERA 4W7VA 3BAJA 4G38A 1P6WA 1WKDA 3ARZA 1EO5A 2VX4A 1X8FA 1VFUA 1J0HA 2YLAA 4DJDA 5BWFA 2L5HA 3LCIA 2ACSA 4KCTA 2FTYA 2OWXA 1WZKA 3O0FA 4AF0A 1VF8A 4MZ1A 3SY8A 1OINA 1QW9A 5L9FA 1XUZA 4V15A 2GQ3A 4M29A 5JBDA 3LX9A 2OYKA 3VO0A 5CPLA 1NM9A 4NI3A 1NAL1 1WBHA 4GI8A 3EOLA 5M5DA 1CXLA 4GC4A 3KBSA 4P7LA 1K02A 4O0KA 1VBJA 5CG7A 4W87A 2BOFX 2X7VA 4WLCA 1EH9A 3AIBA 3KCJA 1EHAA 4UQCA 4WZHA 4BK9A 3MY9A 3CIWA 3MSYA 2D20A 3BH4A 1E71M 4IP5A 4DUVA 3NSNA 3ZLGA 2YGYA 4GH3A 2DUZA 3G1SA 2DSWA 4LW7A 4MADA 3T8QA 3GTHA 4FA3A 2FZBA 4J3SA 4KIRA 1BPLB 3VAVA 2QJIA 3T2OA 2EPHA 3W4RA 1UR4A 1BRLA 3EMZA 1JCLA 4O8RA 4R27A 3CC1A 3BV7A 1WPCA 3CJPA 3W1UA 1QNQA 3GW3A 1TZ7A 3AYTA 3XINA 4H83A 3PUEA 3GE7A 2XHYA 3QV8A 4AD2A 2Z1KA 4OVXA 2ZE0A 4ZE5A 1OT1A 1JEZA 2IMRA 4UTWC 2VC9A 4R7JA 2A79A 4H6KA 4WOQA 4TVUA 3LUTA 1LQ0A 3WYZA 3ITYA 2DZSA 2ESCA 2QS8A 2DV0A 3CUZA 3UGRA 3NM1A 3NL3A 3LHZA 1BVZA 3S5ZA 4RDVA 3SZ8A 4PUEA 4H2HA 4RPQA 1CX9A 2E9LA 2ZZ1A 1ISYA 1EJXC 3M0JA 3PANA 2PRHA 1OZMA 3T4WA 2VX7A 3UYCA 3NPXA 3FYOA 1EP1A 2YB4A 3UWWA 4GH1A 3A4XA 2HPIA 4MZYA 4S2CA 3CH0A 3GVGA 4FAMA 1UMYA 4QQ3A 3P0WA 3HV8A 1H50A 4TX8A 4BWLA 2GWGA 3BQ6A 3P61A 2VCAA 1V79A 3W1LA 1V0MA 5JQ9A 3HGJA 3AHXA 3BL3A 4JXCA 3VM0A 4JKLA 2Z2BA 4PEEA 2ZRZA 4A22A 3MMTA 4GKTA 5BMXA 4C65A 3UJRA 1M65A 1C8XA 1RCQA 3HPSA 3V5CA 2CZDA 2XUCA 1A5CA 3RRAA 1BVNP 2Z7KA 2JKPA 3PPFA 4Z2JA 1OM0A 4Q8OA 3OZYA 3ANVA 1KLZA 3LHVA 1O66A 5HQLA 2WWCA 3TAKA 3TTSA 3QFWA 4GVFA 4JAWA 4ZSTA 4GK8A 4JYFA 1L6SA 4F4RA 4TMCA 3ARTA 2WAGA 4YTSA 1SZEA 4E8CA 4OE7A 4ALDA 1UPPA 3S5OA 1XIIA 2R1MA 1VPQA 5DFAA 3GO2A 1K7FA 1YPXA 5FF3A 3GUWA 1Q2SA 1GQKA 3UZYA 3CAKA 2Q8XA 1HJSA 2GQ8A 2R24A 2D23A 5IHRA 2D0HA 2HWGA 2OSWA 4Y8EA 1MRAA 1A0DA 1IXQA 1TE1A 2C6QA 1QWGA 3URNA 2H9AA 4MVAA 5D02A 4AF0B 2FHFA 2VI0A 4MMWA 1RPKA 1SZGA 5FJIA 2YFOA 2CLFA 2HCVA 4UQDA 1EOKA 1XIEA 1BEUA 3H70A 4J27A 3CZEA 2QCFA 1A80A 3S2LA 5F2IA 1M5WA 1XLKA 2TPSA 1PO9A 2G96A 1RUSA 1QWKA 5ECVA 4A2RA 4Q8UA 3W7IA 1QTWA 3DYMA 1TPDA 1TV3A 4RW5A 3KCLA 4X61A 3UPMA 3AC0A 1O1ZA 4N7QA 2ZRUA 2BNJA 1UH3A 4ZBCA 3BPWA 4LS1A 2FTPA 3ABRA 4YVVA 4R5EA 1EZWA 1HX0A 1BRLB 1WOBA 1PZ3A 2Y8UA 5AN7A 4XAGA 3RU6A 2I1OA 5L6UA 4N02A 4U10A 1WXYA 2XN2A 1ECQA 1WDPA 4C6QA 3H2FA 2XJ7A 2QCHA 4AZBA 5H6HA 1JJKA 4GBUA 1EJUC 2RDXA 2VKZG 3D47A 3PPHA 1OBAA 4KWVA 1X1ZA 2E4TA 4Q7NA 3E3HA 1XV8A 1EGVA 2XFWA 4D72A 3L7RA 4UWMA 5E1QA 1VB9A 3D6NA 3PWGA 1GW9A 3FS2A 4LUJA 4X0VA 1J01A 3SSJA 1MXDA 3G1FA 2BDQA 4WDTA 1F07A 3FVDA 1E3ZA 1PZ0A 3M0ZA 2BHYA 1XYMA 5EBAA 4GGHA 2OWCA 2J78A 1VFTA 4PTNA 1YIXA 5G5IA 2Y1HA 1NP2A 3IJ6A 2ONEA 3N1AA 4PUNA 4UZUA 4JFTA 4US6A 4J40A 3VLZA 5IBXA 1TMQA 4XUGA 3TN5A 4PC8A 4HN8A 1DJXA 3NGFA 4QDPA 3KFTA 2IPJA 1GJPA 3CLMA 3BTNA 3O6CA 3WJXA 3QMTA 2A3BA 2EG8A 2PBOA 3UNTA 3VDAA 4XD3A 5TNVA 3BMWA 4NAFA 4NZFA 1VH7A 5A94A 4ADTA 1B3OA 2TYSA 3V1HA 5E09A 1BYCA 3B4UA 3G22A 3V36A 3KDOA 3W7DA 5I2UA 3S9ZA 3BGJA 3H2AA 2QUVA 2YW4A 3A21A 2PDLA 1QHPA 4K36A 3NOEA 1V6VA 3GKAA 1Y5XA 1JQXA 2X7WA 4KBXA 1TJPA 5KTLA 1EGZA 3WLPA 1J0JA 3CUXA 1DTUA 4MWAE 1QNRA 1IR1A 3ZMRA 3VIMA 3DFQA 4MHBA 4E8DA 1IZKA 3HJEA 4KETA 3KP1A 1XP3A 1H09A 1GG0A 3WQEA 2OLSA 1JPKA 3S6TA 4JTRA 3R79A 3K5XA 1GVFA 4HA3A 3TW6A 3N3TA 2OOGA 5LNUA 3G24A 1XGEA 2C13A 2CZEA 2OX4A 4HYVA 3K8LA 1EPVA 3A5VA 2QPSA 3QXBA 1V08A 1JZ2A 2CEQA 1H7WA 3MO7A 3F5KA 4C6MA 4RKAA 5CPMA 5I07A 3URBA 1KV5A 1PE1A 4WUIA 1PYFA 3SUWA 4IM4A 3SCVA 2DSVA 4HMDA 4LUYA 3EDFA 1TFVA 1VC4A 2VC6A 2ZA2A 5FAGA 2DEPA 2PDXA 1MNSA 4A29A 3W85A 3G1AA 3N14A 4PULA 4HKPA 4EVZA 3VIKA 5CPQA 3TC3A 3VIHA 3S46A 4CNOA 2EKGA 1TTJA 2CKRA 1ZBVA 2FIQA 1OCQA 3C0LA 4MGGA 4ZXOA 3T8LA 4W88A 4ZO8A 1XL9A 3UZZA 3QR3A 2WXDM 4W7UA 4DXVA 1W9VA 3RJXA 3WJWA 1KFCA 2Y7EA 3RPTA 4GNJA 3NGJA 4LEFA 1ZJBA 4MIMA 1SO5A 1DWGM 4UFMA 2QMKA 1UR3M 3TH6A 3CZ8A 5XIMA 5CPNA 3W07A 2YCKX 3B8TA 3TMLA 3WF1A 4C6NA 3S42A 2DT1A 1B3VA 1Q7ZA 4UCGA 2QHAA 2VCCA 4DXXA 3WEZA 4DLFA 3GXDA 1G7UA 2V30A 5TF0A 1RSCA 4C1KA 3CHEA 4CLMA 4PB3A 7CGTA 1EUNA 1H0GA 3O7UA 5EPDA 4PH6A 5GNZA 1VEPA 1TREA 3TYDA 3CZLA 4AIEA 3BG5A 2OGYA 5HNUA 5BXTA 2VM8A 3ARRA 2J7GA 1A5MC 2GGEA 1Q8AA 2H6RA 1E5NA 4AHOA 4U2ZA 5I06A 4E3VA 4ZO7A 3RGTA 4RDZA 4OOZA 1V6WA 3NAVA 2OFJA 2R1PA 2VDIA 2V63A 4E4FA 4NZ1A 1FWNA 3BARA 1J8VA 1XPYA 4LS2A 3THCA 5JIWA 3ZZ1A 4W85A 1A5OC 1Q6GA 4JIEA 1H5VA 4W8AA 3LS9A 1YDVA 4GJ1A 4NAFB 1EC7A 2P5NA 4CQBA 2BHZA 2W9MA 1F61A 1JAKA 1XH1A 3RLGA 1TR9A 3C4UA 2MANA 3WLMA 2WM1A 1XDLA 2Z24A 7REQA 5JIPA 3E2VA 3EA1A 2VR5A 1NFPA 4ICMA 4XX6A 2HS6A 5CC7A 3W2LA 4O15A 1ZL1A 4LUTA 1TRIA 1XKJA 1H4PA 3QYSA 5F2MA 4ES4A 4HHHA 3U7VA 3VVGA 2NX3A 1OZQA 1EUAA 1KR1A 3TE9A 3M4HA 1XLFA 3B8DA 1F6KA 2XVGA 1CB7B 3HOJA 2A7NA 3TWAA 1RQEA 1V02E 2XZ9A 3M6DA 1SW0A 3TR2A 3GX9A 3EWBX 2YIHA 3FOKA 1EF2A 1JGIA 1W5PA 5KEZA 3W23A 1BLIA 3FSUA 1EEXA 2ISWA 4FIRA 1KV8A 3QHNA 1UKOA 1OIFA 3TROA 1Y5WA 4H9YA 1ZS2A 4W93A 3RITA 1HZYA 1TV7A 5FACA 3MM5A 4K8GA 4DBDA 3KBVA 5B7YA 2CNCA 3P5ZA 2AL1A 1WP6A 3MSGA 4IIGA 4PE8A 2Y8KA 6XIAA 1EJTC 2I5QA 1XLJA 2X16A 4PODA 3DDMA 1ZQ5A 1B4KA 2GOKA 2XGBA 3NQ8A 2XN0A 2WHJA 4LYPA 2R9RA 5F2LA 3BCFA 3A64A 4FNQA 3U7BA 3CMFA 2YX0A 2PWEA 3STPA 1G4SA 1GYLA 1A5NC 4TR9A 5HJXA 3KLKA 3OIXA 3IGSA 2DT0A 2GK1A 3WMLA 3S8HA 3W7RA 2E9MA 2XVLA 3Q45A 3WMBA 1E1EA 1A3XA 2WNNA 2V2HA 4QG8A 4H6QA 3E2SA 3NR0A 1TR1A 3IV3A 2XFYA 3A9IA 2G3FA 1J2BA 4O50A 3TTYA 3JVAA 4O1DA 3W7OA 1UR9A 3W6MA 4DZIA 3H2MA 3FDGA 1CPUA 1VBHA 4ICNA 4G7FA 4LVBA 3TJLA 1LUCA 1OD8A 1CWYA 3SDOA 1LYXA 3RMEA 3O15A 1UUOA 3AYSA 3AZRA 3EDKA 3SBFA 5DRCA 3BLLA 2I9EA 1QHOA 1SFLA 3E0VA 3QPEA 3LA4A 3CLWA 4MAZA 4WSKA 5BXPA 3WQ6A 3W1MA 4XZNX 2ALRA 3FFSA 4Q7IA 3UWUA 1W5NA 2WMHA 3D5HA 6TIMA 3DC0A 4MY8A 1TPWA 1E56A 4DO5A 2Z2UA 2VRQA 3ENLA 4R34A 1HKMA 2QIIA 3KE0A 5CBBA 2BY1A 2P88A 3FJLA 2WHMA 2HE8A 1CTNA 1ML1A 2HISA 2OKOA 5G1MA 1PV8A 3W83A 5LA1A 2ZX8A 4K1GA 2V2DA 5H91A 4YIWA 1CGWA 2CERA 1Q5MA 4M6QA 2DVXA 1VFMA 1QI0A 1ECEA 3SN1A 3RN6A 1US2A 3HQNA 2WC3A 4U4MA 2ZDSA 1W1ZA 1I0BA 1OF8A 1YE4A 1Q13A 3MWAA 4U3AA 1J11A 2B0MA 3NZQA 3CO4A 3BLKA 2JK2A 2D0GA 2W6RA 5GNXA 1N55A 1GNXA 3NURA 2Z2AA 3CPRA 4AISA 4Q6XA 3ALGA 3QY8A 4OV4A 2G4FA 1EIXA 4EOUA 4G1NA 2IUZA 4M19A 4AX6A 4GI6A 4MKVA 3CPUA 4AD3A 1V3JA 1AJ0A 2F6KA 2BB0A 2X42A 4PYSA 4G8TA 3MVIA 5TAOA 4AX7A 7REQB 2QR6A 1TELA 3M64A 4O8AA 3MHUA 3BVJA 4QJ3B 4L1GA 4LBRA 3NPVA 4LUTB 3DH7A 5I79A 3T55A 1ODZA 1MRQA 4EIVA 1JXJA 1YX1A 1TQXA 4MNMA 1G69A 1RXOB 3CUIA 4ICCX 4GJIA 3LPFA 1F05A 1E0WA 8TIMA 1ME8A 4M5PA 1V03A 4YCPA 2PD5A 1OB0A 1VJZA 1ME7A 2V2CA 4KWWA 4N9DA 3EXSA 5DXXA 4RUBA 5DBUA 3WEOA 1ZSXA 3ZO9A 1OWQA 3LCFA 4L4MA 4Z17A 3GU1A 1ISZA 3GK0A 2GVYA 2HJPA 5G1YA 1E0TA 3UWYA 1XKYA 4S3GA 5AYXA 2GPTA 2XVNA 4RE3A 4W86A 2PDPA 3R94A 4JOMA 1JCXA 2CLPA 3OZPA 3MM5B 3G6LA 5T9CE 3C8NA 3E5PA 1M9HA 2QJNA 1KQZA 4FIQA 1FWFC 1ZUAX 5C9XA 4HU0A 3ABZA 3LTSA 1TSIA 1DVJA 4IP7A 4U33A 5I0DA 4FR6A 3AQUA 4C5ZA 4OU1A 3WJZA 3L68A 1EJRC 1BGGA 2Z00A 1H7RA 3R5EA 1AUSL 3VX1A 2RHGA 4XG1A 3DENA 3LHYA 1G1YA 4TOQA 1XS2A 3LG3A 4NX5A 1E6RA 2GOUA 4H8HA 3FGCA 3WH9A 2G3MA 3G0UA 1JPMA 1UD2A 4MNLA 5DBTA 5DQPA 4WF7A 4LOCA 1I2PA 3T42A 4GRSA 2GK1B 1FKXA 3ITVA 2CFFA 1L9WA 5DY3A 1TJ1A 5LHEA 3TLQA 4RJEA 5HANA 5C9UA 4L4PA 4RE2A 1ICSA 4TVCA 4FXSA 4DZAA 3TSBA 3AS3A 3W1NA 1HL2A 4I8DA 2BASA 3WDRA 3KP0A 4I5UA 3MUIA 1L8NA 3S6DA 3CQIA 4UQAA 1QUMA 1G0CA 1Q3NA 3GVQA 5A69A 1LUCB 3N29A 1VPYA 2QKFA 2IXUA 3DGRA 1W0MA 4PSPA 5LNWA 3MMUA 5AZ0A 4AOPA 4W4QA 1EGMA 3OB8A 3V18A 4K37A 3WD4A 4H9ZA 1KM1A 3ALFA 1C8QA 1LM1A 4I7VA 3NL6A 2G97A 3BZGA 1IF2A 3B9DA 4TU1A 1GVIA 2YXXA 3NVDA 3AIVA 4KERA 2E25A 1UH4A 3GTXA 4B3LA 5PTDA 3ZT6A 4DJED 3SM0A 3T07A 2JQXA 3SN4A 1FY6A 2PC4A 3N34A 4E38A 4M80A 2VGIA 4NYYA 1GQNA 3V7PA 1NEYA 3VXGA 2VEMA 1S39A 3TONA 2WYSA 1TPH1 1B2YA 3ANUA 4LB3A 2ON3A 4I9AA 2WKLA 3QV6A 5FEZA 3ZS4A 3EWYA 1EX1A 3HFYA 3QW4B 1KM6A 1IZJA 4ATDA 1ZAIA 2O7QA 4GIYA 3FIGA 1FWWA 6REQA 2F38A 3NQEA 4UTHA 5AOUA 2A5HA 1EA0A 2WHKA 3P5YA 2EQDA 1E6QM 5XIAA 4RZBA 1R3QA 4IMCA 1VJIA 2O9RA 2JALA 4AC1X 4W89A 3AHZA 3C8FA 4UZSA 3SW6A 1UW9A 1L6WA 1FCQA 1B9BA 2A7PA 1LL4A 4WJ8A 4UFKA 1J4EA 3KBMA 4LNCA 4AIBA 5A8MA 4M24A 2OQYA 2GGJA 3IGHX 4GQ0A 4B5VA 2BG5A 1BG9A 1X1OA 4XIMA 3GC4A 4JICA 3E38A 3E9AA 3SQMA 2AMGA 1ME9A 3MC5A 3LN3A 4R33A 5DRIA 1X1NA 4GABA 1IIGA 3W7JA 1KGWA 3MM8A 2YYTA 3R10A 3GH5A 2FHCA 4Q22A 3RK8A 3T0BA 5C70A 3ZLFA 3VLYA 3S5YA 5FIPA 1N7KA 3G77A 4NHVA 4AMAA 2QMJA 2HBXA 2WSKA 4QNEA 1L6YA 1KM0A 1P7TA 3IJIA 1FH9A 3MMWA 1TPC1 4DWSC 3AMCA 2VP8A 4ROQA 5DCBA 5LXXA 4PMVA 1Y5VA 3ARVA 2CWNA 3U4AA 3O63A 1ZB5A 4MFEA 4PRTA 5C7HA 3VOCA 4HBKA 5EMMA 3QQWA 1DJIA 1HN1A 2R82A 1BYDA 4CNTA 3STGA 3G1VA 4F8XA 1HP4A 2NZLA 3CV2A 3IANA 1C9DA 2OB3A 2P0OA 3O3RA 4L64A 3REQA 2HMCA 3N2TA 1CXEA 2PODA 2WC7A 2VQUA 3H2OA 1KBBA 1DHKA 4YS1A 3WQOA 5CC5A 3M07A 2V9DA 1OQFA 4XTDA 3GQYA 4XSMA 5LGXA 3AIEA 4WHBA 3CV7A 4GO9A 4PMDA 2ZXBA 4Q8QA 3W9ZA 1U30A 1EJ7L 1OABA 2BSLA 3JW7A 5ABHA 2RGMA 2DQWA 2WPBA 1VZWA 1S2AA 1E4LA 1CECA 1DE6A 3GEOA 3OOQA 3P67A 4JTKA 3Q2DA 1DORA 3LQLA 3KWSA 2ACUA 2CLOA 1ICPA 4KPLA 3R6IA 4MZ8A 3G1DA 1M3UA 4CNPA 4XD4A 2FFIA 1OFQA 2VUNA 4HPGA 4HCHA 2Z0IA 1N2VA 1YW1A 1ONWA 1NDYA 1O68A 2HNHA 2XWDA 1MXGA 2P8BA 4PTXA 2YJQA 4PCNA 1BYAA 3L2IA 2J24A 2J7DA 5D05A 3R12A 3CL6A 4HPXA 2C1HA 4BJHA 3GDBA 4B16A 3P8IA 5ENLA 3M0LA 1TA3A 5HMFA 1TG7A 1FFRA 3B9AA 3GXIA 2QDEA 1JDEA 1IEXA 4DPPA 1US3A 2WNWA 2YCJA 2NXHA 4D6HA 1A5SA 2J62A 1OC7A 1XYFA 4NJKA 4RE0A 6REQB 1V51A 1KWKA 4FOKA 4EPBC 4JQ4A 4HP5A 3B9NA 4LU0A 3WJYA 2IXVA 2JIEA 5AZ1A 4QJ5B 1FHUA 1VFSA 3EX6A 3MCMA 4W5ZA 4MB1A 2VHLA 3LHUA 4WGHA 2DJLA 3APGA 4LB4A 3SIZA 2GDVA 2VWSA 2XSJA 4MUPA 3IARA 1DJGA 1FQ0A 2VEGA 3L67A 2GUUA 3IJQA 3MB9A 4DN1A 1KCZA 4OOUA 1SFSA 2QQ6A 4DJFC 1IWBA 2PD9A 4F9JA 4DI8A 3GSMA 3FK4A 4C6FA 4JTLA 1ZBCA 5D9PA 1I6NA 4U28A 4WEVX 3HQOA 3LLDA 3A47A 4KFOA 1ISWA 1BWLA 4IG2A 1D7KA 2CESA 2W66A 3QZEA 3WD1A 3F5LA 4HNNA 2G3JA 3O16A 1XRVA 3GYEA 3CXOA 4CQCA 4PSRA 3MM8B 3XIMA 2HSAA 3W00A 3WK2A 6PTDA 3M44A 1O12A 4ZOEA 4A8RA 5K4ZA 4PBEA 4ERAA 4I5RA 4GCAA 2W4XA 1YPIA 3W82A 3HPFA 1XM3A 4IFKA 3MCOA 1QAPA 3DHFA 5GJPA 4HN4A 3UQNA 4HNUA 3OLIA 5GNYA 1XBZA 1VQTA 4GXMA 4B4HA 3WUBA 8CGTA 1CGTA 3PY2A 3CWHA 4B5UA 3TW7A 1CXFA 1W1PA 3GDKA 4IQEA 2EO7A 2C14A 2F2HA 3T09A 1NWTA 3B0PA 3N9SA 3CAWA 4XWUA 3TYCA 1FCBA 3WENA 1ZJ8A 5JXQA 3W24A 4XZ9A 3REQB 4ZZ9A 3TAOA 7TAAA 3QTGA 2GL5A 3LPOA 4K7YA 1Q63A 4PTVA 3PUGA 1R85A 1LWJA 1V6TA 2OO0A 1CDGA 2XH2A 2IKGA 4L4OA 4F0HA 5HWNA 3IUDA 4HNOA 2G8ZA 4LEQA 2OSXA 1F74A 5CZKA 3L23A 4S39A 5CSYA 4NY2A 3F7JA 4JTDA 1IHIA 1K8ZA 4KEZA 2XIIA 1K3UA 3G3MA 3CIXA 2NWRA 1SJBA 4AYGA 3BMXA 1XLMA 3G1RA 2J75A 1REQB 1KBKA 1TCDA 1XLGA 3USZA 5HINA 1PX3A 4TMBA 3GD6A 1D3HA 2GGGA 4BF9A 1UZDA 1XPGA 1K9TA 1R2SA 2V5KA 2DSKA 3OA5A 2WW5A 3LXBA 4MB3A 4Y8FA 1LBLA 2VDHA 4B90A 3OGVA 3W74A 4JHOA 2DZVA 3GNRA 4C91A 5G2HA 3IWPA 1M04A 3C2VA 4G7EA 3LK6A 3L0NA 3KVJA 3UXAA 3VGEA 3TN6A 2ISDA 3UA4A 2VEKA 3GIQA 3K46A 2QNEA 1TA3B 2IW0A 4M0XA 2VCBA 4ORIA 3TXVA 5D09A 3FJNA 2VFEA 3HG3A 4FNSA 2J9ZA 1PX4A 1EDGA 1QI2A 1YHTA 4MAVA 5EBUA 3OHMB 3O1NA 3L0KA 2QCMA 4MYXA 5FCZA 5B7ZA 3MS8A 1OG0A 2XIOA 1EJWC 4FNTA 1RR2A 3LRKA 3NVTA 3KX6A 3BOLA 5JBFA 3E49A 2A6NA 3IJLA 4O1BA 2XSJB 1UR1A 2ZZ6A 3C56A 3U2ZA 4KCWA 3UZXA 1GVSA 1W9XA 5D33A 3TZNA 4ZB5A 3I7SA 3M0YA 4WK9A 4JFWA 3RLVA 2O9TA 3CZJA 4JBRA 2XVKA 4KWOA 2JIWA 3GU2A 3THQA 4UMAA 3P14A 3U2CA 3A4AA 4IG2B 4F0SA 1UBSA 5IRPA 1BKSA 1E43A 1HNYA 5H1WA 3MUXA 4I90A 4E2OA 4ZA0A 3W84A 2YL8A 1ZJAA 3GIYA 4NG3A 4H7VA 3N4FA 4BF5A 4E8GA 3KOFA 4NT0A 3E02A 4DQWA 2ZQ0A 4IX2A 1RVKA 5HMEA 1RK5A 3UEQA 4X63A 1BQCA 4AQLA 5JVLA 4JTUA 4EK7A 3AZTA 3ES8A 2PDJA 4BF7A 1W1A1 2YDSA 5A8QA 4HD5A 3NOYA 1UA7A 4GCXA 2ZUMA 4J4KA 3NQFA 4J3ZA 2Y62A 4OFCA 1OVDA 3OVQA 2Y2WA 2XZ7A 1K9EA 1UWTA 4LF1A 1PXGA 1UZ4A 4RL3A 3NQBA 5CGQA 4DYJA 1MO0A 5AHIA 4UBPC 1N8WA 5C55A 2NVAA 4PTDA 2UY4A 2R1NA 2Q02A 2KAUC 3GNDA 1IXOA 3A9BA 1DIEA 1S2VA 2EPLX 3SRKA 3GHUA 4JX4A 2J8FA 1QW8A 1RQBA 3UWZA 1KBLA 1VIZA 4I9JA 1WAUA 2YZRA 3EEZA 1F6YA 5C9RA 3S4TA 3TVAA 1H61A 5IDIA 1JYVA 3BW3A 1W9UA 3DFOA 2GDQA 3I6RA 2VRKA 1LG1A 5T91A 4LYRA 5D2TA 3G8RA 1OK4A 2DORA 3NG3A 2O0TA 1W1VA 3HMJG 1W37A 4DHGA 4J3WA 3SRDA 1X96A 3KBNA 4ZQMA 4KH2A 1UOKA 3B8IA 4MPKA 4X0NA 4FXRA 2YA2A 3ZIZA 3VUSA 1DXFA 1TPEA 1XYZA 1OGSA 3NCOA 5D8ZA 1UD3A 3OGSA 3VGBA 1QOPA 2Y7GA 4ZFMA 3PWIA 4M8UA 3D3FA 3ARWA 2Z6IA 4AWUA 1YDYA 4DAFA 2NSXA 3EX1A 3OLEA 4FOUA 4L5ZA 4GIEA 4G7EB 1Q6QA 1ZBKA 5LKYA 1A4LA 3AHYA 1RVGA 4JTAA 3HPZA 1B90A 1DQXA 4GX9A 4MKNA 3L2MA 4XVDA 4E2BA 2WQPA 3CMGA 3S1UA 3PTDA 2EF9A 5A6BA 5F7UA 1Q85A 4A3UA 1R5YA 4ML9A 2DZWA 4LUIA 4JYEA 5F1VA 4FOJA 1ZU8A 2FGZA 2DY3A 5LIXX 3W88A 1ZBWA 1GUVA 1OD0A 1LL6A 1E6ZA 1E0XA 3LEPA 4J5NA 4F9DA 5IFPA 1Z6KA 1ZPTA 4UFLA 1QI3A 2P3EA 3P62A 2F8QA 2F84A 1B5TA 2VWTA 3LRLA 3HGOA 1W3IA 1PIFA 1B57A 2VOMA 3L2LA 3L0GA 5DO8A 4UTMA 1TVPA 5GJMA 3IIVA 4AY1A 2PRMA 4AY7A 1SJAA 5D30A 2XISA 3RO6A 3SCRA 4S3DA 3NQMA 3ZT5A 4UFJA 3W7NA 3WLQA 1CW2A 4MWAC 4GA8A 2QDGA 2WZEA 3WO8A 2WZHA 2B7QA 3ELFA 3W7PA 2BY0A 2E09A 3F5JA 3V0UA 1T8XA 4X60A 1P0DA 3TIMA 2PF8A 1E51A 4EPDC 1XD1A 3UCQA 3BW4A 1DP0A 2VEPA 2ABAA 5CPSA 3LCHA 4BHYA 3P2VA 4JHZA 3FDKA 1NY1A 2I17A 3BGGA 5BRPA 3WLTA 3L4ZA 3CM4A 3SY5A 1GOKA 5JMUA 4PRRA 2QCGA 3WLNA 3IRDA 1MEWA 1G67A 1TIWA 4PUDA 4P8WA 4XSLA 3M7WA 4IMEA 4XAPA 4PMOA 3IACA 1ZRQA 2DH3A 2F6UA 4V1XA 3KZPA 4Q7BA 1PKLA 2NXGA 2W92A 1GZJA 3GDRA 4ZOBA 3FKKA 2TMDA 5BXRA 1HGYA 3RMJA 3POHA 4O1AA 4Q8PA 4C1NA 3LYEA 1C93A 2ZZ7A 2FPVA 3WH7A 3QPZA 4AY8A 3K1GA 1DWJM 3N6JA 2H3BA 3LXAA 4ZXLA 3T44A 3UETA 1KC7A 3A6OA 1UWUA 1KGXA 4L6DA 3MKVA 3EWDA 3EWWA 5FJJA 8GEPA 2PGEA 3SCNA 2ZE3A 3NZGA 1ISXA 2QYGA 1HJWA 2GWNA 3NA8A 4DELA 1XH2A 3TQKA 4V27A 3S2MA 3EDJA 4RNIA 3U5UA 1ZAHA 4Q4RA 5LA2A 1E72M 4CCCA 5AC6A 2VX5A 2YB1A 3QY7A 3SSZA 3W2JA 4QEEA 1H7XA 4O0ZA 3QN3A 2WSPA 3A4WA 2X30A 3PNZA 1EQCA 3PG9A 3WQVA 3N3MA 5LGZA 2RDTA 3SCUA 5A1AA 4O11A 5I3JA 2PSNA 1VKFA 3MUAA 5D37A 5AYYA 5A6AA 2YDAA 1A0CA 4IPLA 3OIHA 1ZCCA 1R3TA 2GVGA 1K03A 2NT0A 4BQ3A 5DANA 2J6XA 3KDNA 5G4HC 3I6EA 2NX1A 2XG9A 2Z29A 2E1WA 2Y5EA 1S3HA 4H9MA 3KTCA 4DBSA 3PZNA 1UKTA 4Q32A 2EPMX 1LRTA 2XH0A 3L9CA 2EXOA 3OEXA 1W1TA 4NKCA 4GUFA 1SR9A 4XVEA 3UXKA 1MQPA 1P0EA 1L6GA 3FX4A 1TWDA 3W02A 2ADAA 3WLLA 2ISSA 3ZQ9A 4Q8NA 4FLSA 1HO1A 2OZTA 4UC5A 3R1ZA 1PCKA 2IPFA 4GO8A 2UY2A 1CGYA 2G5WA 1Q6EA 3MKCA 4W8LA 4WD0A 4JIPA 1DWAM 2PB1A 3VIGA 2ZZ3A 8XIMA 3AYRA 1H63A 3M7SA 2Y5SA 4GGBA 3DIPA 5EYWA 2IQTA 3B8SA 1WE5A 2QJGA 5A6JA 3DG3A 7A3HA 1TMLA 2Z25A 2PP1A 1NOWA 3H8AA 4GBDA 1OYBA 4FI4A 2VNCA 3VUPA 3DFPA 5FD0A 1XIDA 3CPGA 4HJFA 5CPTA 3APYA 4ZL1A 3CYJA 2QJHA 1X6UA 2WSYA 1JDDA 4NJHA 2BGNE 4YTRA 1PEZA 3LI0A 1YPFA 3DG7A 5C8BB 3EDDA 3GU9A 3CL8A 1GJWA 3IGXA 4BY3A 1QDSA 1QFEA 4R7OA 3VKPA 2VXNA 5KETA 4B9YA 3S2NA 1Q2RA 2WANA 3K1DA 2Y7FA 4Z42C 3QVQA 1WCGA 2WZTA 1XCWA 2VELA 3N18A 1IWPA 5DXYA 1R3VA 5KINA 1F2JA 1DJWA 3BV4A 1EBHA 2NUYA 1UIOA 2CW6A 2EG7A 1TVNA 3OQ8A 1EO7A 1UB3A 4WSJA 3C3UA 4ENLA 3CAQA 1HIZA 4J1OA 3U0HA 4B2DD 2C71A 4QFUA 1IEWA 3GH4A 2GUYA 5LA0A 4NAEA 3GXPA 1QPRA 3AOPA 4OJYA 2RJHA 2E40A 3CQ0A 4UMCA 4C1NB 3GHTA 2ATSA 1O60A 1TJRA 4HHPA 3PZGA 1GORA 4O1EA 1LWIA 1TZZA 4H19A 1SFTA 4OTKA 1E1FA 2PDYA 1ZP4A 4A3QA 2J47A 4AZIA 5BYWA 4ZFCA 4S23A 1HJVA 2DQXA 2RKXA 5K9CA 4M82A 4MWAA 3LDVA 3OR1A 1KM3A 4JZ5A 1WYIA 4EXAA 4UXDA 2G3IA 2I5GA 3RF9A 4IUGA 1JZ7A 3AS2A 1HKJA 1VPXA 2QW5A 4O52A 3WEMA 4NZ5A 3EB4A 3HGSA 2V69A 4NL1A 3LB0A 1HL8A 1ZZMA 4DYEA 3UG4A 4YXGA 3SURA 3ZT7A 2G37A 2WBGA 4PTWA 3PBMA 4TO8A 2OWWA 3U8GA 3ECQA 4CN4A 3Q65A 3VKQA 1KXHA 1ITXA 3BSHA 4ASTA 2EPKX 1XDJA 1NFBA 1JI2A 2ZVRA 3F2DA 3I10A 2HXTA 1DYSA 4O19A 3WKZA 2B31A 1WDDA 2D3LA 4Y2WA 4W84A 4MTVA 4K3ZA 2V0TA 4CN6A 5AYZA 3P82A 4XAYA 2E28A 4US5D 4C90A 2C15A 5LXEA 2O4MA 3LV5A 3EXRA 1BKHA 4I7WA 3AFBA 5C0QA 4I7UA 1PKNA 2I14A 3M5VA 1CGXA 1VHCA 4KCVA 3WQPA 1F73A 3AWNA 2NV2A 4HVXA 2JFEX 1Q6RA 3R8GA 1GQLA 4RV8A 1WZAA 3ITGA 3EOOA 3P60A 3QZ6A 3CHVA 3K4AA 4FF5A 4PUMA 4EX4A 4PMJA 3GFYA 4H41A 2CLIA 3VKDA 1E1CA 2JEQA 2CU0A 5IHSA 1JR1A 4KGJA 4POCA 1E9YB 2BODX 2ZRWA 3WLRA 1KRCC 3L5LA 3B8VA 2XSBA 3RCMA 4N6FA 1K9DA 2DZUA 2EPOA 3N6HA 4TV5A 4GY1A 1SPQA 3MCNA 3MT1A 3C52A 3LMYA 5BOFA 4WJXA 5CSSA 2HPMA 4X2RA 1VENA 1XDMA 4AW7A 1XLCA 3UGVA 3BK0A 5KZ6A 1A0EA 1LRQA 3LSBA 2XN1A 3W86A 4JYDA 5CXPA 5D03A 5LYRA 4PTMA 4EP8C 2QPXA 1SW7A 4FLQA 2VD8A 3WD2A 3GZ3A 1H1YA 1A5BA 1TKKA 3SFKA 3AMKA 2DH2A 3IIOA 3UZ5A 2DZBA 3ONBA 5I3DA 4BI7A 4JL2A 1LP6A 1JRCA 2BP1A 3M0IA 3ZR4A 4WOZA 4HZ6A 4P7RA 4ML4A 4OHQA 4C6BA 3BG3A 4AAJA 3IS4A 4R3UA 2V68A 2ABBA 3VI2A 2R1LA 2AGKA 1J12A 2ZVIA 4F2UA 3A3HA 4D1JA 4CU6A 4OZOA 5I02A 2G0WA 3WQWA 4PMZA 4HSHA 4RZ4A 3RFAA 1QNPA 1RK6A 2XIQA 3NQ7A 2E1DA 2V3GA 1H5YA 5D8WA 4AYSA 2CHNA 3DFSA 3KVMA 4DBWA 5K2ZA 1EXBA 4QXIA 4E5TA 4L6OA 1JPIA 3VGGA 1UWSA 3PB0A 1LLWA 4XZLX 4JEQA 3PWAA 1D7FA 3PG8A 4N4PA 3PBGA 3A23A 4AWTA 3GR8A 1O5RA 1VIWA 3M5ZA 3MP3A 2GUBA 5K7JA 1TJ0A 4NAEB 4G1KA 3UESA 2YL9A 2X1TA 2OKTA 1Q8JA 4KRUA 3N4EA 5C7VA 3NWRA 3MANA 5FJUA 1HKVA 4UTTC 4E4UA 4RDWA 4AWSA 1TYGA 4GUGA 4E4PA 3TEVA 1UKPA 1FHLA 4RX0A 2PS2A 2QT3A 3AO0A 1R46A 3L5AA 4AVOA 3S3GA 3OBAA 1Z69A 1MNZA 1ZFJA 2F6XA 3GVVA 3W2UA 5H8PA 2CIPA 1A3HA 3WX7A 4AZHA 1E9ZB 3CZGA 3CK5A 4JFSA 4MWAB 4WQ6A 4HNTA 3OR1B 1FCVA 1PHWA 4FLRA 1ADSA 3IPWA 2PURA 2C3ZA 1HJUA 1LTDA 4DYKA 5C6MA 1MW0A 1V02A 3QHOA 3TNOA 3DI1A 4OKDA 4GVGA 1M68A 4LS0A 1AFSA 1R86A 4TXEA 2DVUA 1GVOA 4ZSUA 3HFTA 1H51A 2WMIB 2WNQA 3ITCA 4MUZA 1NWUA 2HVOA 1UQYA 3VLXA 1FWTA 3OVPA 1A50A 2D3NA 3LBOA 2VGGA 2E0PA 5ABTA 2ZC8A 1XYBA 3PM6A 1W31A 4JTSA 3ITTA 3SIMA 4JTGA 5D9MA 3PUDA 1AMKA 3TYEA 2VZTA 4U5IA 2ZRXA 1XGZA 3AJXA 1X97A 4QE4A 3OG2A 1OIMA 1UCWA 3UR5A 3VKSA 4IQJA 5AHLA 3MM6A 2X1IA 4GQQA 4YVXA 1OCNA 2WZIA 2XSXA 1PL9A 3OGRA 4AD4A 2PWHA 2JKEA 4E3TA 4QCEA 5CGMA 4PMUA 5LNVA 1YXDA 3TA6A 4IHCA 1MW1A 2C7FA 3EPOA 3HA1A 3GNXA 5T9BG 2HE5A 1P0NA 1E1CB 2B7NA 3UR2A 1TUFA 4IQLA 4NIRA 4REQA 3LPGA 1C90A 5LIYX 3T2QA 1AVAA 2WLYA 2I57A 4J7RA 2WNZA 3PR2A 2PDCA 4KESA 5DMNA 3G2GA 1KRBC 1UD4A 3CV6A 3A5FA 1BXBA 4PB4A 3SCSA 3CEUA 1G4TA 2DZAA 4I3GA 4RK8A 3T81A 4HNLA 4XUYA 4JTQA 4AEEA 3U5YA 1W3LA 4FNUA 3K8KA 2QCNA 2VGFA 2DDXA 1WDWA 3AS1A 5G1TA 1V5XA 3SUUA 1LQAA 4O4WA 4FS9A 2G4JA 1I60A 4QS5A 1E4MM 2OG9A 3WUGA 4A8LA 1HW6A 1MYRA 1GOMA 2YBUA 1BF6A 5ABGA 3QMRA 5EFFA 4UFHA 4XKYB 1GPWA 4GC3A 3LCXA 2NQLA 3S2JA 1L0PA 4DZ5A 1UYQA 4GUHA 1GOIA 2REQA 4IGSA 1WO2A 1XLAA 4WX2A 4PCTA 5HQEA 4C6EA 2BXZA 3EWCA 2KX9A 2P0IA 3FYPA 2R14A 1G6CA 1N82A 5J5RA 3WNPA 3MMAA 3G0XA 3Q94A 5K9DA 3A24A 3C0QA 1K4HA 4LUSA 4Z2IA 4GYKA 3WLKX 1VYRA 1Z8AA 3WBWA 3W0KA 2X41A 5DX7A 1DIKA 3LRMA 3AROA 5JUVA 4XO6A 4H1ZA 3PAOA 5EMUA 4JQ2A 1EF3A 1HKKA 1EHNA 2ZA1A 3NQDA 4N9BA 4FEZA 1E0VA 1RBLA 3NSMA 2IKIA 2GVLA 4BI5A 1XBVA 2XPKA 3WQCA 3ISIX 4HMCA 3AJ7A 3VFCA 3NIYA 5GVJA 2GJLA 5HUPA 3HJZA 4N42A 1EXPA 3CUJA 1F3WA 2NV1A 1LDCA 4EAYA 4QP0A 2G50A 5CCZA 1TPUA 1YXCA 4A05A 4FNPA 4KFPA 2Y63A 4C6DA 3LSCA 1OX6A 2QVNA 3VOFA 3PZTA 3USBA 3NO1A 4YJ5A 5HMDA 5F4WA 4HMNA 4EWJA 3M0KA 3AAMA 3GIPA 3THDA 3TUUA 2QDHA 3OU8A 4RXGA 3W01A 2PBGA 2H90A 3ABSA 4V2XA 2YDRA 1AD4A 5A8PA 1NWSA 3IVTA 3SY1A 2O56A 1Q6OA 3RX3A 1M7JA 2NVDA 1SQ7A 4XBSA 3D46A 3BSGA 3WBYA 4NVTA 3UXIA 4HZ7A 3S83A 1FUYA 3VGHA 5MHBA 1NQKA 1AH0A 2R1KA 5IOBA 1B9ZA 2CITA 2OSYA 3L5MA 4IZGA 3WQGA 1KTCA 3UA3A 1C92A 4ROPA 2JGYA 1JPHA 3WJSA 2NQJA 1AK5A 2XGIA 1R6WA 3MM6B 3FKRA 2O4QA 2NX9A 1MDRA 3ZR5A 1UH2A 1X7IA 2ZBTA 2J66A 5A8OA 1A4MA 4MB5A 1PHQA 1QPNA 1PB0A 4H9TA 5I03A 1VYPX 1HVQA 3SGGA 4D6CA 3JRKA 4JGDA 4TTGA 4OV9A 2FGLA 3H54A 2A3AA 1FH8A 2INFA 4HB7A 7ODCA 1GKQA 1JPDX 4REQB 5CZJA 4CQDA 4UTTA 3RLHA 1E6XM 4C6KA 1X7FA 4KF1A 3TTOA 2DPEA 1W3KA 1KBIA 1SSDA 1EWDA 1AW2A 4X3ZA 1T7LA 2HK0A 3L4YA 1V3IA 5CJ5A 1V3KA 3WQ5A 3B0HA 2POZA 5E0FA 4B92A 1LJYA 1IE7C 2PF0A 3QC3A 2YDQA 2VFFA 4XZMX 2FPYA 3W28A 4KEVA 2Y0FA 1RQHA 2PWDA 1Z32X 4D6IA 4IMAA 3SUSA 4ADSA 5AYBA 2XH7A 3RM4A 3CUFA 3WSUA 2UZ9A 4D1IA 2DGAA 2ZDRA 3VILA 3SCWA 1CEOA 4J35A 5MF5A 1YTKA 1LLOA 4B5XA 3TXZA 4I5XA 4JX6A 4DAIA 4XZBA 3NZRA 4M7SA 2REQB 3AXHA 1IZCA 1KNWA 4K39A 1B3XA 1WBJA 1XLDA 2QXWA 1VS1A 4Z2HA 1KXVA 3EEGA 3FA4A 7XIMA 1TCMA 1VRXA 2BTMA 1KA9F 1MZHA 1ICQA 2PGFA 3UJFA 3MMAB 4TIMA 1I2NA 2XH4A 3FYYA 3UXDA 3W53A 5CBJA 4LF2A 2O55A 4AVFA 4LUSB 3PBYA 1XYLA 4LCRA 4V1YA 4ACYA 4B5NA 5FESA 4UB9A 2YSWA 2E6YA 4MDOA 1NU5A 3R25A 4UFIA 3TNBA 3KTXA 4FP1A 5DF0A 1OGBA 3AXIA 2D22A 2DIKA 2QV5A 3GR4A 1NELA 1Y0EA 4C6LA 5A2BA 3ZFHA 1Y65A 4PA8A 1NQ6A 1SW3A 2ZADA 1W5OA 4TUFA 3DEQA 3PJXA 4UIOA 2Y89A 2E7FA 2FVMA 1L6FA 1JYNA 2VD9A 5AHNA 3WMSA 2HQAA 4H9VA 4HZMA 1OY0A 1GYMA 1EOMA 3IK2A 4XBJA 4Y9PA 3MP5A 2MNRA 2PLJA 4GZJA 3GRIA 2ZZ5A 5ABFA 4JFVA 3FAXA 1DWFM 3WBAA 2QJMA 1F6PA 1E40A 3GG0A 2OYLA 1XFCA 3GXTA 3FA3A 3NXLA 4GIRA 5CZSA 2W79A 2WJEA 2J88A 2FDMA 1V7YA 4GI9A 5A8NA 2FZDA 2NXIA 2D69A 2HROA 1P4CA 3AMGA 2BBFA 1OFPA 2Y24A 4DJEC 4B91A 1FP9A 1GVRA 3H7RA 1R9ZA 1S2UA 2YKKA 4RPPA 4H8UA 5IFTA 3EOUA 3C2FA 1E4IA 1TJ2A 4A3RA 3BSMA 1GOQA 1J96A 1GEQA 3C2RA 3ARYA 3HPXA 3EZ4A 2F2KA 4IFOA 4WY0A 3UG5A 3EKGA 2V8ZA 3LI1A 1EIBA 2YBTA 4MJ4A 4P8XA 4Z1AA 2TSYA 4BA0A 1H62A 4DPQA 2QGHA 1DXIA 2OLHA 4GWEA 4A6GA 3ARXA 1KCLA 1V8EA 3ARQA 1FWIC 1ISVA 1U1HA 3EKLA 3GXMA 4PMQA 1P43A 3VC5A 1QOQA 1RCOB 1JUKA 3NJ3A 4QNWA 2FYMA 4QLJA 1D8WA 3I3BA 1K8XA 4JKKA 1JZ8A 3C2EA 2X05A 4C6PA 2OR2A 1WA3A 1XISA 3H4XA 1BF2A 3BJTA 4K68A 1AQFA 1VFFA 3PZQA 5KITA 1E9LA 1VCGA 3RR4A 4D6JA 1F8IA 3WL1A 2ZUTA 4LY8A 1X6NA 2CBIA 3SB0A 4OUEA 1RJRA 1B1YA 3SR7A 3T6CA 3NDOA 3SCOA 4BR1A 4ZCWA 1MEHA 1W3TA 2Q3RA 2WMGA 3ITLA 2YA1A 3IUIA 4QDMA 2HNEA 3LMZA 4R88A 1R87A 2WOQA 3SQLA 2E3ZA 4NILA 2VOTA 3AHTA 3W7EA 1JIBA 3IJ8A 4I9TA 2E6FA 5A2AA 4UTWA 3PBWA 4B3ZA 4HHLA 3DUGA 5FEPA 2OQHA 3W1TA 3K4WA 2ISFA 4Z1DA 2PLMA 4RW3A 3TQPA 3DCPA 2H9AB 1XLHA 3QV7A 4MJZA 3H53A 5KZEA 1NDWA 1S2WA 3EPMA 1F3TA 1YQ2A 4KWUA 1JL8A 1HO4A 1ZENA 2HBVA 1LG2A 3W27A 1I45A 1MMFA 1PTGA 1VBGA 2TRSA 3TLLA 5J5DA 4H01A 3PZMA 2BVDA 4G2DA 3QSTA 1GONA 2NT1A 4F2TA 3ZJ7A 1DBTA 1E5JA 2UY3A 2YCLA 3DG6A 3CYVA 3QFEA 4PL1A 1UC4A 3CHFA 2C0AA 4NYUA 3HQPA 1F76A 3N73A 5KZMA 1P5BA 2AQOA 2OVLA 4GYPC 4Q6JA 3W1AA 1DJQA 1SGJA 1ADDA 1ENUA 4FSAA 3PZOA 1ZALA 5EFDA 1PWMA 2Y70A 3OPSA 1CYGA 5REQA 2BGSA 2QF8A 5ABFB 4IH3A 4UTJA 3CH9A 6CGTA 3WG6A 3MQTA 4ZTYA 1QXLA 4Y9MA 2PDQA 5CC3A 2ODOA 5BU9A 5I24A 3KS6A 4UTFA 5D04C 2PRLA 1SJDA 3OZOA 4H6RA 1EJSC 4F2BA 4XAZA 4JTTA 2QDDA 3OZMA 2CZ5A 3S5SA 3W2NA 5E6ZA 3B8WA 1D2KA 3LM3A 4KCUA 4YMZA 2X0SA 3TYAA 4GNVA 3PUOA 4Z2KA 1RHCA 1J18A 4GIAA 2EHHA 3BLIA 4IL2A 1PX8A 5A6BD 2Z26A 1PWLA 1LRNA 2O7SA 3WLIA 2VUYA 1RA5A 1PIGA 3GNNA 3PBVA 3CS2A 4QHRA 4WY0B 4H7CA