4S3DA

Ispg in complex with ppi
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 137
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3dA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3dA02
3MMAB 2Y5JA 4O1EA 2H9AA 1TWWA 4G9PA 1TWZA 3H23A 3TZFA 2XSJA 3H2NA 3OR2A 4C1NA 3H2FA 4MWAD 4HTRA 3VKPA 1Q7ZA 3VKTA 3MMAA 1AD4A 1AJ0A 1Q7QA 3MMCA 1F6YA 2XSJB 3MCNA 3TYAA 3VKRA 3VLXA 6GEPA 4C1NB 3H2EA 3MM8B 1TWSA 4HB7A 2E7FA 4DJFD 1AJZA 2Y0FA 2AOPA 3MM5A 3MM6B 3MCOA 3B0JA 3B0NA 5GEPA 3NOYA 3MMCB 4O0QA 1TX2A 4S38A 3TR9A 3TYEA 4S3EA 3MM8A 2AKJA 3H26A 3B0GA 3MM5B 3MM6A 3TYUA 3BOLA 3H2AA 3B0HA 3H2CA 4S3DA 2YCIX 4DAFA 2V4JA 4D8ZA 3MM9A 3TZNA 3B0LA 3H2MA 4DJED 2GEPA 4GEPA 3H2OA 1Q7MA 3VLZA 4CCZA 2OGYA 4MWAC 4S3CA 3AOPA 5JQ9A 1Q8JA 4DJEA 3K13A 3H21A 3GEOA 4PZVA 3TYBA 2V4JB 2VP8A 3MM9B 4AOPA 4MWAA 3BOFA 3MMBB 4NILA 4DJDD 1AD1A 4S3AA 1ZJ8A 4DB7A 2DZAA 2YCKX 1AOPA 8GEPA 4DJFC 3VKSA 3H24A 4NIRA 3H22A 3VKQA 2DQWA 2VEFA 3OR1A 3MM7B 4MWAB 4NL1A 4S3FA 3B0MA 4DJFA 3MMBA 4D9PA 1ZJ9A 3MCMA 5AOPA 4DJDC 3VM1A 4MWAE 2YCLB 4S23A 1EYEA 2VEGA 4D8AA 3VLYA 4NHVA 1AJ2A 3OR1B 3MM7A 7GEPA 4S39A 1Q8AA 4DJDA 2H9AB 3V5OA 4DJEC 3TYCA 4O1FA 3TYDA 3TYZA 4G39A 2DZBA 3VM0A 4DAIA 2BMBA 3OR2B 2YCLA 1TX0A 2YCJA 4G38A 1Q85A 4S3BA 2Y5SA
chains in the Genus database with same CATH superfamily
1UR9A 3G8EA 4EF8A 3IEBA 3ZVIA 3WEOA 4CNNA 3TXVA 1I4NA 2E28A 2VDGA 4YVXA 2V8ZA 3NEHA 1ME7A 5C9RA 1XLDA 4NYUA 1XCWA 3CPRA 4LU0A 2DSZA 3KWXA 3SCOA 4PMJA 3L67A 4O52A 1GORA 3CV2A 1W32A 2XDFA 3W2UA 2HROA 3QXBA 5CGQA 3QKEA 3SCPA 1RY8A 4JHZA 4CEUC 4S3KA 4JKMA 3EGJA 5TF0A 3Q37A 3AROA 2OTDA 2OZ0A 3ARUA 4W5ZA 1H1ZA 2PWUA 3W29A 5ABFB 3AQUA 4JN6A 3H7UA 4WK9A 4K1WA 2GGJA 4JAWA 1BAGA 3VLZA 3GTIA 2Q8XA 2E1WA 1KWKA 2GUUA 4M80A 1UOZA 4JPGA 5FSDC 3HPFA 4NZJA 4EKJA 5KZMA 1B9BA 3FW6A 4P7RA 3C2OA 3KRZA 3IV3A 3VIJA 5LKYA 1WZAA 1KGXA 3GXNA 3HFYA 4GNJA 3O06A 1CNVA 1VF8A 3ITCA 2INZA 1KXQA 2KZHA 1H7OA 2DQXA 5CPNA 2HPIA 2R1KA 4QE4A 4GCXA 1J01A 3UZWA 3M7SA 4L4PA 3D6NA 3GDBA 3VOJA 2V3EA 2YCLA 4UCGA 4QE1A 1FA2A 3MMAB 1WKFA 1XDJA 2ACSA 2H9AA 3A23A 4C6OA 1PCWA 1BHGA 4PTNA 1PX4A 5EFFA 4LJ3A 2XH7A 5FAJA 3W1MA 5C9ZA 1Q7ZA 2DP3A 1VFHA 1ESWA 3ZWTA 3MHUA 1Z89A 4JTFA 3K2GA 4M24A 1U22A 4NXSA 1IR2A 2W4XA 3G0XA 1F07A 4M3PA 1U2YA 4LW7A 2EPLX 3WH9A 3NTYA 1VPQA 3GXTA 4FO4A 3G6LA 2C6QA 1A5BA 1NH6A 2ZWZA 2CBJA 2C0HA 2WMIA 4EXAA 2ZX9A 4KETA 5F2MA 2OT1A 4R7JA 3FVDA 4GQGA 1FWFC 2WKGA 4QSFA 1YLVA 2JIWA 3G3MA 3VIKA 3QY8A 1HFBA 1OT1A 3H8AA 5MKGB 4I5RA 1OWQA 2PDMA 3JUGA 1PL9A 4Y6GA 1IQ8A 1RQHA 1LUCB 3BL3A 4NJKA 4D6FA 2WOQA 4R88A 4GZIA 3NZ1A 4LOCA 2WLZA 4H6QA 1EJVC 3VNDA 4M6VA 2OLHA 4DYJA 1M68A 4ACZB 4AXNA 1T99A 3GD6A 1TR1A 4H9UA 5BOOA 1E6QM 3CT2A 3KS6A 3N29A 4FNUA 1XIEA 2R1PA 4AY7A 3S1XA 4CCDA 4Y9NA 3GXIA 3W24A 4RNFA 2IQTA 3LBOA 4B5XA 5DCDA 3WQ8A 4PTWA 3WY1A 2PRMA 3VCCA 1WBJA 4RXFA 1QHPA 2OJPA 3WDPP 1UD8A 3LDVA 2ZX8A 1KXTA 5CZ0A 1GG1A 2CESA 3R1ZA 4C5ZA 2Z1WA 3AXMA 1VS1A 2ZQ0A 2QCNA 3S46A 3VD5A 5KZEA 2FGZA 1OD0A 1BF2A 2V30A 2VOTA 4R9OA 5G1MA 1X96A 3UYIA 5I23A 3AAMA 3A4WA 3NA8A 2XGBA 4UFMA 1DPMA 3NZPA 4RV8A 2ACQA 3KRBA 3CM4A 3WDQA 5DX7A 2FGBA 1NIUA 2YW4A 2RH9A 1R3QA 3PTKA 4NJIA 4AOPA 3BO9A 3W3OA 1LJYA 4ERAA 4URIA 4K8HA 1H61A 3ZSSA 2JIEA 3GY1A 4DO5A 1PWLA 2E9LA 4UTUA 4OBSA 3PPFA 4MSSA 1YPIA 1CIUA 3TOPA 5IOBA 4X9YA 1E9ZB 1W3TA 1BYDA 1HJXA 2UY3A 1GOKA 5FSEC 3QJAA 3HU7A 4O8AA 4UTKA 1OB0A 2WHLA 2Q01A 1RBAA 1OFQA 3PBMA 2RGLA 2YFNA 1QHOA 2D0FA 1H3GA 1I2PA 2W5FA 4PL2A 5AVNA 1UJQA 1O68A 3OG3A 1L6GA 3IGUA 3QZ6A 4Q4RA 5HNRA 5T9BG 2J8TA 4IUOA 3PBUA 3USBA 3QPZA 3OYZA 1RCOB 4P7NA 3DKLA 4V2XA 1QBAA 3LYEA 1TZZA 4B16A 5LA0A 1XIGA 4AHPA 5CC6A 3SBFA 1WDRA 2D0GA 1UD5A 4NZCA 1AVAA 1E5NA 3VKKA 5K4ZA 2G96A 3WQDA 1VEPA 3A47A 4GZ7A 4C65A 3V0TA 4LX4A 1W91A 1EUNA 4NX5A 3PZGA 3CIVA 2NX9A 3VE7A 3N4AA 4G6CA 3WLLA 1ISZA 2XIMA 1JD9A 4FZIA 4GC4A 3KBJA 4JTEA 3UWWA 2ZRWA 2BP1A 2DZAA 3WK0A 7PTDA 1LBLA 2FTWA 3VD4A 3BLOA 1CXIA 3PANA 1ITCA 1GONA 4AISA 5EYWA 2WNQA 3PPHA 3VA8A 4L1WA 4QS6A 2X42A 1UA7A 1DIEA 4QROA 1B31A 1HG3A 4J7RA 3MUIA 2OQLA 2A3HA 2BX7A 3TKFA 5GPRA 3ANUA 3WQ6A 3O2LA 5H1WA 3PUDA 3P93A 3VIHA 4M1RA 3BTNA 3DI1A 1FFQA 1XRSA 4P7OA 2GFTA 1WOBA 5K9DA 1AH0A 2W27A 3B04A 2CLKA 3VPLA 2V5CA 5CPMA 1K77A 5H91A 2ZE0A 1NP2A 2OXNA 1W5QA 4QNEA 1CB2A 1E4MM 4YMZA 4O53A 4J3ZA 4QISA 3W2MA 4M8UA 4WCJA 3UVAA 1P7TB 4M1BA 2BODX 5DBUA 1IIGA 3H2AA 2P1FA 1YQ2A 1JI1A 3FXYA 4J2MA 1LWJA 2XFYA 1O5QA 2BVWA 3TTOA 3AZRA 4QM1A 1K7EA 3ZM8A 4KEMA 4ONVA 1WYIA 3O16A 4KFNA 2VHLA 5BWFA 4W7UA 1EQCA 2WHJA 4B9YA 3FY1A 1BYBA 1V03A 3MM7B 4RX0A 1JFHA 2F8QA 4J40A 2X1TA 2GJRA 4HPGA 5BRQA 3D47A 4B90A 4RNIA 2E8ZA 1KFKA 1P0NA 1HJSA 4EACA 4HYVA 2XG9A 4XWUA 4NKCA 1HUVA 2NWSA 3IPWA 1E6SM 3CAVA 2PDNA 2WVTA 4TTUA 2PLMA 2QJHA 2FFIA 5DEZA 3E0IA 3F4WA 3FNDA 3HN3A 3M41A 3KXQA 5I3GA 1JQVA 3KOZA 3MZNA 3ARZA 4BR1A 3WQ5A 3HTWA 2OZ3A 3A4XA 2C3ZA 1TPUA 2XZ9A 3WKZA 5K2ZA 3LCIA 3TYEA 5ABHA 1OC5A 3MWCA 4L6HA 4UNIA 1R3RA 5RUBA 1PE1A 2W3ZA 4GX8A 1PZ1A 2O0TA 1E0UA 4ZSUA 4IL2A 2B0MA 1RK6A 2VURA 2DSKA 2OGYA 5G2IA 3ZFHA 3S5YA 2EF9A 3C2RA 4NT0A 2ZXDA 3OG2A 1RH9A 4JEQA 2BHZA 4YYFA 1X1NA 3RX4A 4US5A 2FTPA 4XK2A 3KBNA 2WPBA 1PX8A 4OV9A 3TFCA 1DJQA 1X8FA 1A5KC 3TSMA 3BMXA 3WK1A 3RJYA 1QI5A 3BLIA 2RDTA 4LXFA 3M5ZA 1OX6A 1XUZA 3W7HA 3VLYA 4Q8MA 4AVNA 1QMLA 5AHEA 3T4CA 2V81A 1RP9A 3G5EA 4Y9OA 3V35A 4B3KA 2QF8A 1PBGA 3KW3A 3ANVA 4C6QA 4H8VA 1M41A 4HYRA 5C7VA 4Q8WA 1PUDA 4FX7A 1UBSA 1NF0A 1S2UA 3VNZA 3SIZA 1MW0A 3W2NA 4EF9A 4WEVX 3NWRA 3VKBA 2UY5A 3GAKA 5E9AA 2GQ3A 3M0XA 1MO0A 4KPLA 4ATDA 4RV3A 5C70A 2DZSA 4XZIA 4WSJA 1VCVA 4CNOA 4GZJA 1E71M 1RBOB 5FJRA 1ISYA 1Z3NA 4M56A 3R8GA 2RGMA 3LSBA 1OFBA 3W7PA 2PDPA 4NF7A 1C91A 3LHUA 1UR3M 1Q8JA 3PG9A 4HSOA 4IMGA 2V5JA 4W8LA 1PZ2A 3UW6A 1TJ2A 4AMCA 5DT7A 4FNSA 3WBXA 1H51A 3KS5A 4NVTA 2Y85A 5CZKA 1J0ZA 1FOBA 1Q65A 3WIJA 4LUSB 2WJZA 2BWGA 4LC8A 4WKFA 3SSZA 1H09A 2I7GA 2I9EA 3AZSA 3UCCA 5A6LA 4JTAA 2W61A 3ZJKA 3QMSA 1GTHA 3NVTA 4AEFA 2A3CA 3L4XA 5AB3A 2E09A 3CWNA 5D9PA 4DJDA 1NFBA 3W4RA 1BVWA 4DEFA 2X0HA 4F48A 3L2IA 2QCEA 3K1GA 3SCUA 3D5HA 1R7OA 1JVNA 1TR9A 3ONCA 4PEKA 4KWSA 3PULA 4IPPA 1E6NA 2DPEA 2NWRA 1OY0A 3HQNA 1VIWA 1SMAA 3EA1A 3OGSA 4HCLA 3R12A 1IXNA 3PJWA 4ZBCA 3MCNA 1YPFA 2J9YA 2CLIA 3RCYA 3LM3A 5HPCA 3EB2A 4MDOA 4CU7A 3PZOA 1SZFA 4DBSA 3MP3A 1PPIA 2CLLA 3W01A 1AH4A 4DBEA 1W9XA 1XL9A 3N2XA 1KM0A 2ONEA 3DIPA 3F4NA 4R7OA 4JDYA 2HEJA 3IGXA 5I7GA 1DHPA 3GHTA 4S2CA 3LRKA 4Q8PA 4UZSA 1DYSA 2INEA 4TR9A 1ZJ8A 3QFEA 3BQ6A 1FCUA 3GG1A 3VNMA 3FDKA 1GNXA 3J7HA 2VUNA 3W73A 1ZJ9A 2WVUA 1OC7A 4G1KA 1UIOA 4A2RA 4LBSA 1OYAA 4J5NA 3DFTA 1HJQA 3O0KA 2PTYA 2W6RA 5CGMA 3B8TA 2IXVA 2Z24A 4HK6A 2CZFA 1W2PA 3GC2A 3M47A 3KTCA 3QGAC 2GUYA 4UTIA 4PMRA 1XV8A 4XSMA 1FWSA 4O8RA 3TP4A 2FPVA 3R8RA 4FOUA 4A22A 1ME9A 4M5PA 4HTRA 4KCUA 3CHFA 2I1OA 1IR1A 3RGTA 3W00A 1B3XA 3B9AA 1TJRA 2Z25A 4HD5A 5LXXA 3ITLA 4H8NA 5A2BA 1X7FA 3DC8A 3W87A 1OGGA 1UMYA 5BXTA 5AC4A 1GJPA 2V2CA 2YLAA 3I4KA 3OZYA 3BOLA 3UGRA 3B9NA 1WE5A 4YTSA 4QAIA 2Z1BA 2O9RA 3MYPA 4TX8A 2PTZA 3AUOA 3W7QA 4O1BA 4W93A 3LI1A 4H83A 4RLIA 2H3BA 1KM4A 3AMLA 1DKWA 1QWKA 4Q4MA 1K8CA 3GBEA 4Z2GA 3SQSA 1FHLA 3BURA 4L9YA 5A6SA 4CD5A 3LMZA 3PTDA 1AUSL 1G7VA 2OQHA 2VMFA 4UR8A 5E6YA 1P5BA 4HU3A 1WDPA 5AOPA 3RIKA 3CHDA 4NAFA 3BLDA 3CUIA 2J79A 3V0SA 4AMAA 4LQ1A 4AWTA 4Z42C 1EYWA 5JBDA 2YXGA 2PDCA 3PBVA 2D20A 2QIWA 1BRLB 1OZMA 4HA0A 4F9DA 3WJYA 4S3BA 4JIEA 4A8NA 5HMEA 1GEHA 3VMOA 2Y8KA 3HFTA 1QTWA 1UWUA 4L4OA 3MSDA 1GOOA 3H2NA 5BU9A 4AAJA 4C1NA 2A7PA 4MWAD 3FSTA 1KR0A 5HQMA 3KL3A 3AFBA 1C93A 3UJRA 4TX9A 3QFWA 5CLTA 5AYIA 3IUHA 3GG7A 1C92A 4H8HA 3WLJA 4A21A 1PDYA 3UETA 1JCMP 2QUMA 4JTIA 5D2WA 1RPXA 2CETA 4XKYA 4K68A 4AIBA 1VPXA 4I5UA 1WZLA 3GVGA 2GK1B 4S3DA 2RDUA 3OQEA 1EGVA 1R3WA 4WIWA 3A5FA 4Q4SA 1NWTA 3WH6A 5XINA 5CSRA 1MEIA 1TIWA 3OHMB 3ABZA 4AY1A 1M3UA 4Q6XA 4PUJA 4JDBA 1QNVA 3P14A 3WBWA 3WD4A 4F0KA 5D03A 2CHNA 2QJNA 3GM8A 4H9ZA 3PUGA 1IZCA 1KKOA 3N6HA 1ELSA 4LAZA 4ZOAA 1UKSA 2DVTA 3EZ4A 1V4YA 1FXQA 2FHFA 3IIVA 2QV5A 4QX4A 2PAJA 4LCQA 5FCZA 4WDXA 1XUUA 3PWIA 3E0FA 3H70A 1I2QA 4YVVA 4X2RA 1J9YA 3IK2A 3W82A 3M0YA 4OKDA 1FQ0A 2ATMA 4GXWA 3D3AA 2NV9A 3RK8A 1A5OC 4GBDA 4C6FA 4GQBA 5D30A 2C91A 2V82A 5LA1A 3QY7A 3KZPA 1TMLA 3ARPA 5I03A 4QJ5B 2ZX6A 4KWWA 3C56A 1DWJM 3BC9A 2P0IA 1K1DA 1TJ0A 2ZZ1A 4GVFA 3NQ8A 1JF6A 3W23A 3C0SA 1H0GA 5A6JA 3GNPA 2G4FA 1DL3A 4MFEA 3TE9A 4GXPA 2B7OA 4BKNA 1KBBA 1NVMA 3HGOA 4IT1A 4H9YA 3SB0A 3TSDA 2OMAA 1CBGA 2Z6IA 3CS2A 1WZKA 4Q8QA 4UFJA 4MAVA 3G0UA 4PMZA 4IP5A 1BVNP 2ICSA 4FLRA 3SIMA 3LY0A 4JKKA 3FEQA 5U7SA 1IT0A 1TYGA 1A3XA 3M4HA 3CXOA 4ZO8A 4GNVA 4R3UA 5I6SA 4D6JA 4XAGA 3KHDA 4BHYA 1A0CA 4XB3A 4PCPA 4AZ6A 1GHRA 4S23A 1RY0A 2FIQA 4AG0A 3CIXA 3THDA 1M1BA 4H9VA 1TX0A 4BY3A 4DLMA 3WLHA 3G22A 4NX0A 1BXCA 3NSXA 1AQMA 2YB4A 1XH1A 3NL5A 1SFLA 4MKVA 1TPFA 1EO5A 2ACRA 2FVLA 3UJSA 4D1IA 2ZDRA 2Y88A 2HBVA 4ERGA 2OPJA 1UD6A 4F0HA 4ML9A 4ZFCA 4WR3A 3FK4A 3NQBA 5HUPA 2ZTKA 1G0CA 1X98A 4UTWA 4HN8A 1PHQA 4NP7A 3B4UA 4YLWA 3F2CA 2H3DA 4F40A 1X38A 2VZVA 4WUIA 1FBAA 3ALGA 3MHGA 4W5UA 2CW6A 3RPMA 1D8WA 3T42A 1H7PA 4D8ZA 6PTDA 3QPYA 3DFPA 3BGAA 1OX5A 3M0VA 2BY3A 5LIWX 2OEKA 1GWJA 3AALA 3NO5A 4J28A 4QDMA 2VFEA 1WAUA 4KS0A 3DC0A 1M7OA 3OPSA 2CXEA 4ML4A 2O9PA 2F7FA 4S3FA 2F6XA 1BFNA 4Y90A 2WB5A 4LUJA 4NG3A 1EZWA 3AYRA 4ATWA 1Q6DA 3NR0A 3P5YA 1XM3A 1QDSA 4DJEC 4QJ1A 3LHZA 2NVAA 4O1FA 3EDKA 3L0NA 3RCNA 4DVOA 3BJTA 3AHYA 5HNTA 1X1OA 3SJNA 3WLIA 3CLMA 5BOFA 1Q2SA 3UXAA 4O12A 4LYKA 1Z8AA 1OF6A 3M0HA 3QOKA 3KDOA 1W1IE 1ITQA 3I68A 3PF3A 1ZP4A 5CH9A 4C6IA 1UQZA 3B3DA 3C8FA 5I0DA 2FDMA 4JQ4A 3LB0A 4E2OA 2DZPA 1FDJA 3O0FA 3WUFA 2X05A 1H60A 3LGDA 4JFVA 1E55A 4Z1CA 3F2DA 3QGVA 3AZTA 4HMEA 2V2DA 3RAOA 4EPDC 2REQA 3L4WA 4AF0A 3O3RA 2Z26A 2QLYA 1EUAA 1FVPA 5HWMA 1YPXA 5LNWA 5LNVA 7TIMA 3IVSA 3YPIA 4E5TA 3BOFA 1A4LA 1PHWA 2GJLA 4MJ4A 3AYTA 3PFRA 5A8MA 3GE7A 3NQMA 3QR1A 2G97A 1UR1A 5DMMA 4IP4A 1O1ZA 2XUCA 4OFCA 4WSHA 1DQXA 2J24A 3WELA 3M0ZA 2NQ5A 1VQTA 3T4WA 5CBIA 1BGGA 3WMLA 1V6UA 2PF8A 5CC7A 1BYCA 7GEPA 3XINA 2Y24A 4X2PA 1VBHA 2CLPA 2ZZ5A 4H4IA 4Z0JA 3EMQA 4IZGA 4GJ1A 1UROA 4GIEA 3WLKX 4W85A 1AA1B 3CV7A 4KERA 1IV8A 1H4PA 3AXIA 3O9NA 1UH2A 3WNLA 4Y2WA 4JQ2A 1S3HA 2P53A 1UC4A 1VHCA 3W2KA 1JD7A 1OK4A 3TC7A 4B5VA 1HJUA 3DXIA 1P48A 4GINA 4Q3MA 2O9TA 3BLFA 4IL0A 5K9XA 3IJDA 2X1SA 3H2EA 1JGMA 1JF5A 4MZ1A 3MV11 1UUQA 2PC4A 1WO2A 3HBLA 3MCOA 2I16A 1CDGA 2DZTA 3I6EA 3NG3A 4WOQA 3L4VA 4M6UA 4KIRA 3CPGA 2QMJA 4WJEA 4XTIA 2HXTA 3GZ3A 1EP2A 3DYPA 3G18A 3RHGA 3OW1A 3CL8A 4GUFA 3SO7A 4J3UA 3UPBA 3GFXA 1G69A 4C60A 1M7PA 3KLKA 2CLHA 2Z1VA 4XD6A 2VD9A 3OA5A 3P0XA 1LG1A 2QULA 3N14A 2EPKX 2I9UA 3UNDA 1SO5A 5BROA 1KQZA 4A29A 1JUBA 3E02A 3RFAA 5XIMA 4L61A 3O6YX 1QOQA 3VM1A 4M19A 2ZYFA 3WL0A 3LRLA 4FNPA 2BBFA 1CYGA 1SR0A 2HJPA 3CUFA 2DZBA 3UY8A 4ZB0A 2R1LA 2MANA 1EC8A 4Y9MA 1T7LA 1XRFA 1KCZA 4Z1DA 1EPVA 1NDZA 3S1WA 3U57A 4KEVA 3VGFA 5CSYA 4D6CA 1JZ8A 4JTRA 4MUZA 1NFGA 4QNWA 3VAVA 4UOZA 3TYAA 2YLLA 2VR4A 1JZ4A 3TTYA 2PDKA 1T8QA 1JCJA 4R9XA 3B0JA 1FDYA 2PLJA 3GVQA 3NCOA 2FLIA 1YX1A 3LPOA 2WW5A 4YL2A 4L1GA 3OZOA 2W66A 4KESA 2VNCA 4GH3A 1JAKA 1UD3A 4IJRA 4AD1A 3GYEA 2F61A 3DHDA 4JIIX 3EX1A 2VFHA 5A3HA 3CLWA 4O50A 1Z69A 3PNZA 1YXYA 4PTMA 3TU9A 1QO2A 4GISA 4ADTA 4NU7A 1W9BM 7REQA 3P8IA 4GGBA 3W1RA 1MQRA 1XBVA 3TCEA 3S1VA 1W1A1 3TTQA 2PGWA 2QCMA 2FMNA 5D2TA 3M07A 3CQKA 2PDGA 2GGEA 1XLIA 4IJCA 4CQ9A 3NQEA 3MU7A 3VGHA 3THAA 2E6YA 1KW1A 2W63A 3KLLA 2WM0A 3P2VA 3UESA 1RJRA 4HK7A 4N02A 1JYXA 4QIUA 3SN0A 4IFKA 3EDJA 4QE5A 1XDLA 2PTDA 2VVNA 3VM7A 4FP1A 3ZQ9A 4DYEA 3KVMA 2Q3OA 1LOLA 2XIIA 4UBPC 6REQB 3URQA 5D05A 2CYGA 1TTQA 5IDIA 4CQ8A 4Q8VA 3C4UA 3BZGA 4HMCA 3WQOA 3ITXA 4FOKA 1TKKA 5B7YA 1OYBA 4BF9A 2PE4A 4LBRA 1WDQA 4MHBA 4F0LA 1OFOA 4PSPA 3IAQA 1HVQA 1KFLA 3EA3A 2GJXB 4N0RA 4B91A 1M6JA 1TREA 1R9ZA 1UWIA 3ZJ8A 4O17A 4J3SA 4AD5A 2PWVA 4C7FA 2YCIX 4HKPA 2OFJA 2YFOA 3NZQA 1W1B1 1C8YA 4XUYA 4QTGA 4S3CA 5C6MA 2QDHA 3TA6A 3VFLA 5AFDA 3GR8A 1XD0A 2IKIA 3RX2A 2ZRUA 1SQ7A 3U5UA 3EWUA 3R8HA 3QV8A 1D3GA 3QOMA 4P8VA 1KRAC 2VUYA 4UMAA 1TQXA 5K7JA 4NL1A 3T1GA 1BF6A 3F03K 1B3YA 4H1ZA 5L6UA 2A1YA 1KCXA 1D7FA 2OU4A 1GT8A 3V36A 3S83A 4D8AA 3TUUA 3URBA 1V6WA 3IACA 1KM6A 2GJPA 1OADA 1XISA 3WJSA 2YCJA 3W81A 3PJUA 3CTLA 3P60A 2D73A 4MNMA 1QT1A 1TWWA 1K9EA 5EB8A 5DCEA 4J3TA 1EDGA 2P0OA 4NJGA 3GR7A 1TMQA 1FCQA 1PAMA 2QNEA 4E2DA 3MMAA 2IPWA 5C9UA 5E9XA 4MGGA 5HR6A 1S5WA 4CQDA 2DJLA 3GIQA 3FX4A 3SRFA 3H4WA 5E93A 1KM1A 1DJNA 4WDWA 3T6CA 3DH7A 1NY1A 4EK7A 3LHWA 4I90A 1WKEA 3T55A 2TYSA 3DFOA 3SECA 3SFWA 2I14A 1XPYA 4OECA 3R25A 4H9TA 2FZMA 4IGMA 1YADA 3NURA 4GRSA 4KWUA 2O92A 2V6AA 5EMUA 1QAPA 3LN3A 3MB9A 3WMBA 4A3UA 3ERPA 1ENUA 1YEYA 1WOAA 1XRVA 3B0PA 1N82A 1GVQA 4NIRA 4E0CA 1V6TA 1MUMA 1IHIA 1UHVA 4UTFA 3L0KA 2A3LA 5DY2A 3DKJA 1QASA 4LUIA 2IMRA 3PB2A 2FDSA 3GFZA 3W85A 1LUCA 3NO1A 1VBGA 2FGLA 4FXRA 4IX2A 4ZR8A 1UPMB 2Y61A 3KCLA 3L12A 3O15A 4GABA 4XBKA 3VUSA 1V5XA 4MLRA 1LDCA 1ZB5A 4O15A 1EB3A 5C2XA 4R7WA 3EWCA 3T07A 1HL9A 1H63A 4KH2A 1LQ0A 4AIOA 3GW0A 2R1MA 4ACYA 2DJXA 5FIPA 3UF9A 5CPSA 4BQ3A 2GVJA 1S46A 4MNKA 3KP1A 3LGEA 3LEPA 1JI2A 2E7FA 3JZEA 3W6YA 6XIMA 1DP0A 2Q02A 3UPMA 4KFOA 4F3HA 2QCGA 1R87A 4WQ6A 5D04C 3VYLA 2DT2A 3UR8A 3RPTA 4N4QA 4PMYA 1CLKA 3DX5A 3OLIA 1XKYA 3AS1A 4B92A 1R3TA 3NUKA 4D2JA 4S3GA 4U10A 3KAOA 4PUEA 4XIMA 3LXAA 3NGJA 3W70A 1J6PA 2R6OA 4GYPA 4CD4A 2RUSA 2TAAA 2V38A 4IIHA 1XPGA 3TVAA 4MWAA 2O7SA 1GOXA 4Z2JA 2CWXA 3WUBA 4YCPA 1AD1A 4JHMA 5C0QA 3CASA 4L9XA 4DRSA 4Z2HA 2CLOA 1XF0A 4LUTB 5C8BB 3H24A 1Q6QA 2HBXA 1EO7A 3VD3A 3WK3A 1UA3A 1XYFA 3BV7A 3HG4A 3BLKA 1J0YA 3FIGA 5BZAA 4IQLA 2W79A 1RLCL 1TV8A 3O1NA 3WBYA 4HP5A 3S42A 3ARQA 2QUVA 4KKXA 4HA3A 1VB9A 4FNTA 3VM0A 2B4GA 3UCQA 4N9DA 2Y7EA 3WQEA 4N7QA 2E4TA 2EEXA 3VVGA 3GSMA 2IKGA 4CQAA 1FHDA 2D1ZA 2C71A 3WQFA 3WLNA 4FOJA 2WVVA 2VGBA 1LRTA 2BY0A 4Q32A 4UOJA 1CTNA 4U5IA 3DECA 5EGRA 4DZAA 3M16A 3P7YA 3A12A 3W74A 2NZLA 3QTPA 1A5SA 2AOPA 3MM5A 1J18A 2VRQA 4DUWA 3ES8A 5DCBA 1TWDA 3URAA 4FX8A 4IIEA 4LRSA 1QOXA 4JFUA 4AIUA 2QW5A 2Y4SA 3EOSA 4FXFA 1L0PA 1K9DA 5LNRA 4HSNA 1CGVA 4LFYA 3B8WA 1V7YA 3TMLA 3M5XA 1R7AA 5I2UA 1KXVA 2EQDA 2DORA 3B40A 2QGYA 2QUTA 2ZCGA 3DFQA 4UUIA 1JAEA 3R2GA 3GIPA 3AIEA 2V69A 4U3CA 2RJHA 4PC8A 1JJKA 5G4HC 3H12A 2XFRA 5IHRA 3QR3A 2OZ8A 4W87A 2WC3A 1WX0A 4D9PA 3T40A 4IUGA 3U5YA 3I7RA 3R94A 2FJUB 4GZEA 3G0SA 3FS2A 3BCDA 4N9EA 4FR6A 2VD8A 2CLMA 1ZAHA 3AO0A 1JEZA 1IXPA 4IMEA 5FOOA 4QCFA 1IXQA 3IJ8A 3LHYA 4Z17A 3GQYA 3DG7A 3IJ6A 3NAVA 3IIPA 5CBBA 1QCWA 1Q6FA 1YDNA 2QCFA 3CQHA 2WJDA 3B0YA 3SY1A 1XICA 3QSRA 3F4DA 4MPQA 2QEZA 4RDZA 2GQ8A 3SAZA 3EPMA 1VD6A 2ZICA 4B4HA 1CXLA 2XWEA 5D02A 1L6YA 1EXBA 1KA9F 1DE6A 3L5LA 4WD0A 2GDQA 3T8QA 4HSHA 2QVHA 1V3KA 1EIBA 3GHSA 4GK8A 5BU6A 2X30A 3NZGA 4UTMA 3BCFA 3LQGA 4LWWA 3TQPA 4S38A 2IPGA 2VGFA 3C3NA 1OC6A 1PKLA 2GOUA 1B57A 2XJ7A 1WKDA 3ITYA 3P8JA 3PBGA 2GEPA 4O57A 1AFSA 3EEZA 3FOKA 3AISA 3R58A 5F4XA 4UQ9A 2Z0IA 2Y62A 1UG6A 4WVXA 3UWYA 4RE3A 1QOPA 2ZRVA 3KBVA 2QKFA 1XG4A 3UEQA 1TCMA 1J11A 4X22A 4EWJA 1W5MA 2NQJA 2PCEA 1JDDA 3OIHA 1KTBA 2CU0A 3GFYA 3VO0A 5JU6A 4PB4A 1T8XA 4ICMA 4WLCA 4JN8A 1DOSA 3MM7A 2UY2A 3O6DA 4AFYA 2GQ9A 3TYDA 3CMFA 4ILSA 1TJPA 4NRRA 3TROA 1OG0A 4I7WA 4H8UA 1NOFA 4PULA 1H0IA 4P5UA 4LVDA 4UCFA 2OWCA 3W88A 3CMJA 3IAPA 3VILA 4JY9A 4PMUA 4YNGA 3LGGA 1VFTA 4C7GA 1J5TA 1REQB 3VKPA 1GPWA 4JFSA 1CGTA 4EAMA 5H8PA 1FWNA 1RA0A 1R30A 2NXGA 1DJZA 3M0JA 1XYBA 1EX1A 3G6MA 3LCWA 5EBUA 1HN1A 4AIEA 3HG3A 3G3DA 3ZLFA 3P3BA 2UZ9A 2FVKA 1X97A 1AZ1A 2QPXA 3COTA 4K38A 1X6LA 1Y7VA 3JU2A 1ECQA 5CSSA 3RO6A 1BQGA 1H5VA 2VCCA 1E40A 3CZLA 3TAKA 3CUZA 2G3IA 5AKQA 3EDEA 4MB3A 4MLJA 5F2IA 3NEVA 2EHHA 3PZNA 5T91A 1X6UA 5A69A 4AHQA 3S9IA 3ENLA 3VCRA 4IMFA 3W7GA 3VDGA 4IGNA 4I3GA 1M9HA 3NQ6A 3CV1A 4UB9A 1W1VA 4P8UA 2A5HA 1E1CA 2BFGA 3HMCA 3WENA 1W54A 3AS3A 1E3XA 3ABXA 4RNHA 3B0UX 3Q94A 1V0NA 4TTGA 1D7KA 4RDYA 3WD3A 5CKSA 1YNQA 4E3TA 3AU2A 4D6IA 4ZQPA 4HJFA 3N73A 2QQ6A 2PB1A 3W02A 3E2VA 4TMCA 1QPOA 1Q4NX 4IG2A 1G7UA 2XSJB 3NL3A 2Y1HA 2YYTA 5FF4A 3VLXA 3SCSA 4TV5A 1V3MA 1QI4A 2SFPA 1U5VA 3GG8A 1W3HA 2Y0FA 4QGCA 1QNSA 1TX2A 5HAOA 4IIBA 4ORMA 1FWAC 3T05A 2C0AA 4XQ6A 3KL0A 3MV01 1SO6A 1L2QA 2GJNA 3T0BA 3AOFA 1XKJA 2GGHA 5GNXA 3LNMA 1EIXA 4GUGA 1JZ3A 4CN4A 3GH5A 3T2QA 3GBDA 1NELA 5JQ9A 1TVPA 3LTYA 3KRUA 2GWNA 5I3JA 3I6RA 2PLCA 1ZUAX 2E6AA 2OSXA 3S4TA 3RLGA 1UASA 2FJKA 2QCDA 3K1DA 1RD5A 3QQWA 3CUHA 3IRDA 1US0A 2QZRA 4Z1AA 3CYJA 3M46A 2WKLA 3KTXA 3OZMA 3PUEA 1ISVA 2AQVA 4MJMA 3M5YA 2PRLA 4N9BA 4NUWA 5BRBA 3K8KA 4OZOA 4DO7A 3OR1B 1ME8A 1QPNA 3CUGA 2Y63A 3T78A 1DTUA 1OX4B 4PMOA 4RW5A 1OHLA 2IS7A 3L4YA 2Z6JA 4OT7A 4C6NA 1K6WA 1Z41A 4AU0A 1Z9AA 4NYYA 3DU0A 4M0XA 4ATLA 3TJIA 3AHVA 3E2RA 1MXDA 1TQJA 2J77A 3RITA 3ZVHA 4W88A 3NDOA 3MMCA 1L8PA 3MMWA 2VT0A 1QUMA 3RM8A 1IWAA 3D46A 2BXZA 2NX1A 4IPJA 4WXZA 2FZDA 1POJA 1OZQA 2HV5A 3FLUA 3A24A 2A7RA 4FK9A 3P62A 4ZE4A 3O6AA 4RE2A 3SR7A 4FALA 3N17A 4DAFA 2ZUVA 3NQDA 3NQFA 5BXPA 8XIMA 1PO9A 1LROA 2J7FA 1CLVA 3HJZA 3W7IA 3D3FA 5G5IA 8RUCA 1W3JA 2ASHA 2VR2A 5CPOA 1M7JA 2WC4A 2JGYA 3WD0A 3DYOA 1W3IA 2ISDA 3W07A 3BSGA 2PP3A 3M6DA 1FKWA 3VZXA 1BXBA 3L23A 5FL1A 4FS9A 4BEQA 3CAKA 1TRDA 1MFUA 1SYTA 1JPDX 4QDWA 1TUXA 4AW7A 3VKAA 3V5OA 4KT2A 3UZ5A 3TJLA 1GW9A 3FVMA 1YW1A 5LIXX 4HVXA 2DUAA 3W53A 2WCGA 2OOFA 1OABA 1BWLA 1U1UA 2WSYA 4LYPA 3UD6A 2WWDA 4I7UA 3VD7A 1QNQA 3W1XA 2CEQA 3MO7A 3T9PA 3JS3A 1HJWA 3GNRA 5CJNA 3WNPA 3SFKA 4BA0A 5TBOA 1UWQA 3DN5A 1EHNA 2Z2AA 1TWSA 4DJFD 2ADAA 5HR7A 1R86A 3STCA 1AQHA 2WHMA 1JZ7A 3ISIX 1O5KA 2DU2A 3BWWA 1VFOA 1PSCA 5AYYA 2NQ9A 2C1GA 2AKJA 3B0GA 4YWIA 1Q63A 1VHNA 2EPNA 3TJ4A 2ZE3A 2YL8A 1SJAA 4XAYA 2QPUA 2A0NA 5AHFA 4K8GA 5AECA 2WMIB 4ZGYA 3LSCA 3IVUA 1OGSA 4AWUA 4BQ4A 5AN7A 4IFOA 4UR9A 1EEXA 3RXZA 4C6CA 4HTBA 5K4XA 4QEEA 3OEXA 2CLFA 2D2OA 5A6TC 4JTUA 3ZO9A 1FWGC 4OQVA 1K3UA 1XXXA 1E0WA 1O7AA 3WX7A 1E9YB 7TAAA 3S5NA 2AAMA 2NXIA 2JKEA 2WMGA 3L5AA 4AD0A 1R3YA 1TZ7A 2WJFA 4LY8A 1A3HA 3W84A 1B90A 4XO7A 1JL8A 4PUMA 2NUXA 4PMDA 2PZNA 1BRLA 5BRPA 5DT5A 3VC6A 5A8GA 2GUBA 5J5DA 2WJEA 5HJXA 3GXMA 2QXWA 2OELA 5SWUA 2ALRA 3HPAA 4LH8A 3REQA 1BKHA 4GIAA 4UTHA 4LVAA 3CK5A 1GGOA 2PP0A 4M51A 1TIMA 5AY7A 3WF4A 2XIJA 3OB8A 2VC9A 1U33A 2YA1A 4FLQA 4EVZA 5TIMA 5AHMA 3VZYA 3VIGA 4IX0A 1CPUA 3MI3A 2X1RA 3E5BA 1KCKA 3B06A 4R34A 4Z1BA 4RDVA 3E5PA 1F3EA 1E0XA 3LNPA 3U4AA 3BICA 2PU1A 2ZKMX 3KVKA 2CCRA 1YMYA 1NWSA 2PA6A 1UR4A 3RLVA 3SUSA 1XWYA 4AC1X 4GLEA 1RXOB 1IGSA 1TV5A 1AZ2A 4EE9A 1HKMA 3U2OA 1X7IA 4JN7A 1J12A 1C7SA 4XO6A 3IJ9A 3OGRA 4E4PA 1OYCA 3CEUA 1WPCA 1RPKA 3VCNA 4E8CA 4WJ8A 3GXPA 2X0YA 1XSJA 3RO8A 2BOEX 3JZUA 4NI8A 3ZXWA 2ZA3A 1RJPA 2E40A 1TWZA 2X1IA 5CAHA 3KP0A 3ONBA 1FTXA 1LOQA 2A21A 4ZL1A 5KZDA 3IJ7A 4B3ZA 2Z1SA 2Y5EA 3GG0A 2WZMA 2KX9A 3WBEA 1VBUA 5DRIA 3NYDA 4WHBA 3MM6B 3V4BA 2X7WA 2NV1A 4IQJA 2DW7A 4EXBA 1RV8A 2YIHA 4JX6A 1XGDA 3ATZA 3H7VA 2XYLA 5GJMA 5M5DA 1MVYA 3W7KA 1BSLA 1CW2A 3MSGA 3UZZA 3FYPA 1E15A 2ZZ7A 1R2RA 3ZR6A 1XQLA 4MG4A 1C8XA 5PTDA 2G5WA 1NFPA 3DG6A 4JX5A 2VC6A 1US2A 3VX1A 2XN2A 3K8MA 2DVUA 3G1YA 4A8LA 1EX5A 2XFWA 3NQCA 2Z2UA 4LC6A 2GWGA 1YDYA 2V2HA 2YGYA 1FRBA 5KZ6A 3AIWA 2NVDA 4LS1A 2Y7FA 1XIIA 4NAEA 2YBUA 1OFDA 3GKFA 1E51A 2WCAA 3SJ3A 1LORA 2GL5A 3PN8A 2NX3A 3VIIA 3AMGA 4IPIA 1B54A 1EDTA 2H90A 4IIDA 2XINA 4J4KA 3SRDA 3NZRA 3GH7A 1H1YA 4AZIA 3P82A 2CPUA 3TNOA 4N42A 1E9LA 3UG4A 2PURA 2O4MA 3MPGA 4RDWA 1WA3A 5JIPA 3W76A 1HVXA 1GQNA 2E0PA 2ZVIA 2PGEA 4XBJA 1F6KA 8A3HA 1TVNA 3LI0A 4H7VA 3SCTA 1XD1A 1V8EA 1SM9A 4FEZA 1ONRA 3FJNA 1VIZA 2YYUA 2OLSA 4CVWA 3C2VA 1S5VA 3VKJA 1T0OA 4JYFA 2CKRA 2UBPC 1J5SA 4PZVA 3BOXA 3IJQA 3GDTA 4F9JA 2OX1A 2NT1A 1EWDA 4LB4A 4XZMX 1TTJA 1JRBA 1XFBA 2HCVA 3H22A 3RR4A 1D3CA 1ICSA 4L1XA 2ZUSA 1S5MA 1XINA 1ZZMA 3NVDA 1XJBA 4YYCA 4BEUA 3CMGA 3E0WA 4GI6A 3KE0A 1DWFM 3R6IA 4M29A 5M03A 3GNOA 1WV2A 3WBAA 3THQA 3KTSA 4M82A 2NXHA 5BXRA 1V6XA 5U4NA 4AZ7A 4PUDA 3LMYA 1PKYA 2XVGA 1V0LA 1OFAA 1H2JA 3STGA 5I3FA 3N34A 3S2NA 1W37A 4AZCA 1DVJA 2QJJA 3FA5A 1QW9A 1J96A 1PB0A 1LLZA 4LVBA 1JNEA 3QH2A 3TN6A 3S2JA 1MNSA 3LTSA 3SCWA 1GTEA 4J3WA 4Z0SA 4RL3A 4L56A 3MTWA 3P67A 4PODA 3VFCA 4PR4A 5FKYA 3UERA 1LTDA 5CLWA 3CJPA 4O14A 1DJIA 1JXKA 4YHGA 4K6AA 1MRQA 4JL2A 5IM51 3MM9A 4LEFA 4GJIA 3RYSA 3BARA 4GX9A 4LYQA 3UXKA 2W9MA 4AB4A 3FHQA 1KBLA 3L5MA 3S8HA 1GYMA 3WDRA 2FB3A 2D2JA 4NILA 2A6LA 3NXFA 1PTAA 4H9MA 3H7RA 1AMYA 4FNRA 1XP3A 1US3A 4DQWA 3KEHA 5BYWA 1KTNA 4AZBA 4FA3A 1N7KA 1GW1A 3UU0A 3VDBA 5IRPA 5CPTA 4QITA 5A6MA 1ZAJA 5LZLA 4Q8TA 2R9RA 1PZ3A 5CC3A 2VZSA 2ESCA 4BK9A 4QLKA 3Q4DA 1JYNA 4IM4A 4HZ7A 2PWFA 1RP8A 3H23A 3I65A 5G2HA 4HBKA 3ARTA 1W9DM 3CTTA 1GUVA 2CFFA 1W9PA 1EL3A 2VQTA 1FWTA 2PPGA 2Q09A 5I09A 3TV8A 1VKFA 1DQWA 3JW7A 4UFIA 3MM8B 2XH4A 2GQAA 3B03A 1UKPA 3AYSA 5JVLA 4ZQNA 3QN3A 1XX1A 2OT0A 4IF2A 2PS2A 4PUKA 5D32A 4ALDA 1EJUC 3WSUA 1ISWA 3VNYA 4N6EA 5LYRA 1L8NA 1AMKA 1XLHA 2O4QA 5J04A 1X1ZA 1GYLA 1VFSA 3TTEA 4UWMA 1DJYA 4W84A 4FF5A 2WNWA 1PVNA 4EANA 2P3ZA 4OHQA 4CLMA 4JTKA 3HIJA 4NSBA 3PBYA 3VE9A 5KITA 2JFEX 1S2AA 1QI0A 3IIOA 1KWGA 5REQA 5HBFA 2QDDA 2Q8ZA 3AWOA 2DSVA 2VKZG 5CSUA 1YIXA 3PPCA 1UCWA 4L4LA 4RR4A 2A3BA 3R0DA 2Y7DA 3QYQA 3K46A 1G1YA 4YS1A 1XLCA 1LT7A 2A4AA 3STFA 1M04A 1T96A 1MMFA 2E9MA 6TAAA 1RQEA 3NQ2A 1LP6A 3FHAA 3TK7A 3LHVA 5LA2A 3RMJA 4Q7NA 3PTMA 1E1EA 5T8GA 5I77A 1CECA 3NM1A 4REQA 3WF0A 3MDWA 1XSKA 3H2FA 3N6QA 4TUFA 2OQYA 1VGAA 2BTMA 2WSPA 4XAPA 1BPLB 1TE6A 3HG5A 1YHTA 2ZVRA 4HU0A 5HNNA 4YN5A 3PSVA 1FUYA 4B5WA 3MS8A 1A49A 1QNOA 4P7LA 3I7SA 2D2HA 5CEWA 3EX2A 4MNJA 2J75A 3GIYA 3PC0A 1U1JA 3T2OA 1VYPX 2ZC8A 3L2MA 5HK4A 4J9JA 1DV7A 3B0LA 1Z44A 2PCQA 3U7BA 2NV2A 4GEPA 2OWWA 3TONA 2I57A 3BE7A 1KRCC 2EBNA 4MZYA 3W2LA 1QW8A 2Y89A 3CB8A 3WQ4A 1SZEA 3MMBB 3A9BA 2JKPA 2PU0A 3CHCA 3CO8A 1NQ6A 3LX9A 1I45A 1LQAA 4XVDA 4ZZ9A 1VR6A 4HQVA 4HPXA 3VOHA 4LB3A 5C2CA 1B9ZA 1BWKA 1F76A 2ACUA 4Y9PA 4JCLA 4U3AA 1J2BA 4AUBA 1V02A 3FA4A 4DF0A 2Y2WA 4O10A 2XISA 3S2CA 3SQMA 1R6WA 3CL7A 3LV5A 3MYOA 3H6OA 3BAXA 3G1VA 3TWAA 3SGGA 4HNCA 1JUKA 4HZ6A 3UBPC 5A6BD 2PDWA 3CWOX 4I7VA 1F9CA 1GZJA 5ENLA 1A50A 3E1F1 3FYOA 1XLGA 4WY0F 5DELA 3UA3A 1R2SA 5EFDA 3N19B 5XIAA 4DXKA 1W2VA 1GCYA 1ZPTA 4UTTA 4GOAA 4DYKA 3CU2A 2ZRXA 3WN6A 4CU6A 3BJSA 4QEHA 3W1TA 1Q6GA 1P4CA 3E0VA 1YXCA 3VZZA 3L68A 3ARXA 3ZWSA 4JTJA 3E96A 2VC7A 2YBVA 2W0UA 4HIBA 2FKPA 4PTXA 4C7DA 1P1XA 4NY2A 1KGWA 4O13A 3CHVA 4MYXA 2QMKA 1GOWA 1G4SA 3HPZA 3OP2A 1JGIA 1XIHA 1UYQA 4H7CA 4TO8A 4DJDC 2RHGA 1UP3A 1S2CA 5AHNA 4N4PA 4ROQA 5DN1A 2J74A 4PCNA 2ZXAA 3HA1A 1G6CA 3N04A 1EKOA 4DAIA 2VI0A 4YU1A 4NAFB 1XH2A 3POCA 3UR2A 1W1ZA 3BH4A 4JHOA 4OVXA 4KMQA 5C2GA 1WCGA 1GVIA 4Q6JA 1KR1A 2GVYA 2RAGA 2WYSA 1F73A 5F2LA 3WUGA 4KGLA 2D23A 4DUVA 1YDOA 3RJXA 1YNYA 4US6A 2E9BA 4FMVA 3MVIA 4OUEA 3CZ8A 3C5QA 3OTRA 2J88A 3WO8A 4DZIA 1ZSXA 1QRQA 2VWTA 5I79A 1R2TA 3BJFA 2WPGA 4C1NB 1CI1A 4D1JA 2J9ZA 1ISXA 4F0SA 4CVUA 1R38A 4L5ZA 4EX4A 1D2KA 2FZ8A 3W7RA 4U5KA 3GNNA 4S3EA 4WF7A 1HNYA 1AW2A 1Z6KA 2DIKA 1FKXA 3E74A 4DWSD 3DCPA 4M6QA 4GPNA 2B81A 4XKYB 3VOIA 1RHCA 1Z7AA 3UXIA 1NDWA 2XTKA 1ICPA 1QI2A 2E67A 2OG9A 3L4ZA 1QR7A 2BXVA 4N2YA 1EPXA 3QV6A 4KCTA 4RCXA 1CT5A 2C18A 2VFIA 2X41A 3USZA 1BG4A 1C7TA 1R5YA 2VRJA 5M3WA 1S2VA 3ZLHA 3WLPA 5AHIA 1V79A 1VLIA 2VEFA 1YE6A 4O28A 3OBEA 3STEA 3VK5A 4MY8A 4DJFA 4MVAA 1ALDA 5HNUA 1OF8A 3RRXA 2Z27A 2DZUA 2ZXQA 3EB4A 4NRSA 2VXNA 2HE8A 5CZTA 3GLCA 3CNYA 3SSJA 2IQ0A 2FFCA 5J8LA 1MZHA 3KHJA 4UQAA 1ZU8A 2HK1A 4HHPA 5G4EA 2MUCA 4M7SA 4O54A 1EJ7L 4MTVA 3UXDA 1ZBCA 2VL4A 4ASTA 3H54A 5C9XA 4GUHA 1ITXA 3LZ5A 2ZXBA 1ZAIA 2AQWA 1CXFA 1HX0A 4HTYA 3QZAA 3T08A 1HKWA 4GIRA 1XYZA 4A6GA 1TMHA 5ABTA 2WV8A 1FWIC 2I5QA 3C0JA 2DVXA 3QKZA 4LS2A 4MM1A 1XCXA 1M7XA 1W8SA 4C6EA 3SUTA 3C2YA 3SCRA 3PHAA 8TIMA 4AX7A 3WEMA 4TOQA 3VUPA 3DG3A 4ROPA 4NZ1A 5EPDA 2C14A 2G3NA 1EZ2A 3WLQA 2V68A 2BGNE 3V3WA 3WJXA 1EA9C 2YPIA 3F2BA 4H2HA 3UP8A 2OX4A 1A0DA 4EP8C 3B0XA 3UGVA 5CBJA 1AK5A 2DFAA 3TW7A 2CZVA 4LF1A 1UJPA 2ZZ2A 4UNLA 2AL2A 1E6RA 5M2FX 2UWFA 3T0DA 3SADA 2OKOA 4V15A 2XSAA 3E6EA 3GS6A 5FF3A 3SURA 3QHOA 4PGLA 3LENA 1MDRA 4KEZA 6GEPA 3LXBA 3OQ8A 4W8BA 2NVCA 3B0VC 1MW2A 4TVUA 2YW3A 4OUIA 1L6SA 1KQYA 4A05A 4KWVA 1EXPA 1M65A 4KFPA 2VO5A 1F05A 3RILA 4L64A 2P88A 3ITGA 3N2TA 4H19A 3S1UA 3FFSA 1M03A 3APYA 3TZNA 1B3ZA 1AL8A 3WQPA 3N6JA 3BW2A 3OIXA 3SEPA 3WQVA 2ZDSA 3OVGA 3KVLA 3BG5A 3GTXA 2PDYA 1W1PA 3GC5A 4O4VA 1L2UA 1LZOA 2YCKX 3GZAA 5FJUA 4HT3A 2ZRZA 3BVJA 4I8YA 1W3KA 2PDBA 4PFHA 1Q3NA 3BW3A 1NQKA 3MCMA 1UWTA 3FJ4A 3FJ6A 5D38A 4LVFA 2D69A 1B2YA 3KBSA 3U8GA 2DSWA 2DZWA 4ZO7A 4DM1A 4AD2A 4DHGA 4DO6A 3TDFA 1SO4A 5K9CA 2YB1A 3OR2B 4YIWA 3CPUA 4OJYA 1O5XA 1OCQA 3R5EA 1VRXA 2HXUA 1GQLA 4I6KA 3LA4A 2CBIA 4YPJA 1XHGA 1CX9A 1CWYA 1AD4A 1RLDA 1DJGA 5AC7A 3N3TA 1EOKA 3GYCA 4Q4OA 3MY9A 4PRWA 1P0KA 2P76A 4YTTA 3DDMA 5JH1A 1Y0EA 4TV6A 4NZ4A 4FIQA 1BG9A 2YCEA 1GVOA 4TXEA 2IKJA 3V16A 5TQLA 1NOUA 2VEKA 3B0HA 3W1QA 1B3WA 1HKKA 3KZSA 2P5NA 2GLKA 4C6KA 3KDNA 4J3VA 4GO8A 1L6WA 4J3XA 3M5VA 1G4EA 1PYFA 2D0HA 2CZ5A 4KRZA 2P8CA 3WH5A 4DPQA 4PE8A 1VCGA 4AF0B 3WYZA 1W5PA 4B3LA 1ZLPA 3TH6A 5HOSA 1XW8A 3N4FA 4E2VA 5ABEA 1IEWA 3U3HA 5IBXA 4QHRA 1WP6A 5FEZA 1XSIA 1TZ9A 4XTDA 3L2LA 5GJPA 1AJ2A 4E4FA 2TSYA 3S6OA 3L0GA 3N11A 2IKHA 4KBXA 3MSYA 3SGZA 2CBVA 3UQNA 3AC0A 1SW0A 1EWEA 1M01A 1VBRA 4XV0A 2W62A 4B5NA 4E8GA 3MWAA 1QPKA 4D71A 4QJ3B 9CGTA 3WEZA 3VKTA 3M43A 3GX9A 2Z1XA 3W37A 3IGSA 3UJ2A 3O6CA 3I3DA 4Z1YA 3CAQA 1F8MA 5H8UA 5I3HA 3UXLA 4UTWC 1MFVA 5I06A 1Q6RA 2EG7A 4UIOA 3EXRA 2FMOA 4R85A 5GEPA 3C6CA 1K7FA 1JZ6A 4NJJA 5EY5A 2VX7A 1Z42A 1XIFA 1ZY9A 4FHAA 1PTDA 3W1NA 3W28A 4LNCA 1OJXA 2VX4A 4IGHA 1E4NA 1B5TA 3W6LA 2INFA 2Z00A 1WNOA 4CN1A 4KCVA 5FF7A 1K03A 2UY4A 5FESA 4LTSA 4DJDD 4JNZA 2RDWA 3VIOA 2WSRA 1HTIA 1GQKA 4ENLA 3IRSA 3HQPA 3B0MA 4MZ8A 5IFPA 4AD3A 2ISVA 3SCQA 1H50A 4CNTA 4DNHA 2EPHA 3EEGA 3ABRA 5FJTA 2OB3A 1GKPA 1IEXA 1JCLA 1FP9A 2WNNA 3KFTA 2C79A 1MRAA 4YXGA 1O95A 2Y70A 3V1HA 4G38A 1TWIA 1HW6A 1FCBA 4I5XA 4Z2LA 1NM9A 2VGGA 1RA5A 2X40A 4DBUA 1WUEA 5A8NA 5BOEA 1SSDA 2ABBA 3THUA 1HJVA 4YTUA 4GXMA 4AVFA 1OCJA 4H9XA 1E4IA 4O16A 2G3FA 2XSXA 1I75A 2A3EA 2Q6ZA 3TN3A 8CGTA 4LPCA 1UR8A 2DT3A 3PVFA 1HP5A 1MEWA 3QF0A 4ZOCA 1HIZA 2DUZA 4XD5A 2EPMX 1R85A 3U2EA 4U33A 4KW2A 5CJ5A 3QHNA 3L4TA 3ANYA 4DXVA 2V4JA 1XLBA 4N9CA 3KCOA 2CHRA 2V9DA 5DLCA 1RK5A 2Y6ZA 1N55A 2H8XA 1GEQA 2EG8A 5JUVA 5CAKA 4I9AA 4K36A 4U4MA 2X2GA 5KETA 1FHVA 4KCWA 4M6PA 4ICCX 4CQCA 2XZ7A 3VTRA 1A5CA 7REQB 1KBJA 2VFFA 3VD9A 1SJCA 2CZEA 3ARYA 3LOTA 4L9ZA 3DZ1A 4XX6A 4JGDA 4HCDA 3VDCA 2CERA 2QR6A 2VM8A 3RPDA 1YNPA 2AL1A 3FGCB 4PMQA 4K7YA 3VIFA 3BV4A 5DMYA 2X1UA 1F4AA 1B4KA 1HQTA 3NM3A 1ADOA 4TQTA 3FKRA 4G9PA 3TW6A 1OX4A 1R0MA 4IFKB 1DXIA 4PB5A 1W5OA 1KNWA 3MW7A 1WQ5A 1LT8A 3PFMA 1P0EA 1B0IA 1SPQA 3C0QA 3POHA 3LZ3A 5FF2A 3KL5A 2HPMA 3SDOA 4GUJA 1GOQA 3OVRA 3A22A 3OVQA 3WLSA 1KB3A 3IVTA 3W7CA 4OOZA 4DUOA 4C5YA 3EOEA 4S2BA 2WMJA 5BW6A 4F2UA 4QP0A 5HINA 5LXEA 3M0IA 4O18A 1UUMA 1EBHA 3AUJA 3K5XA 3W1PA 3MP5A 1BTMA 1EOMA 1BEUA 1MW3A 3IIZA 4D6GA 1RJQA 4ZXOA 4E4UA 3HV8A 3H21A 1SFTA 1RR2A 5EMLA 2C16A 4F66A 3QRHA 1K4GA 1EJSC 4ZA0A 3SRHA 2ATSA 1EBGA 4D6EA 2WK2A 1XIMA 3QW3A 4XKMA 1GVFA 4ZE5A 1ECEA 4F0RA 4XUGA 3AS0A 4NNCA 4LUYA 6XIAA 4LCSA 4MMWA 2VFDA 3BK0A 2GOKA 4XBSA 1CGXA 4JKLA 4FNQA 3QTGA 4ZSTA 1JDAA 4Q4QA 4UFLA 1XGEA 1W1YA 3GVWA 4V1XA 3PZQA 1TPB1 3BAKA 1LYXA 3KM8A 3DGRA 1XYLA 3TEVA 2E6FA 1QW7A 4JQ1A 4LY4A 3W7EA 1IZKA 5LIKX 1S39A 3F5KA 4DO4A 2PBGA 3G2GA 2BASA 2V0TA 2BS9A 3MKCA 8XIAA 4JQ3A 1J0IA 3S5OA 3S5ZA 2IUZA 3FSUA 1R9YA 3T81A 2O55A 3QZEA 4ICNA 2GDVA 1IIHA 1ZBWA 4AZHA 1TV3A 1XGZA 4F4RA 1WDDA 3KBWA 2ANUA 3ZR4A 1GZ1A 2FHCA 4NZFA 1F3WA 1FWCC 4MFDA 3W71A 3TR2A 1LF1A 3G8RA 5ECVA 1TUFA 3HGSA 3DENA 3AWNA 3S47A 3T44A 1EFZA 4G56A 1Q45A 4GO9A 3IS4A 3N1AA 3O63A 2CWNA 1ZJAA 3WH8A 1XYCA 1XLLA 5A6BA 4POCA 1GK8A 2F2KA 2Y7GA 4UFKA 4KGJA 4ADUA 4DB7A 3AIRA 5I02A 4F2BA 2HISA 3VNJA 3N9RA 3NYZA 4W9TA 1CGUA 2DQWA 3U0HA 3DFNA 2H6RA 1SU5A 3PAJA 2ZFAA 4MWAE 3P81A 1I2OA 3QLDA 1SUXA 4MADA 6ENLA 3VX0A 3QSTA 4OGZA 3RMEA 2YA0A 1LL7A 1NDVA 3TW9A 4DF1A 1R9XA 2XVPA 3LERA 4KEUA 3WZ0E 2WZEA 1A47A 1OCNA 4GVHA 9XIMA 3MI2A 1RQBA 3GKAA 3AHZA 3AIVA 1TSIA 1D9EA 4R53A 3SGUA 1KM5A 4HMNA 5D9OA 1G5AA 5D2VA 1JYWA 3JR2A 4OBRA 5FACA 4LT9A 4FXSA 3I3BA 2PDXA 1A5NC 2JKAA 3I4EA 5TNVA 3DHPA 4C6PA 1F74A 4LEQA 3OOQA 4WRHA 4QS5A 1FH8A 5I78A 1TV4A 3VMPA 2NQZA 1NWUA 3TQVA 2R24A 3WD1A 1FWWA 1MSSA 1KO0A 2V3DA 3TWBA 1M53A 5DMLA 1S2WA 4IHCA 2TMDA 4BWLA 1Q7MA 2V5DA 3EWZA 3IJIA 1K4HA 2X7VA 1AH3A 2CITA 2OYKA 1FH7A 1KD0A 3P61A 7CGTA 3W0KA 1J8VA 3WLRA 1A53A 1GJWA 3PK7A 4QDPA 1M5WA 4U31A 1MQPA 3CV6A 3VKQA 1DBTA 1OIFA 4WKHA 4XAZA 1EJRC 4MWAB 3CGTA 3VXGA 4GA8A 1C9DA 4KRTA 4C6JA 3GAYA 3RN6A 2V3GA 4HN4A 1EYEA 1YXDA 5C9WA 3GDKA 3HG2A 3BGJA 1CB7B 1Z32X 4DWSA 3UG8A 4KRUA 4MKSA 4FSAA 1O66A 5FL0A 3UJFA 1GPFA 3KVJA 1IEVA 2J25A 2VOMA 4RXGA 3KWSA 2X8RA 1IEIA 3G1SA 5GNZA 4DX3A 1NOWA 1OD8A 3ZT7A 4G7EA 3WLMA 3OLGA 2F2HA 2ISSA 3OJGA 2YKKA 1Q4WA 3V18A 3TC6A 1EEPA 1DIDA 2D24A 1WXZA 3VKRA 2WVVB 1QK0A 3CAWA 1V0KA 1V77A 1C9WA 4HPJA 1EF2A 1DWHM 1SSGA 4CD7A 1KV8A 4LNYA 3MM5B 3MM6A 1FWJC 4NI3A 3UWUA 4IH3A 2ZZ6A 1J10A 1A5UA 2AOSA 5A95A 4JY8A 3WQGA 1TTPA 2L5HA 3B05A 1GKRA 3TYBA 3B8VA 5EBAA 5JMUA 4UOQA 3TQKA 4V28A 3PNUA 4HCHA 4XSLA 1V08A 1CZ1A 2PD9A 2OLAA 1YBQA 7A3HA 1PZ0A 3H55A 4PEEA 3B97A 3QEZA 4IXHA 4QG9A 3ZT6A 3HMJG 3W22A 4IIFA 1MYRA 5JXQA 4MYAA 5I00A 1W31A 1VP5A 3MDUA 1UR0A 2EJAA 3WFLA 4U28A 4AY8A 3RR1A 2DGAA 1GVEA 4FLSA 2VJXA 3U4FA 3ALFA 1FY6A 4Q4KA 3BAJA 4LS0A 2HQAA 1D8CA 4WY0B 2JF7A 4L7ZA 2WSKA 1FHUA 1UWAA 1EDQA 3WD2A 3EB3A 3VM5A 1PS9A 3RCMA 4E38A 2D22A 2CNCA 3C2EA 4ADSA 4JIPA 2TRSA 2HVMA 2I5IA 4W8AA 4G5DA 1TELA 3TR9A 1G9HA 1TA3A 4A4AA 2AGKA 3R11A 3ARSA 4EOUA 1SMDA 3P5ZA 2OEJA 3HJEA 4GYPC 3VNKA 1AQ0A 4LGXA 3NSMA 2PDJA 3NO3A 1EF3A 3TNBA 4MWAC 4O11A 4HZMA 1CEOA 1F61A 2O7QA 1C29A 1NJJA 3GUGA 3XISA 3G24A 3DESA 2PDQA 3N2OA 4RZ4A 3EX3A 4ZFMA 3E2SA 1UKOA 2G0WA 1HL8A 3PWGA 3HGRA 2OWXA 4TMBA 2W67A 4PSRA 4Q8UA 1CCWB 1E56A 2VDIA 4OTKA 2WM1A 4S1FA 1KLZA 2AAAA 4WOZA 4GIYA 4BI6A 1I2NA 5AZ1A 3EDFA 2ZUTA 3K4DA 3R79A 3AU6A 2FTYA 3WQCA 4QRNA 4AWSA 4B4FA 4GCAA 2DZXA 2RFGA 5EL1A 1NSJA 1W56A 4C6LA 4KIEA 2YL5A 4NJHA 2DSUA 1O6IA 1UZ1A 4P8WA 1FWRA 2OYMA 4UMCA 3VOFA 1K8ZA 2DDXA 4IMAA 1N8IA 4A3RA 5ABFA 1T40A 5JBFA 2XPKA 5AC6A 4L80A 3QY6A 4PBFA 3M0MA 1AODA 5DFAA 1ODZA 4Y7EA 2A85A 1SW7A 3HGJA 1F7BA 4YTRA 2X16A 3Q65A 5D9NA 4YCOA 1QPQA 3L66A 1KFWA 3CUXA 4RZ6A 3R89A 3OVPA 4GI8A 5EMMA 1W1TA 4PA8A 2J13A 1R3VA 1DE5A 1LL6A 3L21A 4AZ5A 1EJTC 1YTEA 3OODA 3PUOA 4MB1A 1JDEA 2DH2A 1IWBA 1A5LC 4BZYA 4RE0A 2YDQA 1XBXA 2VQUA 3B8IA 1J6OA 1H7NA 2GGIA 1ZJIA 1G01A 2FH8A 4GFIA 3NDZA 1DWAM 4AH7A 2J6XA 1XLAA 2C13A 1VEOA 4QSHA 3LLDA 2OSYA 5FF0A 5F1UA 4D8LA 1Q85A 1E1CB 4GI9A 3F5LA 1IXOA 4D6DA 3W1LA 2E77A 4IGSA 4JQAA 1P43A 2HVNA 1I0DA 3SCNA 1XLKA 2EAWA 4E6MA 4P61A 2XVLA 5JH2A 3WNKA 4HYWA 2QAPA 5IFTA 3LS9A 1RAKA 2R82A 2ZA2A 2QF7A 3N3MA 3K4WA 3TSBA 4IG2B 3W72A 1JQXA 3NOYA 3CBWA 5BMWA 5FEPA 2G4JA 3QM3A 4LV4A 1TPDA 2QDGA 3WUEA 3M9YA 3MM8A 1O12A 4H2CA 4JTLA 4HHLA 2V5LA 1HKIA 1NP0A 5MKGA 3PZUA 2CBUA 3N12A 2POZA 3BLEA 4NQ1A 1EH9A 4DJED 1HKJA 4XIAA 4XZHA 2ZX7A 3A21A 4W7WA 1EC7A 4O1AA 4XZ9A 3DEQA 4IIGA 3NPWA 2BVTA 3B8UA 1Y5VA 2J8GA 4B15A 3CH9A 4WXYA 1LOSA 5E09A 2LLEA 4ACZA 4BJHA 3KUMA 4D72A 3ARRA 5E1QA 3N2MA 2QCDB 2O56A 3GXFA 4MPKA 1PXGA 4X0NA 3AJ7A 3B4YA 1TO3A 1V7AA 4IPLA 2XN0A 5HJLA 4HNLA 2ZTJA 2OODA 2CHOA 2F6UA 2Y5SA 2E3ZA 2Y5JA 1SZNA 3KOYA 2JK2A 4JX4A 2HNEA 4Y9AA 4GY1A 4L4MA 2QAFA 2YDSA 3M64A 2BNJA 4OIFA 3KCJA 3BMVA 5GNYA 3BLLA 1S1PA 3RF9A 2Y8VA 3RUBL 1F3XA 1K02A 2WZTA 2A79A 4LBUA 2XGIA 1RCXB 2PMQA 3QR0A 2MNRA 5JBEA 3ZVHB 3MMCB 3H4GA 3VGGA 3HM7A 1CLXA 2XGZA 3E49A 3BDKA 1RSCA 3G1FA 2WZHA 1ZRQA 3WH7A 1MI3A 2WO5A 3JRKA 2A7NA 4K39A 5F4SA 1H62A 1K9TA 3ES7A 3CYVA 4CCZA 2XIBA 2H8ZA 5E6ZA 2FPTA 1OEPA 4UFHA 2QS8A 4C1LA 3NPXA 5CC5A 5HULA 4DXXA 4DY1A 2BSLA 4J1OA 5FJOA 5KSWA 4B5UA 1KKRA 1ZQ5A 3GU1A 1VFFA 1F8IA 1UD4A 3DFSA 2CC0A 3HURA 3UZXA 4JFWA 3MMBA 1H7RA 1VYRA 1S2TA 1PWMA 3SI9A 2FZBA 2WWCA 1UWRA 2E5CA 2QJGA 3P84A 1I9CB 2J6VA 4CU8A 1CENA 3FDGA 1SGJA 2TPSA 3OBKA 1RZMA 1UR2A 4EPEC 1K7XA 1SZGA 3RX3A 5AOUA 4GYKA 3GHRA 2FB2A 3ITVA 1I60A 2F38A 3C2FA 1LCOA 5CG0A 2OYLA 3QPEA 4BI7A 4JTGA 2FZ9A 2XIOA 1CGYA 4GY0A 2J7HA 2O9OA 4PUWA 1IYXA 3W7MA 4QQ3A 2ON3A 1VENA 2QV4A 1MZRA 4MJZA 1Y65A 3B0NA 4PL1A 3MT1A 1ONXA 1Q6LA 2E5DA 4RW3A 4ZQMA 3CL6A 1QI3A 3EPOA 3TYUA 1TFVA 4JTHA 3CHEA 2J27A 1DJWA 5K3VA 1GZGA 1V93A 3MQTA 4QR6A 3BG3A 3JVAA 5FJIA 4O1CA 1K8YA 5DXYA 1Q6CA 4UTLA 4QG6A 5AHLA 3MUAA 1PDZA 4D6HA 1HF6A 1EJXC 5FJPA 1VBJA 2AQOA 1JPMA 5DY3A 3TX9A 3EWXA 3ABOA 3GTNA 3BPWA 3SW6A 4HNOA 3ELFA 1UD2A 1BLIA 3VC5A 2XVKA 3N4EA 4HJWA 1XBZA 3VKCA 3LLXA 3WLTA 3H53A 4S39A 1OFEA 3S6DA 3V7PA 3LHTA 3ZZ1A 4BFAA 1J93A 3E2QA 2ZC1A 3UWVA 1EA0A 1R46A 4PN2A 1DIKA 5KINA 3P6LA 3W7JA 1MEHA 3TC3A 4HA1A 1XYMA 1T5AA 3N9KA 1P6BA 4JCMA 3KRSA 1UZHA 4O19A 1P7TA 4U2ZA 4C90A 1ZGDA 1G4TA 7ENLA 4BF7A 1QNRA 3MO4A 1E72M 2ISWA 3REQB 5AYXA 2BHYA 2OO0A 3AYVA 1LM1A 4A3YA 1VFLA 2QJMA 6TIMA 3E12A 1ZJBA 4DZ5A 2V5BA 1WKYA 3S6TA 5C5YA 4I9JA 1LBFA 1BQCA 3EXTA 1UBPC 4QFUA 4B5TA 3O8AA 3EWBX 3W6MA 1QJWA 4WDTA 2HMCA 2BHUA 2J66A 3Q2DA 1RD6A 2YZRA 3A3HA 2CZDA 3ZJ6A 1QWGA 3EWYA 2BVDA 4IQDA 1RCQA 2G3JA 4G8TA 1H5YA 3OA3A 1HO1A 1X6NA 2YA2A 4PMVA 2QPSA 2FVMA 2HDJA 5CQ1A 4PB3A 2XH0A 3VNIA 1VPYA 3N2BA 2VEMA 3U2ZA 3OYXA 3R0KA 1BD0A 1XBYA 3GU9A 3S2MA 1KTCA 3G1XA 1ZP3A 4C6MA 3UZYA 4HNNA 4MB4A 6A3HA 5LHFA 3OHIA 2DT0A 2OVLA 3BAIA 1T41A 3CEPA 1V0MA 4UQCA 1ZALA 4AYGA 1FXPA 4K7VA 1FFRA 2OR2A 2ZX5A 2CLEA 2VVSA 3NQGA 1Q7QA 2WXDM 5A8PA 4LRTA 2ZUUA 4RZ5A 4CNUA 4IMDA 1ZL1A 4UQBA 2ZOXA 1LL4A 1SW3A 3KX6A 2J7BA 3BAYA 4F79A 3EWWA 1JCXA 1QFEA 1VEMA 3E9AA 1AW1A 2VCAA 3E0LA 2HS8A 1RBLA 1DXFA 5C71A 3VINA 1Y5XA 3H2MA 2VR5A 1V3JA 3DI0A 1XIDA 5AYBA 3K13A 5LIUX 4ZMGA 3NSNA 4FLOA 1IF2A 4KF1A 1FX6A 1NDYA 1I6NA 1UB3A 4AHOA 1DQUA 5H2ZA 4A8RA 2BGSA 1A80A 4MIMA 2EPOA 1TPC1 5E0CA 4H6EA 4XZBA 5DXXA 4HNUA 2PGRA 4DM2A 3A6OA 1KFJA 3VU2A 5ECUA 2FQIA 1IEQA 2GVGA 4DNMA 1TE1A 3PZMA 1AL7A 4UTJA 1XG3A 2EGZA 5BCAA 1RUSA 4DI8A 3V75A 1RVKA 2WC7A 3ITOA 1HXJA 3UY7A 4NAEB 1ZENA 5D37A 1WZMA 3EDDA 3NDYA 4XZNX 4HNTA 4JXCA 4CUCA 3QHMA 1KGUA 4GKLA 2XM1A 5LIYX 3FEMA 4RZBA 1I8JA 1HT6A 2HTMA 5IDZA 2YDAA 3L4UA 1F6YA 2Q8LA 1SJDA 5DMNA 2NQLA 2PTWA 3NQAA 2VX6A 4PRRA 2EXOA 2VGIA 1KCLA 5EA9A 1BXNA 4LCRA 4YJ5A 4TVCA 3OZPA 4RPQA 5EMJA 2PDHA 2CIPA 4GE8A 1MWOA 4GACA 1JUEA 2BLEA 3WNOA 2PUZA 3QLLA 4CGTA 1XI3A 2QUNA 3L65A 4LUSA 1R8LA 1JFXA 2IPFA 2WQPA 1UQYA 3PZVA 1UKTA 1AOPA 1NF7A 1DTNA 2VZUA 1SVDA 3GH4A 2G3MA 1LQ2A 3NPUA 3KBMA 2Z29A 3NFUA 4PBGA 4PH6A 3P80A 3RRAA 2ABAA 1VYSX 4Y96A 3Q67A 4GH1A 3II1A 5C7HA 7ODCA 1B3VA 4ZENA 3LPPA 3QW4B 2FPYA 1B4EA 4L65A 4U2YA 3C8NA 1P6WA 3LK6A 2GYIA 4JS3A 3GW3A 1PTGA 3OR2A 3GC4A 1MXGA 2VC5A 2PZ0A 1E4LA 3MA8A 2PF0A 3SUUA 3LU2A 2QIIA 4EXQA 4H00A 1BVZA 2BOGX 3TA9A 3VDHA 2PDFA 4HOWA 2ODOA 1E73M 4ZO6A 3ID7A 4AZCB 5BNKA 4DIAA 1EGMA 3LV6A 1B3OA 3H4XA 5A5WA 3P0WA 1A0EA 2J9XA 3R13A 1LG2A 2R8WA 5MF5A 1JZ2A 2GVLA 3N15A 3LBCA 1K6AA 1ML1A 5I3KA 3LD5A 3ICJA 3QC3A 3W7OA 1JR1A 2OZTA 3A5VA 5HWJA 3A3WA 3MM9B 2IXUA 4RK8A 1N2VA 4S3AA 1UC5A 2QCCA 1N8FA 3QQ1A 3GWQA 4B2DD 1J0HA 4TIMA 3UWQA 3A9IA 1WUFA 4CNSA 3LCLA 1BGAA 3BSMA 1DHKA 3I10A 1C90A 2YCLB 1S5TA 3WCZA 4PYSA 2AKZA 3MUCA 1G94A 2A3AA 3MANA 1U5HA 2YXOA 2H9AB 2BB0A 2PWGA 2ZA1A 4H6RA 3VIPA 2OSWA 2PLKA 3HZ3A 3T7VA 4ES4A 5TD4A 4RE4A 4Q7BA 2C19A 1ADSA 3TZFA 2C1HA 4WKAA 3LBMA 4F0MA 3VNLA 2GDUA 2VZTA 1W17A 1ZBVA 3VOCA 2D3NA 2P50A 1UZ4A 3M44A 4CCCA 4PTVA 3GXDA 1OIMA 3NQVA 2G41A 1RALA 1J4EA 3ZR5A 2WVSA 3O7UA 2OGJA 3QVQA 4BI5A 2WZIA 3DFHA 3GU2A 3ORWA 1XLEA 1PIIA 4DBDA 3GO2A 1E43A 5KTLA 2RDXA 1BSIA 3AI0A 3PP7A 3S0CA 3IWPA 1QATA 1JZ5A 3H2OA 3EMZA 3EA2A 2AMGA 3MP4A 1TPEA 3PM6A 4E3VA 3VMNA 2VP8A 1W9VA 5H6HA 5J5RA 1QVBA 5DBTA 1TRIA 2V63A 3OBAA 3M0KA 1OM0A 3UWZA 3UYCA 4H7ZA 1VH7A 2HE5A 1JYVA 4H01A 3Q45A 1LRQA 4DI9A 1E70M 5REQB 1ADDA 2GSEA 3AHXA 3FAWA 5D33A 4GYJA 1QXLA 4JYEA 4CQBA 2NSOA 1BWVA 5GVJA 1E6PA 2PDUA 2W91A 3TLLA 3CQIA 1PIFA 3FA3A 1SFSA 1V02E 3W83A 2WHKA 1IT7A 1I1WA 3W7DA 3THCA 2JE8A 5KMYA 3G1AA 4FR1A 3ZLGA 5FJJA 1U1HA 4ZO9A 4REQB 3NL6A 3PJXA 5F4WA 3B9OA 4GQ0A 4YTQA 3BW4A 1GVRA 1FP8A 3SUVA 4UXDA 1UH3A 2GK1A 5DQPA 5D8WA 1R47A 4IQEA 4F2TA 2NSXA 1KFEA 3W1UA 3NPVA 2NUYA 2YOCA 4GVGA 3BZJA 3HPSA 5I24A 4UZUA 2GZXA 3NIYA 2YL9A 4NASA 3T0TA 2NLIA 4BQ5A 2BGQA 4ZQCA 2PC8A 1A5MC 3U48A 4GQRA 3C86A 2UV8G 3NL2A 1VFUA 4PFMA 2QVNA 1OFPA 1KLYA 4CKQA 1HGYA 1C8VA 1EHAA 2GPTA 2JEPA 1Q13A 2J7DA 2G95A 3V0UA 3MSRA 1F3TA 5E70A 2Z2BA 2QCLA 4DJEA 4PCTA 2IQDA 3RG6A 3FGCA 3NQ7A 4XISA 3CQJA 3A4AA 5ABGA 4FXJA 3P74A 4FIRA 3PAOA 4X9SA 4PCFA 1ZS2A 2FH6A 3DHUA 3EAUA 4B5SA 1C3FA 1UUOA 4AXKA 1YYAA 4I6VA 2WQDA 4DUXA 1J2WA 1GVYA 4C1KA 3GDLA 3XIMA 3N25A 2Z7KA 3UG5A 1OFRA 1HKVA 2ZRYA 5H8MA 3VGDA 2XH2A 1KV5A 4BF5A 1O60A 5GQBA 1Z48A 3NNTA 2E68A 5CG7A 5I07A 3WF3A 4ORIA 2RJGA 2B7PA 2WANA 5TAOA 4LANA 1GVSA 1XIBA 3R7MA 4PBEA 3W1AA 1AW5A 4ZXLA 1GJUA 1NEYA 4J27A 2QUUA 1QBBA 2C15A 2DT1A 3MKKA 1XLMA 2WMKA 4OV4A 4HGXA 4JTDA 4MJ2A 1Q6EA 1TPVA 3FXGA 3QGKC 2DZVA 1NU5A 1VRDA 4ZB5A 3CH0A 3UR7A 2WBKA 3QQ0A 3DFYA 2G50A 3PG8A 5FEXA 5CCZA 3WJWA 5CGTA 3AXKA 4CD6A 2QGHA 3LUTA 2PDIA 5F2GA 4EWND 4GYFA 2XM2A 5D9MA 3V5CA 1C8QA 2J62A 4BQ2A 1F6PA 3VOGA 1TPH1 3LCGA 3IANA 2BXYA 4OE7A 2DY3A 5A8OA 4AQLA 5AC5A 1H7WA 1JNDA 4HA4A 1MXSA 3DERA 3K8LA 1D3HA 1Q5MA 4LALA 1ZFJA 1BYAA 1W6TA 4FF7A 3UG3A 4INFA 2PD5A 4RUBA 4PCSA 4IJBA 4P7QA 4GWEA 3ZS4A 2HRWA 5A6KA 2J4GA 3H26A 2VZOA 3ABSA 4Q7IA 1FWBC 4B9ZA 1IE7C 4JICA 1E3ZA 4IICA 1DJHA 1TV2A 3VGEA 3I7QA 1EJWC 4IXXA 3C0LA 3TCSA 5HPOA 4JNMA 1OK6A 2EKCA 1TB3A 1JXJA 3WQWA 2F6KA 4UMBA 4J2PA 1I0BA 3N13A 2RKXA 2Q3RA 5AYZA 1ZHAA 1OBAA 3BQ5A 2F84A 2D3LA 2I56A 3MUZ1 1VJSA 4XAFA 4LF2A 3WDIA 1YTKA 1E1FA 3EKZA 4NHVA 3RM4A 3DBPA 1KRBC 5M17A 2GSJA 2BMBA 2PGFA 4MNLA 1CXHA 1S38A 2F9RA 3T09A 3MUXA 2V3FA 3HQOA 3PS7A 1W9UA 3T0CA 4QQUA 4UQEA 3GVRA 2X2YA 3RM9A 1B1YA 4K37A 5DRCA 2JF6A 2XWDA 4IP7A 3SN1A 3L9CA 2P3EA 3OO2A 5DANA 2DEPA 3IARA 1AJZA 1MUCA 1VCFA 4UTTC 1OGBA 1W0MA 4O0QA 1E6XM 1V3HA 4X61A 3W7NA 4IFRA 1U30A 4NNBA 1MUWA 4DWDA 4AYSA 2BOFX 2GVEA 3BG9A 1I1XA 2ZBTA 2TODA 2C7FA 3HPXA 4K8EA 3CZGA 3S1GA 2ZUMA 1TPWA 1VJIA 3I6TA 1OT2A 3VKSA 4NXKA 4LVGA 1JULA 2V5KA 1T6MA 3R43A 4E8DA 2J7CA 1H49A 4JBRA 3L7RA 1O5RA 2VDHA 3PR2A 3TYCA 3SQLA 3W86A 5A6AA 1V6VA 2G8ZA 4LYRA 3KOXA 3LPFA 2WNZA 1JIBA 1VJZA 2XSBA 4UQDA 2J7GA 4NNAA 4TVDA 2AMXA 1UW9A 5D8ZA 3TFXA 4BS0A 3DBNA 3TQ0A 4RJEA 2AL2B 2B7NA 2HS6A 2PWEA 2GGGA 4W89A 1DJXA 1FWDC 2X09A 3N18A 3FCPA 3GB6A 3CO4A 3RU6A 1W3NA 1LWIA 4P8XA 2NT0A 3T0AA 3TAOA 3AIUA 3B9EA 3AMKA 3MVTA 3B9DA 3CUJA 1OSEA 1LWHA 2OEMA 4TU1A 2A6NA 3IV8A 6ALDA 3HB9A 2YZ5A 4GUIA 4QJ4B 3DGBA 3LCHA 3TN5A 2BZNA 1KRMA 3UWEA 1JCNA 3MJMA 3RDKA 3TOYA 1BTCA 2HVOA 3DYMA 4CN6A 3G1RA 2PDLA 2ZIDA 2AGTA 4GQQA 1XRTA 5LNSA 2VFGA 3KOWA 4LAOA 3CIWA 2NQHA 4AEEA 1XS2A 3ARWA 4Q33A 3NJ3A 3ITTA 3W75A 4HOZA 4DJFC 3FN9A 3W9ZA 2PRHA 2OCZA 3NOEA 2BY2A 1F5ZA 2ISFA 1N8WA 1K70A 4V33A 1UP2A 3UCDA 5HMDA 3BANA 5BWAA 4IWWA 1E6ZA 3VKDA 3LCFA 4M7TA 1A3WA 1PEZA 4XVEA 1QK2A 5BXSA 3AMDA 4JIRA 3TIMA 2EO7A 3BUVA 4G2DA 1TJ1A 1ODUA 3GRIA 3QMTA 2ZUWA 2XU2A 1JRCA 3LRMA 3NGFA 2JQXA 4GY7A 3CT7A 5I5RA 3U9IA 1FDZA 3TLQA 3GVVA 1IGWA 3UZJA 4FPSA 1Q6OA 1IT8A 4WY0A 1JCYA 4H41A 3GTFA 5BMXA 2JBMA 3SY5A 3DHFA 3ZJ7A 4Z08A 4GJJA 1CXEA 2KAUC 1EP3A 2R91A 3VIMA 3A3XA 4ZQOA 4A8IA 2XN1A 3M6YA 5EKYA 2YX0A 3BAWA 1NARA 3BGGA 4ZVJA 4I8DA 4WDUA 5CPLA 1WXYA 2DH3A 3R4IA 3QV7A 1GYNA 2I5GA 4O4WA 1J0JA 1WB0A 5HDRA 2EKGA 4JTQA 3ABQA 1XYAA 2YSWA 1GOMA 4GNKB 3QC0A 3WG6A 2ZADA 5A1AA 1QNPA 1UH4A 4I9MA 2EG6A 3TTSA 3W7LA 3MJYA 3B8DA 2AKMA 3SRKA 2Y8UA 3A64A 2DIJA 2QHAA 1ITUA 2PTXA 2ZZ4A 3QBUA 5L9FA 2DV0A 5FD0A 4DLFA 2PODA 4MY9A 5CXPA 2VWSA 2YBTA 2PEVA 1Y5WA 2Q71A 5CPQA 3ZSTA 3TMQA 3TXZA 5MHBA 2J78A 3TYZA 3GNXA 6REQA 1IWPA 3LM7A 3AHTA 1FWHC 5G2WA 1XH0A 1GQIA 3PPGA 3RLUA 3QMRA 1WXJA 3EKLA 3DAQA 4EIVA 3EX6A 5D2XA 1VLWA 1WDWA 4V1YA 5HMFA 3CZKA 1KXHA 2GJXA 1E0VA 1SJBA 1W5NA 4JL1A 2BV9A 5E0KA 4O0KA 1P1MA 3PTQA 1P0BA 3UR5A 3EPNA 1DWGM 1KFBA 1E0TA 5AC8A 3BXWA 3ZYZA 1YE4A 1ONWA 5G1YA 4FAMA 4PMXA 3H2CA 3SZ8A 3FJLA 2VEPA 3IUIA 1P6CA 3G77A 3BCJA 1VFMA 1S3TC 1KM2A 5HQEA 2E5BA 2FYMA 2VEIA 2ZUNA 2EJ1A 1OCBA 3RNDA