4S3EA

Ispg in complex with inhibitor 7 (compound 1061)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 144
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3eA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3eA02
3OR1A 8GEPA 4HTRA 1AD1A 3H26A 3TYUA 4DB7A 2XSJA 3H22A 3H23A 4MWAD 4C1NA 2Y5SA 4MWAA 4DJED 3OR1B 7GEPA 1Q7QA 2AOPA 1AJZA 2XSJB 4DJDD 3MMAA 3MM8A 3B0NA 4C1NB 4DJDA 1F6YA 5JQ9A 4MWAB 2OGYA 1ZJ8A 3TYZA 4MWAC 2Y0FA 1TWSA 2DQWA 4DJEC 1Q8JA 3TYDA 3MM8B 2YCJA 3MM7A 3NOYA 3VKTA 2YCLB 3BOLA 3VKPA 3H2AA 4S3CA 3MCMA 4DAIA 1Q7ZA 3TYEA 3B0HA 3MM7B 2VEGA 4G39A 2YCKX 3MCOA 5AOPA 4S3AA 1Q7MA 2YCIX 2H9AA 6GEPA 1TX0A 3H2NA 3H2EA 4DJEA 2Y5JA 1TX2A 2BMBA 4NILA 2E7FA 1TWZA 4S38A 4GEPA 3VLZA 2H9AB 2YCLA 3H21A 3MM5A 4S3DA 3TYAA 1AD4A 4S3BA 3OR2B 3V5OA 1ZJ9A 4MWAE 4S3FA 3TZFA 2AKJA 3VM1A 4S3EA 3MMCB 2VEFA 3MM5B 3TZNA 3K13A 1Q8AA 3BOFA 3VKSA 3H2CA 4DAFA 3VLYA 4NL1A 3VKQA 4AOPA 3TYCA 3VM0A 3GEOA 4O1EA 3MM6A 3MMBB 4PZVA 3OR2A 4CCZA 3MMCA 3H2FA 5GEPA 4DJFD 3VLXA 4HB7A 3B0JA 4DJFA 4D9PA 3MM6B 4S39A 3H2OA 3B0LA 3VKRA 4S23A 4G38A 3AOPA 3H2MA 3MM9A 3B0GA 1AOPA 2DZAA 2GEPA 4DJFC 4O1FA 4D8AA 4NHVA 1EYEA 1AJ2A 3MMBA 3MM9B 3H24A 4NIRA 4D8ZA 3B0MA 4G9PA 2V4JA 3MCNA 3TR9A 1AJ0A 3MMAB 4O0QA 3TYBA 4DJDC 2V4JB 1TWWA 2VP8A 2DZBA 1Q85A
chains in the Genus database with same CATH superfamily
2GOKA 1NTHA 4J28A 4PH6A 2QIIA 4RZ4A 2E9MA 4X2PA 1V5XA 2PD5A 4ZZ9A 3MM8A 2Q8LA 3VFCA 1H7XA 3KBSA 3AS3A 5DCBA 1RQEA 4D6DA 1HJUA 2GL5A 4L61A 3V35A 1FXPA 3BMVA 3WLJA 1UP2A 2JQXA 3K8MA 2YL6A 1XBXA 2FVKA 2Z1WA 4ZR8A 1X98A 3DYOA 4AVNA 3HBLA 3ZJ6A 4QNWA 2BVWA 2DT3A 3SW6A 2VWSA 1ZY9A 2ZZ5A 5SWUA 1XLFA 2PGFA 2O7QA 4IFKB 1XIJA 2IW0A 4DBEA 4GABA 2FYMA 4CNPA 4UCFA 3B0LA 3FEMA 1F05A 2C6QA 2PDUA 1VBRA 1JL8A 1WO2A 4FEZA 1V02E 3VKCA 1JAEA 1BQGA 1AK5A 3VABA 3L65A 2V3FA 2VR5A 3UJ2A 1VD6A 1MZHA 4AY8A 1BF2A 2VCAA 1Y65A 4XUYA 3BLFA 3R58A 1IYXA 4LFYA 1UP0A 3PK7A 2J88A 3HQOA 4BI5A 1E5JA 3TW6A 1TV4A 4HN8A 2Z25A 5LA0A 3WKZA 3HFYA 3A9IA 3MWAA 4NZ3A 5LIYX 3W9ZA 3TJ4A 4XQ6A 4I8DA 1UROA 2QCCA 2OR2A 3A12A 3WNOA 1C7SA 1OB0A 1WA3A 1K03A 3W6MA 2I1OA 3ABZA 4KPLA 2X16A 2PZ0A 1W1PA 3STCA 2Y8VA 1EX1A 3WQ6A 5BWFA 5E70A 4J3UA 3QPEA 2P8BA 4G1NA 4ZE4A 4B90A 2J79A 1ZJBA 1ISWA 4KGLA 4AW7A 1QI3A 1UKTA 3LDVA 1VFUA 4MM1A 4RLIA 1IGWA 1AODA 1H1YA 3W7RA 5HR7A 1W9XA 3KCJA 2OYLA 3J7HA 1B3ZA 3CC1A 4MHBA 3ARQA 5IHRA 3RCNA 4I9JA 1S2TA 2YA1A 4JQ4A 1DTUA 1FH8A 4MDOA 2NWSA 3I3EA 3VD9A 1WOAA 4CQAA 1XSKA 1WUFA 3P60A 5TD4A 3W1PA 2EPOA 3HA1A 3U48A 1GZJA 3VX1A 4HHLA 1S2UA 3BW2A 3HV8A 2XIBA 2RDXA 4GIEA 2VCBA 3LV5A 1DXIA 1ALDA 5H8PA 3WLQA 3HO8A 1XINA 4G8TA 3B8WA 3LD5A 4RE0A 1IT7A 3URBA 1HJXA 1Q85A 3QVQA 1Q2SA 2ZDSA 3LQGA 2R1PA 3E2SA 2W4XA 4BA0A 2B4GA 3GVQA 3PNUA 4XAFA 1BKHA 5BXSA 2JKPA 4INFA 2ZUTA 3DHPA 1QXLA 3ZVHA 2Q02A 3LY0A 1T8QA 3PJUA 2OEJA 1XIMA 5CGMA 2C7FA 4UZSA 3WBWA 1TRDA 3DYPA 2VDHA 1KB3A 3N04A 1V51A 2WCAA 4HCLA 1GG0A 5ABFB 4ZCWA 4C6IA 3B03A 4U28A 1TWZA 3W2UA 1FP9A 2EPNA 1LL4A 3A4AA 5GJMA 2GVEA 2X7WA 3EA2A 4M80A 3ITVA 5EMLA 2NV2A 1XF0A 1Q3NA 2NV9A 1JZ3A 3RITA 3WENA 4ILSA 1PVNA 2Y7DA 1AA1B 3TXVA 4ZFCA 2DH2A 2Q71A 1BVNP 4DBWA 1F6PA 5CSYA 3B9NA 4OV4A 3EWXA 3MBFA 4MKNA 3C4UA 2VFEA 4D1JA 1OFPA 1JXKA 3GYCA 1YADA 3LG3A 4ICNA 2Z6IA 1RHCA 3TCEA 4DO7A 5A8QA 1SJDA 3D6NA 3K4WA 2YXOA 3L0NA 2E8ZA 1L6SA 3SRFA 3WQCA 2BHYA 3LCWA 4E8GA 1FA2A 3D5HA 3OLGA 3WUFA 3PP7A 1KTCA 2DW7A 3OB8A 4X60A 9XIMA 3OR1A 5CBIA 3TIMA 1QOPA 5E6YA 3A4JA 1D7KA 3LU2A 1I1XA 3C2RA 1BSIA 3TW9A 1UQYA 1C8XA 1JFXA 4IICA 4YTTA 3QRHA 4JDBA 2Y0FA 4LUTA 3KAOA 4JDYA 2TMDA 3V16A 3MJMA 2OG9A 3MJYA 1GZ1A 1S39A 1ZFJA 2AOSA 4L6DA 1VGAA 1IWAA 3GC4A 1XUZA 2RJHA 1PUDA 1EA0A 2OLAA 2QAFA 2VDGA 2BMBA 2YX0A 1XKYA 3KRZA 2VJXA 3TA9A 2HVMA 4B5TA 2OQYA 3OYZA 1HNYA 1XLGA 4K38A 2CU0A 3HN3A 4F0SA 3WL1A 1ZL1A 1UWUA 3O9NA 3PAOA 4O1CA 4BS0A 5KINA 1TMLA 1TVLA 1RJPA 3D0CA 3VNYA 4E0CA 3MMBB 3DC8A 1OT2A 2NV1A 1K4HA 1FHVA 2ZX9A 1NFBA 3LEPA 2PS2A 3VKRA 3WBEA 4F9JA 4MPKA 2Y62A 4DWSC 5H8MA 2E5CA 2DSZA 2NSXA 3EYPA 1HXJA 3P93A 2NXIA 3AIUA 1XYCA 4NJIA 4D8ZA 5I3IA 2QQ6A 1TPUA 4DNHA 4I7UA 1QPQA 2OCZA 3P6LA 3TP4A 4ACZB 3QHMA 4NNAA 3KBJA 4GIRA 2ZUMA 4DWSB 4B2DA 2VWTA 3LUTA 5IDZA 4PMZA 5I6SA 3B8UA 1R3WA 2J8FA 4DJED 3W7DA 4FLSA 3ALGA 4O1BA 2BOGX 2Y1HA 3WLPA 4B91A 4B5WA 2DUXA 4W87A 2O9OA 2GUYA 5TIMA 3ZR5A 3RM4A 2CZEA 1TQJA 1MEHA 1K1DA 1Q7MA 1V0MA 2FLIA 1XIBA 1R2TA 1B57A 2P3EA 5T91A 1AH3A 5IBXA 1CXLA 3C0JA 1ZJ9A 1PHQA 3LTPA 3MO7A 5HULA 1JDFA 2VEFA 2YB4A 3RR4A 2PGWA 3LNPA 3KZPA 4YTQA 4HD5A 4LJ3A 3CQJA 4IMEA 3G1HA 5A6MA 4M29A 2XVLA 2NT1A 3KEHA 4DZHA 5KSWA 2E5BA 4U5IA 4H8HA 1W17A 4QDWA 2A7NA 5A2BA 3LCXA 2WMFA 3VOJA 3NIYA 3MM9B 4UTWA 1XG4A 3TN6A 2P50A 3FA3A 2WBKA 2OLSA 3GC2A 4Q8OA 1VFFA 2Z0IA 2X1IA 3T0CA 4B4HA 2XSJA 3DERA 4P8VA 5FF2A 2HPIA 3HQNA 2O92A 4OOUA 1YRRA 3UD6A 3E6EA 5JUVA 2A3AA 4IIGA 4YYFA 4ORMA 3AXKA 1GG1A 1JYNA 4FSAA 3W38A 1MI3A 3WQ5A 2OZ8A 4FX7A 3T4WA 3T09A 2PWVA 2OO0A 5A6AA 3E12A 6REQB 4K39A 3WDIA 3PUDA 4DYEA 1CECA 5D33A 3W7LA 5JIPA 3SUSA 2QDDA 2WNZA 4GYPC 3MM5A 1J0HA 1LBMA 3S2NA 2HROA 2OOFA 1IIGA 1NOUA 1BYAA 1GHRA 1JAKA 3FVMA 5CC3A 1MUMA 3S9ZA 4W86A 1SGJA 3CZGA 4M7SA 4WY0A 2HJPA 8A3HA 1KLZA 4HK7A 1B90A 1X1NA 3AOPA 1BSLA 2ZFAA 3U7BA 1AOPA 2X41A 5MKGB 1NWUA 2QF7A 1CLKA 1UWTA 4AZCA 1QNQA 4BEQA 1YE4A 1EZWA 1GQLA 3RX4A 4M24A 3K5XA 3WELA 3SUTA 1X38A 3BO9A 4LH8A 3SIZA 4GYJA 4HU0A 1VZWA 2EG7A 3ABQA 3DUGA 3N2CA 2J8GA 3R25A 4UNLA 8CGTA 3LCHA 3OBEA 1V7AA 2QV4A 3K30A 4QNEA 4AG0A 3HJZA 2V9DA 4UTMA 2NQHA 1H1NA 2HNEA 5C9ZA 1VEMA 4NVTA 4Q7IA 4LGXA 2YXXA 2A6LA 2EXOA 1KBBA 2PWDA 3V3WA 2X1RA 4EXQA 4KIRA 1S5VA 1J0JA 2EF9A 1KM6A 3NDZA 2P53A 3ZT6A 1UOZA 2GDUA 2E6YA 2GJNA 1Q5MA 1YHTA 3ZSSA 4O11A 1JCLA 2FMOA 1XICA 1OD0A 3NZPA 1RD6A 1QT1A 2DGAA 1IZKA 4BF7A 3AUJA 4J40A 2EKGA 4KFNA 3TAKA 1WDDA 3MM6A 3EMCA 1ZB5A 2C79A 3B0UX 3PZOA 3O07A 1MO0A 1QVBA 2VDIA 4E4UA 1EJVC 5HAOA 3VAVA 3WQ8A 4AH7A 4ZQOA 1J5SA 3R0KA 3PZVA 4AIUA 1HQTA 2J6XA 2BLEA 3MZ2A 1UKSA 1V6VA 3QV9A 2GVGA 4W9TA 1AMKA 1XGEA 1BKSA 3MBDA 1BPLB 1BLIA 1DJYA 1F5ZA 2JIWA 3BCFA 4S1FA 1QNSA 1RXOB 2V3GA 2E4TA 2CKSA 4GZEA 4NXKA 3PUGA 4GZ7A 5GJPA 3GFYA 5BMWA 4QDMA 3NQMA 4WR3A 1XIGA 3UGRA 6ENLA 1IGSA 4HPGA 3F4DA 4L4LA 3HPZA 4UMCA 2WJZA 3EX4A 3C8NA 4LBRA 4QJ4B 2ALRA 4MADA 3E9AA 3CZKA 5G4EA 2JF6A 1B30A 4DF1A 4U10A 3HURA 4DI8A 1RCQA 3A22A 4HCHA 4XB3A 1OADA 2AKJA 4B5NA 3OIXA 5FKYA 4IWWA 3VNMA 3W7QA 1IEIA 3VDBA 3RJYA 4BZYA 3TR2A 3ATZA 4EPKA 1WDPA 4M7TA 5DBTA 2PDIA 3MMCA 4IXHA 2RFGA 2J7DA 2C13A 4TU1A 5E5CA 1U33A 2PDKA 3HG5A 1BVWA 3SZ8A 1GYLA 5ECUA 3HG3A 2CHRA 1KFLA 1R3SA 1U83A 2QHAA 2WNWA 3DHDA 5J04A 4CN6A 5DT7A 4H04A 1ONXA 4I7WA 2ICSA 3W1TA 3AMLA 5C9XA 3LSBA 3CUFA 1PAMA 4MNJA 2XFYA 3MI3A 3M9YA 4L64A 2MANA 3VOHA 2ZCGA 3MT1A 3GBEA 1Z42A 4JEQA 1SQ7A 3AMKA 3PNZA 1PKMA 1ZJ8A 2OGYA 1VRXA 3WQFA 4JN8A 3DC0A 4S2CA 2WHKA 3PZMA 1OQFA 2P88A 4AMCA 3KL5A 1NWTA 3IJIA 1H5YA 4C6BA 4UFIA 1TE1A 1VFSA 1FHUA 3W7EA 4H19A 3SFKA 3VKKA 3W1QA 5CLWA 1V02A 1W31A 2PLKA 1A53A 1NOFA 1DEDA 5FOOA 3LERA 3NA8A 3FS2A 4PSRA 3K8LA 2G3NA 1QU4A 3PWGA 3LHWA 5LNUA 2V67A 3ALFA 3RJXA 4QP0A 1G1YA 1IE7C 4AFYA 2WBGA 4TV6A 1ZTVA 1XRVA 3QV6A 1VH7A 4RR4A 2WJEA 5AC4A 3GB6A 5F2IA 4P7NA 3UWUA 1PX8A 2XSXA 3TTSA 2ZA3A 3MUCA 2QCNA 5M2FX 2KAUC 1NELA 2WCGA 1SU5A 4JPGA 4ERAA 3GG8A 1KKRA 1OFQA 1EC8A 3FSUA 3WD3A 3W01A 2OSXA 3AMDA 1OG6A 4LUSA 1D9EA 4PCNA 3ITLA 2XFFA 4PCTA 3BL3A 4GVFA 2ZX5A 4NJHA 2YZ5A 4K1WA 3UCQA 2DZSA 1OK4A 1W5MA 3VI2A 2H6RA 3M46A 4IJBA 3RU8X 2NZLA 2VEIA 3MU7A 3BGJA 3K46A 3JVAA 3R10A 3MMUA 3C0LA 1H7NA 4IQDA 1TUXA 4JCLA 1LOQA 4PUNA 1X6LA 4YU1A 3WX7A 1YDOA 1HJSA 3B0PA 1MNZA 3W00A 2HMCA 1OHLA 5CZTA 3DHUA 4JZ5A 4CU7A 1XM3A 4LAKA 3IVSA 4PSPA 1KFKA 3BMXA 4A3HA 1X39A 1XQKA 5M03A 4FB7A 1QHPA 3NUKA 4S3GA 1N8FA 3L4WA 5KEZA 4US5A 1K9TA 3DFQA 3O1NA 4QEHA 4IZGA 2JALA 3WF0A 3OVRA 1W3HA 2WQPA 4PMUA 4WY0F 1MW0A 5CQ1A 1JGIA 1KXHA 5IFPA 2FHBA 1HT6A 5FJUA 3C52A 2CZ5A 2GLKA 1JD9A 3ZWSA 1XLEA 3VCRA 1V3MA 1X8CA 1C9DA 1ITCA 1EOKA 2FPYA 3GKFA 1GGOA 1VB9A 2V68A 3ES7A 1XRSA 1EXPA 2GGIA 3WN6A 2Y85A 3QH2A 3MMAA 4L9ZA 3DIPA 4MWAB 4CQCA 4CD7A 1PX4A 4M0XA 1MXDA 1GTHA 2R1MA 2X0SA 4YVPA 4Z2JA 3EDJA 3C0SA 1PB0A 2FPVA 4KWOA 4KKXA 3SRHA 2C1HA 2EHHA 5KMYA 1QK0A 4H8UA 5I3HA 1GVOA 1BYDA 1SO6A 2D23A 4HGXA 1G6CA 1X97A 1SFSA 1L2QA 3KCOA 5CBBA 4UQEA 3ZJKA 2CLIA 3EXTA 4RE4A 3WFAA 3IS4A 4GACA 3U7VA 3SCTA 4CU6A 3UPBA 3VE7A 1M41A 2BNJA 4GH1A 3BLLA 1GKQA 1W8SA 3NSMA 4ZEPA 5BU9A 3CZEA 1F61A 4MNKA 3OGRA 4O1DA 3A9BA 1XJBA 5LHFA 4JHMA 3QY7A 4IP4A 4G38A 1RP9A 3AS0A 4B16A 1KQZA 3WQVA 2DZAA 4JTEA 4UIOA 1DWGM 1Z41A 5HNRA 1R46A 4Q8TA 4FNTA 2NLYA 3B0MA 3EOEA 1OJXA 3L23A 5DCDA 4D6GA 1XLKA 2G37A 1W9DM 2NXHA 4LNCA 1THFD 3W71A 1MQPA 2Z6JA 4P7QA 1AQMA 2VUNA 3IGSA 4AWSA 3GXIA 3UXIA 3G3MA 1TTQA 5CSSA 5DQPA 3T44A 3QN3A 3SN4A 4PTMA 3UWYA 1VBJA 4M6QA 2Q8ZA 4UTTC 4ROQA 5HWJA 1Z44A 3B40A 4LVDA 1QUMA 3MM8B 3NOYA 4Q8PA 4ZOBA 4X3ZA 5EA9A 2Z29A 4FO4A 1DV7A 2VO5A 4NG3A 3GSMA 1W5OA 2CWNA 2PC8A 5AC5A 2ON3A 2GDVA 4Y2WA 3HQ1A 5HK4A 2P5NA 2NQJA 2PSNA 2J66A 3TXZA 3WG6A 3R0UA 3W2LA 2VXNA 3E0LA 1R3VA 2ZYFA 2B81A 3UG5A 1JQXA 4C6JA 2ASHA 4N4PA 3GTIA 1QASA 3K1DA 5GNXA 2FB2A 1KWKA 3GKAA 3NQ8A 4PGLA 1KCXA 1KNWA 2BFGA 1KD0A 1IEWA 2NLIA 4RZ5A 4PR4A 3S47A 2G96A 1A5KC 1QHZA 1Y8BA 4JN7A 3THDA 4A3UA 1FFQA 3W7HA 5J5RA 2F7FA 4AUBA 3ENLA 2XN2A 5A5WA 3CPUA 2RGMA 3ABRA 4GNJA 3W23A 4REQA 3SURA 2QCHA 2Z1BA 4AWEA 3M4HA 3W2JA 4K8HA 3TYUA 3IJ6A 2PBGA 3UG8A 3GFXA 1FWFC 1V0LA 2HVOA 5I3GA 4XZNX 1C91A 1P1XA 4PEKA 3CZLA 3E49A 3VGDA 5I79A 2XTKA 4FR6A 4OFCA 4R3UA 3G0UA 1SW0A 3FAWA 3GTHA 1VP5A 3WUGA 3VO0A 2QMKA 1VPQA 1W1TA 4ICMA 3W85A 3VVGA 2G3JA 2ZZ4A 3QHOA 1W5PA 1HVQA 5D8ZA 4MFEA 3BQ6A 5BRBA 4Z08A 2QVNA 2WKJA 1ESWA 2R1LA 2VR4A 3H6OA 4H01A 1A80A 3E2VA 5CXPA 4GRSA 2GPTA 1XCXA 1TIWA 3T0AA 3BG3A 1RQHA 1PO9A 3LYEA 4D6IA 2VD8A 2INEA 3G8EA 1FVPA 4W4QA 3MTWA 1JDAA 3TSMA 2ZXDA 5EYWA 2IS7A 2DJLA 4HNCA 1VEPA 3SIMA 1YDNA 5M5DA 1HGYA 3I3DA 4S39A 1QNPA 3L2LA 4ZQPA 3PBMA 2CXEA 2A85A 2G50A 1BD0A 3IK2A 2LLEA 4HPJA 4UOJA 1SFJA 2OELA 3LPPA 3GM8A 1XS2A 3AYRA 3FEQA 3AO0A 3G1YA 1WOBA 4K68A 2XDFA 4Q8WA 1AQHA 3KLKA 2PP3A 4WXYA 2GJPA 4O13A 3GU2A 3MUAA 1YDVA 2VEPA 5HNUA 3W28A 1K02A 3MVIA 4POCA 1Q6CA 3URAA 2DV0A 3T1GA 4EPEC 1KLYA 1XYMA 3AISA 3EX3A 4FMVA 3RMJA 4D6EA 2HDJA 1TO3A 3DN5A 1VFHA 3W2NA 4JIIX 3KVMA 1H60A 3C3UA 3N73A 2J24A 3AALA 3L21A 1KM4A 3N13A 3VNKA 3VKPA 1OEPA 3PZGA 1SYTA 3ZVHB 2CKRA 3UFYA 4GH3A 1FWSA 1RV8A 3NL5A 3WMBA 5BZAA 2CBVA 2BY3A 1Y7VA 4XIMA 2HCVA 4IPPA 2DVTA 2I56A 4IIEA 3TFCA 3O8AA 1D3GA 4JKMA 4PTXA 3UZ5A 1IZJA 5BRQA 3ITXA 2B7NA 3TK7A 2P0IA 3CM4A 1UWSA 4EANA 3OLDA 3I68A 1F8IA 2PLJA 1OCBA 1EHAA 3IRDA 4ADUA 3TTEA 3LS9A 4AZIA 4Z1CA 1VR6A 4EIVA 1KM2A 4IIFA 4JICA 5D09A 4BI7A 4WKHA 4CNTA 2IPJA 3MP5A 1KXQA 3PY2A 3R8GA 4JIHA 1KM1A 5TF0A 4HOWA 3PZQA 3BLOA 1GHSA 4Q4RA 3GBDA 1ECQA 1XD0A 1DIKA 3RDKA 4XO7A 2R1KA 1PKLA 3GAKA 3OQ8A 3RO6A 3HPFA 3OOQA 4C7GA 1PYMA 2BTMA 3MSGA 4TO8A 4RNFA 3OR1B 1W5QA 1QOXA 3S83A 2WZEA 4ATWA 2WVVB 4G6CA 4H8VA 3L2MA 2VVSA 1SZEA 4PBFA 3F4CA 4B3LA 4LUTB 1NARA 5HQLA 4RDYA 3TEVA 1RCOB 1WYIA 4C6MA 2ZTJA 3QTPA 3WDQA 4NILA 1GT8A 1UOKA 3VE9A 4GE8A 1ZCOA 4AD3A 1XSJA 3V5OA 2FZMA 2WXDM 3TZFA 3GDMA 4IP7A 2WJFA 1US0A 3GHSA 5JBEA 1S3TC 1LZOA 4IJRA 1W1IE 1SFTA 2HSAA 4M82A 3OR2A 3NO1A 1JGMA 3IGXA 2CCRA 1R3TA 3R1ZA 2C91A 5EB8A 1ICSA 1JPKA 5E0CA 3GVGA 1NEYA 4KW2A 1ME7A 3HGSA 4GIYA 3WMCA 1WXZA 1A5BA 1GZGA 4G9PA 2YL5A 1FKXA 3FCPA 4QLLA 2ATMA 3C6CA 1XBZA 3AIRA 3P74A 5D9PA 3BPWA 3GNPA 1UQZA 3WF1A 7A3HA 4ZVJA 1RLCL 1W91A 1W37A 4BQ3A 1VJZA 3VGGA 3MKVA 1LQ0A 1ADSA 3W25A 2A7RA 1Q8JA 3RX2A 3MC5A 5AN7A 3M0LA 3L0GA 1XIDA 4F79A 2KZHA 3W75A 4WSKA 3ZLHA 2P10A 1R3YA 2FFCA 4TR9A 1H4PA 5AOPA 3NQCA 1TJRA 4N0RA 4WVXA 1XFCA 2Y5JA 3AYVA 4PULA 4RW3A 1N55A 2WKGA 2BZNA 2G3FA 2G41A 3UYIA 3G1DA 3UWZA 3Q37A 1LDCA 1FH7A 1C90A 1UR4A 3BOFA 3VM7A 1EHNA 4LYRA 3WNKA 3JZEA 2D0GA 1V4YA 2E3ZA 5FJPA 2ATSA 3FAXA 2O55A 1EJ7L 2WNNA 3S6DA 3WQOA 1LUCA 4BWLA 1YPXA 1EP3A 3G6LA 1N82A 4JY8A 2GVYA 1XLMA 4PUEA 2CLHA 4U33A 1Q63A 3IK4A 1XRTA 3HZ3A 2YA0A 2VEKA 2J8TA 3BGGA 2WMGA 4RNJA 1JCTA 5FJIA 2EPMX 1UBPC 4FS9A 3VFLA 2FFIA 4Y9MA 2XSJB 3R12A 4F9DA 1XLDA 2BWGA 3QY6A 2D73A 1I45A 3JS3A 5C6MA 1DVJA 3HOJA 3UR7A 3N3TA 4LBUA 4QS5A 3VIGA 3F5JA 3WJZA 4LRTA 1M9HA 3N4FA 5HMFA 6GEPA 4Q32A 3KL0A 2OO6A 3Q58A 4IMAA 1Q2RA 1F6KA 4MY9A 1TMHA 4XK2A 2J6VA 3N19B 3BAIA 4IGNA 4XX6A 3KOFA 4AZ5A 1Q6LA 3TMQA 1FUYA 3MM5B 2JF7A 2DPEA 1NH6A 1U1HA 2OT0A 4GI4A 3WZ0E 2DUAA 2HE8A 2HE5A 2XIOA 4DJFD 3SCPA 4JKKA 4IQEA 1G7VA 3IV3A 3B0YA 4WY0B 1LBLA 1DHKA 2Y88A 4I3GA 3T0DA 3F4VA 3RO8A 1FY6A 1TKKA 3WUEA 1CGUA 4HMNA 4IPLA 3UVIA 4PCPA 4H2CA 4AZCB 3EWWA 3WLOA 1N8IA 4DWSD 2NUWA 1B9BA 3VOFA 1KKOA 3M6DA 4LNYA 4F8XA 3AQUA 2WWCA 3NM3A 2ZZ7A 3IVTA 3UA3A 4O10A 3TOYA 4ZA0A 4GC4A 1NU5A 3FVDA 3BANA 4ATDA 5CC6A 5DLCA 3M6YA 4CUCA 5BYWA 4OTKA 1FWRA 2J4GA 4K7VA 3WH8A 3B0NA 4L9YA 1FXQA 3S1UA 4H9UA 3V0UA 2FZDA 3D3AA 4G7EA 2A3LA 4LF1A 1KR0A 3DFSA 4E8DA 1QK2A 1XIEA 3N2XA 2GQ8A 2VRKA 1XP3A 4NASA 4WSJA 4F0MA 3MCMA 1HO4A 3W07A 2X1UA 4GWEA 1G4TA 2X7VA 5JXQA 1W2VA 4MKSA 3DECA 2AGTA 4DJEA 2WMKA 2WPBA 1J6PA 3S8HA 4DVOA 2P3ZA 1AL7A 4E6MA 4TVDA 3L4YA 2Y8KA 2YFOA 3WMLA 5G5IA 2ZIDA 4NZ4A 4W84A 2YCEA 1Q8AA 2ISWA 1IZCA 5I02A 4GQGA 4I9TA 5C7HA 2E0PA 5HBFA 3IAPA 4QG9A 2Q8XA 2VT0A 3MM6B 3LZ3A 2QAPA 4L4MA 2WOQA 4PBGA 1BVZA 1TJPA 3QFWA 3D3FA 1F2JA 4NSBA 4MOZA 5A8NA 1K6WA 3DFTA 2E6DA 3K4AA 3UZXA 1ITXA 4UMAA 4GGBA 2ZOXA 1FCQA 4N9BA 3W4RA 3RRAA 3VU2A 2RUSA 3GDLA 4PC8A 4AD0A 1M53A 5AYXA 5TAOA 3SCNA 1UWIA 2OXNA 1M3UA 4HA1A 1LRNA 2ZDRA 4IQJA 3NXLA 1JYXA 1UWQA 3MYOA 4PMOA 4GMEA 4NX5A 2E1WA 4WCJA 4A22A 2E77A 3GIQA 3CS2A 1CENA 3TH6A 3VILA 1B31A 3NZ1A 4WKAA 2X42A 4RUBA 3RCMA 1MEIA 4WEVX 4JIQA 1DJGA 5K7JA 1XBYA 5D9NA 1CI1A 1UZHA 1YE6A 5G2WA 1GOOA 1CGYA 1SSGA 5A8OA 5A6LA 1Q6EA 5FEXA 2PDQA 5HOSA 4NZFA 4PRWA 5F1UA 4OIFA 5JU6A 5LGZA 1P48A 2XINA 4XKYA 5MF5A 3NPWA 4FNQA 4NRSA 4J3SA 2A3EA 3EXSA 4CD6A 1B4KA 1GJWA 2B7OA 3N9SA 4LALA 4O16A 3GVVA 1B3WA 2NUYA 3SN1A 3FJNA 3RUBL 1K9EA 3W1RA 4AWTA 7TIMA 4LY4A 5KZ6A 1G4EA 3VNIA 1CEOA 1DIEA 4DUWA 5ECVA 1S38A 4FI4A 1VCGA 3GX9A 4GZIA 3BH4A 2PU0A 2P76A 5LA1A 3MCNA 1HJWA 4AHPA 1B3OA 2HK1A 3S9IA 1F7BA 4DUXA 3QGKC 4GVHA 1WKEA 1MDRA 3PSVA 3RN6A 2ZXQA 2D69A 1UD2A 1LOSA 2DZBA 1OCNA 1T7LA 4GKLA 4AXKA 4B3KA 1FDJA 5DBUA 3BTNA 3R8HA 1MXSA 1W1ZA 4EP8C 2RDTA 4UQDA 3RK8A 5A6KA 3G1FA 5CSRA 1QRQA 2J9ZA 4LEFA 3C2OA 1ZALA 1H09A 3TSDA 3N25A 3ZT7A 1XIIA 5FSEC 2XH7A 3AMCA 5HR6A 2WYSA 1HL2A 3IIZA 3VGBA 2XM2A 2WM0A 4WDUA 3W1MA 4QE1A 4G7FA 3UY7A 4FOKA 1MRAA 1H63A 1LLZA 1UYQA 4QCFA 4ZENA 5ABTA 4PMVA 4K8EA 2E09A 1EFZA 2YA2A 3EKGA 4UZUA 1V6XA 2WCSA 3W22A 2ZICA 1C8QA 2PDPA 3LHVA 4CNNA 2INFA 4IJCA 4QE4A 3U57A 4GGHA 3W7JA 5IFTA 4ROPA 4EF9A 4MIMA 2PCQA 2GJLA 3E74A 3AROA 4W8AA 4HYWA 2J7EA 4QQUA 3VLXA 1JF5A 3QQWA 1VFTA 1WBHA 3GHRA 3IJDA 3I7RA 2J78A 3QJAA 1GOIA 5CPSA 2QCEA 5F2GA 1XIFA 3WD4A 4FXSA 3STFA 4H9VA 1AW2A 3LCLA 4GHRA 3ONCA 4L6HA 2QDHA 4FX6M 1ZNNA 2CLEA 4DELA 8GEPA 2YFNA 1ZBWA 3C2VA 3R11A 1R7OA 4LUSB 1GQNA 3UR5A 2V5KA 1GVRA 4MG4A 3ZWTA 4QQ3A 1PE1A 3MO4A 4JGDA 1O95A 1ADDA 3APGA 4KCVA 3U2OA 2W27A 4R7OA 4LAUA 4UCGA 3SRDA 3DGRA 2PDLA 3R89A 2FZ9A 2B0MA 2OZ0A 1SZGA 1UH3A 2YCLA 1W3IA 2R91A 4KEVA 1IEVA 3ITGA 5BNKA 2Y2WA 3L4ZA 4WD0A 1REQA 1ODZA 2BVTA 3K13A 3TLQA 4L9XA 3VC6A 4HN4A 3R2GA 5EPDA 5HANA 3LI1A 4HQVA 1GOMA 1Z69A 4UQAA 2V38A 1VBGA 3W24A 4IT1A 2I16A 4Y9PA 1YX1A 3W7CA 2WMIA 4D9PA 5E0FA 2Z4GA 3W1LA 1FCBA 2J7HA 1GVSA 3FHQA 2Y7FA 3N17A 1FWIC 1W5NA 3PANA 2ZRVA 4X0NA 4HU3A 4ZO6A 4KWVA 2YKKA 4J7RA 4CNOA 4LPCA 2IKIA 1E3ZA 3EKLA 3UZWA 4GXMA 2ZUSA 4Q4PA 3UPWA 6TIMA 3VXGA 3QM3A 3FXGA 4DNMA 3UZYA 4JTJA 5G1YA 3V4BA 2NQ9A 1E0UA 1G94A 2QMJA 1J0IA 2TAAA 1EP2A 3S2JA 7GEPA 2PBOA 3OZYA 2XIIA 3UY8A 2PDNA 3U4FA 2DT1A 4DJDA 3CAWA 3KUMA 5A6BA 1TWSA 3FN9A 2VZSA 3T2OA 3CXOA 1LWJA 3IGHX 3RLHA 1TWIA 3PWAA 4CN4A 1OFRA 3SY1A 4GYPA 4HTYA 2BBFA 3FKRA 3AFBA 3C2EA 1PCWA 1VS1A 1IXNA 3AOFA 4MNMA 1SJAA 3UNDA 2OZTA 4H00A 5F4XA 3S6OA 4R7JA 5IXEA 3W7IA 4N6FA 3WSUA 1TPH1 3S2CA 3LHTA 1B5TA 3DG7A 3IWPA 1RBOB 1PKNA 5HNTA 2AAAA 1S5WA 2FTPA 4Y6GA 4HOXA 2CETA 4Q4OA 4JR5A 3WD0A 3EX6A 1J2WA 3KOYA 4MJ2A 1FCVA 1MFUA 5C5YA 1AQ0A 4A3QA 2GWNA 2A3HA 3QLDA 1KW1A 4GY1A 2ZE0A 6A3HA 4K2SA 2HBXA 3DFPA 3VD3A 4F0KA 2FTWA 1WXJA 2ZKMX 3LTYA 1SW7A 2Y6ZA 3W87A 5BMXA 2TYSA 2F6KA 4CCDA 2Y8UA 5BXTA 3VKBA 3AWNA 4XAYA 5XIMA 1RK5A 2PDGA 3GDKA 4DZAA 2QIWA 3BDKA 1BTCA 4O0ZA 4QG6A 1O1HA 4I90A 3TONA 1NFGA 1F6YA 3MKKA 1YNQA 4Z2KA 3EAUA 4ZOEA 1B9ZA 3OVQA 4MYAA 3P0XA 1XPGA 3GTNA 4LEQA 2QGYA 1CXIA 1H51A 3H7VA 3N4EA 1H7PA 4UC5A 2F6XA 3U9IA 4KCWA 1TE6A 4J1OA 3LBCA 2WB5A 1R2SA 4L4PA 5EBUA 3W7OA 4A35A 3R6IA 4JTGA 5CG0A 4ZO7A 4S3FA 3M0IA 5AC6A 3FYYA 2CEQA 1K7FA 4Q6JA 1L8PA 1I2OA 4WDXA 5CBJA 2NXGA 4LBSA 2EPHA 5EU9A 3XISA 2QUTA 1EBHA 2XZ7A 3WUBA 3CUXA 3DAQA 1D7FA 2D22A 3PBYA 1AVAA 2O4QA 3N9RA 4KT2A 1J0ZA 2W67A 1PTAA 1MDLA 3W27A 1ISVA 1QI5A 4ZMGA 3LM3A 3CHCA 3LXAA 3V7PA 4AAJA 5LIWX 2IQTA 3QZAA 4D71A 1K6AA 3ISIX 5LA2A 3ME3A 4GKTA 3ITTA 3E1F1 1F4AA 3UNTA 5ABEA 4J3ZA 2WZHA 3EDEA 4MWAD 3FY1A 3VUSA 2BOFX 4FZIA 1SZRA 2AQVA 4NZCA 3WEMA 5HATA 1M03A 1DORA 3ANYA 2QYGA 3THQA 1SFLA 3H8AA 4HNOA 4NNCA 4RDZA 4B3ZA 1WCGA 1KM0A 3EDKA 3GWQA 1LJYA 2IPWA 2YCJA 4YLWA 3VGEA 4CD8A 3KOWA 2CESA 4IUGA 3VIHA 2GYIA 1HTIA 1V03A 5DMMA 3N2TA 5LGXA 2BSLA 3H2NA 1JRCA 5A6TC 4MAVA 2H90A 5CAHA 1Q4NX 4WIWA 1LP6A 3UP8A 4S3EA 2WZIA 4BHYA 3ECQA 4IGMA 2Y61A 8XIMA 2PWHA 2WVTA 3T6CA 1AH0A 2PC4A 4P8WA 4W7VA 4Z1BA 3LMZA 2YYUA 1F9CA 2C1GA 2J9YA 2V5LA 3DBNA 2WVSA 4NP7A 3NTYA 1DOSA 2GDQA 2FGLA 4DXKA 4NYUA 3E2RA 4L1GA 4NYYA 1GONA 2VURA 5CC5A 2WLZA 1ITUA 3VINA 3TMLA 2PURA 5DFAA 4YCPA 3WNPA 4XAGA 1IV8A 3VDCA 4GXWA 3U3HA 4MPQA 4PL2A 2ZUVA 1JI2A 5T9BG 1O5QA 1E5NA 4F0LA 4PTVA 2DW6A 4WJEA 1WP6A 3W7KA 4OE7A 1TMQA 4GNVA 3THUA 4C1NA 4X9SA 3LTSA 2JBMA 4FX8A 1MXGA 1TA3A 1WKFA 3BARA 3MUY1 3AU6A 3WLIA 1TG7A 2E9BA 3P5ZA 4EKJA 1PTGA 4H6EA 4CQ8A 3CASA 2OEKA 1XISA 3WDRA 3AICA 3E2QA 3G6MA 2VQUA 4ML9A 3PPCA 3R8RA 1FWGC 3BLPX 1EGZA 4LVFA 4M3PA 3OGVA 1NDYA 1ZSXA 5AC7A 4Q7NA 5BXPA 3T42A 3F5KA 1E6XM 4I9MA 4MUPA 3BAKA 3KBVA 5PTDA 3ZR4A 5AHMA 2ZUWA 2CC0A 3OA5A 1ICQA 1TV5A 2BGQA 4X0VA 1K8CA 2W9MA 3VCNA 3GXDA 4MB1A 4ZBCA 3F2BA 3IACA 1IWBA 2QV5A 3WNLA 1E6NA 4WJXA 1JDDA 2RH9A 1J93A 3TCSA 5AYIA 4IIHA 1P43A 4IFRA 3REQA 3IIOA 3H2MA 4QHRA 3GDBA 3TN5A 1BRLA 3TLLA 3ARWA 4CD4A 2NWRA 3KLLA 3ARRA 4J2MA 4OUEA 4PFHA 2F9RA 4BF9A 4X2RA 3U0HA 3B9AA 2G97A 2ZUUA 5D02A 2VFFA 4GC3A 1JDEA 3CV1A 3N2OA 3PB0A 5FEWA 3LM7A 2J77A 2PODA 4AWUA 2YBTA 1XKJA 3AU2A 2GJXB 2IPGA 1AJZA 3WD1A 2YL8A 1E15A 4LS0A 3SSZA 2JKAA 1J4EA 3L66A 3OHMB 1XIHA 4BKNA 2HWGA 1AG1O 1VJSA 4P7RA 2GGJA 4JYDA 3MYPA 2X1SA 5I09A 1F74A 3KW3A 2E1DA 4YVXA 2VEGA 3MZNA 1SJBA 3UCCA 3M0MA 4H4IA 4UNIA 2YBUA 3EGJA 2CLLA 5D2VA 2DQXA 3MW7A 1VIWA 4IQLA 3S2MA 3MDUA 1JI1A 5D2TA 1JPDX 1VHNA 3WLSA 5ABHA 3GR7A 4O19A 3VDHA 4HK5A 4NXSA 3TYCA 4AHOA 2A3CA 5LYRA 1CBGA 3RM9A 1JZ5A 4PRTA 2GQ3A 1GVEA 2WO5A 1JCNA 4GYFA 1EJTC 3HGOA 5G1TA 3LLFA 1JPIA 2PTWA 1OX4A 2GGGA 1DIDA 2QS8A 2XIJA 3NNTA 1PCKA 1NQ6A 3NSNA 4GQQA 3VK5A 3AIVA 2ONEA 1QATA 2PP1A 1J5TA 3CHFA 1LCOA 1ONWA 1DE5A 4HHPA 3GVRA 3MA8A 1TVPA 4JTLA 4BCEA 3OA3A 3CIVA 4H9XA 4PCFA 2YPIA 3QKEA 3H22A 1UC4A 1I2PA 1HL9A 4BY3A 2Y89A 3RIKA 3WLNA 3LK6A 1NP0A 1B0IA 1SR0A 1G69A 3G1XA 4QJ3B 1FWCC 1TZZA 1XLIA 2PLCA 4YVVA 2O56A 1HVXA 1UR3M 3USBA 5BOOA 1E1CA 1XLBA 2DVUA 3TVAA 2ISFA 4UFLA 3B0HA 3CLWA 1KXVA 2OEMA 4JYFA 2QUMA 1BYBA 1WPCA 3DEQA 3A24A 3M0HA 3PWIA 3VLZA 1L2UA 1G9HA 1EJSC 2BG5A 3MY9A 1M01A 1U5JA 3NEHA 5AYZA 2DU2A 4LVAA 2PU1A 1CTNA 3L4XA 1W1VA 3UJRA 4J2PA 1LWHA 2R1NA 4AOPA 3SQLA 1XGDA 1WKDA 3GR8A 3GXFA 4A3RA 3U2EA 3ZM8A 1V3LA 3WJYA 1XHGA 1IWPA 4RNIA 3POHA 1SO4A 5AKQA 5HQMA 1C93A 4O8AA 4DWDA 4HPNA 5D9OA 4IFKA 3PPFA 4JTCA 1LUCB 3DI1A 3C2FA 4O52A 5LIUX 2ESCA 4PMRA 2W92A 3R13A 4JQ3A 4JIEA 4N6EA 2EJAA 3WLLA 2BXYA 3VMOA 1UKQA 4J9JA 4LAOA 1VJIA 2EPLX 4UTTA 1GVYA 4RV3A 1M7PA 2PDMA 3N12A 2ZZ6A 3UG4A 3W6YA 5M1TA 4LVGA 4B5XA 1L0PA 4QISA 4ZQMA 3BOLA 1PWMA 2OQLA 3NDOA 3NL6A 3TJIA 3B0VC 3NR0A 3N4AA 2P1FA 3CUGA 1GEQA 3F4NA 4S3AA 2H8ZA 4TIMA 1M6JA 3H2EA 3P61A 3OZOA 3BCJA 4OVXA 1TR9A 3T08A 4N7QA 1MW3A 4JTTA 4H7VA 2E5DA 3AIBA 1UD5A 1XCWA 4U4MA 1QW7A 4EOUA 3FA5A 4DBSA 1MEWA 1SW3A 4HHMA 4GPNA 1SO5A 2XM1A 1GYMA 3SGGA 3T4CA 2UY2A 1NVMA 1DP0A 2NQLA 3O6YX 1CT5A 3SJ3A 4C65A 1VEOA 3QZ6A 4FXJA 3FLUA 4LAMA 2ZBTA 3SI9A 2WLYA 3W88A 2J7BA 3GR4A 3SCRA 4FR1A 3V5FA 1L8NA 3BV7A 3ZSTA 4LYPA 3M5XA 2GOUA 4PEEA 3B8VA 1LLOA 3USZA 3KL3A 4AYGA 1PSCA 3Q45A 3UXAA 3UQNA 1PPIA 3RRXA 1W3KA 4B2DD 3FYPA 3URNA 2QF8A 1S1PA 4E2VA 1E56A 2V6AA 4UMBA 4UWMA 4AEOA 4LANA 2YB1A 3LMYA 2VTFA 3B9EA 4JFWA 1UR1A 2J74A 3B8IA 3TYZA 1B4EA 2OZ3A 4DJEC 2TSYA 3JRKA 2J27A 1I8JA 3EWZA 3SY8A 4G7EB 3TC6A 4N42A 3CH0A 3TYEA 3EWCA 4GO8A 5HPOA 4AISA 2YCKX 4LY8A 5GVJA 1KGWA 2OWCA 2QULA 2Y7GA 1EGMA 1G01A 1HW6A 2FTYA 4HA0A 5G4HC 1NY1A 1UASA 4MUZA 4MZYA 3CAKA 1EUNA 4UTIA 4XD4A 3CWNA 4K3ZA 4NAEA 1JUEA 5FJTA 1C92A 2QKFA 1HKJA 1VYSX 4UB9A 4KBXA 1JZ6A 1S3HA 4B5SA 1Y5VA 4IIDA 3N9KA 3MWCA 1A3WA 3SR7A 4FLOA 2QCMA 4CCZA 2DP3A 4LC6A 4ZGYA 3MV01 1ZP3A 4I5RA 4UR8A 3LGGA 1YXYA 1OFBA 1ONRA 4ZO8A 5H6HA 3GZ3A 4UXDA 3ABSA 5I78A 3VGFA 1IT0A 2PD9A 3BLIA 1RVKA 4CNSA 5KITA 3TX9A 1MSSA 2QUUA 4TVUA 3TC3A 4HSNA 3WFZA 4C5YA 4HPXA 4R33A 4HNVA 4RZ6A 5KTLA 2Z1XA 2PGRA 2HNHA 1PV8A 1TTIA 1V77A 4R7WA 2L5HA 1EJWC 1XLCA 2PTDA 4XUGA 2WHMA 1HX0A 3I6EA 1ECEA 2VX6A 3MSYA 1L9WA 4DAIA 1Q7ZA 4C91A 1FOBA 4IGSA 2VHLA 4EF8A 4U2YA 4HTBA 1IXOA 2JIEA 1F07A 3WK2A 3BZGA 1J8VA 2PDFA 5REQA 3G22A 1GQKA 3G2GA 3TN3A 1FWTA 5BROA 3AZRA 1CWYA 3UT0A 5CPNA 5M3WA 3KS5A 1OVDA 3NURA 1LWIA 2VFGA 3PUOA 4MJZA 4IF2A 2WMJA 3S5NA 3V0SA 1N2VA 4XKYB 2I5QA 1YTKA 3WH5A 2QNEA 2CHNA 1R5YA 3H2OA 4LUIA 4DEFA 3W84A 3SGUA 3I65A 5AHNA 4QGCA 1JFHA 4GUFA 3BE7A 3MMBA 1R6WA 4ALDA 3A23A 3GU1A 4UQCA 3ZLGA 1RVGA 3T7VA 1VIZA 5A2AA 4YNGA 1UH4A 1MUWA 4XZIA 1DWJM 4C7FA 1P0BA 1JCXA 3NFUA 2PAJA 1FDYA 3B04A 3PG8A 3UF9A 1KFEA 3COTA 1X6NA 4CLMA 5H2ZA 1RR2A 2QCGA 2CHOA 5EFDA 1FWAC 2PCEA 4ZXLA 1K4GA 1EZ2A 5D2WA 5FCZA 3KXQA 3S0CA 2PGEA 3OO2A 1CDGA 5A6JA 1SVDA 3GFZA 1G0CA 3GH7A 1GJUA 4Y9AA 3M5YA 3MM7A 1OK6A 2FH8A 3NZRA 1HP4A 5HPCA 4J3WA 4OOZA 3OTRA 1DJZA 3RMEA 1JPMA 3WLHA 2BY1A 2VC6A 2GWGA 3GK0A 4E2OA 3LN3A 1E55A 4XZHA 3IIPA 4FIRA 2ZZ3A 1FQ0A 3F4WA 1XX1A 4KIEA 4AF0A 1QI4A 1R0MA 3M0KA 4CCCA 3P8JA 5DO8A 2DZVA 3MB9A 2YSWA 4KEZA 5HUPA 3W1UA 4Q33A 4DYJA 5AECA 3FKKA 5HJLA 4NJJA 4A8IA 1E70M 4Q8MA 1O60A 4FOUA 3H24A 1A5CA 3L7RA 4DHGA 5T8GA 2POZA 4LVBA 3HFTA 4W7UA 1V6TA 1W1B1 1DJIA 5BXRA 4I9AA 1ISYA 3C3NA 1Z6KA 1D3CA 3THCA 1JULA 3WNMA 4XAPA 1XPYA 2E28A 2D3LA 5KZMA 1DJQA 4Q8VA 4ATLA 3M7SA 3LRLA 2Z27A 2HQAA 3QMSA 4P61A 4NJGA 1JYWA 2VGIA 4DXXA 4GCAA 1FH9A 2YCIX 3P67A 3H4WA 4J27A 3OVGA 3L5LA 1LLWA 1X6UA 1TX2A 3B9OA 4RX0A 5HA7A 3ZT5A 2W61A 1ZP4A 1ZAIA 5HWMA 1P0NA 1LQ2A 4U5KA 1BXCA 3MHUA 3PVFA 3O7UA 1REQB 4YXGA 3W7PA 4OGZA 4UNKA 3CIWA 1YNYA 4YTUA 1KBKA 3LXBA 1EIBA 2V8ZA 3VIKA 3U4AA 4HKPA 2D2GA 1J9YA 1U1JA 2QPXA 3SN0A 1Y0EA 2WMIB 3ABXA 1UW9A 2GEPA 3MMTA 3N3MA 5FJOA 3RILA 4GBDA 4P5UA 4HA3A 2AL1A 1MUCA 5A8PA 5FF4A 1A5NC 1J0KA 2INZA 5EMUA 1V8EA 4UR9A 1B3XA 1SUXA 5EGRA 4DJDC 2RHGA 1A5SA 2NX1A 1AQFA 1DQXA 5J5DA 5DANA 2RDWA 3RLVA 3WH7A 3E02A 1B54A 4IH3A 2QJJA 4OHQA 4GQBA 1W3JA 4URIA 2W6RA 5TBOA 3R0DA 4DO4A 2Q3OA 1OBAA 1I60A 2D2OA 4RW5A 4CN1A 3L68A 4DZIA 2JEQA 4MY1A 3WMSA 4OV9A 3DYMA 1GYNA 4LCRA 1E51A 4NQ1A 3GNRA 2GSEA 4WDWA 2TPSA 2ZUNA 4MJMA 1TUFA 4K36A 1E4LA 3GHTA 4AMAA 2X09A 2D24A 3CMGA 3TWBA 1K8ZA 4AYSA 4E3VA 3RFAA 1QFEA 1F8MA 2H8XA 5DCEA 3ONBA 4ML4A 4WOZA 3ES8A 4AD1A 3S5OA 2QJIA 3NO5A 3EDFA 3LV6A 4MSSA 1XRFA 3PG9A 3N15A 3PUEA 4WXZA 4W85A 3CB8A 3M0YA 5HDRA 4CKQA 2DFAA 1KFCA 1FWBC 5DXXA 2OYKA 3ZMRA 1UUQA 3ZYZA 1EC9A 3PFMA 5CLTA 3R43A 5DY3A 3OBAA 4AIEA 1R30A 4MFDA 2NQZA 1AD1A 5DRIA 1P1MA 1A3HA 3QQ0A 2YL9A 2HISA 2VD9A 3LI0A 2PUZA 3HIJA 4RE2A 1JRBA 5K3VA 1AW5A 2XH4A 4K7YA 3N11A 4DBDA 3MUIA 3TSBA 4AX7A 3OYXA 5AC8A 5GNZA 3K1GA 4B5UA 1EWEA 8XIAA 2X2YA 3AWOA 4QX4A 3UCDA 4C6QA 3H54A 4MLRA 1FWEC 2QZRA 3HF3A 3PZIA 4AZ6A 4PCSA 2ZADA 4DO6A 2ZRUA 3P80A 1BXBA 1OGSA 1GPFA 1Q6FA 5AZ0A 4QLKA 4GBUA 4IMDA 3CWHA 2FZBA 1O4UA 3WDHA 2ZE3A 1V08A 3F5LA 2YDQA 3AHXA 1PBGA 4UQ9A 4H7ZA 2QUVA 3NQ6A 1JVNA 3UGVA 2ZRXA 2X8RA 3L4VA 5CPOA 3RPTA 1L6YA 3EPNA 2CZFA 3V5CA 5FEZA 4RJEA 3VMPA 1PX3A 3WK0A 5I0DA 3VTRA 3WJSA 3OIHA 1QTWA 2G0WA 2DVXA 5C54A 3NWRA 1O5KA 3EEZA 4AVOA 2D2HA 5IOBA 3PBGA 1EXBA 4HTRA 1J10A 1UCWA 5FAGA 5EMKA 3NVTA 4JN6A 4V1XA 2IXVA 4HHHA 5IHSA 4JTIA 4GUHA 3OP2A 4UTHA 3WBYA 1M5WA 1P0KA 5JQ9A 3ZIZA 4GI9A 3RAOA 2I17A 1QO5A 5C2GA 1TV2A 3EWBX 1GQJA 1JYVA 1U22A 1DWAM 3WLMA 4D6CA 1P5BA 1QMLA 1XXXA 2NUXA 5G2IA 2WC7A 1XCFA 4QLJA 2E25A 1FRBA 1XYZA 1PZ3A 3EB4A 4XBJA 2PZNA 3W2MA 1W3TA 2DEPA 1FWNA 2V5DA 2JGQA 2GQAA 4DN1A 1E3XA 4UOZA 1I2QA 2PDCA 1ONEA 3W0KA 5M17A 4HU4A 1RBAA 1PZ2A 3S2LA 1CPUA 2YDAA 3LRMA 5I23A 2J7GA 5FL0A 4IMGA 4QROA 4Z1YA 3L5MA 4IMCA 5AYBA 3QY8A 3G1SA 1DWIM 1GKRA 4UFHA 5K2ZA 1U5VA 4JY9A 1EYWA 1F73A 3QKZA 1MQQA 1R86A 3WQ4A 2ZRWA 3A6OA 4PMXA 4M8UA 1P4CA 3HPSA 3M0ZA 4KQNA 3LGDA 2ADAA 3U5YA 3LPOA 4DXVA 3VNDA 1V79A 3THAA 1VC4A 5D9MA 3S3GA 3H23A 2QPSA 3CT2A 5G4WA 1QNOA 3DH7A 4OJYA 4C1NB 5LZLA 5LIKX 2XPKA 1TA3B 3NL3A 1HFBA 4LOCA 4O12A 1RPKA 2MUCA 3GQYA 2BVDA 2PP0A 1RJRA 2Z1VA 3VZXA 4AB4A 3ARPA 4UFJA 1Y5WA 4IIBA 3BCDA 3TWAA 1QPKA 4V15A 1R8LA 4YIWA 4HMDA 4TQTA 2VELA 1P6CA 1E6QM 3GUWA 2V3DA 4ZE5A 2VUYA 4GQ0A 1NDWA 4YJ5A 1Q6RA 1Q65A 2VC5A 1X7IA 2R6OA 3P62A 3RF9A 5BOEA 4DM2A 3S4TA 4DF0A 1UPMB 3AXIA 1H50A 5EL1A 2ZC1A 4QSFA 3AUOA 3GD6A 3B0JA 4PMNA 2VGBA 4ZOCA 2CXGA 5IRPA 3REQB 1GTEA 3UR2A 1TTJA 5AVHA 2PRMA 2PTYA 1BRLB 1GOWA 3E0FA 2FDMA 1W32A 4JQAA 4ZSTA 4G1KA 3LBMA 2BHUA 5T26A 1LL6A 3WH9A 4JFVA 1W8GA 4LS2A 4N9EA 3H26A 4R34A 4XZBA 2ZZ2A 5AY7A 1RK6A 4DO5A 5HJYA 2O9TA 4KRZA 3QEZA 4QJ5B 2X40A 5A8MA 3R94A 1MYRA 2ZWYA 4N2YA 5HINA 1IHIA 3ARVA 3VD4A 1A5UA 1DHPA 1M65A 1IEXA 3UWVA 1A4MA 2A5HA 2OOGA 3MCOA 3E0VA 1WBJA 3VIFA 2DSUA 2H9AA 1OY0A 3EEGA 3P7YA 1Q4WA 3L4TA 4EX4A 2NW0A 4F40A 4S38A 4H9YA 4YTRA 2TRSA 3FGCB 2WC4A 2OMAA 2Y4SA 2IUZA 2HEJA 4QE5A 4H41A 1EX5A 4UFKA 1T8XA 2OFJA 3MSRA 1M7OA 4CEUC 1WAUA 5AYYA 4Z1DA 2QJHA 4XD3A 1MWOA 3A13A 1ZQ5A 1GW9A 2PWGA 4WK9A 2HV5A 3VOIA 1C8YA 1R47A 1XC6A 1KO0A 2R9RA 1VFOA 4RE3A 2GGEA 2EPKX 4FP1A 1QR7A 2Z7KA 1OX4B 4DX3A 3PFRA 2QJGA 2J62A 2PDHA 2VC7A 1F76A 2PDXA 4H7CA 4KCTA 3CJPA 3BXWA 2F38A 1Q6OA 3CH9A 1GOKA 3GYEA 4V33A 3DXIA 1J79A 4MB5A 1Q7QA 5FJRA 4ADTA 1K7EA 3ZOAA 5T9CE 1UUMA 1EF2A 3DZ1A 2Y70A 3F2DA 2JKEA 4L1XA 4H6KA 1OD8A 3HB9A 5I77A 2E6FA 2DSKA 1U2YA 1CGVA 1PYFA 3I7QA 3W70A 4WKFA 1E1CB 5EMMA 3PN8A 2YOCA 1EEPA 1C9WA 3GIYA 1ZHAA 3O06A 1PZ1A 1E72M 1XLLA 2ZRYA 5I3JA 1KRMA 2GZXA 1H11A 2PRHA 2GK1A 4DBUA 3M64A 1P0DA 4PTDA 2EEXA 2PTXA 1VPXA 3CV2A 3U2CA 2FMNA 2J7CA 1VF8A 4P7OA 1ZGDA 4Q8UA 4IXXA 3WEOA 3KHDA 2BX7A 1G4PA 4DYKA 3WF4A 3EWYA 3VCCA 3FK4A 3KX6A 1XYLA 2XH2A 2PEVA 3SECA 1YBQA 1XBVA 5CZKA 1PS9A 4GINA 2W91A 2YXGA 1JUKA 5CKSA 4HA4A 3DX5A 3A5FA 2VQTA 1DL3A 1RBLA 2O9PA 3AJXA 2XVGA 1R7AA 4M1RA 2V4JA 4KRTA 4KGJA 3WBXA 1JZ4A 2UWFA 2E40A 4CNUA 3TNBA 2VL4A 2CBUA 4A2SA 4F66A 4R5EA 3MKCA 1LQAA 2DZXA 5I7GA 1QI2A 4YWSA 1UMLA 1A49A 5GJNA 3QYSA 4FALA 5KETA 4IL0A 3ZFHA 1NDVA 1YEYA 3HJEA 1YTDA 3QV7A 5K4XA 3SUVA 1OZQA 3DCPA 1EPVA 3TQ0A 1XYAA 1MFVA 4AX6A 3H21A 4L7ZA 3XINA 2OLHA 3PTMA 2FGZA 2WW5A 4E38A 2JFEX 1FHLA 2QCFA 2NX3A 4MNLA 1KBJA 1UMYA 2O9RA 4TTGA 3VPLA 3EX1A 3PSWA 1IR2A 4C5ZA 4R9XA 1EKOA 1ZJAA 4NX0A 1JZ2A 1TV8A 1DQWA 1EOMA 3UA4A 4D72A 3RGTA 1HKKA 4A2RA 4O15A 4A8LA 1DPMA 1GVFA 2VENA 3CHVA 1KBLA 3BJSA 5E0KA 3I4KA 4DPPA 3VDAA 1EBGA 1ISZA 4S2BA 3ZJ8A 3BAWA 4GY0A 3MP4A 3P14A 4HJFA 3NVDA 2CLFA 2D0FA 4TX6A 3BZJA 3F1QA 3QMRA 3NOEA 4MTVA 1W1YA 2D1ZA 3ARTA 1LL7A 5A94A 1NFPA 4Y9OA 3OG3A 1ZAHA 4V1YA 5FA5A 1BQCA 4F2BA 3L2IA 3AZTA 5C9WA 4PBEA 4C6EA 5AHLA 4GCXA 3SUUA 1HUVA 1YXDA 4S3CA 4FIQA 4W89A 5I5RA 4R27A 4GUIA 1EDGA 2ZC8A 1GPWA 4RK8A 2CFFA 4JX5A 3QSRA 2VKZG 5HMSA 3LHZA 3GG1A 1UIOA 3NQDA 4FF7A 1UB3A 3CV7A 3BW4A 4BQ4A 4O54A 1EJUC 1UHVA 4OZOA 4LW7A 4NAEB 4WF7A 3LRKA 4WLCA 2QUNA 1B3YA 1UD6A 3O6CA 4MB4A 2YJQA 4GLEA 1SJCA 2R14A 2OVLA 4QFUA 2PDJA 4KEMA 1JCMP 4B9YA 1S2AA 1E6SM 5DXYA 2I57A 2XWEA 3O6AA 3LLXA 3GU9A 5HMDA 1TRIA 3QV8A 1US2A 1LRQA 3N6QA 4Y8EA 4YN5A 1VYRA 3VUPA 4X63A 1NIUA 4O0QA 4AD5A 3CL8A 1N8WA 4HSHA 4O17A 5HNNA 2DZWA 4UOQA 1K8XA 1CX9A 4FPSA 3QGVA 3R7MA 3E0IA 2QGHA 2AOPA 1J2BA 1TZ7A 1EEXA 5L9FA 3AMGA 2WPGA 4CVUA 4PMYA 4WRHA 3S6TA 4A3YA 4WSHA 1Z7AA 3RXZA 3UXKA 1PL9A 1QNRA 1T40A 3WYZA 3VA8A 3NPVA 2WVVA 3LLDA 4L80A 4O57A 3FSTA 4HT3A 4PUJA 3B97A 4E4PA 1ENUA 3CUZA 4BR1A 1VKFA 4JTFA 4GJJA 1KV8A 4C6LA 3OBKA 4C6NA 3CEUA 2B31A 3KE0A 5CZ0A 5REQB 2GVJA 2OQHA 4DAFA 4YHEA 4GO9A 5TQLA 5LXEA 4GQRA 4JD4A 3EX2A 1RJQA 3HG4A 2FQIA 1OF6A 1LORA 4DZ5A 5D2XA 3IVUA 1TQXA 8RUCA 3VKAA 3WQPA 3RPMA 3T40A 3GNXA 4ADSA 4HNTA 3IJ7A 1MRQA 1KTBA 4ZFMA 1TPDA 4M51A 2NVDA 2YGYA 3TQKA 3QBUA 4DJFC 7REQA 2DDXA 1EQPA 1O94A 1YYAA 2Y5EA 3ZXWA 3WLTA 4BK9A 1P7TA 4KMQA 3U2ZA 5H91A 4TTUA 3CIXA 2FVLA 2ISVA 3NYDA 3G5EA 3M5VA 3QW4B 3UERA 2GJRA 2W63A 2QCLA 4B92A 2XSAA 3KTSA 1BG9A 1HG3A 1US3A 4O14A 7ENLA 1J01A 4LWWA 4G2DA 2CW6A 2V3EA 1H5VA 3GS6A 1E0WA 2FZ8A 3BWWA 2G3MA 1NM9A 3GDRA 1WUEA 3T07A 5A69A 3A3WA 3NGFA 2J47A 2X30A 3TYDA 2VX5A 5A1AA 1R9XA 1W0MA 1E9LA 3MM7B 5A2CA 2PE4A 3A5VA 2DSWA 4NAFA 3BSGA 3KRSA 3M0XA 5FEPA 1W6TA 2WM1A 3L0KA 4N4QA 4JYEA 3QC0A 4Q4QA 4NI3A 2Z1SA 1KCLA 2PFHA 3VKSA 4JEJA 1XG3A 1H7OA 2Z2AA 1WB0A 3BOXA 4PTWA 3C5QA 4AF0B 1EDTA 3OZPA 2BASA 3OQEA 3B8SA 3PZTA 2W66A 5BOFA 1I0BA 2TODA 3OZMA 1UKPA 1I0DA 1YLVA 2XYLA 1OINA 3KCLA 4ERIA 1PIFA 4JTUA 1QW8A 1YKWA 1UG6A 3B0XA 2HZGA 1YQ2A 3MSDA 1KFBA 4LRSA 4GYKA 2W3ZA 3GE7A 2XZ9A 3OJGA 3UW6A 5JBFA 1L6FA 4A05A 2ZX7A 3C86A 4H9TA 3T0BA 4K1GA 4XD6A 3NQGA 1XSIA 1JZ8A 2QLYA 4HMCA 1ZRQA 3WDPP 4DQWA 1FWHC 4UTFA 1O66A 1D2KA 1LOLA 2VFHA 1TJ0A 1LBFA 6PTDA 1WDQA 2DQWA 4LCSA 3CQIA 4WOQA 1XR2A 1ZENA 2QCDA 4NZ5A 2V69A 1ME8A 3UR8A 5RUBA 3F03K 2QXWA 5CZJA 4Z0JA 5D2YA 1POKA 4Q7BA 2E68A 1E9YB 2BODX 1F3TA 4CU8A 3ARXA 3GHUA 3G77A 1HKMA 1Z32X 4GUJA 1W9UA 4NKCA 3GY1A 3IJLA 1WZMA 5GQBA 1HIZA 3MMWA 1TPB1 2Y24A 4IPIA 1ELSA 4O1AA 5DN1A 1JG9A 3PJWA 1ZAJA 1SZFA 1QO2A 4ECLA 4HBKA 1UR2A 1M7XA 4TX8A 1VBHA 3DKLA 4WGXA 4M81A 5CH9A 3IUDA 1F3EA 4LUYA 3VZZA 4J35A 3ARYA 3WH6A 1H1ZA 4Y8FA 3SUWA 1UC5A 2FH6A 1I9CB 2PLMA 2REQA 3C2YA 4WJ8A 4PMDA 4O8RA 3KDOA 3EKZA 1U5HA 2QDGA 1RAKA 1YPIA 4C90A 4NZJA 1UD3A 1R3RA 2V0TA 1S5MA 2CLOA 4QEEA 1TPWA 2BXZA 3CZ8A 1QPRA 1LT8A 3G8RA 2PI6A 3BJFA 2WC3A 4C6DA 2W62A 5LNRA 1VAHA 3W1XA 1TR1A 4DF2A 3STPA 4K8GA 1DXFA 1P6WA 3MHFA 4KEUA 3NQBA 3UXLA 2E9LA 3WF3A 4XO6A 1EQCA 3S42A 4BF5A 2I5GA 3O0KA 1XH0A 4RDWA 5CCZA 2SFPA 1E73M 1RUSA 1BWLA 1XW8A 3SB0A 3UETA 4P8UA 4O18A 3NYZA 3VLYA 4CQBA 4D2JA 3TQPA 3GXMA 4HZ8A 3L12A 2ISSA 2XVKA 3PS7A 3CYVA 1S2VA 2E6AA 3G3DA 1E71M 2CNCA 3NAVA 2OGJA 4I7VA 2A6NA 3HMCA 2HK0A 1UIPA 3GLCA 4S23A 5B80A 4OKDA 3NQEA 4NU7A 3KVLA 1RPXA 3LA4A 2DZUA 4MB3A 3ARSA 5A6SA 1OM0A 2BY2A 2EGZA 3H12A 1XGZA 6XIMA 1DBTA 5HQEA 4ASTA 5E9XA 1A5AA 4UFMA 2OWWA 3T81A 4YPJA 4C6CA 2ZVRA 4Q8QA 4PB4A 4PMQA 5CPLA 2VZTA 2OWXA 3VYLA 1OYBA 3BVJA 3CL7A 2XIQA 1JZ7A 3GH4A 3AS2A 3N18A 1QDSA 3MDWA 2FDSA 5I3KA 3VC5A 2JEPA 1W1A1 1X96A 3L5AA 3VKTA 1CXHA 3H2AA 3HTWA 3EOSA 3RG6A 3FXYA 2VM8A 1HKWA 1TELA 5U7SA 1RSCA 1A5OC 4Q4MA 1JCJA 2ZA1A 3VKDA 3UVAA 3KVKA 1GK8A 4XBSA 1F3WA 1A0EA 1XD1A 5LXXA 3FJ6A 3E96A 1TPVA 3M0JA 5AZ1A 5LHEA 3IV8A 1NF7A 2QJNA 3HG2A 2BHZA 1LG2A 3DG6A 4Q3MA 1BXNA 4KWWA 1FWJC 3FOKA 4AY7A 3UWWA 4PZVA 5F1VA 3D46A 1WE5A 4L4OA 1K9FA 4J3XA 1KR1A 2BS9A 2AQWA 4R85A 1EJRC 4X9YA 1K70A 4V2XA 3P5YA 5I00A 4C60A 1XL9A 4IP5A 3IUIA 2VR2A 4IFOA 4L65A 1ZBCA 4IM4A 2B7QA 4LX4A 1E6ZA 3PTDA 3GUGA 3PBVA 3G0XA 5E6ZA 3W7GA 5DRCA 3DFYA 4FF5A 1GQIA 3VIMA 4AIOA 2H3BA 3WQWA 1XV8A 3GXNA 5FACA 4CQ9A 4DJDD 1ICPA 3W53A 5A6BD 4B4FA 3ZO9A 1E0XA 3B8TA 4C6KA 4D6JA 4XSMA 1KBIA 1T5AA 4QAWA 3E5BA 3PTKA 4EAYA 1KA9F 3DFHA 4FNSA 1V6WA 4YWIA 4MYXA 3WQGA 2ZX6A 3NZQA 4AD4A 2Z26A 1OZMA 4TOQA 1TIMA 3OLIA 4HSOA 1L6WA 2DIJA 3BK0A 4YCOA 3DOPA 1TPEA 4NF7A 5FL1A 3W1AA 2J9XA 2O4MA 1OG0A 3MMCB 1DJWA 3P81A 5E9AA 4GX8A 4GY7A 3JW7A 1AMYA 1T96A 2YW3A 3SO7A 2J13A 4FXRA 4W8LA 4HK6A 3QR1A 5B7YA 4C6PA 4AU0A 1ZJIA 3PHAA 1J18A 4QG8A 1FWWA 3R5EA 1SPQA 1IEQA 3MANA 4NHVA 2XWDA 1QWKA 2DUZA 7ODCA 3IUHA 2J75A 1UA7A 3QFEA 1FWDC 2YZRA 1XLJA 4GZJA 4O53A 3GC5A 2F61A 3MQTA 4QJ1A 2PWEA 2WV8A 2IPFA 1O6IA 1TWWA 3GG0A 4WX2A 4DLMA 2F2HA 4ZB2A 1GOXA 3CU2A 4DB7A 4FLRA 4IX0A 1RLDA 4QM1A 2OKTA 3MHGA 5C9RA 4H83A 3WL0A 3NQAA 3Q2DA 1OGBA 1W54A 3MUZ1 3BJTA 4PE8A 4N02A 4W93A 2AQOA 1EF3A 3ABOA 1XYBA 4PUMA 5JBDA 2POTA 3OU8A 4S3KA 2G95A 4XISA 4JFSA 3I10A 3MV11 3V1PA 4LB3A 4CD5A 3ARUA 3SFWA 2VFDA 3ERPA 3MP3A 4F2UA 2VZOA 4Z17A 3CB3A 4PUDA 1PIGA 1HGWA 3ARZA 1KGXA 1EB3A 3AAMA 4XG1A 2WK2A 3E5PA 2OT1A 2GQ9A 4KCUA 4IPJA 2Y7EA 1UD8A 4PUUA 3RR1A 4H1ZA 5DMYA 1G4SA 3CMFA 2GVLA 2YDSA 3HV9A 4RXFA 3GNOA 1CLVA 1AFSA 4U2ZA 1M68A 2XVNA 4U3AA 4Z0SA 4F4RA 2FPTA 1PDZA 3ATYA 4GFIA 3WLRA 2A4AA 3VX0A 1DWHM 3P82A 4QAIA 2AGKA 4TUFA 4XIAA 3B4YA 4MGGA 2Q09A 3GVWA 2OX4A 2DIKA 1JR1A 2ZXAA 5LNWA 3CHDA 3G1RA 4ERGA 4Q6XA 1Q13A 1KFWA 1NSJA 1LG1A 2V5CA 4UR7A 3LXCA 1VCFA 4MWAC 3CGTA 2I5IA 3CLMA 5U4NA 3P3BA 3KRUA 4NJKA 1GOQA 5ENLA 3OGSA 3M07A 2FHFA 1EWDA 3GIPA 2NSOA 3UZZA 1B3VA 3DGBA 4BEUA 1AW1A 4XTIA 3NXFA 1E4MM 3NM1A 4ES4A 1PHWA 2H9AB 2HXUA 5XINA 2O7SA 3HMJG 3RNDA 1UUOA 1EJXC 4D1IA 1BHGA 4L56A 3AIWA 3W86A 1QAPA 2BB0A 1XFBA 1EH9A 3CUJA 3AYTA 3W76A 4I6KA 4O1EA 3LHUA 1LM1A 4W88A 3MI6A 5LNVA 4W5UA 3NJ3A 1UZDA 1XDJA 1GVIA 5XIAA 7TAAA 1FP8A 4O1FA 2X2GA 3VNJA 3ZR6A 4IL2A 4KWSA 4IUOA 1UR8A 3BAYA 4AVFA 5K4ZA 1GW1A 2A1YA 4ACYA 3STEA 1O7AA 1E40A 2ODOA 3VIIA 4EWJA 2R94A 1E43A 5A3HA 4C6OA 3MMAB 2XGIA 3QHNA 4RNHA 3RLGA 3PULA 3NEVA 1J96A 1XLAA 3GNDA 4PODA 1HO1A 1LF1A 4OBTA 3BSMA 3BURA 3URQA 3KP0A 1EO5A 1W9VA 5LIXX 1I2NA 3LB0A 5CSUA 1K7XA 3QC3A 4EAMA 3F2CA 1KRBC 4YYCA 3NG3A 3S9YA 3G0SA 3WIJA 3B3DA 4HJWA 1LT7A 5CGQA 2WHJA 3IJ9A 2XFRA 3RX3A 1TX0A 3AC0A 4KS0A 3CTLA 3WJWA 4LS1A 4GEPA 4D6FA 3UG3A 5I03A 1R9YA 5AVNA 5BRPA 3QF0A 3TTQA 4AEFA 4HP5A 2PTZA 1PXGA 2GK1B 2C15A 1DYSA 4JKLA 1OYCA 3TZNA 1G7UA 1E0TA 3QLLA 4LSBA 2OODA 4CVWA 2A7PA 2R8WA 4P7LA 3BAXA 3C8FA 4JFUA 4XVDA 3IIVA 2G8ZA 3V75A 2DY3A 3SRKA 4B5VA 5EMYA 5C0QA 1WKYA 4WHBA 1YBQB 4LB4A 4YTSA 4JIRA 5BCAA 2UY5A 3R79A 3VM5A 3AYSA 4IISA 2V4JB 3B8DA 3SQSA 1FCUA 4JL1A 1FBAA 1M1BA 1JNDA 3PPGA 1G5AA 4E5TA 5EMJA 4NT0A 3EA1A 3WK3A 3D47A 2A3BA 1QBAA 1G67A 1R3QA 3SCVA 1POJA 1PKYA 3PJTA 1CXFA 4G39A 2C0AA 3UPMA 2XUCA 3OODA 3PAJA 4I8YA 3N29A 3QMTA 1NWSA 3GW3A 3SDOA 4J5NA 2XN1A 3O15A 4FNRA 4US6A 1UWRA 4JTKA 4CGTA 4S3DA 1CLXA 4ZTYA 1IR1A 5DY2A 1NJJA 4W8BA 3CAQA 4ZOAA 1E6PA 4HYRA 3GO2A 5CPQA 1RALA 3FJ4A 3SQMA 3GEOA 3WLKX 2AL2A 2AKMA 5DEZA 3O0FA 2PA6A 2WANA 4ZB0A 5GEPA 3WDJA 1MMFA 3EDDA 2I7GA 1UR0A 3B0GA 4REQB 1BTMA 2DZTA 5CJMA 3W37A 1C7TA 4O0KA 1TV3A 3SAZA 4JX6A 4E2DA 2YR1A 1Q6DA 1VBUA 3B4UA 3QQ1A 1UKOA 5F2MA 2VOTA 2XFWA 3BG5A 1CNVA 1FDZA 1EA9C 2G3IA 1A5LC 4L5ZA 3A3XA 3CBWA 2MNRA 1ZU8A 1Z48A 4LAZA 4E2BA 4YL2A 4L6OA 4IX2A 1QJWA 1A47A 3UU0A 1CIUA 4RCXA 3RPDA 3TE9A 3CMJA 5CZSA 2HTMA 7PTDA 1UJQA 3DDMA 1HJQA 3G24A 5CGTA 3V36A 3M7WA 4Y9NA 3KM8A 1TV7A 3O6DA 4CCEA 3PZNA 1J0YA 1GORA 3CNYA 5CJNA 1TYGA 1MW1A 2VRJA 4JTDA 3K2GA 2FZNA 3TAOA 1H3GA 1ZJHA 1WZLA 3T05A 1BAGA 4DY1A 1R85A 3NQ7A 2ZWZA 1QPOA 3ZZ1A 4EACA 1V3HA 6XIAA 2GUUA 1O5XA 1GUVA 4AZHA 5JVLA 3PBUA 4HZMA 3KBNA 5L6UA 3QW3A 3T2QA 2IKHA 2XGBA 1YTEA 6CGTA 1XDMA 1ZBKA 5JMUA 3EZ4A 3ITYA 3EPOA 1EDQA 5J8LA 4TMBA 3E0WA 3VD7A 3QR3A 2V5BA 4EPDC 1C29A 1V0NA 2GSJA 3W7NA 5BW6A 4IG2A 4A8RA 4AY1A 4PB3A 4JFTA 3SBFA 5CPMA 3T55A 5EY5A 5FF7A 2HVNA 2ABAA 4XSLA 3IJ8A 4P8XA 2PF8A 3A47A 4JQ2A 5F2LA 4A21A 4Y7EA 3GRIA 3RHGA 2VEMA 1EC7A 2HS8A 3O3RA 2PF0A 2OKOA 1H62A 2I9UA 3KFTA 3TV8A 3M44A 1EO7A 5CG7A 5KZDA 3L4UA 4U3CA 4R88A 3VNLA 2QVHA 1O68A 2UZ9A 4GX9A 1QOQA 5BWAA 2GJXA 3M5ZA 3OW1A 4LF2A 1BWKA 2DSVA 1I4NA 1OFEA 3KS6A 1DTNA 3AI0A 3JU2A 3IJQA 4AC7C 3QGAC 5AHFA 1WNOA 2A0NA 4V28A 3CO4A 4AZGA 3LPGA 3O63A 3W29A 2VNCA 1E0VA 1A4LA 1GNXA 2Q6ZA 1D3HA 2EQDA 4TX9A 1RZMA 5D04C 1DIOA 9CGTA 1NDZA 1JD7A 3SM0A 2JGYA 3H2FA 5C2XA 5JH2A 4LV4A 4Z2HA 4EXBA 2UY3A 3KWXA 5FD0A 5F4SA 4Z1AA 3H55A 3ITCA 3U5UA 7REQB 4XV0A 5K9XA 1P7TB 4UTLA 1A0DA 3NGJA 3PBWA 4UTKA 1Q6QA 1CZ1A 4GI6A 1QCWA 2CBIA 1A5MC 3FYOA 2C14A 2D20A 2QDEA 4M6UA 2DT0A 1M7JA 4BJHA 1W9BM 5A8GA 1I75A 1KWGA 3PZ9A 2V2DA 2RDUA 2EG8A 3VMNA 1MQRA 1NWRA 5HWNA 3CT7A 3W74A 1E9IA 3P2VA 3IANA 2CLPA 4RV8A 1B1YA 4MJ4A 2GFTA 2WSYA 3QXBA 4AZBA 1HKVA 1XDLA 3T78A 3MMDA 3UEQA 4AXNA 3GNNA 2GGHA 4NUWA 3QPYA 3A21A 4JCMA 2VX4A 1B2YA 4NAFB 2IXUA 3PR2A 3OR2B 1WQ5A 2XJ7A 5G1MA 3VM1A 1NP2A 1FX6A 2YLAA 3ZJ7A 3S1XA 4X61A 4WZHA 5IBXC 1ITQA 1Z8AA 3KHJA 3WQEA 1GVQA 3WNNA 3OEXA 3WY1A 3V18A 4ICCX 1OX5A 1OCQA 2AAMA 1OF8A 2Z2BA 1T0OA 3NPUA 3NPXA 1RCXB 2ACUA 5I3FA 2EBNA 2CERA 4QXIA 7CGTA 4Q4SA 5AB3A 1IQ8A 2YBVA 3DKJA 1TWDA 1NAL1 3C0QA 3EA3A 2ANUA 3E3HA 5DMLA 2NT0A 3SCOA 4UTWC 4FHAA 2Q3RA 2FB3A 5LSMA 3GDTA 2C19A 5D05A 1L6GA 1R9ZA 4A8NA 4C7DA 3VIJA 1VPYA 4HNUA 4GUGA 1OIFA 5GPRA 3A3HA 3ZLFA 3IIXA 5FF0A 3CPRA 5AHIA 1UP3A 1VHCA 4JAWA 1X1OA 1CYGA 4J4KA 3NZGA 2ZX8A 1AZ2A 1HKIA 3MS8A 4U31A 4BQ2A 3H70A 2Y63A 3IRSA 3V0TA 4M1BA 1SSDA 1OWQA 2CPUA 1PWLA 1LTDA 2DZPA 3DFOA 3DG3A 1H7RA 4MZ1A 2QJMA 1UH2A 2NVAA 2QCDB 3G18A 1OFOA 3AHVA 2OTDA 2EO7A 2X1TA 1FTXA 4HOZA 2E7FA 1MVYA 3WEZA 4S3BA 3VGHA 2P0OA 4JTSA 1W3NA 3WCZA 4AHQA 1HZYA 1JXJA 2QEZA 3GTFA 3ITOA 4A29A 4JNZA 2V2CA 2HPMA 3PF3A 1XC4A 5D03A 5DMNA 3I7SA 4R53A 1DE6A 1HL8A 5EKYA 1CGTA 2VCCA 1RY8A 2V5JA 3TKFA 2YYTA 3STGA 1W3LA 2CITA 4QTGA 1OGGA 2OJPA 3HQPA 4LXFA 4JNMA 2HS6A 3EPMA 5G2HA 5IDIA 2G5WA 4JNYA 4BI6A 3SADA 1ML1A 2W0UA 4M6VA 5I3DA 3LNMA 5EBAA 4MDPA 4RXGA 3KBMA 3IEBA 3S1WA 4XZMX 3MPGA 2QPUA 2REQB 2FVMA 1S5TA 1BF6A 2VRQA 2C18A 5LNSA 4ORIA 4JQ1A 4GD0A 4NI8A 1JF6A 3NCOA 5D38A 1QPNA 3CQHA 2UY4A 4JHZA 2GUBA 2JE8A 4QITA 3EOOA 4NY2A 1O1ZA 3SCSA 4QRNA 1Z9AA 3OHIA 4QIUA 3TA6A 3KVJA 4N9DA 4ZXOA 8TIMA 2AKZA 1D8CA 4C1LA 1PEZA 3GH5A 3PM6A 3TYAA 4BFAA 4F3HA 5AHEA 4F48A 1S1RA 1Z89A 4GFSA 1DXEA 4LT9A 1NF0A 2Z00A 2ZA2A 5ABGA 3APYA 3MI2A 4E4FA 2WSKA 4XZWA 1JDCA 1RA0A 4EK7A 5I07A 2X0HA 1P0EA 3H4GA 3AXMA 2HBVA 2WSPA 3CWOX 3GTXA 2AMXA 4W5ZA 3G1VA 5CPTA 2VZVA 1W2PA 1X1ZA 3OLEA 2PDWA 3KP1A 2XN0A 2CWXA 4FOJA 4D8AA 5F7UA 3UXDA 1EYEA 4H3DA 4O4WA 1LRTA 2WWDA 1OYAA 4FXFA 2WSQA 2ZRZA 3HGJA 4M56A 2B7PA 3I4EA 3PC0A 4O28A 3TYBA 1K9DA 2VGGA 3EXRA 2XISA 3WJXA 1TCDA 3BG9A 3T8QA 3QYQA 3SCUA 1BFNA 3GW0A 2UBPC 2A2IA 4ZSUA 3SSJA 1DKWA 3S1GA 2I9EA 3CEPA 2QT3A 2DJXA 1DJXA 1TREA 3EMQA 3LOTA 4GVIA 3UJFA 4I5UA 1WX0A 2CLMA 4RZBA 4PUKA 5ABFA 4S3JA 2OX1A 2ZXBA 4V27A 3FV9A 3CUHA 1A3XA 2RKXA 1ZUAX 4YS1A 4KESA 3AJ7A 1SMAA 2DORA 1TB3A 4B9ZA 1TPFA 3VIOA 1PJ9A 4MWAE 3BAJA 1CCWB 3SY5A 4WUIA 1P6BA 3N1AA 1V6YA 1WXYA 1PTDA 5FAJA 2C3ZA 1OIMA 2WHLA 2G4JA 2FKPA 3EBVA 3INPA 3UJSA 5B7ZA 3VM0A 4Z42C 3TC7A 3M0VA 1VLWA 2VGFA 4JTHA 1KGUA 4TV5A 3RLUA 1XH1A 2XVPA 3CO8A 4QCEA 3W83A 3FNDA 2ZZ1A 1X8FA 1N7KA 3LZ5A 3M47A 3TROA 3QOKA 3N2MA 5I2UA 3CK5A 4GJIA 5H8UA 1TZ9A 4TVCA 3CYJA 4LYKA 4DM1A 2PDYA 1I1WA 2OSYA 2YDRA 2IKJA 1V6UA 2PDBA 2YW4A 1FFRA 4C1KA 4PB5A 3POCA 2PRLA 3LGEA 4J3TA 1JQVA 3H7RA 4DI9A 4LV9A 3R4IA 1WDWA 2ACQA 1VRDA 2IQ0A 3BV4A 2WNQA 3WO8A 3W6LA 1H0IA 1KTNA 2C1IA 2D0HA 5AFDA 1JCYA 5K9CA 4EWND 2X0YA 4NNBA 1C8VA 1J11A 3RU6A 1VENA 2X05A 4KETA 2BP1A 5D4YA 4XKMA 2ACRA 5CEWA 2HXTA 2KX9A 2QR6A 4GISA 1Z3NA 2WKLA 4DUOA 1WV2A 3LCGA 3FFSA 4LCQA 5CJ5A 1V93A 3CQ0A 2WVUA 2BOEX 4JL2A 3UWEA 3M1ZA 4GVGA 3W02A 3O05A 1UR9A 5D30A 2ALDA 2DIEA 3N6JA 4O50A 3IGUA 4OQVA 4HNLA 2VYOA 4K6AA 4MVAA 4DJFA 5E1QA 2GSHA 1OC5A 1YNPA 3DFNA 3CQKA 5E09A 4RL3A 2Z2UA 3ZS4A 4AQLA 1ZZMA 2EKCA 4H8NA 3W1NA 4ACZA 1H41A 1EP1A 3PZUA 1IIHA 3FDKA 1ZLPA 1UJPA 4ZO9A 4DWSA 9RUBA 3BMWA 1LROA 4EVZA 3TTYA 3AIQA 4ZQRA 4HNNA 4NZ1A 3TUUA 1OX6A 2I14A 1S2CA 2BV9A 1JPHA 4RPQA 3KOXA 1MNSA 1QWGA 3TJLA 3DU0A 2XSBA 3BQ5A 5D8WA 2NQ5A 3LENA 4HPHA 1MW2A 1W9PA 3BICA 3PPHA 1RQBA 3T8LA 1AUSL 3BSHA 2RGLA 3A4WA 4DIAA 4O4VA 2BVYA 5C2CA 1JNEA 1OFDA 2XG9A 4PTNA 3UYCA 4H2HA 1BEUA 1W56A 1XWYA 1WZKA 4X22A 1EPXA 1KFJA 2UV8G 5FIPA 1UPPA 1AD4A 3LHYA 5JIWA 3IAQA 5D32A 5I06A 2AMGA 4Q4KA 4JBRA 4A6GA 4Z2LA 4YMZA 2WJDA 4XAZA 1H61A 1T6MA 1J12A 4P2VA