4S3DA

Ispg in complex with ppi
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 137
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3dA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3dA02
4NL1A 3H2EA 2YCIX 3B0GA 2DQWA 4MWAC 3TYEA 3VKQA 3K13A 4DJDD 1Q8JA 2Y5SA 2YCLA 1TWSA 3MMCB 4DJEA 3H23A 4C1NA 4S23A 3MCMA 3MM7A 1Q7MA 4MWAB 3MM5B 2YCJA 3OR2B 2VEGA 4C1NB 4DJEC 4PZVA 3TYAA 4DJDC 4DAIA 4MWAD 3GEOA 4DJED 3OR1A 1ZJ8A 3VKSA 4S3BA 3VKPA 1F6YA 3TYCA 3H24A 1EYEA 3TYBA 2XSJA 4DJFD 6GEPA 2YCLB 2AOPA 4HB7A 1TX0A 3TZNA 4DAFA 3TZFA 1AOPA 2DZBA 2YCKX 7GEPA 3H26A 3MCNA 2AKJA 1TX2A 2VEFA 3MM6A 3H2AA 3MM9A 3MMBA 3TR9A 4DJFA 4G38A 3BOFA 5AOPA 4NIRA 2BMBA 3H2CA 4O1FA 2Y5JA 4S39A 3TYUA 4CCZA 5JQ9A 2V4JB 3MMBB 4DB7A 2H9AB 3H21A 3MM8A 4O0QA 3B0JA 4NHVA 4G9PA 4AOPA 3H22A 4D8AA 3VKTA 1Q7ZA 3VM1A 4GEPA 1AJZA 2OGYA 8GEPA 3B0HA 3OR1B 2E7FA 3H2FA 3AOPA 3VM0A 1Q7QA 2XSJB 4S3CA 3MM8B 3TYZA 3B0NA 4HTRA 3B0LA 1TWZA 3H2MA 3H2NA 4NILA 4S3DA 4G39A 4S3AA 2Y0FA 5GEPA 3VLYA 4S38A 2H9AA 1AJ2A 4S3EA 3BOLA 3MCOA 3VKRA 4DJDA 4O1EA 3MMCA 3OR2A 3V5OA 4MWAA 1ZJ9A 2V4JA 3MM5A 3MM6B 3MM7B 1TWWA 2DZAA 4S3FA 4MWAE 1Q85A 3TYDA 3VLXA 3B0MA 1AJ0A 3H2OA 3MMAB 2GEPA 3MM9B 4DJFC 3VLZA 1AD4A 4D8ZA 4D9PA 3MMAA 1Q8AA 3NOYA 2VP8A 1AD1A
chains in the Genus database with same CATH superfamily
1BPLB 2F8QA 3BAXA 1NP2A 3EB3A 4LQ1A 2DQWA 3RLHA 3BLPX 3U7BA 3CZJA 3BCFA 1YDVA 2A3EA 2VGBA 1UUOA 3TH6A 3QQ0A 1J93A 4HK5A 2QXWA 3RITA 1EDGA 2ADAA 2QUNA 1BXBA 1WOAA 3EB2A 1YTKA 2ZX8A 2W61A 4ZO9A 1FTXA 1CW2A 1HVXA 3N19B 5DMLA 5F1VA 4PMUA 4AVOA 4U10A 3ITYA 1FKWA 2HISA 4I90A 8XIAA 3CUXA 1BSLA 1BWLA 3RLVA 4JKLA 1TMLA 3VOGA 4PE8A 4HZMA 3CQJA 5FD0A 1UZHA 3MMBA 4UOQA 3IRDA 1B3ZA 3JUGA 4E5TA 1HGYA 4S2CA 3MTWA 4LY8A 1OBAA 5T91A 3DG7A 4BEUA 5C2GA 4X61A 4AZIA 3G1DA 1GHRA 3TWAA 2RJHA 5LNVA 4JL1A 3SADA 2XZ9A 3C56A 4ORIA 1SW7A 4MHBA 2JBMA 4MMWA 3GG7A 4NG3A 1UZDA 3K4AA 1ZHAA 2VDGA 2QIIA 3HGSA 1O1ZA 4DUWA 5FACA 3E49A 2QF8A 2O0TA 1TMQA 1SO6A 2Z1SA 3CZLA 3SRKA 3QC0A 5CGMA 3BQ6A 3R94A 3TN4A 1IXPA 3S4TA 3LDVA 4XISA 3FFSA 1R5YA 3LD5A 3WK2A 3DESA 2PC8A 4KERA 4IFRA 3MMTA 3UNTA 1ZFJA 2XN1A 1ZENA 2E3ZA 1EIBA 4FMVA 3VKBA 2GK1A 2YFOA 1R9XA 5FESA 2A3AA 3OZMA 5HA7A 3W7CA 1MZHA 4IZGA 3W76A 4LTSA 4Z1YA 2VNCA 1H60A 5BOEA 5HOSA 1CBGA 6GEPA 1TQJA 3IAQA 2WVVA 3DHDA 4HMDA 4MNMA 4JD4A 4MNKA 2INFA 1KB3A 2CZEA 3MV01 1JCNA 4UNKA 5E70A 1LM1A 3EBVA 1UQZA 3PPCA 4XO6A 1OF6A 1RK6A 1WDRA 3M0HA 1H7XA 4Q8VA 1CTNA 1H63A 1GQLA 4GH1A 1K70A 4LVDA 2IPFA 3H22A 1PEZA 3NPXA 5HINA 3GHTA 4D6CA 1IT7A 1P6BA 1UOZA 4DX3A 3GNXA 4J35A 4RE2A 1C3FA 3SUUA 4JFWA 1YHTA 2BS9A 4NZ1A 1X1NA 2QCLA 1WYIA 3KXQA 4LVFA 3KBSA 3MV11 3T07A 4JHMA 1G5AA 3A3XA 1KTBA 3G5EA 5GNZA 3ZIZA 4IWWA 3COTA 1JAKA 4Z17A 4FB7A 1M7JA 4V27A 3FN9A 3NQFA 4FXRA 3R7MA 4LGXA 3VKQA 3APYA 1R2RA 3W1TA 2YB1A 3BVJA 1L6YA 2H8ZA 4UTIA 3GW0A 4FIRA 3QGKC 2A7NA 3T2QA 4PC8A 1S1RA 4PMJA 3BICA 5I7GA 4LCRA 2X1UA 3AHTA 1JCTA 2XH4A 2NQLA 3WBXA 4KCWA 1ZPTA 3ZVHA 3TSMA 1H7NA 3P84A 3T2PA 2VX7A 1W1YA 4IGHA 2C8NA 5ABFB 5C2CA 3TWBA 4J1OA 3BK0A 1DXEA 1VBUA 4IP5A 1FWBC 4KCTA 4UZUA 3GXMA 4F48A 5A8MA 1KXQA 3EWWA 3VINA 4YVXA 5JMUA 2ZE0A 1KGXA 1GYNA 3W01A 3S1UA 5E9XA 3VTRA 2CBJA 2YGYA 4AZ5A 4WK9A 3QRHA 1MXGA 2DT1A 2YFNA 3OPSA 3S0CA 4PR4A 5HPOA 4TV6A 1E6QM 3OYXA 2QKFA 4JIIX 3WDRA 5BRBA 2ZADA 1XIDA 2X8RA 3GUWA 4GVHA 4B90A 2J7HA 4IIFA 4EXAA 3NTYA 4LAKA 4IIDA 1EJUC 2F38A 1VFUA 5CQ1A 3NQDA 5CZSA 3TFCA 1KD0A 3VUSA 1F6PA 2VVNA 3VC5A 2OLHA 3RNDA 4LNCA 4JX4A 5B7YA 1WZAA 4A3UA 1UR4A 3W1RA 3R6IA 1XYBA 2VHLA 4FS9A 2I56A 1BRLB 2H3BA 3R5EA 3W38A 4O1DA 1EUAA 4J3VA 4JDYA 1EP1A 1ZBCA 3L67A 4UR8A 1R3YA 5L9FA 2ZUSA 4HBKA 4GY7A 1JPDX 2BLEA 2WC7A 4B5XA 1TPWA 3J7HA 4GUHA 3CM4A 5A1AA 4AU0A 1XUZA 4B3KA 3CUHA 3WLSA 4GQBA 1CT5A 2DT0A 4GI9A 3GSMA 1TCMA 2D20A 3NWRA 5K9DA 4F40A 1NDWA 1YW1A 3ITXA 3E02A 3TTSA 3DFYA 3CH9A 2BG5A 3MSYA 2LLEA 1ZRQA 1K77A 2D0HA 4ZO6A 3VD3A 4FOJA 3D5HA 2VUYA 1O95A 3L65A 1NH6A 5H8MA 1J4EA 2PBGA 1FCBA 3DGRA 1PO9A 4DEFA 3O05A 2WNZA 2D2GA 2VUNA 3UETA 1IE7C 5G2IA 2PDMA 4G56A 3HV9A 3WD0A 4UMAA 3UG8A 1QHOA 2PTZA 3BAJA 5MKGB 3MMCA 2WZIA 5CAKA 3LBOA 3MC5A 5CAHA 2AAAA 3UFYA 3WF3A 5HR7A 3UWQA 4MDPA 3RFAA 3UESA 3WF2A 4BY3A 3GS6A 4DIAA 1AD4A 4HVXA 1XIMA 1HTIA 4FOUA 4MAVA 4R34A 5HNUA 4GMEA 4DO6A 1GUVA 4DUOA 1EO5A 1VCVA 4MFEA 5F2IA 3RILA 3UYCA 1Z9AA 4CCCA 1U5JA 3TLLA 2VGFA 4BQ2A 2OT0A 4B5VA 1KBIA 3BG5A 3W6MA 4KT2A 4MZYA 1L2UA 3FY1A 1DHKA 1QPOA 3HURA 3LI0A 2QMKA 5T9BG 1EOKA 3MQTA 2AL1A 1QHZA 3FJ6A 1QI0A 2CERA 3CK5A 2VR2A 4DLFA 4ICMA 1FOBA 1XKYA 1Z44A 1GWJA 4LV4A 3FYPA 5FJOA 3AMKA 3B0XA 1AH3A 1KRBC 4ZMGA 3TJ4A 4RE0A 2ZUTA 1DIOA 3OG3A 1W32A 1JF5A 1X1OA 5RUBA 3BSHA 4AOPA 4D8AA 3P62A 3W83A 1VCFA 1DORA 4HSNA 3PB0A 4U31A 4KWUA 2PU1A 1P4CA 1LRNA 1OC5A 3A13A 4GE8A 1AMKA 1OJXA 4BWLC 3LBCA 1UH3A 3CEPA 4J3SA 2VMFA 1DKWA 3LNPA 3ABSA 4OOZA 2Y5EA 1QW9A 1TV8A 1US0A 1EDTA 4LYQA 4K3ZA 3S42A 1DQXA 1GZ1A 2PRLA 4UCGA 1W9VA 3QOMA 1HP5A 1H4PA 1MO0A 3KZPA 3WH7A 1KLYA 3BGJA 1XLGA 1XISA 5HQLA 3FJNA 1OFOA 2WAGA 4L9YA 4Q3MA 4QE4A 3GYCA 2WM0A 5FL0A 2VOTA 2G8ZA 4QEEA 1UPPA 1TJRA 5BROA 1ISXA 3GU9A 3T4CA 4H6KA 1F6KA 4GHRA 1OY0A 4PCFA 4H9UA 3U2CA 1PZ2A 5I79A 1F74A 3QW4B 1FWWA 1QRQA 3VI2A 4C6BA 3XISA 1V6UA 3ARRA 1ZQ5A 1WKFA 3VU2A 3O6YX 5C6MA 4LVGA 5K3VA 2V5DA 3EMZA 1QR7A 3W70A 4MFDA 3C0SA 1X6NA 1WZMA 2V2CA 5FAGA 2PRHA 3EDEA 3VDHA 2TPSA 1JPKA 4PBEA 3TC6A 4XK2A 4AZCB 1JDFA 1AA1B 4IP7A 3LLXA 1HJWA 4L9XA 3TW6A 1E6ZA 4L65A 4LEFA 4AHQA 2XVPA 4IFKB 2YLLA 2JEQA 4AD3A 2UBPC 3MUAA 1OABA 3HQNA 5KZDA 2PDLA 2F9RA 4KQNA 1GEHA 1VBJA 1B3VA 3RG6A 1KFCA 1KM6A 4I8DA 1R38A 3GXTA 2IUZA 3KVJA 3W00A 1KGUA 2J7EA 3CPRA 4HSOA 1S38A 1TRIA 4DJFC 4D8ZA 4CD6A 4ML9A 4JTEA 3QM3A 1ONWA 2OO0A 3VDCA 4LAMA 4PCNA 1VFOA 1W5QA 3PZNA 4PMYA 4Q6XA 4PH6A 3VIFA 4JTAA 2J47A 1IT0A 5ABGA 5U7SA 1N8IA 3N4AA 4YJ5A 3W9ZA 1SR0A 2VFHA 3CL6A 2Q02A 1DBTA 3EAUA 2JF7A 2YXXA 3L5LA 2WJFA 3CV1A 1XV8A 1W3JA 1OX4B 2G97A 1QTWA 3A21A 1X39A 3WDPP 2QCGA 2WQDA 3O7UA 2ZZ2A 3DHUA 3RX4A 1MFVA 4C6CA 1GQIA 1Q6RA 4JN8A 2VX6A 1M68A 1O6IA 1UZ4A 1WXYA 2DVUA 1H62A 4U5IA 4O1FA 1VPQA 2AL2A 3PHAA 1S5VA 2J77A 1FDJA 4WLCA 3LZ5A 1TA3A 2WSQA 4DZ5A 1YDNA 4W89A 4DUVA 4LYPA 1KR1A 4XTIA 1YTEA 4I5XA 4Y9OA 3WSUA 1J9YA 4DZHA 2RDXA 2VEIA 1HVQA 4NX0A 4C6FA 3PUDA 3CQHA 3GW3A 1MFUA 5C54A 5D05A 1KGWA 1CDGA 5GJNA 2OEJA 1S46A 3CZ8A 2DZAA 4HA4A 1FHDA 3WCZA 5H91A 3UBPC 2QJJA 3N9RA 3EEGA 3K2GA 3PZIA 2DJXA 2I5QA 1F9CA 1V0NA 1FA2A 3LCIA 4HD5A 5SWUA 1LL4A 2DIKA 1I2QA 4AF0B 1VEOA 4HJWA 3AU6A 2G3NA 5KZMA 1LQ0A 1V7AA 4JTJA 1WAWA 1XIEA 3GRIA 3SRFA 2HEJA 3LCFA 3C0LA 3WQWA 4H6QA 2X41A 5CXPA 1RY8A 2GVYA 3LYEA 4FR1A 4E4PA 4F79A 1QATA 4GQGA 1JCJA 4XZIA 1ONXA 4XZWA 3JVAA 4MB4A 2ISSA 3W7RA 2V3GA 5C71A 3G1VA 5E9AA 3L4XA 3SQLA 3MMUA 3EWUA 4O12A 1LOQA 1QAPA 3ATYA 1V6TA 5CLTA 5K4XA 1QNSA 4N0RA 5A6BA 1KTNA 5DO8A 1FWEC 3S6OA 3B0VC 1TPFA 2B81A 4JIEA 5I3FA 1G69A 4H2CA 4IUOA 2P3EA 1HJUA 2CLFA 4JIRA 4B5NA 2QJMA 5E93A 4TOQA 1NDVA 3UQNA 3VM0A 3KOFA 3MO7A 1TRDA 2BP1A 4HN8A 3VDBA 3HMCA 4FAMA 1NP0A 1K8CA 3CUFA 2OSXA 1R9YA 4GIAA 3GDLA 3MCOA 1XLLA 1ZAIA 2MNRA 2EQDA 3M0VA 5A5WA 1SW3A 1Z41A 2WOQA 1XPYA 2GSJA 2GQ3A 3QGVA 3T9PA 3LI1A 2IQDA 4N2YA 5F4SA 4TMBA 3WL1A 1QWGA 4RL3A 3WLMA 3GC2A 4CNPA 4AH7A 3GYEA 3YPIA 3NGFA 4BKNA 4XZHA 5FEPA 2VC5A 3W1XA 1JQVA 4ONVA 3QN3A 1MUMA 2V82A 2ZCGA 4PUEA 3VKPA 4HZ6A 2QDDA 2R1MA 3WJZA 2DPEA 2CYGA 4R3UA 5DY3A 1TX0A 4B5WA 1IXNA 1G4SA 5FF4A 3AS3A 3DBPA 2FZDA 7TAAA 5IHSA 1P43A 4OGZA 3L4ZA 4EX4A 1MQPA 2PS2A 2BMBA 5D2YA 1M7PA 3PZUA 4FNTA 4JICA 4LUIA 5DELA 2Z0IA 5FF2A 3HFTA 3W4RA 3BLEA 3CWHA 3RJYA 5G1MA 4FNPA 2BWGA 4E3TA 2PDXA 2A3CA 1CIUA 3W7KA 4IOTA 2BX7A 4M8UA 3V18A 3R12A 5A6TC 5MHBA 4TX9A 1WXZA 3TQ0A 4IQLA 2MUCA 4YCPA 3BO9A 2PWDA 1SZFA 2R1LA 1QJWA 3AHVA 1HKIA 1R2SA 2R1PA 3ITCA 4GNJA 5EYWA 2YA0A 3WQGA 2G3JA 4PUNA 4NL1A 4YPJA 1SFTA 3TYEA 4JZ5A 3HGJA 1A0DA 4RJEA 3HMJG 4GFIA 2DZXA 4DBWA 4DJDD 1O68A 5BU6A 1VAHA 1EO7A 1GTHA 4IMFA 3W2NA 1YPFA 5FF0A 4MWAB 1VQTA 5CZTA 2BHYA 3THAA 3U5UA 2PF8A 4GX8A 4B3LA 4R9XA 4RNFA 2E28A 1E6PA 2GJLA 4K8EA 3KRZA 3NM3A 1A5SA 4UB9A 1CLKA 2G3FA 3WZ0E 2WMHA 4AF0A 4CQ8A 1SJCA 3HV8A 4W5ZA 2ZZ1A 3MKKA 1QASA 5BRPA 3MM6A 3T08A 3LUTA 2DEPA 3W26A 1EHAA 2ANUA 3P8JA 1QI2A 4J5NA 5BRQA 1ENUA 3EWXA 1JIBA 1DTNA 1JDDA 3VZYA 3BC9A 3RRAA 4POCA 4IL0A 2REQB 1OFPA 2QS8A 1QNPA 1J0KA 1ZL1A 3STCA 4G7EB 1OWQA 4J40A 3VX0A 3UF9A 4W7UA 1EBHA 1O4UA 3ZLHA 2ZFAA 2C1HA 2PDYA 1US2A 1ZP4A 3W2KA 1KBBA 1KFWA 3T0DA 5FSEC 1B57A 4JL2A 3R2GA 2BHZA 2J7FA 4TUFA 3NQAA 3Q4DA 3WIJA 1H7PA 2NUWA 3C2OA 4UQBA 1S2VA 1DIDA 1XKJA 1E4IA 2OOGA 4XKYA 3T05A 1RQBA 3MBFA 3L2MA 2PLKA 2F2HA 1UUMA 3BQ5A 1A3XA 2W3ZA 3TN6A 1OFDA 4OBTA 3W02A 4CUCA 4WF7A 4QCFA 3BARA 1YPIA 1UP2A 3OHIA 5DCBA 5DBTA 2QDHA 2WSKA 4JQAA 2BSLA 3CAKA 4Q4KA 2BGSA 3GE7A 1IGWA 4RLIA 3R8GA 1OIMA 4B91A 3CAVA 1FCQA 3K4WA 2INZA 3SCRA 2FGBA 5T26A 3VNMA 2E5BA 2BODX 2QCMA 2X09A 2A7RA 1FP9A 3KL0A 3CLMA 2Z1XA 4ZEPA 1BVWA 1US3A 1P6WA 1KCKA 1THFD 4MAZA 1WA3A 3AUJA 3UZYA 2JALA 4OWGA 3M7SA 3O07A 2V5JA 4ZFMA 3M9YA 3WELA 4KESA 1C7TA 3WEZA 4NI3A 4UQEA 4YU1A 3UR8A 3EX1A 2Z00A 1EIXA 5AHFA 3NNTA 4LRSA 1IXOA 1YX1A 3F5LA 3IJLA 1CYGA 1AH4A 3UPMA 1XLHA 3TROA 1QPNA 1XD0A 3ARXA 4QEHA 3CQIA 3K8MA 1RZMA 4XKYB 1A5MC 5G5IA 4H9VA 1R47A 5CJ5A 3ZJ6A 1XIFA 3LHWA 1D2KA 2OLSA 1JULA 4UWMA 5CBIA 1PKNA 3W27A 3S1XA 1QK2A 1XP3A 2GJNA 2NVCA 2X1IA 2ZWZA 3G6LA 4U3AA 4YCOA 4FR6A 3O6CA 1FHLA 1H7RA 3EOOA 3ZLFA 4IIEA 1EKOA 2ZZ4A 1S2TA 5HUPA 5FJUA 2PA6A 1DJNA 1PIIA 1JEZA 4DM2A 2PSNA 1OVDA 3F03K 3VAVA 3ANYA 5CLWA 1RA5A 3QEZA 3TUUA 5HMSA 3CBWA 4MJ2A 5BOFA 3UW6A 1UP3A 2QW5A 4Q4QA 3UVAA 3W7NA 1BWVA 4Z2GA 5T9CE 2PD9A 1Y5VA 3W25A 4F9JA 3GXPA 1LOSA 2FIQA 1LQ2A 5EGRA 2FZ9A 4PUUA 3M64A 2XPKA 2NVAA 3LSBA 1R7AA 2GZXA 4ROQA 4AIOA 4XBKA 4XIAA 4LYRA 4O1EA 2OQLA 2CHNA 4ZE4A 4BF5A 1RBAA 4H2HA 3TJXA 3LM7A 3B04A 3OB8A 3UCDA 2QPSA 4CD8A 3C8NA 4DPQA 4M7SA 2VFGA 3A9BA 5FSDC 1UR3M 4LW7A 1UUQA 2CHRA 3B8SA 4QDPA 1JFHA 5EBUA 1NOUA 3K30A 1VFSA 1A5BA 1I2RA 1R2TA 5FCZA 3H23A 3SAZA 1XM3A 4RKAA 2A3HA 4KIEA 4X60A 3I3DA 3SN0A 2YIHA 2AQOA 3ZVIA 2E6FA 4D6EA 2W9MA 1LLZA 3W7LA 4PTVA 5HMDA 4AFYA 3BANA 4BR1A 3ALGA 7A3HA 1IEIA 1GQKA 1CGYA 3FSUA 4DY1A 4P61A 3NZQA 1QOXA 4N9DA 5DXYA 2CZ5A 5A6LA 1JPHA 3O16A 3ITGA 1JI1A 3H4WA 1SJAA 1JGIA 3R10A 3NXLA 3W2JA 1ECQA 2EF9A 2QCDB 4H00A 1IHIA 3KP0A 5M3WA 1MRAA 1TUXA 2PDKA 2X1RA 5CZKA 2Q8ZA 3GVWA 3PFRA 2P0IA 4FF7A 5LGXA 3W6LA 3DAQA 3IJDA 1AL7A 3VD9A 4HIBA 4MUZA 3UG5A 3APTA 1CLVA 4HYWA 2NXGA 3TX9A 5DMYA 1NJJA 3VMPA 2YA1A 3NEVA 2JIWA 4BQ4A 3IPWA 5A8QA 1LWJA 3OEXA 2WSRA 2BVWA 4LBRA 3IJIA 3IUIA 3VGEA 5LIXX 3TOYA 4FALA 1NF7A 3WMLA 4TVDA 2GUBA 4GG9A 3GR7A 2W6RA 3KX6A 2A79A 3F2DA 4UFMA 5LA2A 1RJPA 4NYUA 2R6OA 2ZZ3A 2WKLA 3AQUA 4L6HA 1MI3A 2C15A 4QS6A 4HB7A 1G01A 3QV8A 4OIFA 3E74A 2ZRZA 3PTKA 3CO4A 1W1A1 4F0HA 5AZ1A 1T99A 4LF2A 4AD2A 5CH9A 2Y1HA 4JR5A 3AMCA 3S5NA 4DI9A 1R46A 1U1JA 5GVJA 2EJ1A 4L61A 1BLIA 2PBOA 3RGTA 1TIWA 3K1GA 2DIJA 1UG6A 3MB9A 4C6OA 4KIRA 4C1LA 3TMLA 4HTRA 3RCMA 3FCPA 1QPQA 3NYZA 2E67A 4H7CA 2GUUA 3MYPA 3GU2A 4KWVA 2GL5A 2KAUC 4RW3A 1K9FA 1KRAC 1BD0A 3PJUA 4UQDA 3O63A 3M7WA 4MY9A 1CPUA 1SO3A 1ZBVA 4AC1X 2VP8A 3Q58A 3H4XA 4OU1A 4MWAC 4GOAA 2Q3OA 1HKKA 3R0DA 3TR2A 1SM9A 1ZUAX 1CGXA 4WY0F 3H6OA 1P7TB 1EQCA 1TSIA 3VNIA 3N2CA 1V0KA 4EK7A 1X38A 4DXVA 2VZVA 4LNYA 4QISA 1JCMP 1H7OA 1GOQA 4XZBA 3GUGA 3E0VA 4R27A 1M9HA 4UTTC 1QI4A 3B97A 3A4WA 5AN7A 1O5QA 3L4VA 1P0DA 3VNDA 2TYSA 1L6GA 4K37A 2GVEA 3FYOA 1XLCA 1SFSA 3OA3A 1MUCA 4IQDA 1C29A 2NQ9A 3V0SA 2BXVA 3DYMA 2PP1A 1VLIA 2RHGA 2CXGA 2I57A 3ZJKA 1JGMA 4RXGA 4PL1A 1UKTA 1OG6A 1XLDA 3VMNA 2E9BA 2HBXA 3ZO9A 1TCDA 1Z89A 1QNRA 3M0MA 1DTUA 2C3ZA 1AMYA 1MW3A 3DZ1A 2WSYA 1YXDA 4IJRA 3T44A 3STEA 3GFZA 2E4TA 1VFLA 2Z6IA 4CU7A 1W9XA 3V5FA 3VLXA 3B0MA 3UG4A 2WV8A 3MJYA 4IH3A 5FJJA 2QV5A 3T0TA 4I7VA 3QYQA 3VNKA 1CGTA 1Z69A 2Q71A 2Y7DA 3VYLA 2FZNA 1NOFA 2DH2A 1IEQA 3SUWA 1V51A 3W72A 4F8XA 3QLDA 1FWCC 1KXHA 2J79A 2RDWA 3WO8A 3B8WA 3ZMRA 3CWNA 3MYOA 4DYEA 2PRMA 3W1LA 3S5YA 2AGKA 1IGSA 2Q8LA 1EX5A 3VCNA 5G1TA 3H8AA 3WMSA 1MEWA 3N6HA 3Q2DA 5CZ0A 5DRIA 3UXKA 3CT7A 1NQKA 3N2TA 3CPUA 1EP2A 2A4AA 3G0SA 1AW1A 3NSNA 3BAWA 1CI1A 5E0FA 3WFZA 2DT2A 4F66A 1GQNA 5C9WA 4MPKA 4DHGA 4BHYA 3ARUA 2V6AA 5I03A 6REQA 1D3CA 3DN5A 5J8LA 4PRWA 3TTYA 4FXFA 2PWVA 3OTRA 1YKWA 3D46A 5A3HA 3TSDA 3FAWA 3SN1A 2GDVA 3R11A 3URNA 1V3IA 3VILA 2ZKMX 1PDZA 3W37A 2VD9A 4Q8PA 2D2HA 3GY1A 3EZ4A 4GGHA 1TR9A 2HE5A 4IX2A 3SGUA 1EJXC 4LALA 2DIEA 1SVDA 4RW5A 1G0CA 3ARZA 1W1TA 3ZR5A 3M5XA 4ADSA 2D1ZA 4B9ZA 1H3GA 2G5WA 3B0GA 2ZWYA 2OU4A 1EC7A 1OGSA 5ABHA 3QJAA 3ARQA 4GUFA 2C18A 4QX4A 4Z2IA 1CXKA 4WIWA 3WLIA 5AC4A 3TW7A 4DBSA 4JEQA 3GLCA 1OGBA 3PZTA 2GWNA 2CBVA 2UY5A 4N4PA 1QDSA 1Q4NX 5I07A 3E5PA 1VYSX 4MNJA 3UY8A 3OVPA 3UU0A 2AMGA 4B5TA 3B0PA 1C7SA 2WCGA 1TPH1 5FJTA 4ES4A 2JFEX 2OEMA 3DBNA 3P93A 1J11A 2C0AA 4ZTYA 2Z2UA 2J7BA 1TR1A 2NLYA 3GHUA 4O54A 4W8LA 2FGLA 1K9EA 5DT7A 3WJXA 2TODA 3T8LA 3M6DA 1XCWA 2X1TA 2BOFX 4JIQA 3OVRA 1NEYA 4FLQA 1J2BA 3S1VA 4NZ4A 3LHYA 1FH7A 1WOBA 2XWDA 1DL3A 3KDOA 2ISWA 3BGAA 3IV3A 3M44A 1NTHA 3VE7A 1U83A 3PZQA 1O12A 3M0YA 4LV9A 3DENA 4Y9MA 3L21A 4EAMA 4E0CA 1UIPA 4LVBA 3AJXA 4UTJA 1E9LA 2VENA 1RBLA 1FWSA 5KEZA 2FJUB 1A5LC 1A5AA 1B3WA 3SIZA 2WMIA 4AZGA 4QAWA 2V69A 1XD1A 5IOBA 1U33A 1I6NA 1DJZA 2BV9A 5CBJA 5TAOA 2IKGA 2L5HA 3TK7A 1N7KA 1ZY9A 4J3TA 3GIPA 2FH6A 1WUFA 3B8TA 3ME3A 4XUGA 3TTQA 1FKXA 2VQUA 4CVUA 5T8GA 3D47A 2WO5A 4C6IA 2J13A 2G4JA 3NQ2A 1WPCA 3ABOA 1A0EA 3G6MA 4D72A 1FWHC 2PF0A 3R89A 3E38A 1C8XA 4DNMA 1C91A 3T8QA 2DSUA 3LV5A 4AG0A 4PN2A 3FIGA 2OZ0A 4JFVA 3W29A 3BMXA 3SRHA 1VHCA 3ERPA 2GJRA 3S2MA 4MY1A 1LROA 2CFFA 5BXPA 1H51A 3KBNA 4GISA 5A8OA 3HA1A 3N17A 5K2ZA 1O66A 4Q8TA 5D9OA 1HL8A 3FX4A 3ZVHB 3B0YA 2QDEA 1U5HA 3WQDA 2G4FA 2PLMA 1XYLA 1ZZMA 2X0SA 1NWTA 1S2CA 4Q8MA 1XCFA 2VEMA 3VNLA 2ZIDA 3IIOA 3CEUA 8RUCA 2CPUA 3QXBA 5I3DA 3VKDA 3CT2A 1P0EA 4A3YA 3QSRA 4KFPA 3ATZA 1K8YA 4B4HA 2ZZ5A 1QT1A 1IZKA 4TX6A 5EB8A 1EUNA 1W3HA 1K02A 2DORA 2DW7A 3VUPA 3FHAA 1CXHA 3U7VA 2Z24A 4UOJA 4BEQA 4ENLA 3GFYA 3I4EA 1I45A 1FWAC 3C8FA 3DU0A 3VGHA 3GX9A 3AMLA 1GOXA 3IEBA 4NT0A 3HGOA 1K7XA 1TPC1 1CXLA 4QQ3A 3TTEA 2E40A 1RALA 3BE7A 3B9AA 4LOCA 3HG2A 4RUBA 2HPIA 1FUYA 2WHLA 2E9LA 1R0MA 4Q8WA 4KRZA 2X7VA 1WUEA 2YZ5A 1FWIC 2OGYA 3B0HA 3OR1B 3MHUA 1B9BA 4AWEA 2OYMA 4WY0A 7XIMA 2E68A 1TWDA 3VCRA 3USZA 4H4IA 4OTKA 4FI4A 2JKPA 3LLFA 3MM7B 4JXCA 4Z2JA 1XLMA 4BI7A 5AYYA 3BMVA 2MANA 5C0QA 3TE9A 3ONCA 1TZ7A 4F4RA 4PEEA 2D23A 2VD8A 1JQXA 3BW3A 1A5NC 4FNUA 2CLKA 3GTFA 2YZRA 3TAOA 1GG1A 1ME8A 3BSMA 4U2ZA 1V5XA 1F2JA 2CIPA 1JZ8A 3Q67A 1ICQA 2OR2A 3FV9A 3PSVA 4ACYA 4ZOBA 1QPKA 1V3KA 1OZQA 3GEOA 2ZX5A 2DZVA 2HVNA 1XIHA 1DWGM 3LRLA 1RHCA 2ZRUA 4C7FA 2IPGA 3CXOA 3AYRA 3WQCA 2X05A 3TZFA 2DZBA 1UIOA 3IGXA 4MNLA 3F5JA 4AZCA 4BZYA 3WLNA 3HJZA 3PN8A 4GACA 3B3DA 3HQOA 4OUEA 4QJ3B 2I9EA 1UWQA 3N18A 3AUOA 1D7FA 1EB3A 1Y65A 3R58A 1J96A 3PK7A 4DF1A 2NUYA 4IMAA 1E71M 1XWYA 3N12A 4Q32A 1ZJIA 2ZOXA 5I0DA 3VKJA 1M41A 2JQXA 3EWDA 3F4DA 3UWEA 4D6HA 4GEPA 4Q4OA 1UR1A 1XSJA 3EMQA 3QZ6A 1QMLA 1HL2A 3L0NA 1AVAA 3SW6A 3HF3A 4JHOA 1O1HA 5AC5A 3UP8A 4AEFA 4WDWA 3U8GA 2VCAA 1G1YA 3QY7A 4H8HA 4JTTA 3M16A 1I0DA 4HA0A 1EXBA 4P8UA 1HXJA 3RXZA 5A6KA 3H70A 3GHRA 4NZCA 4I9TA 4UQCA 3RMEA 4V33A 5G4HC 1Q3NA 1Q6LA 3MDWA 3VZXA 4AD0A 2E77A 1TWSA 4M6UA 3C52A 3PUOA 1PX8A 5BXSA 2XZ7A 3S5OA 3MKCA 5D38A 4CCDA 1DWJM 1LBMA 1D3GA 3MVTA 4FO4A 1XBVA 3D6NA 4GYFA 3MSDA 1YDYA 3FA3A 1A50A 2CKSA 4HCHA 3TZNA 3A5VA 1R3RA 2YL9A 3HG5A 3LPOA 4GJJA 2XYLA 2XFWA 3W0KA 4YTTA 2DT3A 4H9ZA 3ZT7A 4AEOA 3E9AA 3WKZA 5LSMA 2H3DA 3G1XA 3U2OA 3T42A 3SURA 1CZ1A 4DB7A 4YVVA 2BBFA 3DERA 3MI6A 1W54A 1PVNA 1ZGDA 3QKZA 3W1MA 4US6A 1QBBA 3B8UA 3WD3A 2OWXA 3QLLA 2EPMX 4WEVX 2WCAA 1JDAA 2XJ7A 3FDGA 4LUJA 3B0NA 4Y9PA 2QPUA 2FB3A 4J2MA 4NJKA 1J5TA 1VENA 1KA9F 3QR3A 1GVYA 2AKMA 2WKGA 2GDUA 3CASA 2NW0A 2DSVA 1AZ1A 1M1BA 1CGWA 3DEQA 1WE5A 4V28A 3VFCA 4ZCWA 3NQ8A 2C79A 3MPGA 2Y2WA 3H2EA 3U0HA 1OG0A 3O3RA 4WJ8A 3U2EA 2F6XA 3ONBA 3QYSA 3NO1A 7REQB 5DN1A 1E9YB 4UTWA 3OOQA 4E4FA 2E6AA 2XIMA 4OQVA 3IJ7A 4MADA 1XQLA 3BSGA 4DAIA 4WR3A 5CPLA 1C9WA 3OZYA 2EPOA 2BZNA 4PGLA 1WV2A 3EDDA 4CD7A 3MCNA 3LGGA 4P5UA 5AYBA 1GPFA 1UKOA 1UWTA 2ZRXA 2PE4A 1XYFA 3PUGA 2WPBA 1YNPA 4I8YA 3VM7A 5H8PA 2WMKA 1DEDA 4Z1DA 5I2UA 4DN1A 3WNLA 4JAWA 3BTNA 1IEVA 2VWSA 4PULA 1R87A 4KW2A 3E0WA 1EBGA 2QAFA 3UJSA 4QTGA 1A49A 5FIPA 1GYLA 2HJPA 2QT3A 2WSPA 3W88A 4HP5A 4OV4A 4HNCA 2I1OA 4XX6A 4ECLA 4J7RA 5D2VA 4LB4A 3GXNA 4V2XA 3MSGA 3LN3A 5FEXA 4FLRA 3PAJA 3NQEA 3UWYA 2QCHA 4ERIA 2WHJA 4IMCA 4EE9A 3AXKA 3HTWA 4GFSA 3LTSA 4PCSA 3CB8A 2OVLA 2VC7A 3MMAA 2VGIA 5HNNA 2WC3A 2G3MA 1V7YA 2C1GA 4Z08A 2OX1A 1O5RA 3NJ3A 4WOZA 1SZRA 2CLLA 2EPNA 2X40A 4HCLA 2G37A 4JTDA 3L2LA 4IJCA 3SGZA 1BVZA 1VR6A 2VL4A 3B0UX 4B92A 3LCWA 1LDCA 3AO0A 1OD8A 4TVCA 2GQAA 1E0TA 1MW0A 5E1QA 1U2YA 3MKVA 3UXLA 2YJQA 3A22A 3GDRA 1UA7A 1EP3A 4J4KA 3OBEA 5EKYA 2Z7GA 3P82A 2VZSA 1L6FA 2VC6A 3RO6A 4BFAA 2YYUA 4F0LA 1A3HA 3R0UA 1MW2A 3BG3A 3IUHA 1O60A 3GVVA 1S2AA 2YDQA 1N2VA 5I06A 3WEMA 2OFJA 1V6WA 2O4QA 3CGTA 1UCWA 3R0KA 3PZMA 4KWSA 1JR1A 1NDZA 4MM1A 3G1YA 5G1YA 2FH8A 1JUEA 2DY3A 4S2BA 4CN6A 2ZTJA 2F84A 2QGYA 4DYJA 1VFMA 2BHUA 2ZC1A 3CWOX 2ABBA 3CMFA 4KEVA 3NQBA 3GXDA 4GXPA 4JYFA 4EWND 3QMSA 5FEWA 1HKVA 4AIUA 3CHDA 1A4LA 4IPJA 1CENA 1KCXA 2AMXA 2JGYA 1TO3A 5JBEA 2FQIA 1XS2A 1WQ5A 1U30A 4YTSA 1AH0A 4AYSA 3S9IA 4FX8A 4Z2HA 1VPXA 3MW7A 1DXFA 1WP6A 3GXIA 3W53A 5ENLA 2GQ8A 1ME9A 4PTNA 4QR6A 3DFSA 1QNVA 4F3HA 5LNRA 1WKDA 4QAIA 2DW6A 4JYEA 1S5NA 2VFDA 1DVJA 1EEXA 3N2OA 3UZWA 4AIEA 4NJHA 1EJSC 2IMRA 4AUBA 3LCLA 1R9ZA 1E55A 1ZCCA 4NAEB 1N8WA 2NV1A 4YTQA 1S5TA 5LHFA 1EC9A 2JK2A 1V3HA 3A3WA 1JCXA 1E0VA 4DWDA 1GYMA 3WD4A 1XDMA 5AKQA 4HHPA 3VDAA 3BURA 3VX1A 3RDKA 4B2DD 1ZNNA 5CC6A 3KL5A 2Y8VA 1O5XA 5AOUA 1Q6QA 4MTVA 1JZ2A 4UFLA 3KTSA 4L7ZA 2A3BA 1VIWA 3ZR4A 4E8CA 2IKIA 1DJGA 1UMLA 1H50A 2CLIA 3LRMA 5AC8A 2Y8KA 1TTQA 1OX6A 4FF5A 3LB0A 3NQCA 2OKOA 3JR2A 1BYDA 1GNXA 5EU9A 3R13A 1ZTVA 1TUFA 1LYXA 3VABA 4KBXA 2WZMA 4CVWA 1NARA 4DJEC 4AISA 2PPGA 3H12A 3CZGA 3P7YA 5GNXA 5A6AA 5D9PA 4PMZA 1D9EA 3V16A 1A5OC 5C70A 4LYKA 2I5GA 1CWYA 4GNVA 4TTUA 2E8YA 2IQ0A 3PS7A 1OK6A 2W5FA 3W86A 2JIEA 1K9DA 2TRSA 3C2EA 1TJPA 3TA6A 2WVSA 2O4MA 5E09A 3M07A 3W2MA 3O06A 3GNPA 4HSHA 1AW5A 3FVDA 3GR8A 4NU7A 4KWWA 1HIZA 3ARVA 4J3ZA 4NKCA 1V93A 3L5MA 2E6YA 3G1HA 4F2UA 5DF0A 4LFYA 3C0JA 2X30A 8TIMA 2PGFA 1FH8A 4GVFA 1K03A 1KQZA 3CTLA 3QBUA 3LOTA 3EWCA 1KFJA 5HQMA 2FDMA 4S3FA 4P7RA 2QJHA 3L23A 4HK6A 1EF2A 2RUSA 5EPDA 4M6VA 1FWGC 3C0QA 1JYWA 4XD5A 1SR9A 1DE5A 5FJRA 3O8AA 4F0MA 2ZA1A 3UXIA 4KGJA 2J8GA 3SJ3A 1JFXA 1UWIA 3UR5A 3WLJA 2BASA 3REQB 1T7LA 1UR0A 2QULA 4O4WA 3FGCA 3FW6A 3KL3A 2HK0A 4ICCX 2GLKA 5A8GA 3FYYA 4CQDA 1QO2A 2CESA 3T7VA 2ISFA 5IDIA 1ZAJA 3W74A 1JD9A 3NAVA 4UFHA 1TB3A 4JY8A 3BUVA 2NT1A 1A5UA 4QGCA 3SCTA 1PS9A 3RM9A 2FVKA 3R25A 2PCQA 1XSKA 3C2RA 4PTXA 1I4NA 1P0KA 2YR1A 3AWNA 5D8WA 3GHSA 2YCEA 3TTOA 4EXBA 1B31A 1NVMA 1G4EA 1TIMA 1RCQA 3WLKX 2A7PA 3AOFA 4MYXA 5CGQA 2PDFA 2PDWA 1HJSA 3VD5A 1UJPA 4NX5A 3VKAA 4C5YA 2PDJA 4O1BA 4AXKA 2F2KA 3E0LA 4QCEA 1EDQA 4WGHA 5E0KA 5JBFA 2PC4A 3EB4A 4RDWA 2OODA 1PCWA 3F4VA 3EKGA 1AQHA 1KV5A 4RPPA 1DJQA 5F4XA 3CIVA 2EEXA 5TNVA 1NAL1 2DUXA 2G41A 2QVHA 1HGWA 3GWQA 2O7SA 1CB2A 4KWOA 4FX7A 4JN7A 1F4HA 3FKKA 2DZWA 3IIVA 3B8VA 3NPWA 3TQVA 5GNYA 3RN6A 1OC7A 3AJ7A 4C6LA 2V3DA 1E43A 4K1WA 3NVTA 3ZT5A 4O1CA 3VKSA 4X22A 1OFAA 5LXEA 5C8BB 3KLLA 1PHQA 3BG9A 1JZ5A 2O9RA 2XIJA 3C6CA 1S2WA 2PDUA 1QO5A 5D33A 5DCEA 3B9DA 1RY0A 1LP6A 1IZJA 1EJTC 1F61A 1SW0A 4X2PA 1OT2A 3CPGA 4JTQA 4MPQA 2ZRYA 3GBDA 5AVHA 3GTNA 4L56A 1G94A 4JNYA 2PI6A 4KH2A 3T0CA 1J6OA 1RR2A 4HNVA 1XRFA 2FPTA 1V77A 3P14A 3NL2A 4KFNA 4UFKA 1VC4A 2AL2B 3M0ZA 3BOLA 1LBFA 3PANA 1WZLA 5TQLA 5CZJA 1Z48A 3GAYA 1UWSA 3NDOA 3LBMA 5LHEA 2WLZA 3KLKA 1UQYA 1Q5MA 1RCXB 4Y8EA 4Y6GA 3W7IA 3E96A 3RPTA 3P81A 3U48A 4IMDA 1LF1A 4PMQA 1GORA 2P1FA 2B31A 4GKTA 2GJXB 3SSJA 1HP4A 2YDSA 3AHXA 3RU6A 3KBJA 3ZLGA 4RV8A 1EYEA 1GW9A 1DXIA 1E9ZB 3FA4A 3C3UA 3KW3A 5LIKX 1YRRA 7GEPA 2HVOA 1J8VA 2G0WA 2AKJA 5F2MA 1KFLA 3UA4A 4RZBA 1GPWA 3AZSA 2W63A 1RVGA 1C8VA 3FLUA 4R85A 1P1MA 1KO0A 1W9PA 5DEZA 1TREA 4GJ1A 3G8RA 4PUMA 4MZ8A 1KCZA 4L4OA 2NV2A 3S6DA 4OVXA 5HNTA 2VQTA 3EA3A 1E6RA 1AL8A 4ML4A 2GGJA 3IAPA 4NVTA 3GIQA 3W28A 3OZPA 3MM6B 3WF1A 4CU8A 1Y7VA 1PUDA 2ZXAA 2BTMA 2J78A 4O4VA 4CNUA 3OBAA 2PD5A 1K4GA 5LZLA 2PDNA 3ITLA 5AC6A 2OG9A 2DVTA 4RDYA 2H90A 2XN2A 3WLOA 2Z1KA 1Q63A 3LY0A 1W8SA 3ABXA 3TYAA 4I6KA 2WXDM 4QLLA 3AFBA 1E56A 4MWAD 5M03A 3PAOA 3GB6A 1U22A 5HDRA 4AZ7A 2Y8UA 3NZGA 4L4MA 1VJIA 4MJMA 4LU0A 4JTIA 1W3IA 5IDZA 1KFEA 2QCDA 3NEHA 4GNKB 4O18A 1N8FA 3OG2A 4JQ2A 1W8GA 3WDJA 2JF6A 3ENLA 3EA2A 1S5WA 2ZZ7A 1W9BM 3GDMA 5MKGA 4JTCA 1E6SM 3OGVA 2A6LA 1BYBA 1OX5A 2OZ8A 1J01A 4DPPA 1GK8A 3GDTA 3BDKA 4E38A 1CECA 1BAGA 3GTIA 4D6DA 2QJGA 2GSHA 4A3RA 1H0IA 1A0CA 6A3HA 1GZJA 2J9XA 1PPIA 3NQ7A 5IRPA 4OOUA 2PWHA 2YL8A 4K38A 3NCOA 2XINA 3CUZA 1HO1A 3GTHA 6PTDA 4BCEA 3TV8A 5KINA 4M82A 4DXKA 1BRLA 1GKRA 1TWIA 4JFUA 3DYOA 4X63A 3EX2A 3T81A 2ALDA 1XHGA 3C86A 2ACSA 1E72M 1AG1O 1MSSA 3AXMA 3G22A 3C2VA 1PL9A 2H8XA 3MM7A 3S6TA 3F2CA 1MXSA 2GJPA 1UWAA 3LPFA 5B80A 5EY5A 5FF7A 4P7QA 1KXVA 4RR4A 3VGDA 9CGTA 3QFEA 4HMNA 3MI3A 4QBXA 2EXOA 3OU8A 5EL1A 2XSJA 4OECA 2NX9A 3DFTA 2PP0A 1SZGA 3VIHA 1QCWA 1K8ZA 1RP9A 1GCYA 3KVKA 4EOUA 4PTDA 5I24A 4LF1A 2DZUA 4JTRA 1X98A 3UYIA 4C6MA 4DJFA 3KRUA 3W24A 1WCGA 3LXCA 2XVLA 3QZEA 4GBDA 2Y7FA 2BVYA 2O56A 1Z32X 4QE1A 4RCXA 1W3NA 1DWFM 2VDIA 1HQTA 3P8IA 4ACZA 4MKSA 4FSAA 1L8PA 3CAWA 4GCAA 3BWWA 1RK5A 3BLFA 2V5CA 2E7FA 4G5DA 2X42A 2J9YA 1QW7A 3WQ6A 4PMVA 1T0OA 4NY2A 4TU1A 4QHRA 3KRBA 1VBRA 3UWZA 1XF0A 3PBVA 1VBHA 1KNWA 3IRSA 2ZUWA 1NF0A 3I3EA 2HK1A 4YYFA 2ASHA 1JD7A 2YX0A 3W73A 5IFTA 2YCIX 3BAKA 4PODA 5DLCA 1ITXA 1XYCA 1UH2A 3TXZA 5K9CA 2WNQA 3B9NA 2OCZA 1LBLA 3EYPA 1RSCA 1DWHM 2ESCA 3E2VA 3H24A 2J7DA 4UQAA 2VVSA 2ATSA 1MW1A 2ZVIA 3RF9A 1ZJAA 3EOUA 1TA3B 3W81A 3G3DA 2D0FA 3B9OA 4IIBA 5JVLA 2ZUUA 1LT8A 1GVQA 1AZ2A 4N9EA 4GC3A 1YPXA 5EMLA 3CO8A 3AZTA 3CQKA 3GZAA 3TYUA 2W91A 2WCSA 2Y7GA 4NQ1A 2H9AB 4P2VA 5C55A 4P7OA 4CNTA 5REQB 1XI3A 2BFGA 4EP8C 7ODCA 1GKPA 2WVVB 3LLDA 4HU8A 2E5DA 3AOPA 4LH8A 2Q01A 3I3BA 2J6XA 2OO6A 2QLYA 1V4YA 1XBYA 1DJWA 3S1GA 2BOGX 3AYTA 5LNSA 4C7GA 3GH5A 3CV2A 2O9OA 4E8GA 5GJMA 4FHAA 3URQA 3U6WA 1Q6FA 1Q85A 4WKAA 5BZAA 3LA4A 4IPNB 4D9PA 3ARTA 5KETA 2VX4A 1EOMA 1W1B1 4O13A 3W85A 1KWGA 3TAKA 4WOQA 3QSTA 4NRSA 4PB4A 3V3WA 4XBSA 1H49A 2VEGA 4IFKA 4PCPA 1M04A 4JFTA 3TQPA 1ZS2A 3UWUA 1F6YA 4HN4A 4O0KA 3VGBA 1B5TA 3AIVA 2G95A 1V08A 3TC7A 2ZBTA 4MUPA 1UBPC 4GD0A 1K1DA 4WD0A 3SY8A 3TFXA 2CWNA 1MQQA 3LZ3A 5K4ZA 3ZJ8A 1AFSA 4H9YA 3P3BA 2XWEA 2P5NA 2FTWA 4LXFA 5BXTA 3UCCA 4LC8A 1UKSA 2Z4GA 1WB0A 2VTFA 3PY2A 3UD6A 3N04A 5A6MA 1FX6A 4W84A 3QMRA 1XGDA 2R1NA 4J3WA 4EKJA 2C19A 2QCFA 3PSWA 4IFOA 1JVNA 3ES7A 1BGAA 2XGBA 2CKRA 2C1IA 1NFBA 1JZ4A 4J27A 5ECVA 4ERGA 3TCSA 1PE1A 3VNYA 3VC6A 3U3HA 3PBUA 1WDSA 1RD6A 3VPLA 3NZRA 1DIEA 5CG0A 2ZTKA 2DUAA 4OJYA 1GT8A 3AXXA 3LXBA 1LT7A 1GJPA 2RH9A 2TAAA 3EXSA 3GKFA 1CGUA 3EPNA 4IX0A 5LIYX 1IR2A 3TOPA 1J79A 1HKMA 1EEPA 3ECQA 3G1FA 1XX1A 2WMIB 1KBJA 3E0IA 1UBSA 3F4CA 1Q45A 4DXXA 1PB0A 2O92A 2QCCA 2OYLA 2YCLB 4JTSA 1T8XA 4XB3A 2OMAA 5D9NA 4DWSD 1IR1A 2Y70A 4K39A 4AX6A 3O0FA 4MSSA 2Y7EA 2VEFA 4MB3A 1PSCA 1XIJA 1ZCOA 4L1WA 3E12A 2AQVA 3WLRA 3BLIA 2I9UA 3MI2A 3B03A 3EA1A 3G77A 3WUFA 4XQ6A 1MWOA 2ZICA 4I3GA 3TQKA 4LAOA 2Q3RA 3N3TA 3VOFA 1FFQA 4Q7BA 1QNQA 1ZP3A 2A1YA 3EKZA 2Y61A 3DX5A 4GABA 2VRJA 1AJ2A 5D03A 3AS1A 3LCHA 3DG3A 2DSZA 3A5FA 5IHRA 3S9ZA 3FS2A 3ARWA 4ATDA 2AOSA 4MYAA 4RE4A 4INFA 3KFTA 3RCYA 2R24A 4LUSB 1Z42A 1A5CA 4AAJA 3K13A 4UFIA 5FA5A 5EFDA 4Z1CA 3S3GA 2Z27A 3W1QA 2EAWA 2YCJA 3M6YA 4AYGA 1QVBA 4JNZA 3VFLA 2B7QA 3GDKA 2JKAA 4HPXA 1NM9A 3P2VA 3NZ1A 2R82A 3DKLA 5JU6A 1LUCB 4A2RA 1TMHA 4JTLA 5CKSA 3BOFA 2OPJA 1ISZA 3PBYA 3H4GA 2D73A 4ALDA 5BXRA 2DJLA 1FH9A 3SQSA 4G2DA 2TSYA 3VNJA 5HWMA 1DWIM 3ZXWA 4KEMA 3N34A 3NURA 4JBRA 4BI5A 3TXVA 1UD8A 1ISVA 2BY2A 2HS8A 1O5KA 3CHFA 3TLQA 1T5AA 2P0OA 1UROA 2WJZA 4K7YA 1ODZA 3T4WA 2NSOA 3H2NA 3NL6A 3VIIA 1DJXA 2YBTA 1FWRA 2H9AA 3N25A 4GJIA 4U28A 3F1QA 1JPIA 4H04A 1QUMA 3FEMA 5HQEA 1EXPA 1TV7A 2OLAA 3R8HA 4LUTA 1Y5WA 3DFNA 2VM8A 4LX4A 1SZEA 1XG4A 3KE0A 3DC8A 3W7GA 1Q13A 1U1UA 2WHKA 2C6QA 4NZFA 1H11A 2HNEA 4AWUA 5CEWA 4O16A 4WY0B 4GIYA 4DYKA 3OR1A 3KOWA 4K1GA 1NSJA 4JY9A 4RX0A 1W1IE 2V5KA 4W5UA 2OXNA 3UG3A 2FGZA 4M1BA 3WNMA 4NZ5A 3ABQA 4DAFA 4L1GA 1CX9A 1Q6GA 2O9PA 1RLDA 4GUJA 1MNZA 3ICJA 1I9CB 1ICSA 5D8ZA 3L68A 4ZR8A 1DWAM 3CYJA 1OCJA 4S39A 2JEPA 5JQ9A 5ECUA 3O6DA 3VXGA 3R79A 4JX6A 2V68A 4N6EA 4ZOEA 4MDOA 2YKKA 5D04C 4JKMA 1VJZA 3NYDA 3VM1A 3T40A 2VJXA 4IICA 2J4GA 3O2LA 3VMOA 1OGGA 1KCLA 3TSBA 4KF1A 5I6SA 3TIMA 3OGSA 3R4IA 4GYPC 1KRCC 3NR0A 3UZJA 3QGAC 3U5YA 1IIGA 2C16A 2V81A 3N73A 3CC1A 1YEYA 4J28A 1ZJBA 5JIPA 3OA5A 1AJ0A 3MM9B 5JXQA 3GQYA 2CC0A 1Z7AA 4AXNA 5ABFA 1O7AA 4QJ5B 1EJWC 4LUTB 5LKYA 1UD6A 1TVNA 2CEQA 4HNNA 1SMDA 1W5NA 3RIKA 2QHAA 4B15A 1Q6CA 3FGCB 4HHHA 2PDCA 3DUGA 3NPVA 2WMFA 2QGHA 2ODOA 1M53A 4W88A 3BCJA 3UEQA 2E1DA 4JEJA 1V02A 3WDHA 4NASA 1OM0A 2INEA 4K8GA 1FCVA 3L0GA 2X0HA 3OLEA 3C61A 3BZJA 2I7GA 3AMGA 6ALDA 4PMDA 5FL1A 2ZYFA 4HOXA 3TR9A 3NL3A 2VR5A 3XINA 3LS9A 2OSWA 1XLAA 3N13A 3VE9A 4ZGYA 4CNNA 4C60A 1EJ7L 1E1EA 3VIGA 3HGRA 2ISVA 1GW1A 2PDGA 2OOFA 4A35A 4FZIA 4ZXLA 2GDQA 1DOSA 1D8WA 4J3UA 4LRTA 3KCLA 2IPWA 4A4AA 3ZZ1A 1B0IA 4WSJA 2JGQA 3FK4A 3T1GA 4XG1A 3V0UA 3VKRA 3MY9A 1Q2SA 1HF6A 2PZ0A 3WY1A 1BKHA 2XSAA 3G0XA 2V2HA 1V6XA 4HPHA 5E6ZA 4D1JA 1Q65A 1DJYA 3FSTA 1JYXA 3WQVA 2EJAA 3V1PA 1I60A 4W7VA 3NOYA 4DJEA 4LBSA 5AHLA 4HNTA 1OB0A 3M0JA 4BI6A 3N4FA 2YPIA 2E25A 4GYJA 1YADA 2Q6ZA 5J5DA 1JYVA 4W7WA 1VCGA 4PMOA 4C5ZA 3MWCA 2VRKA 1XBZA 2WZHA 1FDZA 4LS2A 2GK1B 4LCQA 3NOEA 4REQA 3WK3A 4UR9A 2FFIA 4S3BA 2YBUA 1R3SA 3TYBA 5FI8A 1X97A 1EHNA 3LSCA 2PUZA 4G8TA 1ZSXA 3SUVA 2J74A 2FMNA 3GG1A 6TIMA 1XLIA 1OFRA 2XHYA 4G7FA 2PWFA 3UVIA 4FP1A 4H9TA 2DFAA 4NIRA 3WH9A 4D6JA 3BAYA 2Y5JA 5JH2A 3L7RA 4LS0A 3EOSA 2UY3A 1R3QA 2CHOA 3LCXA 2OTDA 3RHGA 5I3JA 3PZGA 2DSWA 1C90A 1H2JA 3GC5A 4DRSA 2WJEA 1I2NA 4LJ3A 4B5SA 3OODA 4Q8UA 1L6WA 5D9MA 2ZUNA 3UZXA 1GKQA 1X8FA 3WK0A 4GYKA 3PG8A 4EWJA 4L4PA 3PBWA 1XPGA 3SR7A 3S5SA 1E9IA 2WB5A 1XFBA 1EL3A 3I6TA 5LIWX 3AHZA 4Y2WA 3VD4A 4W87A 1HN1A 1KBLA 2YCLA 1RUSA 4EPBC 4C6NA 4AQLA 4GY1A 2RDTA 1XIGA 3W1PA 1W3LA 5A6JA 3FXYA 1RJQA 2GVJA 1XLBA 1MXDA 2XISA 4UBPC 3UY7A 1XXXA 2ZDSA 1E40A 2ZVRA 3TA9A 1VD6A 2XDFA 3ARPA 3TYCA 4E8DA 3QV9A 5B7ZA 3RCNA 1V3LA 4DJFD 1TTJA 4FNSA 5K9XA 4UC5A 3N4EA 3VGGA 1HKJA 5LGZA 4CGTA 3B8DA 2D0GA 2DDXA 4GUGA 4GZJA 2QPXA 2OWWA 4BS0A 2VFIA 2XH7A 5E0CA 4E2OA 4K36A 2CZDA 4C90A 4DI8A 4NYYA 5DMMA 3OLIA 1T8QA 1KM5A 3WQ4A 2A5HA 2WMJA 4GA8A 1KR0A 1AJZA 3HZ3A 1UD3A 3IV8A 4QP0A 2EHHA 4K8HA 2PZNA 5CGTA 1PV8A 5BWAA 4URIA 2NV9A 4IIHA 4R9OA 4JGDA 2XVNA 3G8EA 4JYDA 4DQWA 1HT6A 2WPGA 2Y89A 3GIYA 1JYNA 1OK4A 2YBVA 3W1UA 5JH1A 1KC7A 1UYQA 4RDZA 3QHOA 4MG4A 4UQ9A 1KKRA 4GWEA 4LS1A 2CITA 4UFJA 2ZA2A 4XBJA 5CJNA 1YBQB 3KHJA 3GR4A 2JKEA 3L2IA 3GG0A 2J7GA 4AY1A 3NDZA 3LK6A 3LPPA 4Q4MA 1R8LA 4ZBCA 2ZDRA 2WW5A 3M46A 3ZS4A 2NQZA 2WJDA 3G18A 4ICNA 1IEXA 3W75A 1A5KC 2W92A 1XRVA 3NZPA 3S1WA 1N55A 4Z2LA 2BY1A 4Q4SA 3ARSA 1JZ6A 2PGWA 5EMKA 2YW3A 1OADA 4ZZ9A 4UZSA 3A6OA 2JE8A 1TPB1 4NUWA 1NDYA 1HL9A 4U4MA 4E2BA 4LAZA 5CCZA 4GZ7A 4PRTA 5TBOA 5DBUA 3PC0A 1WZKA 3P67A 1UKPA 1H1YA 1VHNA 2B7PA 5D30A 1Q66A 3L4WA 4W4QA 3CIXA 4KEZA 4WX2A 1A53A 2GGGA 4EPEC 3VIPA 2Z2BA 3AICA 5CBBA 5CC5A 1OSEA 3G2GA 4YN5A 2WC4A 3QOKA 2R91A 2GWGA 9XIAA 3UXDA 8GEPA 1EZ2A 1S1PA 4G7EA 3QQWA 1VPYA 1EJRC 1UKQA 1OYCA 1FVPA 4M56A 1EGVA 4DO5A 4TVUA 3W1NA 4UTFA 1R86A 4MWAA 4ZENA 4JS3A 2XIIA 2NVDA 1TVPA 1J12A 3V35A 3ZR6A 4KETA 4O8AA 4GQRA 3M41A 1VKFA 1BTCA 5XIAA 5I00A 4LC6A 3WG6A 3WN6A 2J6VA 3AIRA 3FAXA 1H5VA 4M7TA 2HXUA 2VGGA 1ME7A 1NIUA 1I2PA 2XH0A 3KWXA 2I5IA 3LHVA 3MM5B 2PTXA 4YIWA 3GO2A 1V0MA 1L8NA 4CKQA 5FOOA 1WX0A 2XN0A 3EDJA 1E3XA 3LERA 4C7DA 4FIQA 4OKDA 5AYIA 4GO9A 3VIOA 2NXHA 3OW1A 5CPSA 1TFVA 3MVIA 4KCVA 4YMZA 4AD5A 4X0NA 2OZTA 2P53A 2IW0A 1JCYA 2DV0A 3M43A 1QXLA 1JNEA 2CLOA 1JPMA 5DRCA 5G4EA 1LORA 4W9TA 1XDJA 3IGSA 4M0XA 1V8EA 4NP7A 5MF5A 4MVAA 2VZOA 1BFNA 2VX5A 4WSHA 3N15A 1GVRA 3VKTA 1UD5A 1FP8A 5CSSA 2P88A 1D3HA 4TX8A 5D09A 3TDFA 1TPDA 3KM8A 2X7WA 1IWPA 3T09A 2Y24A 5JUVA 2ISDA 2Y0FA 2QDGA 2NSXA 4RZ4A 2W79A 4PTMA 2CBUA 2C13A 1P1XA 3OLDA 4L4LA 1E0WA 1TPEA 4XVEA 1DIKA 3E3HA 4PUJA 1E6XM 2ZQ0A 1RPXA 3W3OA 3K8KA 3SCNA 1JZ3A 4BWLA 4K2SA 4Q8NA 1QOPA 4L6OA 1LCOA 1TV5A 3PG9A 4PBFA 3E2QA 3H53A 3REQA 4C1NA 3DI1A 1UC5A 5K7JA 4N02A 1ZB5A 4B9YA 3EWZA 3IGUA 2B7OA 2J75A 3ZQ9A 4S3JA 4JNMA 1ADDA 2BGNE 4E3VA 3SIMA 4ZQRA 7TIMA 4C6QA 1W5PA 3RR1A 1FRBA 4IMGA 4KCUA 2G50A 1RLCL 5CPMA 3H26A 4JQ1A 1OHLA 3FKRA 4Y7EA 1XLKA 4O17A 1XICA 2P76A 1J6PA 3L4UA 8A3HA 1BQGA 2DP3A 3KDNA 1W5MA 3HJEA 3BW4A 4MGGA 3ANVA 5KZEA 4LWWA 2ZXBA 3G3MA 3I7SA 2ZC8A 4QITA 1XINA 2X0YA 2XUCA 3TU9A 2ALRA 4A2SA 2V5BA 4A05A 3WH5A 1BWKA 2HNHA 1W1PA 1OC6A 4AY7A 3W1AA 3OHMB 4PB3A 3HU7A 3O6AA 3QPYA 2YDAA 1H7WA 2QCNA 3TN3A 4QG8A 4R7WA 4S3AA 1M7XA 4H9MA 4HOWA 5HULA 3CTTA 1PAMA 1XFCA 1TWWA 4A3HA 1KM2A 2XU2A 3B40A 4WVXA 3SJNA 1JDEA 3CHVA 2W0UA 3NL5A 3OP2A 3M0XA 2J7CA 2IXVA 1KFBA 1BXCA 2Y88A 2D24A 5GJPA 3SY1A 5A2CA 4RNIA 4O8RA 4H8NA 4QQUA 3WNOA 3M5ZA 5M2FX 4EF9A 4PFMA 3SUSA 4NZJA 4UXDA 4C1NB 2G96A 1H09A 2VRQA 5D32A 1E1FA 3PBMA 1VZWA 3VIKA 1B3XA 1X6UA 4LSBA 4AMAA 3PTMA 1V3MA 1QBAA 1KM4A 2E6DA 4HU4A 3OVQA 1R85A 1G4PA 1TE6A 1EZWA 5L6UA 3H7UA 3NO5A 4JTFA 1PZ3A 1ICPA 2EGZA 4V1YA 5IM51 4H6EA 2A3LA 3F4NA 2QR6A 3F4WA 3HOJA 1E1CA 1Q4WA 5I09A 3FOKA 1W91A 4C91A 2UV8G 5EMUA 3LMYA 2FJKA 2V2DA 4K6AA 4ZQMA 3UWVA 4ZQOA 5AHMA 3P6LA 4NAEA 4WDTA 2PDQA 3KZSA 3W7MA 3LHTA 3SCOA 4MOZA 5IBXC 1G7UA 4MZ1A 1E4NA 2OGJA 2V30A 4J3XA 3OR2A 1BKSA 4QG6A 4TQTA 1BGGA 2A2IA 4RPQA 5LNWA 3FJ4A 4UTMA 1E3ZA 4L5ZA 4G1KA 2CNCA 1W3KA 1EH9A 2GOKA 3CMGA 4LT9A 4P8XA 1HJVA 1IEWA 1UZ1A 3VIJA 2DZTA 1V79A 3KCJA 6TAAA 3L66A 3BLLA 5FAJA 2A6NA 1J5SA 4MKVA 1LL6A 4JIPA 2FLIA 4IPPA 1MZRA 4R7JA 2FDSA 3WQ8A 3MHGA 3OR2B 1UP0A 1XQKA 1W9DM 3PVFA 4MB1A 4XAYA 4XZLX 2GGIA 1WNOA 3HFYA 1FY6A 3C2YA 5F7UA 5REQA 4YYCA 5LNUA 1PWLA 4GVGA 9RUBA 1OIFA 3IK2A 4ZA0A 1Y0EA 3W7JA 2D2OA 1PTGA 4HNOA 3VNZA 5BNKA 1SO4A 1QFEA 8CGTA 1SFJA 1GJWA 5F4WA 4GXWA 1OEPA 3DXIA 4NAFB 1EWDA 2NQ5A 3G24A 5FJPA 1VB9A 4H7ZA 4I6VA 3HG3A 4O19A 1XW8A 3S2NA 1ZALA 3UA3A 2YB4A 3BJFA 2IXUA 2D69A 3LU2A 5HMEA 3SCQA 5BYWA 3AXIA 3O15A 2GUYA 1GOOA 4UOZA 1EJVC 2ICSA 1RPKA 3ZM8A 1GVFA 1B2YA 3S2LA 3S2JA 4H41A 1P7TA 4PUKA 1LG2A 1J0ZA 2A0NA 1KLZA 5DQPA 3MMWA 5KTLA 3WK1A 2ACRA 4ATWA 1FDYA 3QTGA 1VYPX 4OHQA 5G2HA 4CCEA 4ZOCA 5HAOA 4GQQA 5AYXA 1OZMA 2WWCA 2WHMA 2XH2A 1XIIA 3H54A 1PYFA 3STPA 3AZRA 3V0TA 3CL7A 1DP0A 4FK9A 5DXXA 4YLWA 1NOWA 2WLYA 3G1RA 1TTPA 4US5A 3UGRA 2GYIA 4AZHA 1M65A 3SUTA 4FPSA 1R7OA 4D8LA 4JFSA 5JBDA 1S2UA 1YBQA 4I9AA 2QVNA 2F61A 3SQMA 3LQLA 4PA8A 3PF3A 1F3XA 1ONEA 4NJGA 4DWSB 4XSMA 4LY4A 3MBDA 3EDFA 5KSWA 1R6WA 1EQPA 3T0AA 1B9ZA 5AZ0A 4GC4A 1HKWA 2Z6JA 2BVTA 5PTDA 3K4DA 1GEQA 4B5UA 1PIFA 3IVSA 2VURA 2V0TA 3KHDA 4CEUC 3AALA 3IWPA 4G6CA 3T6CA 1CLXA 1F5ZA 3RMJA 2CXEA 2PDHA 3IANA 3V5OA 1GONA 3BLOA 3I6EA 4ZB5A 3XIMA 1WBHA 1T96A 3V7PA 1RH9A 3PNUA 1VFTA 3C2FA 1DJHA 1MYRA 2R1KA 3MANA 3F7JA 4JCLA 1Q8JA 1IQ8A 1LWHA 1B3OA 3CAQA 3W7QA 3STFA 4D1IA 2RJGA 3EKLA 3QMTA 2Z25A 3VOCA 4O50A 2O9TA 3SEPA 2XVKA 4U2YA 2PP3A 3CLWA 3KS5A 2R8WA 3M0IA 3OJGA 3PUEA 2J8TA 3PJXA 4H01A 1BF6A 2Z26A 3CYVA 3LM3A 4DF2A 3AMDA 5HR6A 4O0ZA 2I14A 2AAMA 5AB3A 2WBGA 4JTUA 1TJ2A 5AOPA 3HPZA 4K68A 4L64A 1FBAA 1I2OA 4TTGA 8XIMA 4NNBA 3KTXA 4JDBA 4O0QA 4M3PA 1OF8A 4XTDA 3NO3A 2QV4A 1YXCA 2XFYA 4JTGA 3QTPA 1W17A 3LG3A 2HTMA 3TVAA 1LLOA 2Z7KA 2BDQA 3WJYA 3MS8A 4GKLA 2C7FA 1OYAA 1K6WA 4QIUA 4Q22A 2Z1BA 3S9YA 4PMRA 1LOLA 4M81A 3S2CA 1VFHA 3MM5A 1QPRA 3BXWA 2VOMA 4XD3A 2VYOA 3DECA 4U33A 4N42A 4X2RA 4HJFA 1YTDA 3LPGA 5I3KA 4ZO7A 2J8FA 3MMDA 3NDYA 3VOJA 1AD1A 1L9WA 3P60A 4QSHA 3QR1A 4ATLA 2WMGA 1UD2A 3IACA 1KKOA 4S23A 2YL6A 1M6JA 2FZBA 1QNOA 1JUBA 1WDWA 1OYBA 3BJSA 4PZVA 2Y4SA 1TTIA 3AYSA 4JPGA 4NRRA 2E8ZA 3ANUA 2BGQA 1V02E 3PJTA 1GJUA 4CNOA 5H1WA 3PPGA 4ZO8A 3M1ZA 3CIWA 3M0LA 5J04A 2PWGA 3APGA 3GK0A 3AIQA 4W85A 3G0UA 4KFOA 4GY0A 1CNVA 1TKKA 3T55A 3MM9A 3PWAA 5M17A 2DH3A 2NLIA 2V8ZA 1TV3A 2P50A 4PEKA 3ITOA 1YLVA 5CJMA 2VZTA 2Q8XA 2OYKA 4YHGA 1GOWA 3RPDA 4X3ZA 5LA0A 3ITTA 1FXQA 1J0YA 3M5YA 1S3TC 2WVTA 2ONEA 3TYZA 4A3QA 1OINA 4M29A 5F1UA 1O94A 3OBKA 5A69A 5G2WA 3L4YA 4HNUA 5HNRA 1F3WA 4JIHA 3UZ5A 1B4EA 1I0BA 3WQFA 4WDUA 3KRSA 3GFXA 3S8HA 3TJLA 3URAA 2V3FA 1I1WA 4HYRA 3HQPA 4QE5A 4IGSA 3E6EA 2XSXA 2HVMA 3TNOA 2Y5SA 3WJSA 2FVLA 4LANA 3MP4A 3SZ8A 2QF7A 4IIGA 4FOKA 1MRQA 4IUGA 1RJRA 3A47A 4YWSA 4KRTA 3A24A 1PWMA 1H1NA 5ABTA 3S47A 3VOHA 1VRDA 3RPMA 4IJBA 2HDJA 4GZEA 3P5YA 4LVAA 1JDCA 4O15A 1A3WA 5EMJA 4J9JA 6ENLA 4AD1A 3T78A 1Z3NA 4NAFA 3UT0A 4TMCA 4HTBA 2WWDA 1X7FA 4GGBA 5CSRA 2PWEA 4LUYA 4D6FA 4IXXA 2PGRA 3W84A 4F2TA 1X7IA 2FB2A 1QI3A 3AU2A 3E0FA 3MO4A 3LTYA 4I7WA 5CPTA 5U4NA 4HPJA 3MZNA 1ECEA 3GVQA 2BB0A 4US5D 1EGMA 3QZAA 4MJZA 3WMCA 4AWTA 3SN4A 1PXGA 3CUGA 1BTMA 3PTQA 2FVMA 1T6MA 3GNOA 5LYRA 3W23A 2E09A 4AY8A 3WNNA 4HPGA 5D02A 4JTKA 4QM1A 2ZRVA 3TYDA 4WRHA 2FFCA 3NGJA 1LUCA 4NXKA 4CN1A 3IGHX 1ELSA 3BZGA 3GM8A 3RLGA 1B1YA 3GNNA 3SM0A 1W5OA 3W7OA 3BLKA 3HO8A 2PFHA 4QJ4B 2D2JA 3KOXA 1M03A 3TNBA 5LXXA 3N29A 3EXRA 1LTDA 1M7OA 4IQJA 3WQOA 5H8UA 4OBSA 3T2OA 2W27A 5A2AA 4R7OA 2W66A 1BG4A 3C5QA 1HO4A 3IIXA 2PGEA 3WLHA 3HPAA 5DFAA 4EACA 1BVNP 1PHWA 4GUIA 1A80A 3QFWA 3E2SA 2ZUMA 5I3HA 3DC0A 3OZOA 4QS5A 5CG7A 5BCAA 1MEHA 3RX3A 5HMFA 2FZ8A 3H2CA 2C91A 4IPLA 4Q33A 3MMBB 2CLEA 1TZ9A 3IUDA 3WJWA 2FPVA 3I10A 4HA3A 3WLLA 1K4HA 3N2MA 1XYZA 2HBVA 4GZIA 1BG9A 4Z2KA 1G6CA 4FNQA 1GZGA 3KOYA 2CCRA 4PB5A 4XZNX 3WUBA 1JG9A 4GI6A 1V6VA 1LRTA 4REQB 1ZLPA 2B4GA 3MUIA 5C5YA 3JRKA 3PNZA 2J25A 1GVEA 5C9RA 4JTHA 3THUA 5M1TA 1H61A 2H6RA 4PL2A 2WKJA 4OUIA 1NWUA 5AY7A 3ZOAA 3P74A 1JZ7A 1P5BA 1UW9A 3W82A 2X2GA 3VOIA 1ISYA 1EX1A 3I7QA 4UR7A 2DSKA 4QSFA 4ZXOA 5AVNA 3MA8A 1KFKA 3CJPA 2YSWA 1XIBA 3OO2A 1MEIA 4RXFA 3UZZA 1H41A 1XC4A 3M47A 4NZ3A 2W62A 3T0BA 2AKZA 5H6HA 3CL8A 4W86A 2NQHA 2FHFA 3WQEA 2DUZA 2VT0A 3URBA 1XH1A 3CNYA 4J2PA 1MVYA 3CHCA 4D6IA 1UH4A 3FHQA 3SDOA 2D3LA 3ABZA 1UPMB 4O52A 3DKJA 2QJNA 1KM3A 2PODA 3BGGA 4QROA 3WDQA 3OYZA 2UY2A 3VGFA 4R53A 1YXYA 2J62A 4IMEA 3UPBA 2FTPA 3DFPA 3DH7A 2DQXA 4AZBA 3H55A 1B54A 3PR2A 1OCNA 5GQBA 1VBGA 1DE6A 1A4MA 3MP5A 4NNCA 3P5ZA 3B0LA 2FHBA 4TO8A 3HG4A 4W8AA 1XSIA 6REQB 4CD5A 2HPMA 3QV7A 4AVNA 1FWFC 2ZXQA 4V15A 3WMBA 1KBKA 3L9CA 3WBEA 3ZT6A 4CNSA 1V03A 1GHSA 1PCKA 3NQMA 4QNEA 1J10A 2NQJA 3B9EA 3BOXA 3P80A 1UR2A 4MY8A 1HW6A 5AYZA 5A6SA 4BA0A 2R94A 1GVSA 1ZBKA 3V5CA 3RO8A 3A4XA 3TEVA 1E4LA 3WD2A 3IIPA 2GQ9A 1D8CA 4LBUA 3HPFA 4DJED 4ILSA 2P10A 4JQ3A 2VFFA 3BH4A 4NJIA 3MUCA 5HUOA 5F2GA 2Q09A 4UNLA 3WQPA 3ZFHA 4Z0JA 5C9ZA 4GLEA 4HHLA 3OQEA 3WH6A 1Q6OA 2QCEA 1RVKA 4O53A 4C6PA 4JQ4A 2ATMA 4HT3A 4ZQPA 1Q7ZA 3UXAA 1Y8BA 4GQ0A 1RP8A 3NQVA 3JU2A 2ZX6A 2EKGA 1GQJA 3CZKA 3P0WA 2POTA 3SFWA 5I3IA 5I02A 1QOQA 3CMJA 4LAUA 3DHPA 2W4XA 1KRMA 3LHZA 1XGEA 3AIBA 1RD5A 4UUIA 2I16A 3G1SA 3GZ3A 3PPFA 5DX7A 1QHPA 4R88A 3THDA 3I4KA 3HN3A 2CETA 3JW7A 2EG7A 1J0JA 1R3TA 4JHZA 4AIBA 1XG3A 3VKCA 1NWSA 4E2VA 3M5VA 3W6YA 2IKJA 3QPZA 1F3EA 4ROPA 3P61A 3N1AA 1UOKA 1N82A 3BCDA 3ORWA 3LEPA 4JX5A 4UTTA 4R33A 1VP5A 5AHNA 4MJ4A 2NUXA 2WANA 3KBVA 2XTKA 3CH0A 4B3ZA 3EX3A 3SB0A 4WXYA 3U4FA 1I1XA 4IXHA 1AOPA 3NFUA 4ADTA 3AWOA 2WZEA 3WBAA 1IIHA 1IYXA 3V75A 4HU0A 1EGZA 1TELA 1MQRA 3D3AA 3IIZA 3K46A 4WZHA 4Z42C 3LHUA 2HRWA 4P7LA 3WLQA 4B16A 1KM0A 4KS0A 4UIOA 5AECA 2WYSA 3POCA 1Q6DA 3KBWA 1OFQA 5FEZA 1W6TA 3AI0A 3FA5A 4DO4A 1YDOA 4KMQA 3TW9A 4AWSA 1LZOA 3AHYA 3TP4A 4L6DA 3EX4A 2DU2A 3SECA 5A8NA 5KZ6A 3FJLA 3UNDA 1TWZA 3K1DA 3LENA 4ZB0A 1XCXA 4S38A 2ON3A 1W9UA 2PMQA 4GIRA 1PTAA 1F8MA 4H7VA 5C7HA 2HS6A 3W71A 1JI2A 4CQBA 1JJKA 3MMAB 3NVDA 4FXJA 3PTDA 1WDPA 1PBGA 3QPEA 3PB2A 4XAFA 1WKYA 2BOEX 2HCVA 3AROA 3MSRA 4Y96A 1IWAA 1PX4A 4XIMA 3S83A 3AC0A 2SFPA 5FF3A 3W87A 1PKLA 4E6MA 4DO7A 3V1HA 4GI4A 4X9YA 3B4YA 4I5UA 2ZRWA 2W67A 4DWSC 3WDIA 5HBFA 3SO7A 4XAGA 1OCQA 1XDLA 2A85A 5TD4A 1G9HA 4TV5A 1T41A 1W37A 3SSZA 4UTLA 3DG6A 4PCTA 3MJMA 4F0SA 5FJIA 2ABAA 4C6EA 3ISIX 5HPCA 3UGVA 1ZBWA 2VELA 3WENA 4ERAA 2V4JB 5TF0A 3N2BA 4WJEA 1WBJA 2YA2A 4IGMA 3H21A 3AS2A 3GVRA 3ELFA 4X9SA 3ARYA 2E1WA 2GOUA 3JZUA 4Q7NA 3LQGA 3QV6A 3VDGA 5GEPA 4AC7C 5BU9A 2RAGA 1W2VA 4XO7A 5CC3A 4DJDA 3CV6A 1ZU8A 3U4AA 1NFGA 4P7NA 3LXAA 1NU5A 4LEQA 1TJ0A 1VEMA 2Y63A 1K7FA 1EA9C 3DCPA 2UY4A 5EMYA 5D2XA 3VVGA 2OWCA 1OCBA 3RK8A 3LGEA 1YIXA 3A12A 4FA3A 2XIOA 1CGVA 3NSMA 2VEKA 2CZVA 1W1VA 4AEEA 2QQ6A 2TMDA 2Z2AA 1EF3A 1ALDA 2HV5A 2DGAA 1Q7MA 4XV0A 3SGGA 1VJSA 4H1ZA 2ZE3A 3R43A 3C4UA 3QW3A 4HOZA 2NT0A 1G67A 2F6KA 5D4YA 1S39A 4N9CA 6CGTA 4DBUA 5HATA 5HANA 4UTKA 3HQ1A 3PM6A 2Y6ZA 2PTWA 3H2AA 3RU8X 3PZ9A 2WBKA 4PYSA 2ZXDA 5CPOA 3B05A 2QUUA 4WQ6A 2J88A 3KEHA 2VC9A 1NWRA 3TC3A 4HMCA 1ONRA 5CC7A 1E70M 3PULA 1MMFA 2HSAA 3KWSA 3PPHA 4ASTA 3UJRA 3THCA 1H5YA 2PDBA 2IPJA 1LRQA 3NSXA 3EDKA 2EPLX 1U5VA 1IZCA 1DHPA 4BK9A 1AW2A 1ZJ9A 3W7EA 3NUKA 1RAKA 4D2JA 3R1ZA 2GJXA 4M6QA 2QAPA 3W7PA 2EO7A 1E6NA 2WM1A 1GOIA 3UWWA 3ZWSA 1WKEA 3AIUA 1HJXA 3RUBL 5HWJA 4B4FA 1J18A 1E15A 3W2LA 4A22A 3CUIA 1I8JA 5E5CA 1EYWA 2KZHA 2BXZA 3EGJA 3MMCB 5D2WA 2DZPA 3TN5A 4XKMA 4GK8A 3MCMA 4YS1A 3GG8A 2EG8A 4G1NA 1TV2A 3W07A 4GCXA 5C9XA 2Y62A 2FZMA 2V9DA 1XGZA 3FXGA 5KMYA 3MU7A 4FX6M 1P6CA 3RLUA 1X96A 4QLKA 3CS2A 3EEZA 4FNRA 4WGXA 3LV6A 2V3EA 4XSLA 1TJ1A 3KAOA 1NQ6A 1DQUA 4UNIA 1SU5A 1C8YA 4G38A 3A9IA 2RFGA 1QWKA 5A8PA 3HPSA 4GX9A 1WXJA 3QC3A 4MF4A 1K7EA 3HB9A 3MHFA 4OV9A 4I9MA 3PP7A 3CU2A 4EF8A 4G9PA 4DBEA 2CWXA 5I77A 3N9SA 3QHNA 3EMCA 3L0KA 3MM8B 3QH2A 1DJIA 2V38A 2PDIA 1LWIA 4EVZA 1MNSA 4C6JA 5CPNA 4GINA 4KPLA 3QY8A 4QRNA 3KUMA 4A8RA 2V63A 2PWUA 3LGDA 1NY1A 1FHUA 2POZA 5BOOA 4DWSA 1Z8AA 4EAYA 3H7VA 1FHVA 3QVQA 4U3CA 4KKXA 1Q8AA 4O1AA 2CLPA 2GVGA 1G4TA 3FDKA 4A6GA 5I78A 1F8IA 4GI8A 4M5PA 2OJPA 1E4MM 3UJ2A 3BLDA 2PCEA 1GOMA 3W7DA 3DI0A 4WCJA 4Q6JA 1G7VA 1YE6A 4DM1A 2QJIA 3RM4A 3PWGA 1YNYA 3L5AA 5EFFA 1L2QA 1ML1A 2AOPA 2EPKX 3NA8A 4QG9A 3HBLA 7CGTA 2OT1A 4XD6A 3B06A 2REQA 1CXIA 5I3GA 4GBUA 1FWNA 1RV8A 1EC8A 1C92A 4CCZA 4HZ7A 1NFPA 1FFRA 4C1KA 1TV4A 2G3IA 3PFMA 3II1A 5BW6A 1EPXA 3HPXA 1AK5A 1B30A 4XZ9A 2WZTA 5IFPA 3WH8A 1TPVA 4NI8A 3GBEA 4GO8A 2XSJB 1VFFA 3GAKA 2XFFA 1DQWA 1PKYA 3CB3A 3LMZA 3JS3A 3WLTA 1KXTA 1PZ0A 2F7FA 1SSDA 3UJFA 1BYCA 3AYVA 3O9NA 3W22A 3DHFA 5A6BD 2OQYA 4L9ZA 2R9RA 1GG0A 1IF2A 1W2PA 3D3FA 4Q4PA 4I7UA 2GVLA 4MB5A 4AMCA 1CB7B 1K9TA 1FWTA 4LB3A 1AQFA 3USBA 2QEZA 5AFDA 2IKHA 4DF0A 1P0NA 2FTYA 3SBFA 3RM8A 3VA8A 4F9DA 3NQ6A 3NG3A 1KM1A 4R5EA 3CZEA 5DT5A 3TCEA 1E51A 3WFAA 3WNKA 3B4UA 5I23A 3OQ8A 2YXOA 3GVGA 4W8BA 3MZ2A 3IVUA 1WDDA 5DANA 2BY3A 1F07A 3WUGA 1BYAA 2EPHA 3BMWA 1F76A 4P8VA 1ADOA 1YE4A 4IGNA 3D0CA 3N6QA 3OGRA 1ZAHA 2CW6A 3SRDA 4JKKA 1VLWA 1H1ZA 3VD7A 4O10A 4D71A 1FWDC 1UHVA 3M0KA 3AAMA 3ZSTA 4YL2A 4QJ1A 3ZYZA 3DDMA 5C9UA 4ACZB 4Q8QA 5C7VA 3N2XA 1QI5A 1UWUA 4Y9AA 3WUEA 2VKZG 1SPQA 5EA9A 4CQ9A 1E1CB 3C3NA 4ZL1A 5D2TA 1BEUA 2YYTA 2HE8A 3BJTA 2E5CA 4GVIA 1RBOB 1W0MA 3PWIA 2VXNA 1WAUA 4MWAE 4YNGA 4EPKA 1HG3A 3EPOA 5F2LA 4BQ3A 2DZSA 2X2YA 1VEPA 1ODUA 3O0KA 1X1ZA 1R30A 2ZZ6A 1XLEA 3KVLA 1IV8A 3KVMA 4A29A 1TQXA 4QDMA 2OB3A 4MLJA 3WL0A 2OSYA 4H83A 1I75A 2VDHA 3M4HA 3EX6A 4A8IA 2Z29A 1ZJ8A 5GPRA 1F05A 2XIQA 3N14A 3P0XA 4N6FA 2PTYA 1SMAA 4ZQCA 4DUXA 1TG7A 3PZOA 1J0IA 2J24A 2XIBA 1KV8A 3RR4A 1KTCA 5LIUX 1XLJA 4OFCA 4RK8A 3RJXA 1RQHA 4BQ5A 3INPA 3ZJ7A 2CBIA 9XIMA 4EXQA 4HNLA 2C0HA 1Z6KA 1POKA 4E2DA 5A2BA 1BQCA 1E0XA 1JUKA 1XJBA 3E1F1 1JXJA 3A4AA 2XM1A 2OQHA 4IF2A 4UMCA 1Q7QA 5E6YA 3VIMA 3RAOA 2EG6A 2Z28A 1VF8A 4HZ8A 1XBXA 3MWAA 4RV3A 2V4JA 2GFTA 1K6AA 4DZIA 5CPQA 2J66A 4KRUA 3GH4A 1FCUA 1VYRA 5HWNA 5EMMA 2J27A 3N6JA 1YQ2A 2Y85A 4WKFA 2F6UA 1YYAA 3UPWA 3WFLA 4XUYA 4Z0SA 6XIAA 1XLFA 4BF7A 4TIMA 3IJQA 2XGZA 4XAZA 3MDUA 3LNMA 2RDUA 4H8VA 2CU0A 4K7VA 1XR2A 4NSBA 1MDRA 4PMXA 4BJHA 1HUVA 1ESWA 4IL2A 2CZFA 4X0VA 3N9KA 5BMXA 1F3TA 4PRRA 1KWKA 2KX9A 2FPYA 4DZAA 4PMNA 5DMNA