4S3DA

Ispg in complex with ppi
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
402
structure length
401
Chain Sequence
b'GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 137
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3dA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3dA02
4DJED 3B0JA 3H2NA 3MM5B 4C1NB 4S39A 4S3BA 4S3FA 3MCOA 3B0HA 3B0GA 1Q7QA 6GEPA 1ZJ9A 2GEPA 3MCMA 4DJFA 3OR1B 3B0MA 2Y5JA 3H2CA 2VEFA 4DAFA 4HB7A 4S3DA 2YCIX 3GEOA 3TYZA 2AKJA 3BOFA 3VKRA 1AD4A 3H2MA 2XSJA 2Y5SA 3MM7B 3VM1A 4DJDC 1Q8JA 4S3EA 3OR2A 3VKTA 4G39A 4O0QA 2E7FA 3MM9B 3TYEA 4GEPA 3MMCA 4HTRA 3VKSA 4MWAB 2YCLA 4DB7A 1Q85A 4DJEC 2YCKX 2Y0FA 4PZVA 2BMBA 4DJDA 3H24A 7GEPA 2OGYA 4AOPA 4MWAD 3MMAB 4S3AA 4NL1A 1AD1A 1TX0A 1Q8AA 2AOPA 2DZBA 3MMBA 3MM8B 3MCNA 3VM0A 4S3CA 3K13A 2V4JB 3AOPA 3MM6B 1AOPA 5JQ9A 1EYEA 1AJZA 4NIRA 4NHVA 4O1FA 8GEPA 3TYDA 3VLXA 2VEGA 4C1NA 1F6YA 2YCJA 2H9AB 3VKPA 3TYBA 3VKQA 4MWAE 4D8AA 1Q7ZA 3TYUA 3H23A 4DAIA 1AJ0A 3TYCA 3OR1A 4O1EA 4S38A 3TR9A 3V5OA 1Q7MA 3NOYA 4S23A 4MWAC 3H26A 4NILA 3MM7A 4DJFD 3H2OA 4DJEA 1ZJ8A 2DZAA 1TWWA 3H2AA 2XSJB 1TX2A 3H2EA 3MM9A 1TWSA 3TZFA 3H2FA 3OR2B 1TWZA 3MM5A 1AJ2A 4MWAA 3TZNA 3MMCB 2YCLB 3MMAA 3TYAA 3B0LA 4G9PA 3VLYA 5GEPA 3MM8A 3H22A 4CCZA 3H21A 4DJDD 3B0NA 2V4JA 2DQWA 3MMBB 3MM6A 4G38A 5AOPA 2VP8A 3BOLA 3VLZA 4DJFC 2H9AA 4D9PA 4D8ZA
chains in the Genus database with same CATH superfamily
2ACQA 4IGSA 3HFTA 3PY2A 1JZ2A 1BGAA 4JN8A 4JD4A 1NARA 3E5BA 3PBUA 2W66A 3BLPX 2OLHA 4DELA 3QYSA 4UMBA 3LNPA 3AXMA 5A2CA 3WLNA 1WKFA 4Z2JA 3C5QA 1NFBA 4EF8A 1WBJA 4UBPC 4G2DA 2ACUA 3MM9B 4M81A 4XO7A 3UVIA 5HNNA 3QR3A 5LA1A 3N1AA 3KVKA 4E4UA 4F40A 4GZIA 4AD3A 4W7UA 1JIBA 5C54A 4NSBA 1EWEA 3EOSA 4D6GA 1F6YA 3BSGA 3W23A 2V3DA 3W7QA 5TNVA 4YPJA 3M0YA 3QC3A 2XIOA 1R3RA 1KFJA 1GQIA 4C7DA 4ERGA 3LMZA 3PF3A 4P8XA 1ZJ8A 4WJ8A 1LWHA 1OFAA 4AAJA 4QS5A 3KWXA 1EA9C 3BH4A 2X40A 5CJMA 5JMUA 4AY7A 5HXMA 4IQLA 4GXPA 4DNHA 2OYLA 2ZUNA 2BY3A 5BU6A 4OFCA 5C6MA 2E67A 4GISA 4F3HA 3HJEA 4RZ4A 2VX7A 4GIRA 5A8NA 3P74A 3CAKA 3VLZA 3W37A 2WQPA 2ZZ5A 3N14A 5HR6A 3R13A 5F4SA 4QAIA 3CAVA 5DY2A 1DE6A 1R87A 1EQPA 3N17A 2YL5A 3MDWA 1BVNP 5F7UA 3ARWA 4ZCWA 1QTWA 3SCRA 4PTDA 2VCCA 1E0TA 3BAKA 4HCLA 3AHZA 4E2OA 1ZNNA 1F3EA 5XIAA 3GW0A 4Q8PA 1K9TA 3K46A 3QGKC 3BMWA 1EP2A 4PA8A 1A5AA 1W9BM 2V3FA 2OO6A 5M1TA 3QVQA 3DOPA 3G3MA 4DRSA 5EU9A 3CM4A 4GO9A 2P1FA 5KZ6A 3GG8A 1O7AA 4AEEA 1JQVA 4AMAA 3I4EA 3I3EA 1Q6EA 1S1RA 4NZFA 3GY1A 3GTXA 4H7VA 3QHMA 2JE8A 1P43A 4L6DA 3WH9A 1F2JA 2WZMA 1PL9A 1T7LA 5HNTA 1DHKA 4JHOA 3UZXA 3T4CA 4H01A 4Y8FA 4QITA 1DJNA 3SN1A 4C6PA 4FP1A 1WXYA 1W1ZA 1SFTA 2ZUSA 2ATSA 3KWSA 3IAPA 2ZWYA 3QTPA 3H7UA 3BAJA 3WL1A 2OKTA 4RNHA 3VIMA 1IZKA 2EG7A 4IGNA 3RU6A 1S38A 4AZ7A 2J77A 3CEPA 3VKTA 3IJDA 4OV4A 3QOKA 3H70A 4FNQA 1S2CA 1W3JA 3PBMA 4I90A 4UZUA 1ZAIA 5BWAA 4O12A 2GUYA 2JGYA 2A2IA 2VFIA 1K6AA 3A13A 4GKLA 1CXEA 5FF4A 3WQPA 1E40A 3NM1A 1TWDA 1EGVA 1AOPA 4DWDA 4EXAA 5CSRA 2POTA 4FX7A 4Y9PA 3E2RA 1QDSA 4J27A 2NT1A 2Y5EA 1CBGA 4KCVA 5LXEA 4JHMA 1BYAA 5A3HA 4BI5A 1H5YA 1R3TA 5IBXC 4NKCA 4JR5A 3NPVA 3EKZA 4JTCA 1BVWA 2C7FA 2RDTA 2X30A 1GW9A 1V7YA 4RNFA 1KQZA 4EWJA 2J7HA 4BHYA 5DMNA 2OQLA 3GB6A 1ESWA 4L5ZA 3QW3A 5J5DA 2JKEA 4H2HA 4L9YA 4I9TA 3AROA 4WCJA 5D9NA 4H8HA 3UU0A 1RK5A 4XBJA 4RJEA 5CPMA 5D9OA 1PYFA 4U2YA 2FFIA 2UZ9A 1MRAA 3WCZA 2CLFA 2JGQA 1W2PA 3TOYA 4M6QA 2OZ0A 3A4JA 3H55A 3NFUA 2J8TA 1IWAA 1EDGA 1SFSA 5FJRA 4JN7A 2BSLA 3RLGA 4DYEA 1KBJA 1E9IA 1E15A 3UXIA 1I0BA 1BEUA 3AS3A 1NP2A 5JUVA 2C1IA 2XUCA 1LUCB 1PWLA 3TJIA 3FVMA 3BCDA 3UCCA 1H1YA 1E4LA 1FWAC 1A3WA 3QPYA 6TAAA 1XGEA 2QJNA 2HRWA 3UPMA 1W3HA 3AIWA 3V0UA 4B5XA 3LV5A 3QLDA 2F2HA 3T05A 3WUEA 2YL9A 2FGLA 2ADAA 3QZEA 2X42A 3SUSA 2VFHA 3IARA 3QW4B 2Z26A 2ZRWA 3W27A 3DIPA 1JYXA 4X0NA 5EMKA 1JEZA 2ACSA 3IJ9A 1C93A 3NQ2A 3T08A 2C3ZA 1VCGA 4XIMA 5JIWA 2OWWA 3WBYA 1P0KA 3GD6A 4ACZB 4UTWA 4NZJA 1M9HA 4TTGA 3QGAC 5DELA 3LS9A 1QOPA 4ZOEA 2B81A 4POCA 5K7JA 3L5MA 2D0GA 3LM3A 5JIPA 2ZA3A 3EWXA 5LIXX 1FUYA 3C2VA 1ZUAX 4GPNA 1AODA 3MANA 2W6RA 4MF4A 4KWOA 3XIMA 3PZTA 3GR4A 4W86A 3KS5A 4WSJA 1NQ6A 4QR6A 2DT2A 1B57A 1HTIA 4UTMA 4C7GA 4LCRA 3AHTA 1B4KA 3R2GA 3N34A 1F61A 2YL6A 1J0YA 2WC3A 1MVYA 1TZ9A 3VKSA 3WZ0E 1JZ8A 2YCKX 2WZEA 3LPFA 1LROA 2BS9A 4HMCA 5DT5A 1T8XA 3VNLA 1QK0A 4JTLA 3AO0A 2DZBA 2Y8UA 3MM8B 5BROA 3ZXWA 2Z2UA 1JFHA 1LDCA 1E0UA 1XH2A 1Q2SA 3W4RA 1UWRA 3OTRA 4NZ1A 1S3TC 3VGFA 3GKAA 1BSLA 3M07A 4ZZ9A 1PX8A 1M6JA 3LBOA 4Z17A 1GYNA 4AZBA 1MXGA 1XRTA 3QBUA 3DAQA 1WUEA 3PM6A 4ZXOA 2Y7EA 1B3OA 3HG2A 1MRQA 4IUOA 1EEXA 2V2DA 2BDQA 4KPLA 2WSPA 3PFMA 4URIA 1E73M 3WNOA 4FZIA 1SJDA 3WQOA 1JDDA 2DH2A 4NJIA 2V4JA 3RXZA 2FFCA 2VQTA 3S0CA 3HBLA 4FA3A 1XQKA 2JFEX 1R2TA 1CTNA 3W6MA 3B9EA 4EP8C 4UTJA 3W6YA 5KMYA 3ZVHB 4IQEA 4AQLA 3DFTA 3GLCA 4WVXA 2WSRA 1E0XA 3NZ1A 5FACA 2V5LA 3GAYA 4X63A 2PGEA 4ZSUA 1JPDX 1A50A 1SO5A 4ACYA 2V6AA 4JX6A 1ODUA 4QCEA 4X61A 1V5XA 2WMFA 2IQ0A 1DWJM 3TIMA 1V3MA 3VM7A 1FHUA 5AY7A 4J2PA 3KDNA 2GSHA 1A49A 3NQCA 3HPSA 3MMDA 3S5OA 4XX6A 4NIRA 5DANA 4BI6A 1VQTA 1OIMA 4JKKA 1XYCA 4UFJA 5T91A 4KF1A 1RQEA 4CD8A 4HA4A 4U3AA 3S9YA 4GLEA 2BG5A 1ISZA 4NILA 1NFPA 3MUY1 1CCWB 1TSIA 5GNZA 1MSSA 2CW6A 3GHRA 4YU1A 4A22A 1NH6A 2WC7A 3ENLA 2VTFA 1F7BA 3S1XA 4CU7A 1JCTA 4F2UA 1NWTA 3VK5A 5GEPA 4B5WA 4M29A 3W85A 1WZMA 1TZ7A 2PA6A 1QNSA 3FW6A 5D09A 3UWYA 2QV4A 4GX9A 3WQGA 4M3PA 2J62A 1ISXA 4OECA 2FTYA 4O10A 5FI8A 4EX4A 1OD0A 1UD8A 1QOXA 1RV8A 2D0FA 4NZ3A 4KESA 4XK2A 2PWUA 3PJTA 5A6BA 3OVPA 1PX3A 4Q8WA 2X1TA 3L4ZA 4HN4A 1YDVA 4J5NA 1KFCA 4C6EA 4PTMA 3T0CA 3SN0A 5BOOA 1ML1A 2A6LA 2PLJA 1OYCA 4DBUA 2QJIA 1H49A 4C5YA 2J6XA 4QE4A 4LS2A 2W67A 4KWUA 4DXKA 4AC1X 5E5CA 1XYZA 2B31A 1U5VA 1UW9A 3M0HA 3RG6A 3OVQA 4TMBA 2CFFA 3LPGA 1UP3A 3SUWA 3QSTA 2FHBA 1M7PA 1YPIA 5EPDA 2CZFA 3DGBA 4GY7A 4H8VA 2VXNA 1J01A 4GCAA 1TQXA 3N9SA 3LERA 2QVHA 3VD5A 3SQLA 4CN4A 5I79A 4MKSA 4RV8A 3HFYA 2E9LA 3T6CA 2ZRYA 4J2MA 2GGGA 2YLAA 4LNCA 2WVTA 3JRKA 5A2BA 5C9ZA 2QCLA 4WY0F 1WB0A 3W26A 1ONRA 3STFA 1US0A 4PYSA 1CENA 2HS8A 4LUJA 3D5HA 4DAFA 4C6OA 3ALFA 4OTKA 4ZGYA 5I3KA 4QE5A 1V6UA 2YCEA 4LEFA 3ALGA 1VHNA 3A47A 4JTKA 3FHAA 3RAOA 1J8VA 3MJYA 1KWKA 1F9CA 2Z2AA 2KAUC 3QMSA 3MMTA 3CWHA 3NZGA 3WBEA 4ZTYA 3RM9A 5CGTA 4IQDA 4B3LA 2FPYA 4UZSA 3NL2A 5BMWA 4CVUA 3R0KA 4RZ6A 1B4EA 4I5UA 1V6VA 4PL1A 3LENA 2WM1A 3UBPC 1TJ1A 4G1KA 4JBRA 1LOSA 1Q13A 3W7RA 3LCLA 1X96A 1OFPA 5M03A 4HNTA 5J04A 3U5YA 4QJ4B 2EPNA 1O12A 3VD3A 4NJJA 1GGOA 5IBXA 4MM1A 3GVWA 2BHYA 1E1EA 2XISA 2ZDSA 1WA3A 5ABGA 1IGWA 2E9BA 5T26A 4MZ8A 3WK2A 3TQPA 4M7SA 1PKLA 4HU3A 4OJYA 5AHLA 4DPQA 3CHVA 3EX6A 2NXHA 3M16A 1DPMA 2C0AA 4A3UA 3TOPA 1OFBA 1SFLA 3MM6A 1ZAJA 5I77A 2O9PA 2WSYA 1LRNA 1EBGA 3WDQA 6PTDA 3S1VA 3AXIA 5AB3A 1RVKA 4K68A 1WCGA 3PZ9A 2Q01A 1LWIA 2E40A 1YPFA 1Q6RA 1I60A 2PD5A 5DXYA 4F2TA 1M04A 1TPVA 5CPQA 1WNOA 1TA3A 2P10A 3UT0A 1V03A 3THAA 1WOBA 2NLIA 4ADUA 2V82A 4MJ2A 4AD2A 1XL9A 1F3XA 3EEGA 3UXLA 4RE4A 4CEUC 2OFJA 3QQ0A 1JD7A 5DXXA 3CUZA 3ARXA 2VEGA 2ZWZA 4A21A 2V67A 4DAIA 3OPSA 3W7OA 5FSEC 4LV9A 1LQ2A 3VAVA 1XDMA 2PE4A 3W7HA 3M47A 3HG4A 4IX2A 1Q65A 2XFWA 3Q58A 4REQA 1XBVA 5LNRA 1FWDC 1LBMA 2E6DA 4HQVA 2XWEA 3H2AA 1VS1A 3IANA 4KW2A 3ZR4A 5M17A 3W70A 5A8PA 2WNNA 4NG3A 4O19A 1DORA 2NVDA 3TYAA 3C3NA 4QAWA 4Q3MA 1X39A 5HOSA 4DJDD 4V27A 3UG4A 4NQ1A 2UY3A 1H7PA 2J75A 1LRQA 5HWMA 1BKSA 5FAGA 1FFQA 4ERAA 1LL4A 5E09A 5MHBA 4D2JA 3RR1A 3THDA 2QIIA 2GWGA 3KVJA 1TB3A 4N02A 4L56A 3QR0A 1Z42A 4O4WA 2EPOA 2XSJA 1EUAA 4CQAA 3UR5A 2Z0IA 1YXYA 2AAAA 1KB3A 3EMQA 1H50A 1C90A 4QG8A 1AQMA 4MWAB 3MDUA 1Q85A 2J66A 4DJEC 5GNYA 1GYLA 5I23A 3VMPA 1FDYA 1EFZA 3R5EA 3T07A 3MU7A 3FEQA 3URAA 3RILA 4QDWA 4TX8A 1EYEA 5HINA 3S6DA 3N9KA 3UESA 2F8QA 1CEOA 3W1UA 4D6CA 4A29A 5F4WA 1K1DA 2WOQA 3FGCA 4V33A 1A0CA 2C8NA 2CLLA 3GVGA 4JYEA 1H7RA 3N2MA 1F3TA 2X41A 3DGRA 3NQMA 3GVRA 1UUQA 4QG9A 3AHYA 3EA2A 3NZQA 3OIHA 3W3OA 3KRBA 1JZ4A 3AJ7A 1VYPX 2P53A 3B8WA 1W3KA 3C0QA 3ME3A 3WELA 1AQ0A 4D9PA 1JPHA 1EQCA 1A5MC 4HZ8A 4PSPA 2Z7GA 1DL3A 5ABEA 2DW7A 2VM8A 1TVPA 3OJGA 2VFGA 1UH2A 3MUZ1 3GG1A 4K8HA 3SCWA 1FCUA 3OG3A 3CH0A 4PL2A 1JL8A 3V36A 4E6MA 1IZCA 1FH7A 2Z7KA 1N8WA 2W79A 3H6OA 2QIWA 4JTHA 4W4QA 4PSRA 3FA4A 3DFYA 4CUCA 4R27A 5D9PA 1QBAA 3FIGA 3PSWA 4IFKA 1J5SA 4FAMA 3NQ6A 1Y0EA 3CAQA 4P7LA 4GABA 1ZLPA 2VOMA 3IIXA 2BV9A 4E8CA 4YNGA 4GIEA 3OR1A 5IFTA 1QT1A 1EDQA 1E6NA 1O60A 3EKGA 2ATMA 2PRHA 3SCOA 4EIVA 4D6FA 3W76A 1THFD 3EX3A 3KXQA 1VLWA 1UWSA 3S9IA 3OQEA 4OVXA 1VBGA 2P5NA 2DEPA 1XRSA 3WMSA 2ISFA 3E74A 4LALA 1S3HA 5F1VA 1NWRA 5CC5A 1YNPA 4ONVA 3UR2A 2E3ZA 1E4IA 1KV5A 4N9EA 2YFOA 2JBMA 4CNSA 2WANA 4B15A 1M01A 1TPC1 4G38A 4Y9AA 3T78A 1RQBA 5G5IA 1T5AA 1H7WA 4GY1A 1RCQA 4HTRA 2NXGA 4HBKA 4HHPA 3BG3A 4UR8A 4OWGA 4PTVA 1OHLA 2GK1A 2CBIA 2Y89A 4PUNA 1BVZA 2VEFA 1AW2A 4P7QA 4BY3A 3W01A 2Z1VA 2E68A 2IKIA 3MM7B 2BOEX 3MWAA 2IQDA 2X09A 4RW3A 4NNCA 3BK0A 4A35A 4ICCX 5AYBA 2HS6A 2GDUA 3PWAA 3GZ3A 3QEZA 3BJTA 3REQB 2X1SA 4CQBA 1W9PA 1TTIA 5K9CA 3F4DA 4MB1A 2P8CA 2QLYA 2VHLA 1R2SA 3R43A 3F4VA 4C1NA 2XGZA 1OFOA 4QXIA 4CD6A 1TTQA 1BHGA 3NQGA 5E9AA 4JFTA 3GNNA 2FGBA 2J8FA 3M43A 5CH9A 3M4HA 3QMTA 4GKTA 4E2BA 1XRFA 3BMVA 1YBQB 2CHNA 3LHUA 2DZAA 4J35A 2PDWA 4WJXA 1W8SA 3CZ8A 3PS7A 3GFXA 5CLTA 4WX2A 3TN6A 5EFFA 3VKBA 3AICA 3TTYA 4ZB5A 5I3JA 1M7OA 3T09A 2VZSA 4PUMA 4BA0A 4UXDA 5A1AA 1PHQA 3TR2A 2R82A 1EOKA 4Y6GA 3SFKA 5AOPA 1I6NA 1W9DM 3SEPA 2QV5A 2XWDA 2VEPA 2G3JA 1EF2A 5SWUA 1QI0A 4LUSB 1KTCA 3GDRA 1Z41A 1V3KA 2DSKA 2WZIA 3DN5A 4RDWA 4YHGA 4M6PA 3LXBA 1XSIA 2BGNE 3UVAA 3GU1A 4F8XA 1P0DA 4AUBA 3GVQA 4PUDA 3T0BA 3WK1A 2BB0A 4L64A 3IRDA 3B9DA 2Q8LA 4OGZA 1XW8A 5I00A 1L9WA 3ABXA 2E8YA 2EEXA 4HHMA 1BQGA 1SO4A 4HSOA 2VX5A 4DF0A 3L2MA 5K3VA 5EMJA 3AWOA 2Y88A 2V2CA 2DVTA 4AYGA 1XINA 1JDCA 1OT1A 3FJ6A 2ZXQA 3KOFA 3CS2A 3CUGA 2Q3OA 1UG6A 2XINA 4XZMX 4ACZA 5LNUA 1GTEA 4MWAE 3GH4A 2Z6JA 1V6TA 1VPYA 5DLCA 5H1WA 3W38A 3CZEA 3PZOA 3BL3A 1OC5A 2E5DA 3PK7A 1Q7MA 3RCYA 1B3ZA 5FJJA 3B03A 2Y8VA 4M24A 4IF2A 1V51A 3MBFA 3W74A 4RK8A 5CBJA 3OVRA 2YZ5A 4QEHA 2GQAA 4K1GA 4EF9A 5HQLA 2OLSA 1RZMA 1OVDA 3S1UA 3VIIA 5ABTA 2OOFA 3G0XA 2HZGA 1R86A 3IJQA 3GNRA 3WLHA 1GVYA 3T4WA 1H0IA 1EPVA 3OQ8A 2Y70A 1FXPA 1EJWC 4IICA 4GX8A 2QPUA 1E1FA 4F0RA 4MKNA 5HBFA 3Q45A 2GQ8A 1FBAA 1BYCA 2AAMA 3GH5A 4FLSA 3G3DA 2IUZA 1JQXA 1SSDA 2F7FA 4WGHA 5CBIA 3L21A 2CETA 5CJNA 3GH7A 3AWNA 2BZNA 4ZOCA 5FA5A 1OFQA 3HM7A 4JQ1A 4CU6A 1G7VA 4LUYA 1FWBC 3HZ3A 3BGJA 4QLKA 3MVTA 1GOXA 1EUNA 3UXAA 4M82A 1VEOA 5C71A 4B2DA 1PAMA 1YQ2A 4CNPA 1HO1A 1ADDA 4GIAA 1A5UA 4YXGA 4JTSA 1IHIA 4KGLA 3BE7A 3DFNA 1BAGA 1KCXA 4E38A 1JCMP 2ZUTA 1GG0A 4O1EA 1J0JA 3ARVA 3N15A 4XO6A 1AVAA 3BVJA 4PMYA 3DG3A 2YYTA 3N2OA 4DO5A 1R3YA 3BV4A 3UWQA 1HJVA 5FF7A 4HCHA 1O6IA 1KR0A 2YDQA 3PSVA 3TMLA 1XLBA 3E9AA 2I9UA 4MHBA 4N2YA 3ES7A 3WUGA 3TTSA 3WD3A 3KW3A 3DZ1A 2HPMA 4C6MA 3FX4A 2GJRA 3AI0A 1KO0A 2IXUA 3VKAA 5HR7A 2I17A 1W9UA 1DKWA 1DIOA 2C6QA 4P8VA 4HTBA 2RFGA 4H6RA 1F4HA 4MB3A 4LH8A 4HN8A 1UA7A 3WLIA 4Q8MA 2W0UA 3CB8A 3H2CA 3ABRA 1FWEC 3S83A 2RAGA 4NYYA 1IWPA 3FS2A 4LVGA 3HG3A 3PFRA 1GVFA 1ZL1A 5E0FA 4IM4A 3GG7A 1IIGA 4GVHA 3AIRA 1ZU8A 4KKXA 4MWAD 3KOWA 4CKQA 1EJSC 3GNXA 3BWWA 4Z2GA 4PMDA 1BG4A 4KWVA 3QV7A 2OSYA 3GDLA 1XCXA 1U1UA 1XYAA 3N9RA 1X97A 1BRLA 2A3CA 1P7TA 4IJBA 4YJ5A 1GONA 2QNEA 4ZODA 3UWVA 1POJA 2NQ5A 1UD5A 2CYGA 4M80A 3G2GA 2YA0A 3L4YA 2POZA 1HQTA 3F5KA 3PAOA 4LS0A 4D1IA 4F66A 3GXDA 1AH3A 4AXKA 2A3AA 3JUGA 3AYTA 5EA9A 2CZEA 4JTUA 4KEUA 3UNDA 3RM4A 4IFOA 3PULA 4XZIA 4EAMA 4JIPA 1TO3A 3UWUA 1IXNA 2WVSA 2VP8A 2Z24A 3QF0A 3VIGA 4QBXA 3C2FA 4NAEA 3EB2A 2B7PA 4NF7A 3AOFA 4FI4A 1HT6A 3WF0A 4KWSA 3B0GA 3S47A 3NTYA 3DHDA 2CLEA 1Y65A 3WLSA 2X0SA 1UZ1A 2G3NA 3ARRA 1W5QA 5H91A 1WAWA 2XFRA 4S3EA 1UPPA 4LFYA 1GOKA 3AFBA 5HUOA 4WR3A 3VOHA 4LYQA 3NQ8A 2DU2A 3T0TA 4U33A 3ZLGA 3VNZA 2OCZA 4L4PA 1ONEA 2QCCA 2DUZA 4N0RA 1H1NA 3PJUA 2QUVA 3PZVA 2XPKA 5JQ9A 1MI3A 3UR7A 1OX6A 3BMXA 1V6XA 1XIHA 2KZHA 1XUZA 3GXPA 1RH9A 3BSHA 3LB0A 4XB3A 3RNDA 1WYIA 1A5LC 2YZRA 4W7VA 2PDGA 1GT8A 1JZ3A 2OEJA 3M7SA 4XBKA 4AU0A 2EJAA 1K4HA 4AEFA 3APGA 4XZWA 2JIEA 2VX4A 5D4YA 1EF3A 5F1UA 1AH0A 1UP0A 3DI0A 4JL1A 1S2TA 2INFA 1XLLA 5AC4A 1EOMA 4XZBA 4XVDA 1BKHA 1EB3A 2WPGA 3QQWA 3OA5A 4DN1A 1DQUA 3WQ6A 3Q94A 3VOCA 3VOFA 4LUTB 3MM5B 1QHPA 1U2YA 3GW3A 4IP4A 2HCVA 4M19A 5G2IA 3PUGA 3IAQA 4M56A 2GOUA 4FOUA 1ZJAA 2VZUA 4DI8A 2Y61A 1NF0A 3KAOA 4GEPA 1XP3A 3CV2A 4BEUA 3WMCA 3P5YA 3PG9A 4QE1A 4C5ZA 2RJGA 4J3TA 4ECLA 1FCQA 3DESA 1ISVA 5D2XA 4AF0A 1FTXA 4PGLA 3BLLA 5FEXA 1SW7A 3BGGA 3GR7A 3EDFA 3CYVA 4ZVJA 3SJ3A 2PDJA 1NDYA 1MFUA 1UD3A 2CZ5A 3LLFA 3ID7A 4WGXA 4W8AA 1B90A 2PP0A 3LY0A 3TYBA 2OR2A 3C8FA 1RA5A 3DENA 1QW7A 3L4VA 3EOEA 1Z8AA 3OZOA 2DGAA 2VC7A 2EAWA 3RPMA 3PJXA 2PUZA 4FLRA 1PE1A 3ZWTA 5HWNA 3FYOA 4C65A 3P0XA 1ZCOA 3HPXA 3NXLA 2OEKA 3DECA 1WBHA 3VCRA 5D03A 1OGGA 1VRXA 1Z7AA 4GZJA 3A3HA 4G9PA 1BSIA 3N4AA 4JPGA 1PTDA 3ABOA 3B8SA 2EKGA 3MSDA 3RM8A 3DXIA 3MMWA 2HK0A 4M6UA 3DHPA 3ICJA 5HMEA 4I7UA 3FVDA 4LWWA 3ZZ1A 2WZHA 1D3GA 2WPBA 1J79A 1GVEA 2ZTJA 3HOJA 3UJEA 3TC7A 2ISSA 1LRTA 3VKCA 3BCFA 4Q8TA 3QPZA 3VDCA 3DFOA 4TOQA 4OE7A 4O8RA 4GO8A 5IHRA 3ERPA 2QCGA 1U33A 1LBLA 2QYGA 1XWYA 4RZ5A 3AXHA 3T44A 3IJIA 3PNZA 3ITGA 4MNKA 4O18A 4TTUA 3WUFA 4S3AA 3U2EA 2WO5A 1F8IA 5H6HA 3S2CA 4YTTA 7ODCA 3KL5A 3N13A 4QFUA 4MB5A 3IK4A 3MS8A 2QJMA 1PEZA 2C1GA 1BTMA 3WNMA 5EB8A 1WUFA 3IEBA 2VGFA 3GIYA 3W82A 4CNNA 4C6FA 1H7NA 4O13A 3UCDA 2E5CA 4GGBA 3KTCA 1EH9A 1NJJA 1GWJA 4WSHA 4PUUA 4Z42C 1IEIA 4JEJA 2BY1A 2ISDA 2EBNA 3O9NA 3ZFHA 3VIFA 1FWIC 2YXGA 3GFYA 5E6ZA 1VFMA 2E28A 5EY5A 4ZSTA 2CKSA 4H04A 2WHKA 5A6LA 2X1UA 1M68A 4HSNA 3ITXA 3LOTA 2BGQA 3OEXA 1UQZA 2PDIA 2YL8A 2VD8A 3W72A 4Y9NA 1OEPA 2WHJA 2V5KA 3AAMA 4F0LA 3ZIZA 3B0XA 3NQDA 3THUA 2JF7A 4JTFA 3FA5A 4AWTA 4LBSA 2XG9A 4GUHA 5KEZA 3IS4A 3VKJA 2D2GA 4Z1CA 3VC5A 2PF0A 3ZT6A 3FFSA 3A5FA 1ALDA 1Y5VA 1S39A 1ZP4A 3C0LA 1RR2A 3TFXA 3RJYA 4PBGA 7REQA 3IV3A 1MFVA 4JEQA 2CLOA 3ZT5A 2PDMA 4UR7A 2ZRVA 3NXFA 3VZYA 3IUIA 3FJLA 2DZSA 3UJRA 3RJXA 1DJIA 3MJMA 4H9UA 3GHUA 1XF0A 1U5JA 3NOEA 1HUVA 4LCSA 6TIMA 2FZMA 3S5SA 4A4AA 4BWLA 1V02A 4NXKA 1X6LA 2A5HA 4IMCA 1XRVA 3VCNA 1S5TA 4RUBA 4XD4A 1J4EA 1L6WA 3UXDA 1KGWA 4CQ9A 2EG6A 1FDJA 2V81A 4HOWA 3OLIA 2ZVIA 3Q2DA 5C5YA 3WBAA 3EDDA 4XSLA 2GGEA 5IDZA 4W8BA 3LPPA 2D73A 1VCVA 4EPDC 4W89A 4TR9A 3QHNA 1XYLA 4GUFA 3IIOA 2PS2A 4OIFA 2XM2A 1FWJC 1J5TA 1X1OA 3EYPA 4HOZA 3WX7A 3RLUA 1Q6GA 2VDIA 2XDFA 2G95A 4PCFA 4CLMA 1W31A 3PTMA 2PLCA 1E6SM 1EGZA 2YB1A 1C29A 3ARZA 3LM7A 2HEJA 5DCEA 1CYGA 2QCNA 3VKRA 3M0MA 1U83A 4ATLA 4CD7A 2OEMA 3CO8A 5H2ZA 1CXIA 1UBPC 3WJSA 1OIFA 4FNPA 2OGYA 1V3IA 2Q09A 2GQ3A 3VI2A 4ASTA 4FOJA 1VYRA 3SY5A 1JF5A 1T8QA 3L12A 5MKGB 1IEWA 4S3GA 3AUOA 1A5SA 3KE0A 3SFWA 1HJUA 3OZMA 3W1QA 3B0UX 2J24A 1W32A 1I2PA 3VGGA 4HYRA 1IGSA 4GG9A 1X6UA 1YXDA 1ZBKA 2QXWA 1TIWA 3B8IA 5A6SA 3RN6A 1YW1A 1VYSX 4XKMA 4IIGA 1KXTA 2NZLA 2IMRA 4F2BA 4ZO8A 3AIQA 3SCTA 4E4FA 1SW0A 4I5XA 4MNLA 1LJYA 4R3UA 3G0SA 3EEZA 3VNDA 4Q8QA 5BCAA 1I2NA 4QX4A 1QNPA 3WF4A 4NJHA 2CXEA 2NSXA 3S42A 4QNWA 1GKPA 3KRSA 3TC3A 1UZHA 5HK4A 1K3UA 4I3GA 3UEQA 2RDWA 1MZHA 3VFCA 5BU9A 1S2UA 4LNYA 4W93A 1RJPA 3A9BA 5CCZA 4QNEA 1R3WA 4ORMA 5G4WA 2PDKA 3L67A 3REQA 3VINA 2GWNA 4A6GA 4ZQNA 2VI0A 4XAYA 1NEYA 4K7VA 4DVOA 4Q6JA 1LYXA 1NVMA 3WJXA 4TMCA 2PP1A 3KP1A 3B97A 3C2EA 3WLLA 4AH7A 4WKAA 1TTPA 2D69A 3C52A 4AZGA 6ENLA 1E6ZA 3CPRA 3GTIA 1RY8A 1GVRA 3NJ3A 2CXGA 1NM9A 6XIMA 1YBQA 4FPSA 1AK5A 3K8KA 5AC6A 3B04A 3W7IA 4GBDA 2C71A 4GVGA 2YCJA 1G6CA 3RCMA 4DY1A 1XLIA 2X0YA 4AX6A 3KHDA 5M3WA 4HNUA 1QHOA 3DERA 1A5OC 3J7HA 2DZWA 3PZUA 2OO0A 2JIWA 5D38A 4B16A 2PTWA 3TK7A 1LZOA 2HWGA 2Y6ZA 3VILA 3LZ3A 7TIMA 4HZ6A 1UUMA 4C60A 1KFEA 2ZRZA 1XLGA 2QGYA 1TREA 3OGVA 1S46A 5G1TA 1LF1A 3QPEA 2ZC1A 1SZRA 4D6HA 3VLYA 2CIPA 2BGSA 1GK8A 3KOZA 4P61A 4FMVA 3VD9A 3IUHA 3GUGA 3V35A 3W7KA 2ZUWA 1O5KA 3NWRA 3L0GA 5ABHA 3CC1A 3UGVA 4FXJA 4AHPA 1HFBA 4L1WA 3VE7A 3WIJA 3BLEA 1X7IA 4ES4A 2NT0A 2J9ZA 5K2ZA 4H6QA 3GEOA 3TYZA 1Z48A 1S5WA 2RDUA 3SUUA 2CHOA 3KX6A 1CXFA 2VNCA 5HPCA 2E0PA 3QKEA 5LNWA 3ARTA 3PHAA 1UKSA 5LSMA 1KFKA 1PCWA 2CBVA 3V0SA 1DWIM 2WXDM 3NYZA 3Q4DA 1X1NA 3BTNA 1LG2A 4O53A 3I6EA 1EIBA 3GZAA 2GJPA 1CZ1A 4HVXA 2OODA 1OGSA 4K7YA 1EL3A 7A3HA 4YVPA 4YN5A 4WK9A 2QCDB 2GVLA 4AC7C 1AZ1A 5I3FA 1GJWA 2BTMA 3W53A 2I16A 2VC5A 3MUCA 1JCJA 3FLUA 3WLJA 5HPOA 2HBVA 4LOCA 4ZFCA 1H7OA 4UR9A 4ADTA 4IMEA 3UZ5A 3OBEA 1FVPA 1HG3A 1G7UA 2Y7FA 4U4MA 1R9XA 4OOUA 4L61A 3MHGA 4BS0A 4J4KA 4NI8A 1H4PA 1RD5A 1MDLA 2EPHA 3H21A 4IQJA 3WKZA 3F03K 4IPLA 3A9IA 3KDOA 2IXVA 2YA2A 4LBUA 5AC7A 1YX1A 2DH3A 5C0QA 3KZPA 3ITCA 4B5TA 5I24A 4US5D 1FCBA 4EK7A 4PMZA 4GNVA 3ZYZA 2NV1A 1ZFJA 3W75A 3M6DA 1L0PA 4Q32A 5DBTA 2J7DA 4CNOA 4A3RA 1L6GA 1IQ8A 3MT1A 2R91A 1EC8A 1EZ2A 2QUUA 3EB3A 3BAIA 5LNVA 4WSKA 1E6XM 4D6IA 2D3NA 2QCMA 4PZVA 1P6WA 1Z32X 2YX0A 1ZCCA 2GDVA 3CH9A 3WYZA 4LVAA 3V18A 5C2XA 3E02A 1TUFA 1HZYA 2ZZ4A 5D8WA 2A21A 3IGXA 2IKJA 2DPEA 2VEMA 3MV11 2QUTA 1B3WA 2ABAA 4L9XA 3SRKA 3E96A 4HK5A 3H7VA 2ZC8A 4B5UA 2REQA 2YIHA 3IRSA 1FP8A 3PWIA 4RE3A 4AWSA 1TJPA 5CZJA 5IDIA 2WBKA 2XIMA 1KTNA 5K4ZA 3NQVA 3VOIA 4KFPA 2FZ8A 1GPWA 1ME8A 3WNNA 1OX5A 2FIQA 2XVPA 5CZSA 3OR2B 5A69A 3RMEA 9CGTA 1UKQA 4UOQA 3FSUA 5F2IA 1US2A 5A6TC 1I1WA 1ECEA 2NV9A 1KM1A 3TLLA 2V9DA 2FQIA 4RR4A 2H9AA 3M44A 3CUFA 3I3BA 3GFZA 1TJ0A 3GIPA 4NJGA 2QT3A 2YBTA 1S1PA 1V93A 1FWCC 3MCOA 1UKOA 3G77A 5AHNA 1WP6A 4H3DA 3E49A 3AJXA 5FJOA 1UPMB 2DSWA 5EMYA 3OGRA 4KFNA 3VE9A 3NSNA 2GVEA 2YA1A 2DZUA 1DIDA 1K6WA 4RE0A 1V0MA 1MNSA 3F2CA 4E2VA 3W87A 3W9ZA 2F9RA 5BRQA 3GXIA 1TJ2A 3BPWA 3EX2A 4JNYA 1AD1A 5ENLA 3C4UA 2V63A 1GOIA 4FF5A 3IIZA 3TLQA 3TU9A 2X2YA 1F74A 3BZGA 3LBCA 1XIGA 1VC4A 4AZCB 2GVYA 1KXHA 4RW5A 2XGIA 3K2GA 4BQ2A 2YB4A 4QEEA 2PWEA 4NZ4A 4HKPA 1HVQA 3C3UA 1VHCA 3B9AA 2PODA 4HK6A 3LHZA 1MW1A 3OBKA 2R9RA 2OJPA 3MV01 2C16A 3RLHA 1EHAA 2VYOA 3N6QA 4LAMA 2PZ0A 4HU0A 3EAUA 5BNKA 4PBEA 3UXKA 5HJYA 4K39A 1QK2A 4IP5A 4LYKA 1Q45A 4K36A 8TIMA 5F2LA 1E56A 4NX5A 1CXLA 1Z89A 4QISA 1HL2A 3WQ8A 1KD0A 1Q4WA 1XLCA 1WKEA 3FKKA 1OQFA 4ILSA 1CGTA 1K7EA 3U2OA 4S3KA 2INZA 3V75A 3W2NA 4UTHA 2F6KA 3BZJA 1V7AA 1QI3A 2ZE0A 1PXGA 2O56A 4L6OA 4GJIA 1D2KA 1KBIA 3WY1A 4L1XA 4H9MA 2UY5A 3R0UA 3K4WA 3UNTA 1UR2A 4NJKA 2EGZA 4FNUA 1OYBA 3CUIA 4UMAA 3G1YA 1FWSA 4UC5A 1WOAA 3DC0A 5A6AA 2Z1XA 1RPXA 5D2YA 1AJZA 4KCTA 1XKJA 4EPEC 4ZQPA 1LCOA 3IJ8A 2GJLA 2NUYA 4GQRA 3L4WA 4DF1A 1SZGA 1XH1A 1V4YA 3GX9A 4S23A 4TU1A 4WD0A 1F8MA 4DBEA 4GUIA 1OBAA 3MM5A 2NX3A 1F3WA 3IJLA 1EZWA 4P7RA 4MNJA 3U4AA 4WDTA 5PTDA 1ENUA 4KERA 3POHA 3G1DA 3G18A 4ZO6A 5I07A 2XTKA 1UHVA 2HK1A 1QR7A 2FLIA 3NUKA 2QULA 4W88A 2BXZA 3I7RA 1BXCA 5EGRA 1YDYA 1IZJA 4L7ZA 3R0DA 4O1BA 1G69A 4QJ1A 1J11A 4LC8A 3DCPA 4O4VA 1UBSA 1AH4A 4JTDA 4NU7A 3NSMA 3SJNA 3NR0A 1OF8A 3E2VA 1HL8A 1W1PA 3BAWA 3ZQ9A 3SGZA 1SJBA 4XD5A 3B4YA 4NAFB 2VC6A 4OQVA 4CQDA 4CCEA 4FXSA 3EB4A 4QS6A 2OB3A 3W1LA 1HN1A 2W27A 1TZZA 5G1YA 3TYUA 3CQHA 4ICNA 3MWCA 1IEQA 3GUWA 3PZIA 1XIBA 1YE6A 3ONBA 2PPGA 4LYRA 1XYBA 1KRAC 4PCPA 1QWGA 2X7WA 4KRTA 4Z1DA 2PTDA 3VCCA 1JJKA 4I7WA 1N8FA 4AHQA 2D1ZA 3MMCB 2H3BA 2J8GA 4M7TA 2GPTA 3HQNA 2GDQA 5E93A 5L9FA 3E1F1 2TSYA 3MI3A 3VGDA 2PBGA 3HV8A 2RHGA 3ECQA 4WEVX 2OZ3A 3MKCA 2VR4A 2CZDA 2GGHA 4MVAA 1VEMA 3TX9A 4UNLA 3TTEA 4HIBA 3EA1A 3GU2A 3ZSSA 2BVTA 3G1SA 3QR1A 5KINA 3BO9A 3VMNA 1W6TA 1KFWA 3ZLHA 4LAKA 2JEQA 3T9PA 4IMDA 3W7MA 2PC8A 3M0KA 3LHYA 2DZPA 3WF1A 4K37A 1MW0A 3WJYA 3S3GA 1DTUA 1Q5MA 5AHFA 1B3VA 1M3UA 1KCLA 1D8WA 3KBNA 4QGCA 1RLCL 1P0NA 3SCPA 1VFFA 4FF7A 1JNEA 1POKA 1L6FA 4W8LA 3A21A 1HXJA 4NUWA 3E0IA 2AQWA 2DZXA 4IIDA 1HKWA 3A3WA 5G1MA 3LLDA 3U48A 4MNMA 5F4XA 1TG7A 3M0XA 3U5UA 4LANA 3UW6A 1NFGA 2OELA 4DZIA 3P61A 3H2EA 4FX6M 4JFSA 3WLRA 4W7WA 3VC6A 1TVLA 4O0KA 3HA1A 4RE2A 4JZ5A 4QROA 3GYEA 8XIAA 1J93A 1L6SA 3EOOA 3R7MA 3NPWA 5M2FX 1O95A 5C7VA 1TMLA 2PB1A 3USBA 1V8EA 1N82A 3S1WA 3DH7A 1HF6A 2BP1A 4UUIA 2QPXA 4XZNX 1BQCA 5JBFA 5REQA 2W9MA 1VIWA 3CIWA 4L4MA 1K8ZA 3W7PA 1QHZA 6REQB 1KGXA 1Q6OA 5CXPA 4MUPA 4D72A 3HIJA 1C8QA 4PRRA 3ZMRA 3D6NA 4RX0A 4GH3A 1YNQA 3FJ4A 2XGBA 5FEZA 3O6AA 1H7XA 1N2VA 2FJUB 2INEA 2WCAA 1XD1A 4B4HA 2AOPA 4IJCA 3HQOA 3O6CA 4KEMA 1RA0A 3LGEA 5EMLA 1E1CA 3DBNA 1JRBA 4AZ5A 1LOQA 3KS6A 3B40A 1FWNA 2IPGA 1AZ2A 4FX8A 4H9VA 5C9UA 1FWGC 3WD2A 3HU7A 5E9XA 2PRMA 3HGOA 2QKFA 7TAAA 3EXTA 2X7VA 3TZFA 2ZIDA 1DJXA 4HTYA 3VX1A 1B31A 1SSGA 3FHQA 3H54A 3EWBX 3L9CA 2OX1A 1W3NA 5AVHA 3MMBB 4PE8A 1QATA 4GIYA 3K5XA 4H6EA 4YWIA 1OFDA 1LBFA 8XIMA 4HPXA 2Z1BA 3W1RA 4QJ5B 1OZQA 3KBVA 1RD6A 3E6EA 1OG0A 1W8GA 1NU5A 2GJXB 1FHLA 2UY4A 1IWBA 1OWQA 1RCOB 4NVTA 3CUXA 4ENLA 2OWXA 3QKZA 2QAFA 3V3WA 2Y1HA 3P5ZA 1QNOA 4O54A 3BC9A 4YVVA 2DQXA 3FV9A 4ICMA 2FB3A 2G50A 2YCLA 2WC4A 4WIWA 5DMLA 4O15A 1G4PA 1WV2A 4TQTA 3XISA 4NZCA 4QRNA 3MQTA 3W1TA 5TAOA 4MLJA 4GI4A 1UH4A 4JTEA 1EX5A 4Z1AA 2H90A 1F05A 2J6VA 2X16A 1DEDA 4UQAA 2WYSA 2DV0A 2XIJA 4WUIA 3GDBA 2Z29A 4UQBA 3KBJA 3WDPP 4H19A 4E8DA 3DHUA 4JXCA 1GNXA 1EKOA 2G4FA 2QDHA 4QP0A 3N2TA 1FFRA 2QHAA 1XIJA 3OHMB 5B7YA 1U22A 1BD0A 2XSXA 1PB0A 3R89A 1YIXA 1YADA 4PEKA 3GHSA 3VNIA 4UWMA 2SFPA 3UQNA 1QI5A 1UKPA 2BXYA 2ZXDA 1B54A 1I2RA 4OHQA 1S5NA 4Q22A 1RXOB 1WXZA 3N4EA 1TQJA 1HKVA 3N04A 1J2BA 2DSZA 3B0MA 4IJRA 3I4KA 3H4WA 3BLFA 4K3ZA 5H8UA 2OPJA 4ZMGA 4IGMA 4A8RA 1JULA 1W3TA 3GXNA 4B3ZA 3LHTA 1JAEA 2E09A 3A5VA 3T1GA 1B5TA 3D46A 3UJSA 3N73A 1VP5A 3UYCA 1T99A 2A79A 4YIWA 4Z2KA 1LQ0A 4UFIA 4U28A 2X2GA 3W2UA 4ZXLA 1JCXA 5C9RA 2WVVA 3VKQA 1XGDA 3UZZA 2J9XA 1TCDA 2CBUA 3WLKX 5TBOA 4ML9A 4C1KA 3H12A 3P8IA 5LIUX 1W0MA 4MJZA 1UR1A 1GKQA 1K4GA 4US6A 4EPBC 2PP3A 2B7NA 3BJSA 4EPKA 4J3SA 1R6WA 3MYOA 1EJUC 3HGJA 4KETA 4I8YA 3QV6A 1KKOA 2YSWA 2VDHA 5C55A 3W6LA 4CCZA 1P1MA 2QQ6A 4D6JA 2G5WA 4OZOA 1F5ZA 4C7FA 1AQFA 1OCNA 4DO4A 1Q66A 4LY8A 3WO8A 1XLDA 3OZPA 2Z25A 4L4OA 1VENA 4YTRA 1Q6CA 5FF3A 4JCLA 4M6VA 1XC4A 4YS1A 1ZJIA 3CLMA 2BOFX 3I7SA 4AD5A 1I4NA 1FX6A 2J7GA 4S2BA 2X0HA 1E5NA 4JYFA 3UYIA 5E0KA 3TKFA 2GLKA 5C9WA 3TNBA 1M5WA 1TV3A 1VBRA 3WL0A 5L6UA 1I2OA 1Z44A 1MEIA 3COTA 1G0CA 1TX0A 2OX4A 3BAXA 2DUXA 5BZAA 1XI3A 4WLCA 1R85A 4JTRA 4HCDA 3LQGA 5FEWA 2PAJA 1ZP3A 2P0OA 1ZHAA 2VGIA 4UIOA 1UWAA 5BXRA 1F6PA 3TV8A 3CAWA 1QI2A 3W02A 3DBPA 3W1MA 3C2YA 2I5GA 3WBXA 2CBJA 2EXOA 4DWSD 2VRQA 4CQCA 1OCBA 1US3A 1XBYA 1E3XA 1H41A 1CNVA 3CU2A 2XU2A 1VGAA 1UOZA 4JIEA 2CC0A 3KL3A 1LT8A 4N9CA 3S2LA 4MKVA 1BG9A 4JDBA 1QPNA 1L6YA 1J2WA 1FWWA 4I6KA 2VGGA 4DPPA 1TV5A 5KZEA 1S2VA 1VD6A 3P60A 4Q8VA 4DO6A 4YCPA 4LC6A 5I78A 1UC5A 4L4LA 1TPEA 1YNYA 2YLLA 2TODA 1CXKA 4DEFA 1E51A 2NQJA 3D3FA 1SFJA 1W9XA 2Y7DA 4LUIA 2CESA 6XIAA 4PODA 1GVOA 2PDLA 4XQ6A 1IEXA 2FHCA 3L5LA 5I7GA 3L0KA 2OT1A 1ISYA 3W0KA 2WNWA 3O05A 3NAVA 3MYPA 1PUDA 3PG8A 3TN5A 1H60A 2ZICA 2O55A 3IIVA 1X8CA 1GEQA 3PN8A 4H9TA 3O6YX 1D8CA 3IPWA 5LNSA 4IL0A 3DUGA 2EPLX 3U57A 4LX4A 2ABBA 3LHVA 3AOPA 1XIDA 4B91A 2XFFA 3EXRA 2JEPA 3N2CA 2XH7A 4A3YA 3UZWA 1FOBA 3MY9A 2WMIA 4O17A 3DYPA 2I57A 1IXOA 3DG7A 3TONA 4WKHA 4N9BA 1BTCA 4DJFD 3HGRA 4H1ZA 2ZZ6A 3UWWA 1TPWA 2VC9A 3DKJA 3ZLFA 4W5UA 3K4DA 4WOQA 2ZZ7A 2FZ9A 3ZVIA 3PNUA 1XBZA 1RPKA 2R1KA 1H09A 1X98A 5CPOA 4HPGA 4U5KA 3NGFA 4L80A 5JBEA 3LBMA 4O50A 3M5YA 4QM1A 2PDUA 1WX0A 5JBDA 4UOZA 1UD4A 1OSEA 1W1IE 4CN1A 1K03A 3OYZA 6GEPA 3OODA 2J13A 2FDSA 1WZKA 3GKFA 4K2SA 2VVNA 3B8UA 1O66A 3BOFA 2G37A 3AU2A 4O0QA 1IF2A 4AZCA 3HV9A 1N55A 1IR2A 3U4FA 2J4GA 3G24A 4XUYA 1E0VA 5BOEA 2Q8XA 1B0IA 3SY8A 2D2JA 2NWRA 4Q4QA 4IMFA 3ARQA 1KFLA 1IYXA 3N6JA 1C7TA 4O1DA 3GDMA 2PDBA 4U10A 4PFMA 3CNYA 4X9SA 3FK4A 3TR9A 3TXVA 3PB0A 3U2CA 1B9BA 1GYMA 1OX4A 2PWDA 4XKYA 5A8GA 2IPJA 2GUUA 3E0WA 4IIEA 2VX6A 1RVGA 4W84A 4Y9OA 2GFTA 2R14A 1YDNA 3TDFA 1SZEA 3PTKA 1O5RA 5LHEA 1JVNA 3CZGA 2I14A 2GSJA 3G1FA 4IIHA 5FKYA 2DQWA 1VF8A 4AY1A 3EGJA 1A4MA 2WLYA 2WJEA 1Q63A 4UTKA 4IPNB 4I7VA 3WMLA 4R33A 3V4BA 1U1HA 3LN3A 4IXXA 3QXBA 4M1RA 4EXBA 2PU1A 3MSGA 1XLHA 1FRBA 3MSRA 4JIQA 4GRSA 2VUYA 4DO7A 4B5NA 1DBTA 5AYIA 2ZXBA 4HMEA 1B1YA 3GTFA 3W29A 1JGMA 3H2MA 2OXNA 3DC8A 3PZNA 4B3KA 3S5NA 4CNUA 1SM9A 2ZRXA 3D0CA 5KSWA 3EBVA 2IS7A 3AXKA 2G0WA 3MKKA 2NXIA 3WQFA 3SGGA 4OBRA 1Q8AA 3NGJA 4M8UA 4F48A 3HJZA 1EJXC 2V4JB 2FZNA 1XISA 5BXTA 1UWIA 2BY0A 4QSFA 1JI1A 1DHPA 1TMQA 2V3GA 2RH9A 5K9XA 4HJFA 5FJPA 3AS2A 2OTDA 2AL2B 4UB9A 3G0UA 3JW7A 5ECUA 1EWDA 2Z00A 1M53A 2A4AA 5ABFA 3DEQA 4A05A 4H00A 4LF2A 5GQBA 1PSCA 1DQXA 1E6RA 3H4GA 3ONCA 3E38A 1XG4A 4MZ1A 4R88A 2WCSA 1X8FA 2YR1A 3KHJA 4AYSA 5FAJA 4RKAA 3PPCA 3BURA 3MMAA 1JD9A 2ISVA 2G3IA 1E55A 2XVGA 1UB3A 1VRDA 3KCOA 3GDTA 1VCFA 1W17A 2HPIA 5EBUA 1IR1A 5I0DA 5EMUA 5EFDA 2HISA 4P7NA 4ZR8A 3W2KA 3HQ1A 1C91A 1EJRC 5U7SA 1HKIA 1ODZA 1ZJ9A 2DVXA 1ME9A 3EMCA 2W5FA 2O7SA 3P7YA 3ELFA 2A3LA 1D7FA 1SYTA 2YCIX 3LTPA 1MQRA 1W5NA 3S4TA 2Y5SA 4DJDC 2OVLA 5CAHA 1A3HA 2TAAA 1D3CA 2D3LA 3TSDA 3FKRA 2BMBA 1LWJA 4DWSA 3NVDA 2QZRA 4YMZA 3B0VC 1GPFA 4DIAA 2DJLA 3TCSA 4AB4A 3GNDA 5DMMA 3BANA 2VWTA 3LHWA 2Z28A 4R53A 3T7VA 5C2GA 2CEQA 4CU8A 4BJHA 1K9FA 2OU4A 1L2UA 3CEUA 3H23A 5HMDA 4O11A 2VRJA 7CGTA 2BHZA 2QJJA 4B4FA 3TNOA 3CV1A 4LY4A 4DX3A 3QTGA 5FJIA 4PB3A 1OFEA 3I65A 1YPXA 3G22A 2ZQ0A 3AMKA 3SIMA 4IZGA 5HNUA 4B9ZA 4DBWA 3LCWA 4AWEA 4X2PA 3VZZA 4JNMA 1VB9A 3S2MA 1J18A 5LZLA 2GVJA 3VU2A 3IGHX 4JCMA 2ZX5A 4A3QA 3SRHA 3K1GA 4C6LA 1OB0A 1XJBA 2A3HA 1XLMA 1QCWA 4D8ZA 5CZ0A 5DEZA 3VGBA 2OG9A 3VNKA 3MMUA 4RDYA 4JQ4A 1XLAA 4ZTXA 3W73A 1HJWA 1QNRA 3MUIA 4FS9A 2YYUA 3VNMA 3V1HA 1QAPA 4H41A 2CPUA 2R94A 4CD5A 3F1QA 3O7UA 3T81A 1L8NA 4RNIA 3W71A 1O4UA 3V5FA 3FYPA 1SW3A 4FO4A 1QPKA 2YBUA 4AISA 3NQAA 3MUAA 1EXPA 3YPIA 1AMYA 3KTSA 4AG0A 2OOGA 3EMZA 3ARYA 2CITA 5EMMA 1W1B1 3QHOA 4R9XA 2PDNA 2DIEA 5C9XA 2V69A 4JHZA 3VFLA 2GQ9A 1V3LA 3LGGA 5LHFA 1KW1A 2WCGA 3JU2A 3NOYA 4RL3A 1A3XA 2VZOA 3EDJA 1JZ7A 2VGBA 5LIWX 3MM9A 1PVNA 1WDWA 2CLPA 1AJ2A 2VZVA 2KX9A 3QLLA 2C18A 3GYCA 1UMLA 2BVYA 4RLIA 5D30A 1Z3NA 1XLFA 2VFFA 4D6EA 3KOYA 3QGVA 1RHCA 1PDYA 1GQJA 1BWLA 1V0NA 3DYMA 1YYAA 4AVFA 4WQ6A 4RXGA 3WQWA 1EO5A 1OK6A 1A0DA 1R9ZA 4LS1A 4XZHA 4JFWA 2G4JA 2VVSA 4R7WA 3FXYA 2HNEA 3INPA 2D2HA 3HPZA 3LA4A 4ZOAA 4IMAA 3LCXA 1SUXA 1Y5XA 3A12A 1EIXA 4JY9A 1KQYA 1FHVA 3U0HA 4U5IA 3II1A 4FNRA 5F2MA 4NASA 2ZUMA 4O1CA 4PRTA 3C2RA 1Z69A 4ERIA 3NQEA 3MM6B 5GJMA 4QLJA 3K8LA 1GJPA 2EF9A 3PUDA 4TXEA 3L65A 4PEEA 3C8NA 4BFAA 1FKXA 4KQNA 1PV8A 4JIHA 2Y63A 3LCIA 2YOCA 2HVOA 2FPVA 4IH3A 5AZ0A 3IACA 2Q02A 5JU6A 3EWWA 1W5PA 3FDGA 4JTJA 3ANYA 2YKKA 4RZBA 4Z2HA 2WWCA 4XG1A 4Q4RA 1CDGA 1NP0A 1GCYA 2FJKA 1TA3B 3BLDA 3WUBA 3O06A 3JZUA 1F4AA 2BX7A 2H8XA 3FAWA 3Q37A 3TA9A 1L2QA 1HW6A 2Y7GA 1Q6DA 4KFOA 2WMGA 1GZ1A 1LM1A 4PMVA 3A24A 1MQQA 1CB7B 4UTLA 1TPB1 3SADA 1QOQA 4G56A 4JKLA 1OC7A 2PGFA 4LU0A 4Y96A 3UD6A 3QSRA 3V7PA 2F38A 3OA3A 2ZX6A 3HB9A 4REQB 4AIBA 1A5CA 3EX1A 3VM1A 5HQMA 4IISA 1FWTA 7XIMA 2WHMA 3GNPA 1UR8A 2L5HA 4FSAA 4B9YA 1J0HA 3RX4A 3VIPA 2VL4A 2V3EA 3CIXA 1QFEA 4WDXA 1JPMA 4AD0A 3LXAA 5BYWA 3FXGA 3QM3A 3WEZA 3VKPA 2E6YA 4C91A 1RBOB 2XIQA 1AJ0A 4ATDA 1X7FA 5FJUA 3TSBA 2ZFAA 4WOZA 3VPLA 3RR4A 3HGSA 3PR2A 2XSJB 3LGDA 3TJ4A 1XCFA 4C6BA 4PMXA 1A0EA 1Y7VA 2RDXA 3SSJA 4ZEPA 1GZJA 2XIIA 1TRIA 2D0HA 1BLIA 4GE8A 3VO0A 4RPPA 4JGDA 3NVTA 1D7KA 3M6YA 3PZQA 5KZMA 1QI4A 1MEWA 5EBAA 1GZGA 1Q3NA 4LEQA 6ALDA 4H9ZA 1SQ7A 1BYDA 3ZS4A 4DI9A 3OZYA 2WNQA 3RPDA 2JALA 4WDUA 3FGCB 3U2ZA 1EJ7L 3A4WA 2NQLA 4GA8A 1TKKA 1FWRA 3PWGA 1NIUA 5CKSA 2QAPA 3GAKA 1TV2A 1XIEA 2PWHA 3B9OA 1ZJBA 1VAHA 5DT7A 1DWGM 2E4TA 2I1OA 1KCZA 3T42A 4NXSA 1ONWA 3NL5A 4KRUA 1TR1A 5I3DA 1R5YA 1DWFM 5D8ZA 3B4UA 3RGTA 3E2QA 5FEPA 2H6RA 1W5MA 1I8JA 2G96A 1PZ3A 1RQHA 4FLQA 4PBFA 4DZAA 4XAFA 3A22A 3O3RA 2PBOA 3EOLA 2GVGA 4W5ZA 2NVAA 1LUCA 2D2OA 3BARA 3PBWA 4Q7NA 3M46A 1GHSA 1R3SA 3I3DA 4ROPA 1E4MM 3M41A 2YXOA 1UD2A 4HP5A 4ZB2A 3LU2A 3TTOA 1C9WA 4Z2IA 4IFKB 3QC0A 5DX7A 5EYWA 3H7RA 4BF9A 1GVQA 1TWIA 1PIIA 1KLYA 3NO1A 4G1NA 1HJSA 3R94A 5B7ZA 3LUTA 3N2BA 3OR1B 4CN6A 4IPIA 3KL0A 1DXFA 3W00A 1PZ1A 4L65A 2ZZ1A 4Z08A 3IWPA 1WO2A 5AHMA 2ESCA 3CQKA 2WNZA 4GJ1A 3IK2A 3L5AA 4G6CA 4R5EA 3HF3A 4X22A 4AIOA 4DJDA 4IL2A 7GEPA 2FH6A 4A3HA 1JCYA 1AW1A 1IE7C 1E4NA 4IHCA 1KXVA 1QASA 2VFDA 3M5ZA 2DSVA 5CSUA 3TQ0A 2QVNA 4CVWA 1WDDA 2A0NA 1H3GA 2WKJA 3N18A 1R7AA 1Q7ZA 3FJNA 1I1XA 4GCXA 2FH8A 4OBTA 3USZA 4TIMA 2GK1B 3AHXA 4K8GA 2EQDA 2A85A 3AYSA 2WSKA 5KZDA 4MWAC 5AHIA 1VJSA 4DYKA 1KM6A 1AW5A 4FR6A 2FDMA 2J47A 1GUVA 2DP3A 1TPH1 4Y9MA 1T96A 2NX9A 3SM0A 1VJZA 4MY8A 5A6BD 1MUWA 2VJXA 3S6OA 1XGZA 1M1BA 1KM2A 2J74A 1SMAA 1LP6A 3MM8A 3S5YA 4GNKB 1SO3A 2E6FA 5DRCA 4EOUA 6CGTA 2WKGA 3PBYA 3UJ2A 4B92A 3GR8A 1DOSA 1JDAA 4C1NB 4MDPA 1NWSA 3BSMA 2WHLA 2XZ9A 3PANA 3ZO9A 4BI7A 3W28A 2V5BA 3MZ2A 2CLMA 2O9OA 4LAUA 1S5VA 2ANUA 4BWLC 4LAZA 3AUJA 3L23A 4F9JA 3GDKA 4TVDA 4K1WA 1C92A 4QQ3A 1NOWA 4NYUA 2ZXAA 1SU5A 1V0KA 4HJWA 2PCEA 1UA3A 3Q65A 5FL0A 4PB5A 4G7FA 4HNVA 4JQ3A 4GYKA 1E70M 3BG9A 4MY9A 5LXXA 3T2QA 3MA8A 2OGJA 1BFNA 3MW7A 2C15A 3NM3A 4LVBA 1WKYA 3NDOA 2BHUA 3L68A 3S46A 3PB2A 2NQHA 1OGBA 2OYMA 1TIMA 1NDVA 2DDXA 4Y7EA 4XD6A 4HMNA 1KC7A 1C8XA 1B2YA 3LEPA 3CPGA 4M51A 1VIZA 3MUXA 3ZVHA 3NO3A 3AYVA 4TX9A 1EC7A 3AQUA 4PMNA 4XISA 1DIKA 1XYMA 2WMJA 5HATA 1Q4NX 5E1QA 1LTDA 4DUXA 1KKRA 3VOJA 2VFEA 1QPQA 3BLIA 1UZ4A 3KCLA 4KEZA 2JQXA 1W37A 1TUXA 5FD0A 5A6JA 1KR1A 3WQDA 3ZJ7A 2P8BA 3MHFA 2GL5A 3F4WA 2R1LA 3O0KA 3STCA 3C86A 1UROA 1HKKA 3MSYA 3GIQA 4LXFA 4CEXC 2BODX 4M1BA 3ZJ8A 1AFSA 2CHRA 3LK6A 1JF6A 3TSMA 4PUJA 2JK2A 5CC3A 3GXFA 3CV7A 1PJ9A 2QUMA 2HE5A 1M7XA 3U7BA 3C0SA 4TO8A 1L8PA 4BEQA 5BOFA 2J88A 3WF3A 2F6UA 3LSBA 1I9CB 2VT0A 2QEZA 4R7OA 2YJQA 3BG5A 5DQPA 1ZBWA 1O68A 1DXEA 2BASA 3M5VA 1DJQA 4WRHA 4L6HA 1XFCA 3I68A 2DT1A 1JYNA 4MB4A 4J1OA 1IXPA 1W1VA 4KCUA 3JS3A 1ADSA 2V5CA 2NX1A 3KLKA 1KCKA 1SZNA 3GQYA 4TUFA 2FVLA 3FCPA 1B30A 5CPTA 3HO8A 4FLOA 4HPHA 3NZRA 1KM4A 5D2VA 2PU0A 3FEMA 4IFRA 4JQ2A 4AD4A 3HTWA 5LIYX 1VBUA 1HJQA 2WBGA 3RLVA 1JUBA 1KM3A 3UJFA 3PUOA 4S3JA 3PPGA 3ITOA 2HE8A 2W3ZA 4WJEA 1FWHC 5T8GA 4IIBA 1BXBA 2FVMA 3QV9A 4AW7A 1KLZA 1NF7A 2YDAA 4TVUA 4IP7A 1GEHA 4MMWA 3CO4A 2DZVA 2WVUA 2X1RA 3K8MA 3VKKA 5I06A 4GHRA 3SY1A 3TWBA 5IXEA 3CWOX 3LSCA 5GPRA 3L0NA 2WV8A 4O8AA 3R11A 3BW4A 5TQLA 1PTAA 3DHFA 3VA8A 4UTUA 1QW9A 5D32A 2UY2A 3OLEA 5D02A 3W7LA 3KBMA 4LQ1A 3UA3A 2VURA 1XDLA 4FR1A 4J3WA 4PC8A 1J10A 3FOKA 4Q8OA 2GUBA 4GK8A 3AMDA 4A2SA 5GVJA 2AL2A 1UC4A 5HAOA 5LIKX 4K38A 3VD4A 3TQKA 4UCGA 1BXNA 3VIKA 5H8MA 3DU0A 4Y8EA 4S3CA 5B80A 3S9ZA 1UZDA 3UG8A 1P48A 4LRSA 5GJPA 1P5BA 4QCFA 4QHRA 1DE5A 3CQJA 5IOBA 2B4GA 2PFHA 1Z6KA 4EKJA 1ITUA 4GGHA 4AVNA 2ZRUA 4P5UA 3N12A 4KGJA 5AVNA 5DN1A 3M9YA 1KWGA 2VELA 3E5PA 3NEVA 2XJ7A 3DFHA 1HNYA 3U7VA 3VNJA 3EWDA 1QU4A 3DYOA 3UCQA 3PP7A 1X6NA 3DI1A 2XM1A 2J25A 4LGXA 2HTMA 1J6OA 3SUTA 3WEOA 2ZCGA 1DJYA 3O1NA 3L4TA 2PDYA 4H83A 3ABQA 3W24A 3VMOA 3VDGA 1KRBC 3L7RA 2XIBA 2QMKA 3MHUA 2WJFA 5A5WA 1TELA 2ZX7A 2VD9A 4HT3A 1O94A 3SCNA 5G4HC 3SB0A 1WAUA 1BRLB 3APYA 3MI2A 1P7TB 3P2VA 2D22A 2YBVA 3LMYA 3P67A 4KCWA 4FHAA 4AY8A 1B3YA 2HDJA 3UZYA 2DORA 4YCOA 4DNMA 1EA0A 4BK9A 1RLDA 4WF7A 3ZJKA 1LL6A 1EC9A 3ZT7A 4HPNA 5M5DA 3VOGA 1XFBA 3AS0A 4Z2LA 1TV4A 2ZX8A 1W5OA 1OJXA 5HUPA 4BZYA 3W1AA 4QLLA 1SGJA 4DUWA 2G8ZA 3B0PA 2HVMA 5HJLA 3I6TA 2ZOXA 4GQGA 3R1ZA 4HHLA 5JXQA 2WJDA 5XINA 4NAEB 1ICQA 4GQBA 3C2OA 1MZRA 5I3GA 3CQ0A 3G8EA 3JZEA 4QG6A 3P6LA 3TQVA 3CTLA 3B8DA 3EDEA 3QY8A 4G8TA 4O1AA 4JTIA 2ZUUA 2IW0A 3F4NA 3W22A 2ACRA 1OT2A 3THCA 2VOTA 1CXHA 3RYSA 1UR4A 2YFNA 1JUEA 3FSTA 1XIIA 1CGVA 2CLHA 1W54A 3CT2A 4INFA 2DT0A 4MG4A 3CASA 1HO4A 2YPIA 3B0JA 4U3CA 1JNDA 1HGYA 1VFUA 1J9YA 4S3BA 1XUUA 3B0YA 4Q7BA 2WAGA 5CZKA 5J8LA 4ZL1A 2QF7A 3G1AA 2NW0A 3G6MA 3ARPA 4Y90A 3JVAA 4UQEA 1JUKA 2ISWA 1GJUA 3LRKA 2I56A 1TFVA 3IVSA 2WQDA 3LPOA 1ISWA 4N6FA 3MVIA 3TN4A 4KIRA 3WMBA 4QJ3B 4UQ9A 1XPGA 3N11A 3CMGA 1GQLA 3QV8A 5F2GA 1KGUA 2JKPA 3ANVA 4N6EA 5D33A 1TJRA 1EXBA 4HK7A 3GC2A 4K8EA 4HPJA 4OKDA 1EPXA 1EHNA 3F5JA 4UOJA 1SVDA 3THQA 3BLOA 4F9DA 3NQFA 3BOXA 4H2CA 5GJNA 1EGMA 3WFAA 1S5MA 1NY1A 4I5RA 2UBPC 1XC6A 1TWZA 4MWAA 4OV9A 4MGGA 5XIMA 1TE1A 4GJJA 3NEHA 2X1IA 3RX2A 4OUIA 4YTSA 3UPBA 4N4QA 3SURA 4AF0B 3NL6A 3U9IA 3UA4A 3SCSA 2Z2BA 1GORA 5D04C 2P0IA 1RCXB 3ZOAA 3TCEA 3L66A 4Q4KA 1QUMA 1WXJA 1ZS2A 4RDVA 1UJPA 3VXGA 3IGSA 1IT8A 3PBVA 3EPMA 4HB7A 1V0LA 4EANA 3ZM8A 5BXPA 4ALDA 3RPTA 2TPSA 3E3HA 4JQAA 5I3HA 1NAL1 2XVKA 2W4XA 4HZMA 2E7FA 1V77A 4PULA 4UTIA 3MO7A 2FKPA 4Z1BA 4JOMA 4C6IA 3F4CA 2PWFA 4WY0B 1E5JA 1EX1A 3RO8A 1HIZA 4UFKA 3K13A 2ZZ2A 2J27A 3IV8A 2XH2A 3R79A 3W07A 4RV3A 2Y24A 4I8DA 1PKNA 4WXYA 1P0EA 1E6PA 3T2PA 1JR1A 5HMSA 1MXDA 3V5OA 4JTAA 1G4TA 1NTHA 1HX0A 2B7OA 3GTHA 3RK8A 3SCVA 3TW9A 1SJAA 4FNTA 3UFYA 3H2OA 3ITLA 3UF9A 1E0WA 2PLMA 4OT7A 4NY2A 1TPDA 1P6BA 1K7FA 3W88A 2WMHA 1YHTA 1C8YA 1ITXA 4AX7A 4E3VA 4NZ5A 4LF1A 2V2HA 5A8OA 3IJ6A 1WDSA 1KM0A 2DW6A 1A53A 1R2RA 3BAYA 3FAXA 3XINA 2NLYA 2Y8KA 3A23A 1UIOA 3T2OA 4ZQCA 4O57A 3B0HA 2EHHA 2EKCA 3MO4A 3H53A 4PMJA 3V16A 2QMJA 3ANUA 4O0ZA 5TD4A 2PDXA 4P7OA 2O4QA 5IM51 2VUNA 3VM5A 3P82A 3KUMA 1KA9F 2AL1A 1SR0A 3O16A 1T41A 5A8MA 3HPFA 1JDFA 3GXMA 2XVNA 4A8NA 2W92A 4CD4A 4C6QA 1K70A 4J3ZA 4LV4A 4GZEA 4HNNA 3O07A 1RK6A 1U30A 4HA1A 1DP0A 1ME7A 2EG8A 5E6YA 2E8ZA 1KBLA 3HMJG 3QZAA 1KV8A 1ZENA 2VO5A 4UFHA 2C19A 3L2IA 2MNRA 2YGYA 1WQ5A 1NOUA 2EPKX 2Y2WA 3MM7A 3KTXA 1UIPA 4ZOBA 4NP7A 3HG5A 3SBFA 4DF2A 1W56A 3NDZA 5AFDA 2QPSA 3M64A 4JX4A 4MUZA 3K1DA 4E4PA 1CLKA 3VNYA 4GYJA 4CCDA 3QRHA 1H0GA 2VR5A 2RGMA 7REQB 1NOFA 4E8GA 3W1XA 4H4IA 5BWFA 4GI8A 1BGGA 1NELA 1PDZA 3R58A 3IJ7A 4ZFMA 4B2DD 4F0MA 1RBLA 3E0VA 3UGRA 1YKWA 4N9DA 3A4XA 1E72M 1OC6A 2O0TA 1J96A 5BW6A 5AHEA 1KXQA 4C6NA 4ZA0A 2HSAA 4KEVA 5AYYA 1W1A1 5JH2A 4GFSA 2C13A 4CNTA 1TPFA 1Q6LA 4QQUA 1JPIA 2C1HA 1H51A 4X9YA 3AIEA 5RUBA 2R1PA 1TE6A 5DRIA 2PTZA 1ICSA 3TN3A 1C3FA 3TXZA 2HBXA 1ZALA 2QCFA 3KEHA 1FP9A 1V79A 4V15A 4JNZA 2EJ1A 4GI9A 2V38A 8GEPA 1T0OA 1V3HA 4LUSA 2RGLA 3CUJA 5IHSA 1K02A 4WKFA 2R6OA 3G5EA 3W7NA 3TYCA 3TEVA 1LT7A 1VZWA 5JVLA 3BCJA 3S2JA 1VLIA 2AQVA 2G97A 1ZGDA 4WZHA 1DQWA 1R30A 4YTUA 3LD5A 1CWYA 5CC6A 1HL9A 1ADOA 1F6KA 5CGMA 1WKDA 2MANA 5CJ5A 4ZQRA 4OU1A 4MADA 1RP9A 2G41A 1XPYA 3WN6A 4N4PA 4C1LA 2A3BA 3LYEA 1M41A 3LDVA 2Z27A 2A7NA 3KVMA 1DWHM 3KFTA 4JAWA 4FXFA 4DJED 3W25A 1G1YA 3MBDA 2HQAA 3ABZA 3NNTA 3WQCA 1PKMA 1F73A 1MQPA 4MPQA 3VGEA 3OGSA 2FZBA 1RBAA 1K9EA 1PZ2A 1UYQA 3RHGA 2F61A 2BOGX 4TVCA 1V08A 2GYIA 4GYFA 3QZ6A 1UKTA 1YLVA 1ZRQA 1YTEA 2VDGA 1G4SA 3T0AA 2PRLA 4IWWA 4NRRA 3WK0A 1LORA 2QCHA 1RY0A 1UR9A 1W2VA 1VR6A 3FNDA 1XLJA 1CGYA 2J7EA 4Z0SA 3W83A 1RAKA 3MP4A 4XAPA 2CZVA 4UNIA 3NO5A 4DZHA 4PH6A 3AALA 4QSHA 3GO2A 2FGZA 2TMDA 1E9LA 2HROA 3H8AA 4HA0A 4GUGA 1BF6A 2ZYFA 3UY8A 2UWFA 4HA3A 4Q8NA 2ZTKA 4RDZA 3N29A 4PMUA 4GVFA 1BWVA 5FL1A 2ZA1A 1XKYA 5FJTA 1JI2A 2W61A 3KBSA 1LLZA 3R8GA 3O6DA 1ECQA 2ICSA 4YL2A 1GOQA 3MZNA 3STPA 1WE5A 4GXMA 2E25A 3M7WA 3VD7A 3ZR6A 1PX4A 2Z4GA 3UPWA 2P50A 4LRTA 4H9XA 1PYMA 1M65A 3WJZA 4GQQA 1DJWA 2WJZA 1MYRA 3NG3A 2I9EA 3PTQA 1CLVA 3WD0A 3WNKA 3B8VA 1WZLA 2ZVRA 1MO0A 4Q33A 1DV7A 3BV7A 4AVOA 2AKZA 5IFPA 1OADA 3PJWA 4LCQA 2VCAA 1K77A 4WHBA 2LLEA 2J7BA 5C70A 2AGKA 1C7SA 1YXCA 1J6PA 3KOXA 1KRCC 1AUSL 1UQYA 3G1HA 1UUOA 4X2RA 5CPSA 3WBWA 4NX0A 5CPLA 4KRZA 1TWWA 4D71A 3OHIA 5DBUA 2CKRA 1X1ZA 1VBHA 3SSZA 5AECA 3TZNA 4LBRA 3O15A 1FH8A 4YTQA 1R3VA 2VZTA 2ZZ3A 3PZMA 4LT9A 2C0HA 4UFLA 1PS9A 2OLAA 3VYLA 4JICA 2NUWA 4MDOA 2AGTA 3KBWA 1J0KA 3TJXA 1MEHA 3RMJA 3FDKA 4BKNA 5I3IA 1K9DA 1H11A 1EJTC 3LTSA 4AWUA 4KIEA 1SMDA 4LTSA 1VH7A 2QF8A 2JF6A 4Q4SA 4AZ6A 2ODOA 3EPNA 2AKJA 1HVXA 3QOMA 2BVWA 3R4IA 5FESA 1FCVA 1UWQA 2PDFA 2CU0A 4O14A 4Z1YA 4HD5A 1GVIA 5I5RA 1C9DA 3WG6A 3MB9A 3JR2A 1V02E 2WW5A 1J12A 2ALRA 3H4XA 2FZDA 5LKYA 1H63A 3OP2A 4ZB0A 4MY1A 4WXZA 3EA3A 3WDJA 2R1NA 2RKXA 1IT0A 1R38A 3LCFA 2QDEA 3AIBA 2ZDRA 1REQB 1M03A 3RIKA 1OABA 3G1XA 3VLXA 3CK5A 3IVUA 1T6MA 1PHWA 1I45A 3T8QA 3RU8X 3GE7A 3HN3A 3NA8A 3I10A 1QRQA 2F84A 4PMRA 2C14A 1E9ZB 4HMDA 5JH1A 1PTGA 4H8NA 3CHFA 4PTWA 2OT0A 2Z6IA 1G67A 3D47A 1LOLA 3RUBL 1GOOA 3GK0A 3DKLA 3P3BA 9XIAA 3NURA 3PBGA 1HGWA 2PLKA 2OSXA 5DY3A 2PDQA 4FEZA 1BF2A 5BRBA 3GTNA 3SQMA 2O4MA 4B5SA 4W9TA 4HNOA 3IUDA 4PMOA 2REQB 2UV8G 2ZKMX 1Q7QA 3A64A 3IVTA 3NCOA 2XN0A 4GY0A 2P3ZA 1G9HA 1A80A 5A6MA 3BQ6A 1UWTA 4Q4OA 5CG7A 2OZTA 2EO7A 1SO6A 1G01A 5AOUA 1TV8A 4E5TA 2MUCA 3RF9A 4LW7A 5CPNA 3WDRA 3TC6A 4DM1A 4JFUA 4PR4A 5G4EA 4XZLX 4V28A 3UG3A 1MUCA 3PPHA 4IX0A 1G94A 4HU8A 3SIZA 9XIMA 3TAKA 3FY1A 1S2WA 1QMLA 3N4FA 2DY3A 4LUTA 1CGWA 4GZ7A 1GG1A 2H9AB 5TF0A 4RXFA 3LLXA 3SUVA 1FWFC 1A5BA 4MAVA 2PC4A 4XUGA 3W7EA 1MXSA 1MW3A 4DJEA 3L2LA 4HU4A 2QR6A 4Z0JA 3EXSA 3CMJA 1H5VA 4YLWA 4PTXA 2HVNA 3OVGA 3N3MA 1HP4A 1QXLA 1A5NC 3SRDA 1GOMA 4F0SA 4UTTC 2XSAA 2A6NA 3UR8A 2TRSA 1FDZA 4MJ4A 2QGHA 3QJAA 3OO2A 1CIUA 3HMCA 1JXKA 4I9MA 2G3FA 4PFHA 2WMKA 1KRMA 4JTTA 1JRCA 2B7QA 1J0ZA 1PIFA 1AG1O 5CAKA 2BBFA 3CLWA 3TP4A 2E9MA 2I5IA 4J3UA 3NZPA 3QN3A 1NQKA 2QS8A 3F7JA 4L9ZA 1P6CA 3GWQA 2FHFA 1O5XA 1CLXA 3H24A 4PMQA 5E70A 2ZA2A 3GM8A 3AZRA 3WQEA 1OG6A 1X38A 3N25A 1OD8A 4DXXA 2DT3A 4HNCA 3U3HA 3AMCA 3ATYA 4US5A 4IMGA 1XSJA 4XTDA 4MZYA 3GG0A 2Q6ZA 3VVGA 2ZADA 3VDAA 3TA6A 2V8ZA 3CT7A 4TV6A 2O92A 2F2KA 3S1GA 1I2QA 3E0LA 3PPFA 4LVDA 2TYSA 1VFHA 4M5PA 1UP2A 1CPUA 3AISA 1VEPA 3SI9A 4JFVA 2HV5A 3TJLA 3W86A 1NSJA 2VCBA 2I5QA 4QDMA 4AD1A 2DFAA 3KRUA 3RITA 4FXRA 3EZ4A 2VQUA 1E3ZA 1VJIA 3OB8A 4UMCA 1AA1B 4EAYA 5D05A 4EWND 3F2BA 3UERA 5HWJA 1GTHA 7PTDA 1XX1A 2X8RA 1H1ZA 2JKAA 1GHRA 1A5KC 3GC5A 1JGIA 3LNMA 1H61A 5J5RA 5T9CE 1JXJA 2FYMA 3WH8A 1TYGA 3GNOA 3WH7A 3CL6A 1AQHA 3QMRA 1PCKA 1C8VA 4FNSA 5A94A 2J7CA 4MFEA 3AHVA 1JDEA 1JYVA 1G5AA 5KITA 1DIEA 4G7EB 1Q8JA 5CQ1A 2CCRA 1FHDA 3TW7A 4HGXA 3P80A 4UQCA 3B06A 1WDRA 4XTIA 4DXVA 2IKGA 1DYSA 1OF6A 2GSEA 3NQBA 1B3XA 5LGZA 4F4RA 3AYRA 3BLKA 2ASHA 3HURA 4NI3A 4ZQOA 5HNRA 4BQ3A 3WLTA 3NPXA 3LCGA 2VKZG 3GXTA 1ZTVA 3ITYA 5C2CA 3AZSA 3SRFA 1Q2RA 4CQ8A 3V1PA 2W62A 4AMCA 3OU8A 1JZ5A 3PTDA 4R7JA 3WFLA 5T9BG 4R34A 4GACA 5I02A 1CW2A 3V5CA 3CYJA 4F0KA 3SECA 1HJXA 3N6HA 4UNKA 1SR9A 4GYPC 1ZQ5A 3MPGA 5DFAA 1OY0A 1MUMA 1N8IA 1XH0A 3O63A 4MTVA 2CWNA 1HKJA 3WH5A 3WQVA 3BXWA 5D37A 3IGUA 5HJXA 2G3MA 1ZBCA 2GGIA 2H8ZA 1NDZA 1CT5A 1KNWA 2XN2A 3OLDA 4HZ7A 5ECVA 3W2LA 4AXNA 1PWMA 1GOWA 3KLLA 5AN7A 1QPOA 4XSMA 4WY0A 1XDJA 3V0TA 5I09A 1D3HA 4HYWA 1IT7A 3CHEA 2E6AA 3NYDA 3APTA 4GWEA 2HNHA 1XIMA 5D2TA 4IG2B 3C0JA 7ENLA 3BUVA 2VEIA 2ONEA 5LA0A 1A47A 3ZR5A 2OQYA 3ORWA 4KMQA 2PZNA 1OK4A 3SCQA 4UCFA 5G2WA 1LQAA 3FA3A 4MJMA 1T40A 4BQ4A 4U31A 1FXQA 1V6WA 4MAZA 2QUNA 2AKMA 3G8RA 1VFOA 4PUEA 4ZBCA 5HULA 4S38A 2FMNA 3WSUA 4N42A 1R8LA 1JZ6A 3W7GA 4E0CA 4DZ5A 5BXSA 3TAOA 3W1NA 3WDHA 1K8XA 3W2MA 1ZJHA 3OW1A 5KETA 3AS1A 3VIOA 2VMFA 3VGHA 3P8JA 4C6KA 1IV8A 1GQNA 2WK2A 5A8QA 3RRXA 1QJWA 1SPQA 3BJFA 3KCJA 3ISIX 3WENA 3CJPA 2Y85A 5MKGA 4AEOA 2VRKA 3LQLA 2RJHA 3EPOA 3DFSA 2O7QA 4KT2A 1BWKA 1YEYA 2A3EA 2FB2A 4XAZA 3S8HA 4I9JA 4S3FA 4AIEA 1GKRA 3QFEA 1PIGA 1VPXA 2P3EA 3DDMA 1QBBA 2E1DA 2XFYA 3VABA 4BF7A 3VKDA 2W63A 3QQ1A 4F0HA 3U8GA 5CSSA 3TROA 2WLZA 2PSNA 3S6TA 1K8CA 4DB7A 3E0FA 3M0VA 3L4UA 4ZO9A 4AFYA 4IT1A 4W85A 4J28A 4XV0A 1JCNA 3UETA 4GINA 1ZZMA 1JPKA 3GVVA 3UWZA 1N7KA 2WM0A 2CLIA 3NSXA 2J7FA 2BVDA 5CBBA 2P76A 4CGTA 3CUHA 3EWUA 3VX0A 3O8AA 3ITTA 2GOKA 4FIQA 2WWDA 4J9JA 4ORIA 5DF0A 1QNVA 4P2VA 1XHGA 5REQB 4DLMA 3SN4A 2WB5A 2NVCA 2P88A 1JFXA 1YTDA 1HKMA 3WNLA 4A2RA 1TCMA 2Z1WA 2WZTA 1CGUA 4U2ZA 4B90A 2V30A 3H2FA 3CTTA 3CL7A 2NUXA 4PCSA 5FOOA 1PPIA 3C56A 1ELSA 4QIUA 3CZKA 4JTQA 2CNCA 4O52A 3ZJ6A 3B0NA 4QTGA 3P62A 2CERA 4ZE5A 4DWSC 1NDWA 3GRIA 3IIPA 3STGA 1E1CB 3CZJA 2QW5A 3H2NA 4ROQA 1A4LA 4XZ9A 5FCZA 4LVFA 3TTQA 1OM0A 4IGHA 1Z9AA 3CXOA 1TR9A 5DCDA 2Y5JA 3MI6A 2DJXA 3WLQA 4JIRA 2DVUA 2XHYA 1R46A 4G5DA 2R24A 1DTNA 3AIVA 3T0DA 4H6KA 3TW6A 1J0IA 1BYBA 3LI0A 5HANA 4TV5A 3FN9A 2YW4A 4AOPA 3LZ5A 2B0MA 3EDKA 4NL1A 4X3ZA 3M0ZA 5E0CA 2OKOA 3GC4A 1XLKA 3W2JA 1Y8BA 4X60A 4NHVA 2VEKA 1SZFA 2QJGA 1LL7A 1XSKA 2HXUA 4BQ5A 1FY6A 3I6RA 3TVAA 1OZMA 3VZXA 1F07A 3WNPA 2PWVA 3AMLA 1H2JA 3CZLA 3TMQA 1CX9A 1CGXA 3G1RA 1OCJA 2PF8A 2O9RA 3MC5A 4PTNA 3QYQA 2NQ9A 3WD1A 3P14A 1VFTA 3STEA 2BY2A 3OLGA 4OBSA 1CB2A 5LGXA 2QCEA 2ON3A 1O1ZA 3LRLA 2YW3A 1KFBA 4GNJA 1CI1A 4LSBA 4CCCA 2YCLB 1FQ0A 4ML4A 1QPRA 2HXTA 1H62A 1ZSXA 2Z1SA 5LA2A 2PI6A 2FTWA 2D20A 2BNJA 4IXHA 3RO6A 4GFIA 2PEVA 3RRAA 1ICPA 5D2WA 3Q67A 4DJFC 2PMQA 4UTTA 2QCDA 4UQDA 4PUKA 1RP8A 1QWKA 1DVJA 1K8YA 5CC7A 5I6SA 3W7CA 5AC5A 1AMKA 4Q6XA