4S3DA

Ispg in complex with ppi
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 137
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3dA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3dA02
4DJEA 4S3FA 2YCJA 3VKTA 2YCLA 2Y5JA 4S3DA 1Q7QA 3VLZA 1AJZA 2YCLB 3MMAA 4O1FA 2GEPA 2YCKX 3OR2B 4MWAB 4C1NA 3TZFA 4MWAD 4NIRA 4S3BA 4DJDA 4O0QA 1EYEA 4G39A 3VM0A 2VEFA 3VKPA 4C1NB 1Q8AA 3TYZA 4MWAA 7GEPA 4NHVA 3OR2A 1AOPA 3MMAB 3H26A 2V4JA 1TX2A 1Q8JA 4S38A 3H2MA 4DJFD 2Y0FA 1AD1A 4GEPA 4S23A 4NL1A 3OR1B 3TYUA 3MM6B 3TR9A 3VLYA 8GEPA 3MCNA 2VEGA 4CCZA 1TX0A 2AOPA 3MMCA 4NILA 2H9AA 3BOLA 1Q7ZA 1Q85A 4MWAC 3GEOA 1ZJ9A 4DJED 2DQWA 2DZAA 4HB7A 1TWZA 3K13A 2XSJA 3BOFA 3MM7B 3MMBA 4S39A 3VM1A 1TWWA 3AOPA 3MM8B 2OGYA 3MM9B 3NOYA 3B0LA 3MM5B 4G9PA 4O1EA 4D9PA 3B0GA 3VKRA 3MM9A 4DJDC 3MM8A 3MMBB 2DZBA 2XSJB 1AJ0A 3H2OA 2VP8A 3H2NA 1ZJ8A 3B0HA 5JQ9A 6GEPA 4G38A 3B0MA 4HTRA 4S3AA 2E7FA 3TYDA 3H22A 1AD4A 3TZNA 3MM5A 3TYCA 3VLXA 2BMBA 3H23A 3H2AA 1TWSA 4PZVA 3H2FA 4S3CA 4DJFC 5AOPA 4MWAE 1Q7MA 3MM7A 4DJEC 4D8AA 2AKJA 3TYEA 3MM6A 3V5OA 1F6YA 3OR1A 1AJ2A 3MCMA 4DB7A 2V4JB 3B0NA 3H2CA 4DAFA 5GEPA 2Y5SA 4S3EA 3TYAA 3VKSA 2H9AB 3H21A 3MCOA 3H2EA 4DJFA 3B0JA 4DJDD 3MMCB 4AOPA 3H24A 3TYBA 2YCIX 4DAIA 3VKQA 4D8ZA
chains in the Genus database with same CATH superfamily
2Y24A 5TF0A 1AJZA 4IIDA 3FDKA 3K30A 3W1RA 1KM0A 3AWNA 4E8CA 1OABA 1O1HA 1UWSA 1UOZA 1J96A 1HO1A 7GEPA 1JDFA 4K6AA 4H9XA 5GVJA 4PTDA 4G7EB 5A6AA 1TJRA 4AY7A 1JULA 1DJQA 1G5AA 2GVYA 4JTQA 3W85A 1R2TA 1R8LA 3CMFA 1TX0A 1JCYA 4B90A 4NI8A 3SFKA 3V35A 2CLEA 1XLKA 4ZO7A 3LPOA 5T91A 3WLLA 5XINA 3W86A 3N13A 3ABZA 3CM4A 1FHVA 4GXPA 3LMZA 3TKFA 3WFZA 4EACA 1DEDA 4MUPA 3VCRA 4A3QA 3F7JA 1OM0A 1JDDA 1AA1B 3P8IA 1CGWA 4HN8A 3W73A 4IP5A 3ARTA 4AWEA 2XSJB 4OKDA 3PWAA 1G7UA 2AMXA 5A6JA 2GDVA 5AYZA 3FLUA 3MDWA 5H1WA 1HJVA 3WG6A 4KQNA 5E9AA 4IPPA 1XIDA 4JYDA 3IWPA 4XZLX 1Q5MA 1T41A 2PCEA 5EMYA 1A53A 3HG2A 8A3HA 4OJYA 3NGJA 1W9VA 4OTKA 3EYPA 4GG9A 4XZ9A 5DFAA 3VD7A 2GQ8A 1KRAC 3GKAA 3M16A 4FPSA 5U7SA 2PWEA 2QJJA 4I5XA 2QIIA 2ANUA 3A21A 4LNCA 2DIKA 1PKNA 3R8GA 4PODA 4D6FA 2FTYA 4DVOA 4AYGA 2PP3A 5FEWA 4F9DA 4C5YA 3C0JA 2VYOA 4IIHA 5EU9A 2W63A 1KA9F 3SQLA 3OIHA 4Q4QA 1ICSA 2WHKA 3DFTA 2QMJA 3LSCA 3N2OA 2ZTJA 1MEWA 3K46A 4WJXA 3ZWTA 2O56A 1ONEA 4M3PA 1XLAA 3TJ4A 3MMCA 3UA3A 3ZT7A 1I1WA 2J24A 2X1IA 4Q7IA 4L4OA 4OUIA 3SY1A 4FA3A 2I14A 3CUXA 4XWUA 3WLTA 3SO7A 1EX5A 1S3HA 1ZJ9A 3CHVA 1WA3A 3LHVA 4ROQA 3KEHA 1TTPA 4JBRA 2J7DA 2PODA 3CYVA 3BW2A 5CLWA 2ISDA 1FH9A 3AMLA 1E6XM 4S3GA 1UH3A 3CLWA 5D9OA 2FLIA 2F6UA 4IWWA 4O57A 1Q4WA 3G3DA 5JIWA 3WLHA 5D38A 4ASTA 4FR6A 2Z7GA 4K7YA 1XP3A 3GS6A 1V6XA 3W7EA 2E77A 1KM4A 3WF0A 3W7KA 4ACZA 3TYDA 4OV9A 2QEZA 2XVLA 4QHRA 3RX3A 3EX4A 3PG9A 2G3JA 3LLDA 3R0UA 2ODOA 1SU5A 4TV5A 3PZQA 5AZ1A 4P2VA 1H7XA 3O1NA 3NXLA 2QJIA 2XH4A 4H9ZA 4DBWA 5RUBA 1LQAA 2Z1BA 1H5VA 2QKFA 1QXLA 3QF0A 3I7SA 1G94A 4A35A 3W7CA 3NM1A 3DIPA 4R7WA 2CKRA 3EOOA 3F5KA 4AD2A 2GDQA 4EX4A 1PYFA 3VKPA 3LU2A 3WELA 1LROA 3W29A 1DQUA 3AOFA 1NM9A 2FH6A 4Z0JA 2OYMA 1NY1A 3RLGA 3RCMA 3VILA 2QPXA 4XD3A 3TTOA 5A6SA 3O07A 1W31A 2YIHA 2XHYA 2FHBA 1TV3A 4D6DA 4YTSA 2XIMA 1M3UA 1UZ4A 2B4GA 5F2LA 3SUWA 4QXIA 1KCLA 3TLQA 2ZZ1A 3VUPA 3EDJA 1FCBA 3A13A 1R46A 3QV9A 4RE0A 1RY8A 1U5HA 7A3HA 4FNTA 3MM9B 4S1FA 1FKWA 4Z08A 2OKOA 3I6RA 3URAA 1V3IA 3TN6A 4D6GA 3MMBB 3XIMA 3IJ7A 2UY4A 1JNEA 3MZ2A 1UMLA 4J28A 1EHAA 3NUKA 2VD9A 3BGJA 4AX6A 3H2AA 2R91A 4GJJA 3FJNA 5J04A 4LU0A 3UCQA 2OZ8A 5AYYA 2QCCA 5K9DA 1FWDC 5JBFA 1WAWA 1NFGA 4IUGA 4ATLA 1K6WA 5L9FA 4W85A 1Y7VA 4GQGA 2JK2A 1EUAA 2WVVB 3VKTA 2DVTA 2VGBA 3WQ8A 5FJIA 5DY3A 1GQLA 3WF4A 3TCEA 3WH5A 5FESA 4Z2KA 1PCWA 3VNZA 5AVNA 3GR8A 1QHPA 1FWTA 4CQ9A 1AZ2A 2ALRA 5I03A 4FS9A 1RK6A 1J79A 3LSBA 2EG6A 4TIMA 2GQ3A 1S5MA 3W27A 3MM6B 5BRBA 3UD6A 1R0MA 4ATWA 5BXPA 1AMYA 1XICA 1YYAA 4EXBA 5FSDC 1XW8A 3EMZA 1EDGA 5KEZA 1SM9A 3HZ3A 3W00A 2P88A 2XDFA 3ZLGA 2WMHA 1AQ0A 5FCZA 4L4MA 3UPMA 4GINA 1E9IA 2DP3A 5FACA 3PZNA 1CDGA 4J1OA 1KLZA 4O17A 3W75A 3BAXA 4YYFA 4TVUA 3KAOA 4LAOA 4LCRA 2X09A 2DU2A 1Q4NX 3EKGA 3F4VA 4ZODA 4I6VA 5DMNA 4QITA 3AHZA 3QY7A 3PZ9A 1L8PA 2C79A 3I3BA 1J10A 2AKJA 3ABXA 2ESCA 5HK4A 4J3UA 2IPFA 3AS2A 1AODA 3SRKA 2Z26A 2PGFA 1RJQA 3CZ8A 4LPCA 4YVVA 3QFEA 4I9MA 2VEPA 4Z2GA 1XUZA 1UIOA 3OW1A 4EK7A 3P74A 1E73M 3R12A 3SDOA 1E0WA 2YPIA 4UMCA 1CYGA 4HN4A 4PEKA 3W70A 3HQPA 3NYZA 1KKOA 1K8ZA 2HE8A 4JDBA 1I75A 3MKCA 2X16A 3O6AA 4R7JA 4K1WA 3UWZA 3L4XA 1M04A 1G4EA 2Z24A 7ODCA 1MW0A 1KM6A 3TLLA 3AIRA 1I2RA 1QNOA 1OVDA 3N29A 4HOXA 2QJMA 2UZ9A 4NNBA 1Q85A 3RHGA 3I7QA 1NWSA 3SUUA 3CWHA 1QBBA 1WNOA 5E6YA 1TFVA 4LANA 2ZX9A 4QE4A 4LS1A 2AKMA 3PJUA 3TW7A 3RGTA 4E4PA 2ZKMX 3DOPA 3KRBA 4B3LA 1TJPA 2YR1A 1J9YA 4ADUA 3DDMA 4RUBA 1EOKA 4Q4MA 1UWIA 1QO5A 3GBDA 5AYXA 3S5OA 4DLFA 1WKDA 4DXVA 4GD0A 1QNVA 3LZ3A 4EAMA 3W0KA 1W1VA 1YXYA 4UQCA 4WY0A 1PAMA 2WV8A 3BH4A 3RR4A 1RA5A 1C91A 4UTTC 4LTSA 4CU6A 4DJFA 2YL9A 4AD4A 2YCEA 2NV9A 4K3ZA 3WQCA 4EXAA 3VKQA 2BBFA 4C6NA 2YCJA 3SCTA 3ID7A 4L61A 1OFEA 4Q6XA 3PUEA 3U9IA 3R10A 1TELA 3L66A 1WBJA 5TIMA 3TSBA 1PIGA 4AHQA 3DYMA 2CYGA 1H1YA 2HS6A 4R33A 2YX0A 5I3JA 5HWNA 3LI0A 3WFLA 1CB2A 3HJEA 3MY9A 3KXQA 1OCQA 3POHA 3VMNA 4PMZA 5AFDA 1V3KA 1Z7AA 2AOSA 3PZIA 4O8AA 3G22A 4H2CA 4MNMA 3UR7A 2ZOXA 3G8EA 3IIXA 4CQDA 1N55A 1HL8A 1A47A 4E8DA 1E72M 3RN6A 1CXFA 1TVLA 1THFD 3HGSA 2GSEA 5IFTA 4AXKA 1TB3A 3GFZA 4ZQPA 4AH7A 2OT1A 1YX1A 5DQPA 1W9PA 2QQ6A 1PWMA 4C6OA 4S3AA 4P61A 1H1ZA 3H22A 2QUTA 1VFSA 3W1LA 4CNSA 3O05A 3CK5A 1I60A 1W9UA 1W8SA 4YPJA 4ACYA 3T42A 3MKVA 1HJSA 4K68A 1UKPA 3TXZA 9CGTA 2DJXA 3DFHA 4J3XA 1H61A 3RR1A 3W1AA 1GHRA 4LF1A 2D2GA 5TAOA 3W6LA 3LCXA 1IEIA 2Y8UA 1DJNA 3NVDA 4GWEA 1QK0A 3I3EA 3PJXA 4S3DA 3LCWA 1KBBA 4POCA 2PEVA 2A3LA 4LWWA 7TIMA 4L9YA 3N9RA 5KZDA 2A0NA 1YTEA 2ABAA 3E0LA 2QJNA 4DUOA 1HTIA 1AD1A 4N4PA 2PDFA 4DBDA 2DVXA 3EBVA 1V51A 3VNLA 5CPQA 2PTXA 2D22A 1E6QM 2GJNA 1JG9A 1WP6A 1RBOB 3ECQA 2VEIA 1FA2A 1BSIA 3FYOA 3BSGA 2DQWA 3H4XA 4UTUA 1KB3A 1JZ2A 2DJLA 1M03A 3ZR5A 3IUIA 4NNAA 2HEJA 1W3KA 1BYDA 2Y8VA 4JIRA 2EF9A 3CUGA 3LCGA 3M0MA 6XIAA 2R1MA 1A5NC 2P76A 4FXRA 5EL1A 1ZY9A 2PMQA 3B8DA 3V36A 4Z0SA 2UY5A 1CXIA 3UWEA 1H09A 1RQBA 3WDPP 1W56A 3APTA 1UR3M 3VKBA 4JZ5A 3L0NA 1QUMA 4UC5A 4DAFA 4TXEA 4M7SA 2EPOA 2P3ZA 3C3NA 1I1XA 2VCCA 3MMCB 1WCGA 4P8UA 2ZUTA 1JPDX 3EX3A 3DECA 4PBGA 3WUEA 3NPWA 1VENA 1FHDA 3E96A 3TROA 3TFXA 2YA0A 4WKHA 1PVNA 3VOCA 2EQDA 4H3DA 3VGFA 1J6PA 1GJPA 5CG7A 4PUMA 3G0XA 3DCPA 3T55A 2INFA 4A3UA 4X3ZA 2EPKX 5I09A 1Q8JA 4DJFD 1W1IE 3H2MA 3UWWA 3CGTA 2Z1XA 2F8QA 3HPSA 1CI1A 3ENLA 1PO9A 5C71A 1EC9A 1VFFA 3WENA 4AZGA 4B5WA 3GEOA 3N2XA 1Z8AA 1QWGA 4H8HA 4XIAA 2I16A 5AB3A 4RE4A 4CU7A 1ZENA 2F6XA 4YWIA 3AMKA 4NZJA 3DYPA 4RNFA 3DENA 2I17A 3EWDA 1UP2A 3GUWA 1B1YA 1DP0A 3BJSA 1JD7A 3CWNA 4LUYA 1GVIA 4FX8A 4UTTA 3CQHA 1E40A 3W24A 2GGHA 2GK1A 3TZNA 2VFIA 3ORWA 2QJHA 1EX1A 4QQUA 4HNOA 1XLEA 1TE1A 3AS1A 5CBJA 3MP3A 3XINA 1OZMA 1N8WA 2ZDSA 3N4FA 2NX9A 3IIZA 1LWIA 1Y5WA 1QHZA 5DN1A 2W9MA 3GDTA 4YXGA 1CBGA 4NZ3A 1TWDA 1EJRC 4PBEA 5I78A 3FEMA 4PR4A 1RQHA 3FW6A 3W74A 4TR9A 2BY2A 3AZRA 2GEPA 3FA4A 3KBMA 3GNPA 5E0FA 1SJAA 2J9XA 2PTWA 3CAKA 4QS6A 3MHGA 4C6BA 2W79A 5FF7A 3NEHA 4EPDC 2WKJA 4IL2A 3XISA 4H04A 1XLDA 2ZRVA 3QOMA 3GR4A 3T4WA 3U57A 1Q6QA 2IKJA 3N11A 5MHBA 4L64A 4WDXA 4GI4A 4RK8A 1DHPA 4YYCA 3KZPA 1CXKA 1TPB1 4FLOA 3TN3A 3WBWA 4UTWC 2GK1B 4P7RA 1XH0A 1EB3A 1J4EA 4QS5A 1GOMA 3T09A 1UC5A 1JF5A 4ENLA 4JHZA 2XN2A 2R6OA 3G24A 3PZUA 4S3JA 4HTYA 1QU4A 1UD5A 3WH6A 1XRSA 2PU1A 1FDZA 2VQTA 3B0VC 3HGJA 4GZEA 3D3AA 2YSWA 1Q65A 4HQVA 1T7LA 3KBVA 1GZJA 2FHCA 3KOZA 3HM7A 2WANA 4L1WA 4G6CA 2OQYA 1PHQA 2VR4A 1Q13A 1RD5A 3SEPA 1PZ1A 1GW1A 3ZYZA 2E6FA 2PTDA 3RM8A 3T0DA 3L4WA 3HG3A 2VZOA 3F03K 2WKLA 4TX8A 1U1HA 5AHNA 1US0A 3UR8A 4HNTA 1V6WA 2D0GA 3CJPA 4L5ZA 1W2PA 1JZ3A 3GDKA 3M44A 3VKDA 1G67A 3M7WA 3N17A 4MNKA 2PD9A 1P43A 2BS9A 7PTDA 3DKJA 1RP8A 1BQCA 1M7OA 1H0GA 2W6RA 2XINA 1K8XA 4IPIA 4KIRA 4PMOA 2DUXA 4EWJA 3V1PA 1NDZA 2F7FA 4GI9A 2CLOA 3JUGA 4P8VA 4U31A 4L6HA 4KPLA 4UQAA 4GACA 4MKVA 3NSXA 4GH3A 1BWVA 3CHEA 2WMKA 2TSYA 1OX5A 3VX1A 4KBXA 3VKRA 3S8HA 3OQEA 1V0LA 2YW3A 4LYRA 1KC7A 4S2CA 1AJ0A 2OSXA 3SCUA 3WZ0E 1E56A 1FCVA 2AL2B 2FTWA 3UG3A 3PTQA 4PULA 2OEJA 3T07A 2Z4GA 5FL0A 2PLJA 1BPLB 4FAMA 3VLXA 3KM8A 5D8WA 2ZFAA 3G2GA 3M41A 3NQ6A 1DQWA 3AQUA 2GGJA 4JN7A 1W3TA 1J11A 1F61A 3OJGA 4AC1X 5HQLA 5A6BD 1C29A 2X30A 1KFWA 2VDGA 3PPGA 3KWSA 1IEVA 2WSRA 3O6DA 4M5PA 2WVSA 3R0DA 4DRSA 4AMCA 4RZBA 2UV8G 3R5EA 3CZJA 4AG0A 4ZFCA 3I4EA 3F4NA 4TMCA 3C2FA 1W1TA 4RDWA 3GVRA 1PZ2A 3NQFA 4LAKA 2PS2A 3HIJA 1F4AA 2NQ9A 3K5XA 4H7CA 3T05A 3CH0A 2H9AA 2RGLA 3CQ0A 4N9CA 4Y6GA 3TC6A 3N6HA 3NQ8A 4UQDA 1HKIA 3UCDA 3WQ6A 5JVLA 1UWAA 1L6WA 1XYBA 4MPKA 3CV7A 2YBVA 1GEQA 3NOYA 4N0RA 4Z42C 3B0LA 2HSAA 1OX4B 3PWIA 2ZZ7A 4P8WA 4ZL1A 4FX6M 3KVKA 1BKSA 2BNJA 4XZBA 1TA3B 3POCA 4M7TA 2NT0A 3L4TA 1P5BA 3TE9A 3S5ZA 4DPPA 4QJ5B 1IXOA 4H00A 1QOPA 2V4JB 4NJIA 4HYRA 5AC6A 3TQKA 3BAKA 4HA0A 3LHYA 5IHSA 3VKSA 4X22A 1TR9A 5H8UA 3E0WA 5HWJA 2IS7A 3BMVA 3E6EA 2VCAA 3LHTA 4L7ZA 3WSUA 3M6YA 3ZQ9A 2V38A 5BRQA 3TAOA 4MNLA 4LSBA 3KW3A 1PZ0A 3PB2A 2HPMA 2GPTA 1ITQA 4E2BA 3BICA 2NLIA 5BXRA 3V0TA 2VFEA 1QCWA 1JL8A 5CPLA 3HQOA 4WJEA 2J66A 4HHHA 3PTMA 4P5UA 4XAGA 5D09A 4JD4A 3U5UA 2DT0A 4IISA 4DF1A 4RJEA 2QCMA 1LWJA 3ABSA 1OFPA 4EOUA 5LHEA 3WLJA 3N3TA 2PDNA 3UY8A 1GOIA 3OBAA 5IHRA 3BL3A 4IMCA 1A5BA 3QVQA 4UR9A 4O8RA 3C8FA 4TX9A 1DWGM 2ZIDA 1V6TA 5ENLA 2E28A 3E5BA 2Y6ZA 2ZX8A 2VFGA 1Q6GA 4Q22A 1J8VA 2F84A 1KM3A 1BKHA 5D37A 3AHYA 3VDCA 3P81A 4IMAA 5MKGB 1K8YA 4GOAA 4IMEA 1DTUA 5T26A 3UCCA 3GVGA 3CZKA 4N42A 3TTEA 3BLKA 2FYMA 2I7GA 4K38A 4PL2A 4ZOAA 3LI1A 4JL1A 2RDWA 1Z32X 2F2KA 2PDWA 3CUIA 4WSJA 3AC0A 1DJHA 1S3TC 1CECA 2CZEA 1C92A 1WDRA 3VMOA 1WDWA 4GIEA 4UNKA 4QJ4B 4NRSA 5CC6A 2ZYFA 1KXHA 3VI2A 1K9DA 3D5HA 4IT1A 3DBPA 1XC4A 1A5KC 1B4KA 3C0LA 2XM2A 3LBMA 1ZSXA 3GNDA 4W8LA 4IXHA 4XKMA 4FR1A 3DG6A 3S2CA 1EOMA 5IDZA 1JZ5A 1OFBA 2GJXA 5CC5A 2VQUA 2IQDA 3MMBA 1V7AA 4LUTA 1RA0A 5HPOA 4XBSA 5F4SA 3LD5A 3MI6A 2D2OA 1IR2A 1WB0A 1HKKA 4DF2A 2ZE3A 2J75A 2DPEA 1PDZA 2CZ5A 4WVXA 4X0NA 2CLLA 1TV2A 2X7VA 4DJFC 1OFDA 4MYAA 1X39A 5C9RA 1ZUAX 3BLLA 2P3EA 5LSMA 2XN1A 2CBIA 2NUWA 1A3HA 5EY5A 4W86A 2Q01A 3GTHA 1Z3NA 1UZ1A 2BV9A 4QFUA 1VBHA 2WJZA 3MC5A 1HFBA 4YNGA 2HTMA 1WX0A 3BJFA 3L67A 1FX6A 3K2GA 2X40A 5DO8A 2VTFA 1MXSA 1NF7A 3RUBL 4AY8A 2Y85A 4QSFA 1UMYA 3MMAB 1M7JA 4MY8A 1VRDA 1JXJA 2YB4A 3C2VA 4I9JA 3FYPA 1UR8A 1X8CA 2ACSA 3EPOA 2PUZA 1FWEC 1OD0A 1OQFA 1Q6OA 3QHNA 3FK4A 2NT1A 1MW1A 1EJWC 3NO3A 4HPXA 3W7MA 4GVFA 2VVSA 3MM8B 4WJ8A 2YXOA 4IP7A 2BZNA 3UFYA 5HNRA 1WKEA 1REQA 3BLIA 1IV8A 5J5RA 1R7OA 3HG4A 4WF7A 4NUWA 3HGOA 3BPWA 4MZ8A 4UZUA 1XIBA 2GUYA 3M0YA 5G5IA 4MUZA 3MM5A 2ZZ6A 3DFSA 3M07A 4H9MA 4INFA 3WL1A 4WRHA 5FEZA 3OHIA 3FV9A 1JGIA 2PTYA 3ITVA 4KFPA 2CERA 4UIOA 1CLXA 4EF8A 3BG5A 1VFHA 3C2YA 4C1LA 2NXIA 4J40A 3EDEA 5D2YA 1WZMA 4HMEA 4RW5A 4UTWA 3LB0A 5TD4A 4PH6A 5FL1A 2QW5A 1GKQA 2J13A 2OYLA 3ANYA 3NM3A 3PY2A 2H3BA 4ERGA 4KW2A 3T0BA 1QPRA 4FLRA 1UC4A 1U2YA 2RJGA 1R2SA 2GJPA 1DIOA 3GH4A 1PX4A 4GHRA 5HJLA 1ZP4A 4LT9A 3T4CA 1CXLA 3SGUA 3KL3A 1GYMA 2PDMA 1EIXA 3EPMA 3L5AA 4QROA 4XX6A 2J6VA 3R8HA 4B5VA 3GDRA 5HDRA 3I10A 7TAAA 2BODX 3GH5A 1V0KA 1KXTA 4JICA 1OK4A 2VL4A 2QAFA 3D3FA 3VD3A 2J27A 3TK7A 1V3LA 5LA0A 2PDGA 1AQMA 3H70A 1PUDA 2PDYA 5AYBA 5GJNA 2VEKA 2YKKA 3S1WA 1BFNA 1UYQA 1QATA 1XYAA 1XC6A 5FF2A 3KTXA 2GGIA 5K2ZA 1FKXA 1DJWA 3AZSA 3LLFA 1PTGA 1HL9A 1TVNA 3B0YA 2WO5A 3GIQA 4MFEA 1E5JA 1NJJA 3UG5A 4F9JA 3E12A 4JHMA 2QZRA 4FXJA 3MJYA 4XAYA 1Q6LA 1K03A 1BGAA 4GJIA 1F05A 4WUIA 2MUCA 1B54A 2IKGA 4PTXA 2WC7A 5I5RA 1NH6A 1X7FA 4N4QA 3VINA 2G4JA 3M47A 4AD3A 5K3VA 4C1NA 1HGYA 2OLHA 3T0AA 3LPGA 3PBGA 3VM0A 3MYPA 3TYZA 4MAZA 1EQPA 1EZ2A 5ABHA 1UA7A 3C52A 1QK2A 5BXTA 2HJPA 3SFWA 5GNZA 3LOTA 1ZBVA 4GGHA 3GZAA 1R7AA 2O0TA 4D6JA 4DZHA 3WNMA 1JI1A 1S5VA 1N8IA 2CWNA 3WMBA 4FK9A 4JTJA 1QOQA 3SADA 2A6NA 2V82A 5CSSA 1I2OA 4UOZA 1JIBA 9XIMA 1XH2A 1J2WA 1GKPA 4LBSA 1IT8A 2G3NA 3FFSA 4E38A 1XSJA 2PDXA 4XBKA 5E93A 2WPGA 2OT0A 3H2OA 5E09A 4JNMA 1XWYA 3NXFA 5GQBA 1UUQA 4NVTA 3TXVA 4B3KA 3B8SA 4JQ3A 4MJZA 1PXGA 3ONCA 2B7NA 3IRDA 3G77A 2OYKA 5BYWA 1X1OA 2VDHA 1EHNA 1H4PA 5D2XA 1EEPA 2ALDA 2YOCA 2DT1A 3NIYA 4B9YA 1FHUA 1Z6KA 3L2IA 1AMKA 4A6GA 4Y9NA 3TMLA 4YU1A 4JDYA 1SR0A 5C9XA 3WD2A 5LA1A 4L1XA 3S1GA 5CH9A 5TQLA 4KEVA 3SN4A 3HQ1A 4R34A 5A6BA 2GL5A 4IX2A 2QLYA 3CZGA 4V1XA 5C9UA 3UJFA 2IQ0A 2FFIA 3APGA 1OB0A 4S38A 2PDLA 3HURA 1A80A 2YYUA 2Q09A 1HF6A 3J7HA 1FWWA 2X05A 3FA5A 3C3UA 3UWYA 1YKWA 2O4QA 1HP4A 2E6AA 1N2VA 3CL7A 4AWUA 4L65A 1U30A 1TJ2A 3R11A 3BO9A 3IJ8A 3HPZA 1J01A 2OWXA 2WM1A 4US6A 1LG2A 5I24A 3OODA 3O8AA 2OSYA 2HK1A 4F48A 3BGAA 4B5SA 3CYJA 4ORIA 1WDDA 3ARVA 4H19A 3MUCA 3VMPA 1E5NA 2J62A 2Q3RA 3ZOAA 1BTCA 4FEZA 3SQMA 3N34A 4JIHA 5ABFA 1CGVA 5CAHA 4UR8A 2BLEA 3OBKA 1AQFA 1U33A 4HSNA 3Q67A 4AIEA 3HMCA 3CUZA 3LTPA 3DU0A 1EJ7L 4X0VA 1VIWA 1KKRA 4DB7A 4ZTXA 2PDIA 2Z2BA 4IPJA 1AK5A 4S3EA 1EL3A 4GIAA 3MI2A 1JCLA 3TSMA 3H12A 3GZ3A 2WMFA 3UR2A 1E1FA 5E9XA 3SCPA 3WLKX 3F2CA 1VRXA 2AQVA 5EPDA 3ANUA 1EGVA 1AFSA 1XCXA 1UQYA 4M81A 2ZTKA 5HR6A 3SB0A 5G2HA 1F9CA 1MMFA 4Y9AA 4OBRA 5M3WA 1U83A 4CEUC 4OHQA 4X2PA 4FHAA 3EWYA 1UZDA 3LYEA 3OIXA 4KMQA 4C6FA 1UUOA 3PBYA 2XGBA 2YGYA 4LH8A 1EP3A 1GG0A 3G1YA 4HZ6A 3S9YA 3NQCA 3GNRA 4KKXA 1CGTA 4G8TA 4CCDA 3BCFA 5AC8A 4DWSA 3T8LA 3BQ5A 1H7NA 4CLMA 3BQ6A 3O2LA 1NQKA 3VVGA 1IWBA 3KCLA 3QY8A 2ADAA 2XVNA 3TX9A 4XUYA 5C54A 1S2CA 3VE7A 4I3GA 4R88A 2EXOA 4B15A 3PBVA 4RPQA 4W7VA 1UJPA 1TPVA 1TV5A 1PIFA 3OVQA 5DXYA 3VNKA 3WO8A 1BRLA 2AKZA 1TUXA 1ADOA 1S38A 4KEUA 4NX0A 1FWHC 1RCQA 1DIEA 1LQ0A 5G2IA 1K9EA 2XSAA 4Q4PA 3PANA 3UESA 3UETA 4LVDA 3EPNA 4O1DA 1EPVA 3BUVA 4HU4A 1WAUA 1KFCA 3W25A 4C6CA 1Q2SA 3T7VA 2VEMA 4JHOA 1UG6A 4H8UA 3Q4DA 3VPLA 1EFZA 3VM5A 3W88A 1J6OA 1QPKA 2WM0A 4MWAD 1KR1A 4ERIA 2QV5A 3UJSA 3SW6A 1E6ZA 2JBMA 4IF2A 3GG8A 4N2YA 3BK0A 3MCNA 5KITA 3LS9A 1VC4A 3IK4A 3N14A 2ACRA 4H9VA 3WQVA 1W2VA 4NI3A 4S3KA 1XLJA 5CPSA 1B90A 3NQGA 1PE1A 3G1FA 2R1LA 2XH7A 2GYIA 2P5NA 1HGWA 2G3IA 3W4RA 2J8TA 2XSXA 3PBMA 3AUJA 2Y61A 4CNOA 4CQAA 1O60A 3H7RA 4IGSA 3KCOA 4ICCX 1W54A 4JL2A 1ZAIA 3W6YA 5D9MA 3QYSA 4FLSA 4UBPC 4R85A 1ZS2A 3TJIA 3ARUA 2VUYA 1Z48A 1VEMA 1AL7A 4GFSA 2VMFA 4LCQA 4F2UA 4AVFA 3NOEA 1EXPA 4M0XA 4BZYA 3MM7A 2JF7A 1EF2A 5FAJA 4UNLA 4ZZ9A 1BTMA 4G5DA 3IIPA 1UKQA 2P0OA 1R85A 1KRMA 3MHFA 2A4AA 4H9TA 4KESA 3UWVA 1LL7A 3BXWA 4B4FA 4RW3A 2YCIX 3VIKA 4DAIA 4V33A 3GUGA 4LYQA 2FHFA 4QCFA 3ZSSA 2PF8A 4LF2A 3G5EA 1PKLA 1KM1A 3VOJA 1PKMA 4CQBA 5BXSA 1O66A 2VX4A 1FXQA 4TUFA 4UQEA 1G4TA 4YJ5A 1MW2A 2FPVA 3TEVA 1T5AA 3BWWA 4G1KA 5AOUA 5BOOA 3QN3A 3NQBA 4JYFA 1HZYA 3STEA 1ISZA 1BAGA 1G1YA 3CNYA 2OQLA 4I5RA 2C71A 2V81A 4IQDA 4DBEA 3ANVA 4X2RA 4KWVA 2D20A 2YW4A 1A3XA 1T6MA 1W9XA 1HP5A 1EJTC 1JNDA 2QAPA 5CPTA 3RDKA 3RITA 3VIHA 1REQB 3RJXA 1TE6A 3EX2A 5HMSA 4J3SA 2Z1WA 1BXBA 3BMXA 3U48A 3AISA 3UVAA 1LUCB 1GQJA 2ISFA 3O16A 3RLUA 2BGNE 2O4MA 3FA3A 4AZ5A 2VT0A 3H2NA 3W84A 4GC3A 3B0MA 4WDUA 1E1CB 3QR0A 2CESA 3ITXA 4UTIA 3QGVA 4QIUA 3EA3A 1OGSA 3USZA 4IPNB 2IPWA 1LLOA 2I57A 3JR2A 4FIQA 5HXMA 4IMDA 5DCDA 3W82A 3EOUA 4LFYA 5E5CA 1HKVA 4O0KA 1XIHA 3AHTA 3GD6A 2ZBTA 2ASHA 2INEA 4PTMA 2TRSA 4Z2HA 2NWRA 4H6QA 1TTIA 1GVRA 5E0KA 1VBUA 4GO8A 3DFQA 4MYXA 3SZ8A 4JQ2A 3U6WA 3WK2A 3OZYA 1EKOA 5DLCA 4AAJA 2X0YA 4P7LA 3AMCA 7CGTA 3ITOA 3M64A 1OG6A 1QI4A 1XSKA 3OLDA 1GVYA 4U2ZA 2E1WA 4HPHA 2F61A 4AX7A 3GNNA 3Q37A 1GNXA 3DHUA 2BHZA 4Q7NA 4GA8A 4LAMA 5BZAA 1TPC1 3V18A 3WDQA 3VDHA 1HT6A 3CZEA 3VUSA 3WH9A 3VIFA 3E2VA 2TMDA 3ZS4A 3BZJA 3CU2A 4HJWA 1ITCA 4LUTB 3KHJA 1J18A 3VNYA 3UVIA 5EB8A 1K8CA 2VP8A 1BYCA 3VTRA 2P10A 4QISA 4IP4A 4TU1A 4HU8A 2AL1A 4TX6A 3SAZA 1TPWA 1EUNA 4GISA 3NO1A 3GC4A 2B31A 2HBVA 4GIRA 1F4HA 3WUGA 1DXIA 1BXNA 2GUBA 3MA8A 3OG3A 5CZJA 1JCNA 4GBDA 7XIMA 2VRKA 3P0XA 1G69A 4QEEA 3ZJKA 3VLZA 1L6GA 4MZ1A 4ZA0A 2EO7A 3REQB 1V79A 4JYEA 1YEYA 4NAFA 2GGGA 1ADSA 2JKEA 1ML1A 3ARSA 1UR9A 2B0MA 3OPSA 1ONWA 3HQNA 4X63A 4FI4A 3CT2A 2XFFA 3IJDA 4ZFMA 4BQ3A 3SURA 1XF0A 3WNKA 1M7XA 4M8UA 2J7HA 4KRTA 4A3HA 1NWRA 2X8RA 1KFBA 3W1MA 4M51A 3U7VA 1OZQA 3FHAA 2V2DA 3PJTA 5AC4A 3U2ZA 4UQBA 1IYXA 4WIWA 4ORMA 3W83A 5JIPA 3F2BA 1K6AA 2WMIB 4W4QA 5HNUA 2YL5A 3ALFA 9RUBA 1TJ0A 3ME3A 3PZTA 4OIFA 4AZ7A 5G2WA 4Q8OA 3B0PA 5JH1A 4PSPA 3STGA 2ZRZA 2HV5A 1YTKA 3DZ1A 1R2RA 6GEPA 1KO0A 8CGTA 1G6CA 2V9DA 3ES7A 4YTRA 1M68A 1LUCA 1FCQA 3Q94A 2E9MA 5DMMA 3B9OA 1EC8A 5I00A 1XKYA 3VKCA 4B5NA 3H6OA 1QR7A 3B4UA 3PVFA 4AQLA 3CV2A 1A5MC 2QCDA 2R14A 3H2CA 3QV6A 1WOAA 3NCOA 2WZIA 1CGUA 4Q8QA 1X1ZA 1NELA 1VYPX 1R3RA 4JTCA 3M5XA 4GI6A 4IJRA 3IARA 3S0CA 4GYFA 4HCDA 4GYJA 4DO7A 5I3GA 5CSYA 1K7FA 1R3WA 3GW0A 1UWUA 2JGYA 2W4XA 1R9ZA 2W62A 3FCPA 4UXDA 3M5YA 4PUJA 1AW5A 1ZPTA 1YDVA 3E38A 3VGDA 2DEPA 4NYUA 1GJUA 3OVPA 2FZBA 2V69A 1W8GA 3FX4A 2OZTA 5FJTA 1DWAM 4NZ4A 5LIWX 3VAVA 3E2SA 2OMAA 1MQQA 2G50A 4TTUA 3GFYA 4GRSA 4RZ6A 3SR7A 1A3WA 4C6EA 3ARWA 4R3UA 8TIMA 1W91A 5IRPA 3NAVA 3THCA 2PF0A 2E8ZA 1WXZA 4W8BA 1PDYA 1J12A 3MW7A 4NJKA 4AIBA 4HPJA 4B5TA 4Q7BA 4ZQMA 6REQB 2W67A 1XRFA 3RX4A 5DBTA 1E3ZA 3MV11 4U4MA 1XISA 1QW9A 4U5KA 3M5VA 3RM4A 4WKFA 5E6ZA 3I3DA 1L6FA 4QDWA 2GOKA 4GXWA 2W92A 3BDKA 1TIWA 2WQPA 4JTHA 1KCKA 3M0KA 2RDTA 1OEPA 2QDGA 2IW0A 3A47A 3BW4A 4C1NB 5C7VA 1Q8AA 4CVUA 1ZBKA 4C6KA 3WF3A 2RH9A 3V7PA 2YDAA 3EWZA 3MT1A 4BI5A 1W5MA 1WYIA 3UXDA 4JN8A 1TSIA 2FVLA 3W2UA 1WKYA 2GUUA 2HPIA 4U3AA 3GM8A 1W6TA 3P6LA 4C7DA 3GBEA 1H7OA 3EXSA 3TMQA 2IXUA 4BQ2A 5TNVA 3AYVA 1AL8A 1XBXA 2XVPA 1JPIA 1IT0A 3B8TA 1Q6RA 3KTCA 3BOXA 1LOLA 4GX9A 1XXXA 1MVYA 3QZ6A 2C13A 4EE9A 2PZ0A 1L2UA 4LQ1A 1E6PA 1W3LA 1I6NA 3THQA 4C6MA 1VBJA 3WBYA 4I7UA 2QCNA 3DGBA 1JPKA 1YE4A 4L1GA 4LALA 5A2BA 2WMJA 3EEZA 3LGGA 1HKWA 2NVDA 1VZWA 1VHCA 1F6YA 2QPUA 1VYRA 3RRXA 3WEOA 4Q4KA 4JTEA 3HG5A 2QVNA 1DHKA 4I9TA 3GH7A 3OOQA 3VIMA 3M1ZA 1XM3A 1R3VA 2KAUC 3K8LA 4DJEA 4Y96A 4KF1A 2EJ1A 2GFTA 3C6CA 3TQVA 2QT3A 2R8WA 2WVTA 3TC7A 1Q7QA 2OWCA 5A8MA 4TO8A 3PSWA 5LIKX 1OHLA 1H5YA 2ZUWA 2DSKA 3GKFA 3PZVA 3H4GA 3WLRA 3ONBA 3P62A 3TTYA 2PURA 2XG9A 1W5QA 2ZX6A 3O3RA 3A22A 1GOQA 3P82A 5HULA 3CXOA 2FDMA 3TWAA 1RLCL 3V75A 4IUOA 1IT7A 4UWMA 3STPA 2AQOA 3GC5A 1FWFC 1JPMA 4HCLA 1UA3A 1OBAA 3V5CA 2PD5A 1J0IA 3DFOA 3T44A 3NQAA 1VPXA 3A5FA 2HISA 1DKWA 3KOXA 2NQHA 3H7UA 1CXEA 5ABGA 1I4NA 2PE4A 1MUCA 2QGYA 1DIDA 1IXQA 2OLAA 5CGMA 4E4FA 1SJCA 1FP8A 4IIEA 3IJLA 3F4DA 1D9EA 4HKPA 2OJPA 4X9SA 4O1AA 5T9CE 4IJCA 2CEQA 3URBA 2VZTA 3M5ZA 3NZPA 1S46A 3N6QA 1UKOA 3EOLA 4DBUA 2UY3A 1IEXA 4XAPA 3G1XA 4IIBA 3FIGA 3S6OA 3SY5A 2KZHA 3VNMA 3A4WA 1UBPC 4PBFA 3LPPA 5JH2A 4QGCA 1CENA 1Q6EA 4AIUA 2E9LA 2VD8A 4PA8A 4RXGA 4D6CA 3BTNA 3W7QA 2PGRA 1UWTA 1B9BA 3E5PA 3C56A 2PU0A 2YLAA 1XIGA 1M9HA 3GE7A 1QMLA 4HK5A 3IEBA 2V68A 2OCZA 3B97A 3OB8A 2AAMA 3DFNA 3BW3A 2VKZG 3LXBA 3AMDA 2EGZA 4MWAA 3AIVA 4XZMX 3VXGA 3IAQA 1Q2RA 3REQA 1OGGA 3F2DA 1O68A 3IJ9A 4RKAA 4JKLA 1YDOA 1GG1A 2ISVA 3Q2DA 3TR9A 1H62A 4MB5A 4UFLA 3NEVA 4UTKA 1E4NA 3R94A 1WO2A 3RM9A 2JE8A 3B9DA 4MDPA 4FOJA 3I6EA 1CGXA 1Q3NA 3E74A 2WAGA 1SFLA 1E0TA 1D3GA 2A5HA 3R8RA 4W9TA 1RCXB 3E2QA 3MHUA 2XIOA 1KNWA 4WOZA 2BXZA 1ISWA 4TTGA 2XPKA 4LCSA 1PYMA 1QW8A 2VURA 4Y7EA 3G6LA 3LHUA 1S2VA 2VENA 5D04C 4S3CA 2VJXA 4KIEA 1X6LA 3E0IA 4PRRA 3UT0A 3QBUA 3HGRA 1NOFA 1KQZA 3S9IA 4PUDA 1YPFA 2XFYA 5EMLA 1XLIA 1ONRA 3CUFA 3MMUA 3RPDA 2H90A 5CBBA 3LRMA 4UNIA 3WLQA 3P0WA 5HAOA 4MM1A 4O15A 3LXCA 5AHLA 1XBYA 3UZWA 3W1PA 1A5LC 2GLKA 3IGHX 2YCLA 4AZCB 4XZNX 4BI7A 3WBXA 5B7YA 4FMVA 4F0SA 4Z2JA 2CKSA 3UPBA 1NP2A 5I06A 3P7YA 4MJMA 3QYQA 3G1AA 1GOOA 5C2CA 4GFIA 5GNYA 1HVXA 3H26A 5TBOA 1JYWA 2OEKA 2X1UA 4ZENA 3WQ4A 4AVNA 2J7FA 5M1TA 1OC5A 2Z1KA 3T78A 3QM3A 3RCNA 1ITUA 4E3VA 2QV4A 5I3FA 3W53A 1XBZA 1H0IA 3MWCA 4NT0A 5FSEC 4OU1A 2QIWA 3UY7A 4R9OA 5DELA 4QDMA 4KRUA 2WJFA 3PTKA 4HU3A 3VM1A 1XRTA 1Y5XA 3K4DA 5D03A 1GPFA 4O28A 4LUIA 1X7IA 1GOWA 5HOSA 1FWJC 3HMJG 2V5JA 1POJA 4NZ1A 4HNUA 2E4TA 2A3AA 3GXNA 1CLKA 4ATDA 3BMWA 1ODZA 2VC9A 4LGXA 5HQMA 3QH2A 1X1NA 1YDNA 5A94A 4GK8A 5LNVA 1OYBA 5LYRA 4AISA 3MUY1 3V4BA 4MJ4A 4LRSA 4OGZA 3QR3A 4W8AA 2GWNA 1NTHA 3LTSA 2DGAA 1DJGA 1RVKA 3ZIZA 5KZMA 4NZCA 4YS1A 4LB4A 1LBMA 2PDPA 1BSLA 4MHBA 3VZXA 3EWUA 4MB4A 1BWLA 3KOFA 3SM0A 4ICNA 3S2NA 2RDUA 3EAUA 4HMDA 3GFXA 3SCWA 3N9KA 4Z1DA 4GY1A 4QBXA 1X97A 2PZNA 3QC3A 3QW4B 1FWIC 4JTFA 3APYA 3BZGA 1KTNA 4J2PA 3B8VA 3ZZ1A 4KCUA 3B8IA 2FZ8A 4UFMA 1TZ7A 2GQAA 2V3EA 4H6RA 1OY0A 1O95A 4DNHA 2PRLA 3WQFA 2WHLA 4HB7A 1NDVA 3QSTA 1T0OA 3PPCA 4JXCA 1XX1A 1XL9A 3QTGA 4CCCA 5CPNA 4DM2A 4O1EA 2QULA 2POTA 3VU2A 2WZHA 1JF6A 3VGGA 4Q4OA 3VC5A 1BVNP 3K1GA 1VLIA 3MU7A 4MPQA 2J9YA 1JDAA 1XG4A 3HBLA 4NRRA 3GB6A 1E15A 3H2FA 3TONA 3BVJA 1RJPA 2Y62A 2RJHA 1GW9A 3G3MA 4Q33A 5I23A 3P14A 3JU2A 2NVAA 1ICPA 1J0KA 3PB0A 3GRIA 3TA9A 4FX7A 1RK5A 1TV7A 1O12A 4E6MA 4D8ZA 4FIRA 4HA4A 1ALDA 5GJPA 2ZXQA 3GHSA 4PUKA 4J3VA 1F8IA 1ZP3A 4R9XA 5CGTA 4UFKA 2O55A 3K8MA 4NZFA 4L56A 4RPPA 3TP4A 4U28A 4Y9MA 1FRBA 1PKYA 2O7SA 3ARXA 4DNMA 1EGMA 2Q3OA 4WX2A 4S23A 2J77A 3QZEA 3WKZA 1EWEA 3GDLA 3FSUA 2B7PA 3SY8A 4HGXA 5DF0A 3G1HA 1TZ9A 3WL0A 3BV4A 5I0DA 1XINA 1R3YA 3WY1A 1SZNA 5H8PA 4K8EA 1NWTA 5K9CA 3VX0A 3PAJA 4QX4A 5EMUA 1PCKA 1ISYA 1UD6A 3VD5A 3I6TA 1C7TA 2VFDA 5J8LA 5DT7A 3DHPA 4W89A 3OO2A 2ZXAA 1VFUA 2V30A 4C5ZA 2ZRYA 2OLSA 4PUEA 1TPH1 3FYYA 3RPTA 5HPCA 4XSLA 2V67A 1EYWA 3ZJ7A 1H1NA 3WJZA 4LUSB 4Q4SA 3SCSA 2OKTA 1GUVA 1I2NA 4XG1A 4GY7A 2Z1VA 3E3HA 4AUBA 4AD5A 2FH8A 1LRNA 2I5GA 2E6YA 1L2QA 2V63A 2F6KA 3ITLA 4PCFA 2GDUA 2WHMA 3NFUA 1B3XA 2FFCA 4HHPA 1S2UA 1RVGA 2B7OA 1XBVA 4DELA 4F66A 3QXBA 2ZUVA 1CXHA 4XVEA 1ZB5A 1K02A 1NDWA 1F3XA 2DT3A 1VBRA 6ALDA 3FOKA 4HHMA 2A3HA 3FAXA 1OFAA 1QOXA 1NFBA 1QO2A 3AXXA 4PCNA 2G41A 4WKAA 2E6DA 3WMSA 1CIUA 2XVGA 1F5ZA 5A8QA 3TV8A 3TNOA 1PTAA 3EKZA 1R6WA 6TIMA 1F8MA 4XUGA 3KUMA 1VPYA 3QV8A 4FP1A 1DJXA 3KS6A 3CPRA 2XSJA 4M6VA 3W9ZA 2OGYA 4ZR8A 2DUAA 1CWYA 3W2LA 5T9BG 3PS7A 2WQDA 3ISIX 3KLLA 3SN1A 4YVXA 5EMKA 4GY0A 3WDIA 1GVQA 1CZ1A 4J2MA 1C9WA 4IL0A 2NXHA 1OX4A 1IGSA 1IR1A 1J5SA 4MMWA 4EXQA 4DEFA 2BOFX 4P7OA 3DBNA 3EOEA 1GCYA 4GCAA 3QPEA 2CW6A 2G3FA 4HSHA 1T99A 2ABBA 5B80A 6TAAA 3FHQA 3PUGA 1AVAA 2WWCA 5ABTA 2VGIA 3S46A 4JEQA 4FLQA 1XYCA 5F2IA 4P8XA 5A8GA 2D2HA 4KCVA 4AF0A 2DH3A 3MQTA 3WJXA 5KTLA 4GLEA 1M6JA 2ZVRA 1TTJA 1MI3A 1TX2A 1QVBA 3W26A 3FAWA 4LC8A 4MGGA 3B8UA 1KXVA 2FGZA 2O92A 3JRKA 1L6SA 5I3KA 1XRVA 4WEVX 3KL0A 3W28A 2E68A 4BQ5A 3CO4A 4XBJA 1UBSA 4D71A 4JPGA 4JEJA 3RLHA 4LVFA 2F9RA 3B0GA 1DJIA 3MO4A 1OCNA 3QY6A 3RILA 3VGHA 4GVIA 4JTIA 4M6PA 3ZM8A 4HPGA 3OEXA 2J74A 3MS8A 4L9XA 4MY9A 1ZJ8A 4JQ4A 2ONEA 2BY0A 4ZO9A 5CZTA 3IVUA 2HCVA 4XIMA 1XUUA 3MSRA 1TWSA 3HOJA 5C55A 1A5OC 1SW7A 2IPJA 5EKYA 4XO7A 2OOGA 8RUCA 2OWWA 1B9ZA 1OSEA 2FTPA 2OVLA 3NQ2A 2ZVIA 4ZB5A 3PUOA 5HMDA 3CLMA 5H8MA 4XD6A 3H2EA 3N04A 4QP0A 2O9RA 5HQEA 2E1DA 5BU9A 4J4KA 5CC3A 3OBEA 1PB0A 2G95A 4M56A 4A8LA 3GK0A 2Y5EA 3MDUA 2WSPA 2D2JA 2CNCA 4KFNA 4DY1A 3THDA 4N02A 1LL4A 4O0QA 4G39A 1J5TA 2A3CA 1ONXA 2DZTA 1OINA 4N7QA 4QLKA 1JFXA 2CLIA 1JPHA 3VNJA 2PP0A 2VC7A 3T2OA 4GQ0A 1FH8A 1S2AA 2ZRUA 2QCHA 4AU0A 4K8GA 5HJYA 4QNEA 3FN9A 3L5MA 3PULA 1U1UA 2W27A 5E70A 5C5YA 3WIJA 2WBKA 4JIIX 3LBOA 3G6MA 3LPFA 1MQPA 2R94A 4JX6A 1U5JA 1ZAJA 1XYLA 4MOZA 1I8JA 4QAWA 2TYSA 4Q8VA 2BTMA 3ZO9A 3UZ5A 4GIYA 2AGKA 1WDQA 2RDXA 4D8LA 3NA8A 4XKYB 5F4XA 3DHDA 4NJJA 1UR1A 3QR1A 3L0KA 2QDHA 4DJEC 3OGSA 3WLMA 2ZC1A 3V5OA 2J47A 4H8NA 4HMCA 3QHMA 4IOTA 3BSHA 5GEPA 1XLGA 1GGOA 5REQB 2YXGA 3SIMA 2XM1A 1HVQA 3PJWA 1DTNA 2X1TA 4ZXOA 3LQLA 1W1A1 2DY3A 1UQZA 1YNYA 3KDNA 1X6NA 3A6OA 2JEPA 3C4UA 1OIFA 3EZ4A 3GXDA 4O1FA 1FWSA 4EPEC 3TZFA 1UJQA 2ZADA 3CWOX 4GJ1A 1E4IA 4CN1A 3ZVIA 4OQVA 1AOPA 2NX3A 3ZJ8A 5K4ZA 1DL3A 5FAGA 2P8CA 3GTIA 4Q8TA 1V7YA 1K1DA 3UJEA 2E5DA 2AOPA 4JTUA 3GXIA 3OQ8A 5F1UA 4ZBCA 2ZUUA 3AYSA 3RNDA 3MSDA 1SO6A 3VKKA 3IGXA 2HE5A 4OZOA 4IG2B 4AEEA 3QQ0A 4A8NA 1OCBA 1MNSA 4GXMA 4UOJA 3W2NA 1H41A 4GUHA 1I0BA 4G9PA 4D9PA 4IX0A 4JFUA 4BEQA 1RUSA 2CU0A 3VCNA 4XSMA 1RP9A 4XO6A 3QSRA 5I3HA 1B3WA 1VR6A 3EB4A 3ARYA 5FEXA 1A49A 2QDDA 2XWDA 1TVPA 4TVCA 4WGHA 1VAHA 5LNWA 1YBQB 2QUUA 4YCOA 4FO4A 2DZPA 4GNVA 4B92A 2A3BA 2ZX5A 1SFSA 3MM6A 4H6KA 1TZZA 1MZRA 4JCLA 1XR2A 3NZGA 4J5NA 1DOSA 2AAAA 1KGUA 1E0XA 3CIXA 4BEUA 2DVUA 2GSJA 4HZMA 1C8XA 2BGSA 2CLFA 3RLVA 1AW2A 1F3EA 3NZRA 1SO5A 2C16A 5I79A 2JF6A 4AD0A 2ZWYA 3OLIA 1HKMA 1UPPA 3F5LA 2ZXDA 1LL6A 4CD5A 4LV4A 5HA7A 3DX5A 3R58A 1LJYA 4FNSA 2J9ZA 3AICA 1E6SM 2PWUA 2PLCA 1UH4A 1ODUA 2RGMA 4PMNA 4V28A 5AHIA 2PFHA 1XIEA 3GVVA 2XFWA 4QG8A 3RF9A 4I9AA 3SJNA 3B0UX 3UZXA 2IUZA 2V2HA 2Z6IA 2J78A 1GTEA 5A95A 3M43A 4BY3A 4ZE4A 4J3WA 5JU6A 4N9EA 3II1A 2XGZA 2Y63A 1W1B1 3MM9A 3COTA 3UPWA 3DI1A 4BK9A 1UD2A 4QG9A 5A6TC 4URIA 2E7FA 5AKQA 3CL6A 1ELSA 4BF7A 1GVFA 1CW2A 2VWSA 4F3HA 4E0CA 3TYCA 1N82A 1JDEA 3OHMB 5I07A 1RZMA 4D8AA 1KFLA 3RJYA 4PMUA 4PSRA 4X9YA 5CZKA 3USBA 3LN3A 4JTKA 4QCEA 2HDJA 2VZVA 1XLFA 2JFEX 4GVGA 3TU9A 3Q58A 3DYOA 3BLFA 2YA2A 5G1TA 2EPNA 4D6IA 3DEQA 2EKGA 3VGBA 4CD8A 3TSDA 4HTBA 1ECQA 3FXYA 1KGXA 4J9JA 3WQOA 3KTSA 1ZNNA 2DSWA 1W1ZA 3S2JA 4UOQA 3KHDA 3GY1A 4I90A 2Y0FA 4HNNA 4KCTA 3L21A 4TV6A 3W02A 1NIUA 3L23A 2PC4A 3H7VA 3LV6A 5HUPA 1WZKA 3LCLA 2CZVA 4XVDA 5HANA 5DCBA 4KERA 4Z2LA 4HCHA 4REQB 4PGLA 4Z1BA 3T81A 2POZA 2WMGA 3LGDA 4JR5A 4IZGA 3VO0A 3KP1A 2Q8XA 1UASA 3S5NA 2WPBA 4V2XA 1LT8A 4XKYA 3E2RA 3LRLA 4DYKA 4GI8A 5LIUX 1F7BA 1GYLA 2UBPC 2VOTA 1FWRA 1ME8A 4IFKB 3P3BA 1OYCA 4U10A 1ZL1A 5AOPA 4BA0A 2Z00A 4DWSB 1AH3A 1IIHA 5C8BB 3WMLA 3OR1A 1YRRA 1SMAA 4ML9A 2OTDA 3WDHA 2E25A 3H21A 3UNDA 2XIBA 4AOPA 5AHMA 1DYSA 1KV8A 4MKNA 3PN8A 1VH7A 2G3MA 3U7BA 4O4WA 4PB3A 3VNIA 2G96A 1RPXA 4D6EA 3G1VA 2EPMX 2PP1A 1JYVA 1F73A 4B16A 1PBGA 5MF5A 3ERPA 4RE2A 2EKCA 2JGQA 3EGJA 4NL1A 3MKKA 4O19A 4S2BA 3LZ5A 2ZZ4A 2PDUA 5FJOA 4CQCA 1IF2A 3TOPA 1N7KA 3YPIA 3MP4A 2XZ9A 2C7FA 2WYSA 3CASA 1ZLPA 3UEQA 1W32A 2YA1A 3EX6A 3OYZA 4JTGA 1SMDA 1HQTA 3CIWA 1MYRA 3MM5B 4QG6A 5DY2A 1E4LA 3CB8A 2Q02A 3U2CA 1BEUA 3OZPA 2VC5A 3UG4A 3N3MA 1Z69A 3JS3A 4U33A 5BROA 3UU0A 4B2DD 2WVUA 4YMZA 1MUWA 3P61A 5EFFA 4ERAA 4GO9A 2FJUB 2BMBA 2EBNA 4HYWA 2NUXA 2PDBA 3WD4A 1EGZA 3B8WA 3EB3A 1XYFA 2AQWA 2HXTA 2O9OA 2X7WA 3O7UA 2ZDRA 1QJWA 4A05A 4QJ1A 1LTDA 1W5PA 4AB4A 1RBLA 4Y90A 3KL5A 3BGGA 5AVHA 1LORA 2Y5JA 3WJYA 3M0JA 3SI9A 3UZYA 2A21A 3K4WA 5FJJA 2J7BA 3QPZA 3QW3A 2R1KA 4HJFA 2DSZA 2VR2A 4L6OA 3T40A 1Q6CA 1SZGA 1S1PA 4A29A 3CHDA 2F2HA 3MP5A 3SCOA 1G4PA 3SRFA 4ZQNA 4J3TA 3OVGA 3NO5A 1BRLB 2ZC8A 4RL3A 2Y88A 4PFMA 3N9SA 2OX1A 1XFCA 3EWBX 3MMWA 1LG1A 1JXKA 3LUTA 3PP7A 4ZXLA 1E0VA 2QCDB 3MVTA 4BJHA 4CN6A 3LA4A 4S39A 4H83A 4ML4A 1TMLA 3MM8A 1HJWA 5F4WA 4Q8NA 4B9ZA 2TODA 1H60A 5BMXA 3AS3A 1KBLA 2DFAA 4KT2A 3RRAA 1F07A 3R13A 2E9BA 3L65A 4QE5A 4UMAA 4C6JA 3L4YA 1Q6FA 4O53A 2XFRA 1JCTA 1IIGA 1Q45A 3IACA 3CPGA 4Y9PA 4GQBA 2IKIA 3V1HA 3TA6A 2EJAA 4E2VA 3W7NA 4Q6JA 3WLOA 4DJDD 3TTSA 4EP8C 4D2JA 1LCOA 4J35A 2VX7A 4G7EA 1PPIA 4D6HA 2WNNA 3N2BA 3M0VA 2VUNA 3PBWA 2J8FA 2QNEA 1LP6A 3CHCA 5A6MA 4ZB0A 4GEPA 1FOBA 1A4MA 4GZJA 1I2QA 2FDSA 3U8GA 3K1DA 2IMRA 3UGRA 4PRTA 3E1F1 4GQRA 9XIAA 4NYYA 1OYAA 3MUIA 3KX6A 2G97A 3AU6A 1TCDA 3WDJA 3QPYA 4QLLA 4WCJA 2PB1A 1TV8A 1LBFA 1VIZA 1RQEA 2ZUNA 5A1AA 3R6IA 2Z28A 3BANA 3SCRA 2WBGA 3T0CA 1IXNA 3GXMA 4QTGA 2O9TA 1RAKA 4LV9A 4V15A 3N4EA 3VOHA 4I8DA 3GNXA 4XZWA 2D69A 3WYZA 1E6RA 3FVMA 4LC6A 1O7AA 1EF3A 1KLYA 2PPGA 3BV7A 4UFIA 1JZ7A 4RXFA 1A5AA 5SWUA 1KFJA 4UFHA 4HA1A 1B57A 2PLMA 4QM1A 3EWCA 1XLBA 4ZQCA 4OOUA 3FY1A 3T8QA 2YCKX 4NIRA 3M0ZA 4WDWA 3EXTA 3V5FA 1TO3A 2WJDA 1QFEA 3W2JA 4DUWA 4DPQA 3LK6A 3O9NA 5GJMA 1FCUA 1R30A 1CX9A 1OFRA 1GQNA 1HG3A 4KWOA 2FVMA 2RUSA 3RMEA 2WCAA 5IFPA 4F0HA 1GONA 3ABOA 4JY8A 1KFEA 5BU6A 3I7RA 3W2KA 3V0UA 1P0EA 3CC1A 1MXDA 2WKGA 3W01A 1JCJA 3DG7A 2V5BA 2OZ3A 3GG0A 4IFOA 1YQ2A 5G4WA 4YWSA 1M53A 3NZ1A 4OE7A 4WXYA 1JZ4A 1YHTA 2VXNA 1ZU8A 1R86A 1GK8A 1ZZMA 1MZHA 4FB7A 3UXLA 1RR2A 3WD0A 3DXIA 2QUVA 4BI6A 4M1RA 5CCZA 2Y1HA 1PV8A 1XDMA 1YPXA 1NAL1 2H6RA 4L6DA 2PBGA 2C0AA 5D2TA 2PLKA 4G2DA 4AWSA 3E0VA 2W91A 4DWDA 3CUJA 1OD8A 3VA8A 1OFQA 2HRWA 2ISSA 2RAGA 1TRDA 1VJSA 3L4ZA 2VWTA 4CNTA 3BAIA 4O13A 1L6YA 1QNQA 3QGAC 3MPGA 3CO8A 4JCMA 2ZRXA 5D30A 4UTLA 3ITCA 3BAWA 1LRTA 3TJXA 1OC6A 3UGVA 4B5UA 4CCEA 1F2JA 2ZA3A 4NHVA 1P0DA 4NAEB 1X38A 3TCSA 4IQJA 2V4JA 1EIBA 3DI0A 2CC0A 3DESA 4MB1A 5HINA 5CG0A 4DZAA 3KWXA 4R53A 3TW6A 4E5TA 4DF0A 3UW6A 3U2EA 2PDHA 3VZZA 4KFOA 3MO7A 1BLIA 1XIMA 3NL6A 3K13A 1GZ1A 1DE5A 1CGYA 2X2GA 1KBIA 2VC6A 3OLEA 1RBAA 5LGXA 1SYTA 5C0QA 2HVNA 3ZR4A 3NL3A 4A8IA 3N73A 2FPTA 4QLJA 5FIPA 2NUYA 3PC0A 1DIKA 2BVDA 1C3FA 3BLEA 3AHVA 5D2VA 1V0NA 4ZO6A 3RYSA 3CTTA 4C60A 5AHFA 3UQNA 4MIMA 1VFOA 1PX8A 3ARQA 3C61A 3UF9A 1YNQA 2NVCA 4V1YA 3FVDA 3KVJA 3PNZA 3B05A 3TYAA 3H4WA 3NQEA 1PIIA 2PDQA 1WUFA 2YL8A 3H24A 3CS2A 4AHOA 2QMKA 5A2AA 3IAPA 4IJBA 4LY4A 3UXIA 5C70A 1NWUA 2QUMA 3RXZA 4IIFA 3TC3A 3WNLA 4JTDA 4MY1A 4MSSA 1BXCA 1NFPA 2QUNA 4TQTA 4BWLA 1MEIA 3RIKA 3FGCB 3C8NA 1DV7A 1Q66A 1BWKA 1V0MA 4PUNA 1XI3A 2CLKA 1XFBA 3FEQA 2C1IA 2EPHA 4W84A 3S9ZA 3GG1A 4EKJA 1R3TA 5T8GA 2WZMA 2ZCGA 1TMQA 2EHHA 1JGMA 3IV8A 4LBRA 1JVNA 5G1YA 2G5WA 7ENLA 1XG3A 1UB3A 3A12A 3GU1A 1VFMA 3MVIA 4D1JA 4MTVA 4FSAA 4M80A 5IBXA 2Y70A 3CQIA 2ZZ3A 2QCEA 4E3TA 1B2YA 2VR5A 3VIIA 3LNMA 3LERA 4K39A 5H6HA 1P0BA 2ZA2A 2CITA 4EWND 5K9XA 5CJMA 4DJDC 4DO5A 1B3OA 2DZSA 5D33A 2GJXB 5JQ9A 5HWMA 1M7PA 3INPA 3CEPA 3ATYA 3NPXA 1W5NA 1QPOA 1XQLA 3UP8A 1FBAA 3EX1A 1V3JA 1VFTA 3T2QA 3CV1A 2DV0A 4DXXA 2G0WA 2BVYA 4JTLA 3S2LA 1XJBA 3ICJA 3I4KA 1FFRA 1IE7C 1HJXA 3G1SA 3O63A 5JBEA 2ISWA 5F2MA 4F0LA 3GWQA 2IKHA 4RZ5A 1ISXA 1ITXA 4KWWA 2WLYA 4LXFA 4GNKB 3NDYA 4ECLA 1OADA 4C6DA 1RLDA 1XLCA 1WDPA 4DJDA 3SIZA 2WNWA 5A3HA 1Z44A 3LG3A 5IDIA 3CPUA 1C90A 3UA4A 2WZTA 4MDOA 3UJRA 3P84A 3W7OA 3BAJA 4M6UA 3EA2A 5KZ6A 2C91A 2ZZ2A 4HSOA 4C7FA 3G0SA 2V3DA 5BMWA 1QNRA 4Q8WA 1M41A 3UXKA 3HPFA 1FWGC 1VJZA 4JKMA 1C8YA 4PB4A 2VI0A 4NZ5A 3VM7A 1GOXA 1HJQA 1SVDA 4WGXA 4IG2A 4PEEA 3GXTA 1H3GA 4W88A 3VDBA 5AYIA 3N18A 4K36A 5DT5A 3CMGA 1UD8A 5EBUA 1DJYA 1ZCOA 4FF5A 3IVTA 4NQ1A 3R1ZA 3MMDA 5KINA 5D32A 3VE9A 1EJSC 1M5WA 1PTDA 4YTTA 5LA2A 3R25A 1UPMB 2L5HA 4HBKA 3QQWA 2JKPA 1MWOA 3KRZA 3UYCA 3MMAA 1TMHA 4RV3A 4D72A 3ZMRA 4GPNA 2VGGA 1W0MA 2HNHA 3D6NA 3K8KA 2Z27A 1O4UA 3O15A 3W7IA 3VOFA 2QJGA 1EJXC 4OUEA 1SZRA 4O18A 3OR1B 4FNRA 4XZIA 1N8FA 5FD0A 2V2CA 3KDOA 4IMFA 2Y7DA 1XIIA 3S2MA 3SQSA 1SPQA 6PTDA 1GVOA 4DWSD 1HUVA 2YYTA 1VB9A 1ZALA 2P50A 4NY2A 2LLEA 4JAWA 1LWHA 2DH2A 3IANA 1E55A 3ZLHA 5G1MA 2Q6ZA 1E6NA 3C0SA 3BJTA 3DHFA 3C5QA 4C6LA 3SRDA 4O16A 4UFJA 3MANA 3GDMA 4N9BA 5BW6A 2Q8LA 1E51A 1XQKA 4RZ4A 3HPAA 3NYDA 3QKEA 3GR7A 4ZOEA 4W7UA 3SCQA 4XD5A 4IICA 3STCA 2J6XA 1A5SA 3OGVA 2WNQA 2HROA 4GUGA 3NGFA 5CSRA 4PMRA 1H51A 2WC4A 2PWFA 1JD9A 2FMOA 4HT3A 4KH2A 3L68A 4OT7A 3WH7A 4H6EA 3AYRA 4AF0B 1CEOA 2NQ5A 3ZVHA 3RAOA 1JQXA 3GHUA 5LIXX 1QRQA 4BS0A 4WR3A 4JFTA 1K9FA 4HZ8A 3KVMA 1S5NA 3AXIA 1B3YA 2J79A 4NAFB 4GYPA 2V5LA 3IV3A 1WPCA 4C6QA 4LYPA 3UZZA 5DRCA 3GTFA 1NARA 5CLTA 3WF1A 3VDGA 1UWQA 3HF3A 2A6LA 1XV8A 4UCFA 1W9DM 2PRMA 1VFLA 1GYNA 2DORA 3O06A 5CZ0A 2WJEA 1R38A 4KGLA 4B91A 5LNSA 3LEPA 3O6CA 1FWNA 1XIJA 3G8RA 3L2LA 4Q4RA 2XH2A 3IK2A 4IM4A 1M01A 3NSNA 3C2RA 4BR1A 2X42A 4AZHA 3RCYA 4LS0A 1XD0A 1SR9A 1BF2A 2VRQA 3IVSA 3A5VA 3KCJA 2QCLA 3ZR6A 1B4EA 3OYXA 4M19A 3VKAA 3NZQA 3DERA 4Y8EA 4M24A 4F2BA 3H54A 4FZIA 3CTLA 1RY0A 3BAYA 2HVMA 3S1XA 2OB3A 4YHGA 2WWDA 3W1NA 2XISA 3CIVA 3ABRA 2XN0A 2HK0A 4M29A 2PC8A 2Q8ZA 2D24A 5A8PA 1TJ1A 3WLPA 2IQTA 1VQTA 3S3GA 4JN6A 1TCMA 1P7TB 3BARA 2W61A 3NDOA 5D9NA 1D3CA 4FNPA 1PS9A 1BD0A 2VFFA 4F79A 2FKPA 3W1QA 4DX3A 3OR2A 3KBWA 1HL2A 4MF4A 3MUZ1 3NR0A 3AXMA 1ZGDA 3WQWA 2X2YA 5I6SA 5HNNA 2BOEX 1CNVA 4ONVA 3WLNA 1YBQA 2FIQA 4JIEA 3FJLA 1V8EA 4ZQRA 5IXEA 2PWVA 4KETA 4LEQA 1FP9A 4EIVA 1UROA 1CT5A 4EVZA 1QDSA 3TOYA 3FNDA 3LMYA 4AWTA 2DDXA 1I9CB 3CH9A 3EWWA 2BFGA 1L0PA 3W1TA 3GAYA 1KCZA 2WCSA 4REQA 4HTRA 2R1PA 2FGLA 1XSIA 1MRQA 2PDCA 3AXKA 2QF8A 3VOIA 4ZOBA 4XTDA 1DWHM 3OA5A 1QI3A 5EMMA 5H91A 4HIBA 1S1RA 1EJVC 3G1DA 1CB7B 1WUEA 5AC7A 2V5CA 5DANA 2FZMA 4H9YA 4UQ9A 4O54A 3OZOA 3TW9A 5HBFA 1O5RA 4FF7A 4C91A 3ZSTA 1CCWB 2FJKA 1IEQA 4ZE5A 1SO4A 1YMYA 3URQA 2WXDM 1XPYA 1KM5A 3SSJA 4CU8A 4DQWA 3BG9A 3W07A 2EPLX 5LXEA 5LKYA 3TAKA 3NPVA 4HHLA 4ZB2A 5DMLA 5AN7A 1A50A 4LVBA 5DX7A 1VCFA 2NLYA 2PDJA 3HN3A 3HPXA 3B4YA 5I77A 4IMGA 1W1PA 3WQGA 3WBAA 1Z89A 4H2HA 1F74A 3ES8A 3P2VA 4G7FA 5CQ1A 4Q8UA 5FA5A 2Q71A 4X61A 2WW5A 3EA1A 4ZGYA 3C0QA 1WZLA 2VZSA 4DUXA 1OWQA 2BSLA 2NX1A 2XUCA 3LQGA 3PPHA 2DQXA 4AIOA 1KTBA 4HK6A 5FKYA 3DUGA 1RH9A 1HJUA 3PM6A 5CZSA 1LT7A 2Y7EA 1JAEA 2HS8A 1RXOB 2BWGA 4YIWA 4MG4A 2OSWA 1YW1A 5M17A 4JIPA 1UD3A 3AJXA 3M0IA 3TTQA 5C2GA 8XIMA 1UP3A 2OU4A 4MVAA 3PZMA 4F0MA 4Z1YA 1MDRA 2AGTA 1QNPA 1O6IA 3M6DA 1RCOB 1K4HA 4NXKA 4GZIA 3D47A 2A85A 4IXXA 4JNZA 4N6EA 2EEXA 2SFPA 4WD0A 3LM7A 1JAKA 1EA0A 5LXXA 1ZJBA 2BP1A 3W7RA 3KZSA 1K77A 4AC7C 1ZJHA 3ARPA 1Y5VA 1A5CA 1TQJA 4BWLC 3UNTA 2RHGA 4W5ZA 3LDVA 4RV8A 1F6PA 4QNWA 2ATMA 3NWRA 1JQVA 5EFDA 1BG4A 3VABA 4JX5A 5A6LA 2VEGA 5LZLA 4W5UA 2HVOA 2C19A 3OU8A 2BXYA 1C9DA 2Z2UA 1EQCA 1IZJA 3LGEA 2VNCA 4GKTA 2JALA 1DORA 5DCEA 4GUJA 2ICSA 1YADA 5C6MA 5DEZA 1O1ZA 3LCHA 4BCEA 3VD9A 3MZNA 1XPGA 3NQMA 2QHAA 1EBHA 5BNKA 2I56A 1T8QA 4R7OA 1D7FA 1WE5A 3VFLA 3TJLA 3W7DA 4ICMA 4NXSA 3NL5A 1R5YA 3CAVA 3EEGA 3R7MA 5B7ZA 2YLLA 3H23A 1W3NA 3P5YA 4FNUA 3B9NA 2ZE0A 4RNHA 2V3GA 4WSKA 4NSBA 2HQAA 1Z42A 4O12A 2P1FA 3OVRA 5AC5A 1JJKA 1K7EA 4ZSTA 2BY1A 3U0HA 2V5DA 1P1MA 1VEOA 1XS2A 3OLGA 1ENUA 2YBTA 3UBPC 4PMXA 3LBCA 3AIEA 1SJDA 4JFWA 4DI9A 2NXGA 4CVWA 3Q45A 3AI0A 4JGDA 4C1KA 2FPYA 3M4HA 4MWAB 4PCTA 1FQ0A 4ALDA 2FB2A 4H01A 4BF5A 1T8XA 4CD7A 1ZTVA 1EO7A 2OELA 3I65A 1UHVA 5EYWA 3P93A 1L9WA 3GVWA 2R9RA 3H55A 3BLOA 3NQVA 3N15A 1TPUA 1K3UA 3LNPA 4GCXA 3SCVA 3A4JA 2Z29A 3SN0A 3AIWA 1GHSA 2ZQ0A 4DHGA 3F5JA 3FXGA 1UIPA 3O0FA 4C6PA 2JQXA 3HFTA 1TWWA 2NSXA 2WNZA 2R24A 1E43A 2GOUA 1TA3A 2PWDA 2GJLA 3EOSA 3W71A 2WSYA 1V02A 4PTNA 3MYOA 3CL8A 1A5UA 3GU9A 1XLMA 3MSGA 4GGBA 2GVGA 2PI6A 3NQDA 4A2RA 1PSCA 3DC0A 3PHAA 4OV4A 4A22A 2X1SA 4GH1A 1DJZA 2D3LA 3GW3A 1YXCA 3FKRA 3TYEA 4ZMGA 3VFCA 4HA3A 4XISA 4GKLA 4AZIA 2C0HA 1EA9C 3DFPA 3M0LA 1EXBA 1AG1O 1DPMA 4DI8A 2Z6JA 4JQ1A 4RDVA 3BLPX 1UCWA 3HV8A 1FUYA 3STFA 2W5FA 1B5TA 1TUFA 3EDKA 3ZVHB 2A3EA 1V3MA 3S6TA 1SGJA 3QMSA 2E0PA 1DWFM 3S4TA 3TYUA 4RE3A 2QPSA 4IHCA 2X0SA 4O4VA 2BGQA 4AYSA 2D1ZA 1E1CA 2YJQA 5A5WA 2YDRA 1V4YA 2VO5A 4I7VA 1LLZA 1GQKA 3UR5A 1LYXA 3TQPA 3NURA 5KZEA 1ME7A 3D0CA 4K1GA 1WOBA 1NQ6A 4RNJA 4H8VA 3T6CA 1EBGA 5LNRA 3AROA 5C2XA 3TWBA 1L8NA 5FI8A 1YNPA 4YTQA 3UYIA 1SO3A 4E2DA 5ECVA 1UOKA 2A7PA 1IWPA 2X0HA 5HNTA 4IQEA 1TRIA 2DZUA 3MMTA 4A4AA 5GPRA 3P60A 3FJ4A 3GIPA 3MBFA 4B3ZA 1FH7A 1ZBCA 5CXPA 2OFJA 2Z0IA 2BHUA 3RFAA 1NOWA 5BOFA 3GNOA 3ATZA 2EAWA 4ZEPA 4W87A 1QI5A 4OFCA 4XB3A 2A7NA 1H11A 2WSQA 4AHPA 1OT1A 4B2DA 3HB9A 5I7GA 1JUEA 2VX5A 4HPNA 1MFVA 3WF2A 4F2TA 1LRQA 2OX4A 2RKXA 3TUUA 5M03A 1KTCA 5HMEA 2PBOA 3C86A 3GTXA 3ZT5A 1KV5A 1ADDA 4WZHA 8GEPA 1V02E 4QAIA 2MANA 1TV4A 3IGSA 1IEWA 1US2A 3WD3A 3A4AA 3SSZA 1QPNA 1NDYA 3CHFA 5KMYA 3ALGA 3ZWSA 4FOUA 2ON3A 4C90A 5FJPA 3KS5A 4M1BA 1RPKA 4ES4A 3V3WA 3CBWA 3LHWA 4RDZA 3HA1A 4H4IA 1AUSL 4HD5A 5C7HA 2GQ9A 4UZSA 3U4AA 1ZHAA 3PFMA 1XGDA 4Y9OA 1AH0A 2HBXA 3N2MA 1DXFA 1EO5A 1LOQA 1X6UA 3CQKA 1AJ2A 3ZFHA 4H7VA 4MJ2A 3W7LA 3GG7A 4JKKA 2BASA 2A7RA 4UCGA 3MCOA 3IUHA 5BWFA 3GHRA 1O5XA 3W23A 2ATSA 4M6QA 4I6KA 2OEMA 3SJ3A 3M0XA 1TPEA 4KWUA 3AALA 1WXYA 3JZEA 1MSSA 3OTRA 3FGCA 4A8RA 2H8ZA 1K7XA 3AAMA 4OOZA 3B9EA 2CHRA 2FQIA 4AXNA 4GE8A 5J5DA 5I2UA 3MV01 1DXEA 2A79A 1J93A 4GC4A 1Z41A 3E02A 2DSUA 2B81A 4E2OA 3MWAA 3N1AA 4LBUA 1J0HA 2ZUSA 1G7VA 2C1GA 3PAOA 1J0JA 3IUDA 4IFKA 4RX0A 3PZGA 1SW3A 4LOCA 2BOGX 1MEHA 3RPMA 3OZMA 3W7GA 3W7HA 1SSGA 4BF9A 2DZVA 3N4AA 3ABQA 1IGWA 4O1BA 6XIMA 1HN1A 2Y7FA 3KP0A 2J88A 7REQB 5XIMA 5AECA 1V5XA 3GVQA 1TREA 3EDFA 4GX8A 4IQLA 3TNBA 3DG3A 4J3ZA 4W93A 3DGRA 3IPWA 3NJ3A 1E9YB 3P5ZA 1BHGA 1QI2A 4NJGA 1IHIA 1Y0EA 1W3HA 1FFQA 4GNJA 2V3FA 1MUMA 3GO2A 4R27A 3LRKA 2J7GA 3T1GA 4ZQOA 3QEZA 2HWGA 1ZRQA 4KEMA 2TPSA 1KBJA 3N12A 1UP0A 1HW6A 2XVKA 4DYJA 1XD1A 3PF3A 1TWIA 1TG7A 4K7VA 2DUZA 3CAQA 3HO8A 1IQ8A 1S2WA 2VGFA 1P7TA 2VEFA 2X41A 2AMGA 3WK0A 2Z1SA 1BYAA 3VIJA 2H3DA 3RMJA 3TFCA 2WCGA 5CEWA 3VLYA 3MUXA 5XIAA 4LUSA 2BB0A 3BE7A 2C14A 3WX7A 1EP2A 3BOLA 3OG2A 3U2OA 4TVDA 5EMJA 4MWAC 4WSHA 2PGEA 3N6JA 1PX3A 3MM7B 5LIYX 1UR0A 3EMCA 1C8QA 3B3DA 1GVEA 3WUFA 4PYSA 3MBDA 2E09A 5GNXA 1OF8A 5D02A 2QXWA 4O10A 3RG6A 2JKAA 2D23A 3KBNA 2Y7GA 4Z17A 1JDCA 3WD1A 1YE6A 5I3DA 3PUDA 1V3HA 3NDZA 4XV0A 3V0SA 1DWJM 1JR1A 4JS3A 3CMJA 3BURA 3ITTA 1XYZA 3VGEA 1I45A 4ROPA 1SZFA 2XWEA 1WV2A 2XH0A 4LRTA 2D0FA 1ICQA 4LVGA 4R5EA 2CLHA 1VKFA 3EWXA 1P1XA 3OP2A 3LM3A 1H63A 1K4GA 1EWDA 3L4UA 1EYEA 3GU2A 1W9BM 1RV8A 4GZ7A 4PMJA 3NVTA 1MW3A 2TAAA 1HO4A 3GXFA 3F1QA 1JCXA 4GMEA 1RSCA 3UERA 4D1IA 1QNSA 3ZJ6A 1UD4A 3QZAA 3C2OA 5DMYA 3W37A 3EDDA 2I9UA 4F40A 2CZDA 1HNYA 4TMBA 4FALA 1F3WA 3T2PA 1R47A 3JZUA 3THAA 5BWAA 4PC8A 3W81A 2OXNA 4WQ6A 1WXJA 1JUBA 1JZ6A 1ZBWA 3P8JA 2WMIA 1RD6A 2ZWZA 3DN5A 2QDEA 4FNQA 1RHCA 5HUOA 4JTTA 1AD4A 5H2ZA 3CV6A 4JX4A 3EMQA 3IJ6A 5G4HC 5DRIA 2CETA 2YZ5A 2CHOA 1DE6A 4H7ZA 1KBKA 4RLIA 1GJWA 3SBFA 4UTHA 3MCMA 1FTXA 3B0NA 4O50A 5F1VA 4I8YA 4HVXA 3S1VA 1WZAA 4O11A 2V6AA 4GUFA 2J8GA 1S2TA 3O0KA 4QR6A 1LDCA 1B0IA 2Y2WA 2R1NA 1OCJA 3A3XA 1E9ZB 1QW7A 1NEYA 2INZA 1OK6A 1LOSA 1S5WA 1UR2A 3LCIA 4CD4A 4Q8MA 1OC7A 2BVWA 3L2MA 4YL2A 5REQA 4NP7A 2DSVA 3LY0A 4O0ZA 5FJUA 1GKRA 3ZLFA 3SUTA 2WOQA 1O94A 1W5OA 3CUHA 5CJ5A 1VHNA 3PPFA 5DXXA 4N9DA 1Q63A 5IM51 4JTAA 3BLDA 1UKTA 3HU7A 3KBJA 1XLLA 4K37A 3A4XA 1IZCA 4CD6A 3PNUA 3DKLA 2OGJA 4HK7A 1PEZA 1U22A 1AQHA 4U3CA 5CKSA 1R9XA 4L4PA 2CFFA 1I2PA 2QCGA 3GIYA 4DZIA 4PMYA 4V27A 4JFSA 2VM8A 1SJBA 4CGTA 1NP0A 4CQ8A 1FDJA 1V6UA 3AUOA 4Z1AA 3A23A 1XKJA 1MFUA 2C15A 2BVTA 2OR2A 3NSMA 3B06A 3HV9A 1NVMA 4NKCA 3WCZA 5LHFA 1X8FA 3N2TA 4CNUA 3BG3A 3V16A 8XIAA 5CSUA 1VS1A 3MTWA 4M82A 4LAUA 2FZNA 3LENA 3W1UA 2VRJA 3KOYA 1US3A 4G1NA 1GZGA 1S5TA 4LEFA 3U4FA 1KQYA 5K4XA 4AW7A 4PCPA 4GYKA 3W6MA 2PGWA 3KOWA 4LVAA 4AFYA 3SECA 4F4RA 4RNIA 4MADA 2A1YA 4OECA 2MNRA 4N6FA 3NPUA 1WKFA 1H50A 3L0GA 4XD4A 3QKZA 4NF7A 4HP5A 4KCWA 4H1ZA 2IXVA 3MSYA 1Q7ZA 1KWKA 3PTDA 3W2MA 4PCSA 3U3HA 2OO0A 1JI2A 2VDIA 1F6KA 2E5CA 4DN1A 5A8NA 1AZ1A 5FF3A 3QHOA 4DBSA 3AOPA 3LX9A 5JUVA 3AIQA 1GTHA 2UY2A 3RX2A 4DUVA 1ECEA 4U2YA 1ESWA 2HZGA 3QGKC 1J0YA 7REQA 4ZO8A 1XCWA 5KSWA 1SW0A 1BGGA 1K70A 3FKKA 5D9PA 5D2WA 4GBUA 2BY3A 5FF0A 4RDYA 1WBHA 1MQRA 1UUMA 1S39A 5CPOA 5BCAA 4J27A 4P7NA 3GYEA 2GVJA 1D8WA 4NAEA 3E49A 1KD0A 3IRSA 5E0CA 4HZ7A 1E1EA 1KFKA 2E8YA 4XTIA 1NF0A 4Y2WA 1P0KA 3A3WA 2B7QA 4FOKA 1UKSA 5A6KA 3OR2B 4OWGA 3W22A 1KW1A 3GHTA 1H7PA 2XU2A 4RR4A 2BX7A 2YFNA 1KRCC 5I3IA 3AFBA 4HYVA 3WNOA 3S42A 3W72A 2Y4SA 2CLPA 5CGQA 2E3ZA 1VCGA 1E9LA 1FXPA 1G4SA 4UTJA 3W87A 2YDSA 5CAKA 1TPDA 3QLDA 3UXAA 1FY6A 2CXGA 1VCVA 4KGJA 1P0NA 1VLWA 4QDPA 4ZCWA 1VPQA 3G1RA 3GTNA 3KLKA 1TR1A 2C18A 4DXKA 5PTDA 3SCNA 4DO6A 2Z7KA 5LGZA 3UZJA 1EJUC 4QQ3A 4UR7A 2VZUA 2C8NA 2OG9A 3QFWA 4HOWA 2BXVA 4AZ6A 3L12A 4HNCA 1JEZA 1XH1A 1PWLA 1YLVA 3LLXA 2I9EA 3ARZA 4NASA 3L4VA 3F4WA 5AZ0A 2XIJA 1XGEA 4CKQA 4LW7A 2NW0A 1GOKA 4L4LA 2H9AB 5JBDA 1PJ9A 4ADTA 2YZRA 1H7RA 5EGRA 3QMTA 4S3FA 1CPUA 3A9BA 5ABEA 3CZLA 4I5UA 4WDTA 2REQB 4PMDA 4ZVJA 3D46A 3EB2A 2E67A 2E40A 3VK5A 2DZWA 3P80A 3R2GA 3R4IA 3PFRA 1E3XA 3PBUA 3DAQA 2VHLA 4MKSA 5KETA 5FEPA 3RU6A 1EC7A 5C9ZA 1TIMA 4DM1A 4JTSA 2PTZA 5FF4A 1FWBC 2NWSA 3RO6A 2JEQA 2PSNA 4GYPC 2I5QA 4YCPA 3G0UA 3TR2A 1OX6A 2NV2A 3SUVA 1IZKA 2J25A 3KFTA 3M7SA 3G18A 1VD6A 1C7SA 2EG8A 3FJ6A 4AY1A 4JNYA 1XIFA 1WDSA 3ARRA 1UH2A 1F76A 2CBVA 1P6BA 4CEXC 1E70M 1R3SA 1V03A 1X98A 3H8AA 3IGUA 3QJAA 5CJNA 3BCJA 2ZA1A 4Q32A 3WK1A 3B0XA 2ACQA 3BSMA 3MI3A 2V0TA 3GQYA 4A3YA 3ITYA 3WN6A 4MFDA 1UWRA 4FXFA 2PDKA 4XZHA 5FOOA 3NQ7A 2YCLB 4AZCA 1H7WA 3WBEA 1U1JA 3VNDA 2VVNA 1XDLA 1XCFA 2VFHA 2CLMA 1XGZA 1RALA 2DT2A 2REQA 5LNUA 4KS0A 2XGIA 3B04A 3S5SA 3URNA 1KCXA 2O9PA 3LTYA 3S47A 4TOQA 4EPBC 2W3ZA 5E1QA 4F0KA 4FXSA 1PZ3A 2FMNA 2VCBA 1D3HA 1C8VA 1DQXA 1ISVA 1OJXA 1BQGA 3NTYA