4S3EA

Ispg in complex with inhibitor 7 (compound 1061)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
401
structure length
400
Chain Sequence
b'MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 144
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3eA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3eA02
4PZVA 4O1FA 3TYAA 3TYDA 4DJEA 3NOYA 3TR9A 2XSJA 3B0NA 4S3EA 3H24A 3MMBB 3VKSA 4CCZA 3GEOA 3MMCB 3VKRA 2H9AB 4D8ZA 4MWAA 4DJDC 3MM7B 3TYEA 5AOPA 1F6YA 3OR1B 1TWWA 1ZJ8A 2VEGA 4DJDA 3VM1A 2V4JA 3VLXA 3MCOA 2VEFA 4HTRA 3B0LA 3OR2B 3VKQA 3H2NA 3K13A 3TZFA 3MM6B 3H2EA 4S38A 3H22A 3VKPA 4S3DA 3H23A 3VKTA 3MMAB 6GEPA 4MWAC 2Y0FA 3B0HA 3H26A 3MM5B 1AJ2A 1AJ0A 4NHVA 4NIRA 3MM9A 1AJZA 1Q8JA 2E7FA 2AOPA 2BMBA 2GEPA 4O1EA 3B0GA 3MM8A 3MCNA 4C1NA 2Y5SA 3H2MA 1EYEA 1AD4A 2YCLA 3H2FA 3TZNA 2YCJA 2XSJB 4GEPA 4DAIA 3TYUA 3H2AA 3VLZA 1Q7MA 4G9PA 1Q8AA 3TYCA 4DJFD 3AOPA 3MMBA 4D8AA 3H2CA 2YCKX 3B0JA 3V5OA 4DJED 4MWAE 8GEPA 3H2OA 1Q7QA 4S3CA 3TYZA 2AKJA 5GEPA 4MWAB 2H9AA 4G38A 2DZBA 3MM7A 1TX0A 3VLYA 4D9PA 4DB7A 2YCIX 7GEPA 4NILA 1TWZA 2OGYA 3OR1A 1Q7ZA 2DQWA 4AOPA 2V4JB 1AOPA 1ZJ9A 3OR2A 3BOFA 1Q85A 4HB7A 3MCMA 4G39A 4DJDD 4S3AA 3MM6A 1TWSA 4NL1A 2DZAA 3MMAA 3VM0A 3MM5A 3MM9B 3MMCA 3TYBA 3H21A 4S39A 4DJFC 1AD1A 3BOLA 3MM8B 4C1NB 4S3FA 4DAFA 4DJEC 3B0MA 2Y5JA 4S3BA 2YCLB 4DJFA 4S23A 1TX2A 5JQ9A 4MWAD 4O0QA 2VP8A
chains in the Genus database with same CATH superfamily
2XU2A 3PZTA 1RH9A 4CCZA 4ZCWA 4O52A 5CPTA 3CT2A 3BMXA 3QQWA 4TXEA 1OQFA 2DZTA 4C1LA 5CJMA 3BLFA 3RNDA 3LLFA 4KWWA 4AG0A 4PBEA 1A53A 1FHUA 5DMYA 5JVLA 3RG6A 4UR7A 4DBSA 5PTDA 2HS6A 3TN6A 4H7ZA 4MNKA 2WHMA 4IQDA 4DYKA 4P7QA 4DY1A 3B0GA 1LL7A 3N13A 5I3DA 2ACQA 3AIQA 3LLXA 1XQKA 1MVYA 1TIMA 4X3ZA 2WC4A 4UFMA 3GO2A 1FWFC 1XCWA 3EPOA 4AZBA 3FJ6A 1A5UA 2V5DA 4IP7A 1W3LA 5AVHA 5LNRA 1CXLA 2E3ZA 3UGRA 4BQ4A 2ANUA 3CH0A 1GONA 2GSHA 2WZMA 4GXMA 2YCEA 5FF7A 1JQVA 4NYYA 1A49A 3EB2A 1KFEA 1R30A 4FNSA 4JQ2A 3DH7A 3IJDA 1ZAHA 1MEHA 2FB2A 3PBWA 2R8WA 3V35A 3C2FA 3NFUA 4K2SA 2YOCA 5A94A 3S47A 3DXIA 3EEZA 2QMKA 1B0IA 1PKLA 3VKSA 2F6UA 4HCDA 3W6YA 3GIQA 4GINA 1E0WA 4YLWA 5A6JA 3U48A 1KM0A 2WWCA 4H2CA 3CIWA 3TYEA 3EA3A 3UW6A 1LLOA 4B15A 2GK1A 1KRBC 1QASA 3WLQA 2HZGA 3RDKA 4QJ5B 3W38A 3OPSA 2QDHA 4NJHA 4EP8C 3R7MA 1J2WA 4YVXA 2FFCA 1VBGA 1OT1A 3NAVA 2GWNA 3ARUA 4S1FA 1V7YA 4EKJA 1QPKA 4QM1A 5A95A 2VX4A 3G22A 4W8LA 1QNOA 2ZUUA 4JTDA 1MEWA 5J5RA 1HJVA 3W7DA 2YL6A 3DECA 1QHZA 4ZEPA 3TYZA 3VI2A 3BZGA 1RCXB 3LTPA 2W27A 4DB7A 2J8TA 1DWHM 3RR1A 3ABOA 1E6PA 2W62A 3CL6A 4A3RA 2R94A 1J6PA 3MJYA 5GNXA 2X1IA 2QCEA 1Z69A 4JIEA 2VQTA 4KRTA 4QROA 2L5HA 1DL3A 3K1GA 1TV3A 5FCZA 1MFVA 3RFAA 4QRNA 3B0MA 4R53A 4GZEA 2J9XA 3Q4DA 3NPVA 1R3SA 3G0UA 3SCQA 4UC5A 2P10A 3MSRA 4R34A 4B92A 2I5QA 3GM8A 3GXPA 4OKDA 4AZ7A 5KSWA 1F05A 1QR7A 3TKFA 4JEQA 2J13A 2WZEA 3TH6A 1SM9A 2YIHA 3C56A 1JJKA 1JD9A 4Y9NA 2BHZA 3DHDA 3K46A 3AHXA 1KXQA 3S0CA 3IUIA 3ANUA 3GU9A 1R3VA 3EAUA 1FA2A 2Q3OA 1JFHA 1UQYA 1CGYA 4CN1A 2B7NA 4K6AA 1KBKA 2CXEA 1FRBA 5AHNA 2P3EA 1R9XA 3M43A 3I65A 4M0XA 4O28A 2DZSA 1GOWA 3I4KA 4UTTC 2YR1A 2C7FA 4I3GA 5CG7A 2NUYA 4WDTA 1JYVA 1FWEC 4ZQMA 4OBRA 1XYLA 3OBAA 7ENLA 5FJPA 1TPVA 1MUCA 2I9EA 4X0VA 4H6QA 2GUYA 1C8QA 1NSJA 3GFZA 4M6QA 1KXTA 3MM8B 1DYSA 2J79A 5MKGA 3C0SA 3PG8A 2ZXQA 1OX5A 5XINA 1KBBA 4GLEA 1SR9A 2DUXA 3WD3A 2ISDA 3P7YA 4IMFA 2QR6A 1UD5A 3ZVIA 4KT2A 3PTMA 1KCKA 2TAAA 4XBJA 3VKRA 4HNUA 1TE6A 3M7SA 5HQLA 3CZ8A 3E9AA 4MF4A 3IK4A 2EPLX 3TN4A 4WUIA 1JD7A 4JTFA 4GNVA 2X40A 4ZZ9A 2CPUA 1E0XA 3ZM8A 2CLIA 4IUGA 3R10A 4AY1A 1MW0A 2GWGA 4Y9OA 4LCRA 3KBMA 3P14A 2D0HA 3AYSA 2ZYFA 1OINA 2Y61A 3LV6A 1R85A 5DCEA 2XYLA 3MUY1 4DHGA 5LA1A 4UOQA 1TV4A 4FXRA 2WNZA 1PWMA 3S6DA 1IT7A 2HEJA 1LUCB 1YPIA 1D8CA 3GXFA 2XSBA 2E40A 1TWZA 1O60A 4YN5A 2BGNE 5CC7A 1ESWA 1JZ5A 2YW4A 4EVZA 4EF8A 5HDRA 2PCEA 3VIHA 2IS7A 3OVRA 1XIGA 5BWFA 2YXOA 4DM1A 4JNYA 3NUKA 5G4WA 1W54A 4WJXA 5HPOA 2Q8LA 4GYKA 2GVJA 4G6CA 3W76A 2ZZ1A 1FOBA 1PS9A 4PCNA 3L2MA 5DXYA 1P0KA 3WZ0E 1R46A 4GNJA 3BG3A 2XZ9A 1DWGM 2OKOA 1VC4A 3AXIA 3CZEA 1SFTA 1Z89A 1UMLA 2FMOA 2NX3A 1C3FA 1TKKA 4GO9A 3SEPA 4YPJA 4BZYA 3N12A 1BKHA 1G9HA 2G0WA 3S1XA 4DJDA 2P0IA 5E0KA 7REQB 3NQ6A 2O9TA 1HJXA 3G1SA 3MBFA 4QDWA 1E70M 1LZOA 3CXOA 1KD0A 4TTUA 1CX9A 1VFTA 2VURA 1SFSA 1KV8A 1LL4A 1L0PA 2E8YA 2XHYA 2V0TA 2XN0A 4IM4A 1H11A 3B0XA 1ONWA 5AC7A 3W4RA 5C2XA 3U2EA 4HT3A 3KHDA 2RH9A 3FXYA 1H0GA 3RO6A 4GCAA 1NP0A 3P6LA 1PV8A 3TDFA 1W3TA 3NQ7A 4R7JA 1L6FA 4POCA 1HNYA 3KL3A 4JDYA 4LAKA 4A8IA 4J3ZA 5DF0A 4HZMA 2O9PA 3BG9A 2Y4SA 4XB3A 1OY0A 5KITA 5FEWA 3HV9A 2D3NA 4C6FA 8XIAA 2YYUA 1TVPA 3CT7A 4WGHA 3CYJA 3ITTA 3TN3A 1N7KA 1FH7A 3R94A 3LOTA 2X2GA 4O12A 2VR4A 2BB0A 1XKYA 1H0IA 1VS1A 1XGZA 2Z6IA 4H01A 3B0NA 1MUWA 1QOQA 3QTPA 2PWEA 2C0AA 1XYAA 2ZVRA 3OOQA 4E4UA 1O66A 4EOUA 3EMZA 1WBJA 4ORIA 1ZPTA 3M44A 2YXGA 1ML1A 2HXTA 1W0MA 1VHCA 3VAVA 1LWHA 4PMDA 3BCDA 1IXOA 3AMKA 1V77A 1TJPA 2DSZA 4EE9A 2IUZA 3BV7A 5AYBA 2BMBA 2QJHA 4HA0A 4JQ4A 1BEUA 1R87A 3WBAA 2A0NA 3V18A 3ITXA 3DI1A 5H2ZA 1R3WA 1GJWA 3GXMA 3UZ5A 3BICA 3UZZA 2VGBA 5HJYA 5AB3A 1M53A 1QI0A 4FZIA 2YCIX 2ISSA 4MOZA 2FHBA 3ZWTA 3SJ3A 3WQ6A 2VEMA 2UWFA 1FWIC 1ZAIA 3WFAA 3ID7A 1OG0A 2I17A 3R11A 2G95A 4DBWA 5D09A 3UA3A 3P0WA 5CPNA 4U2ZA 1TPB1 2ZZ4A 1A0DA 5HBFA 3WD1A 4FK9A 2PDLA 3LCLA 3TYBA 1Y5WA 3TFXA 1RUSA 4PRWA 1EB3A 4J3SA 1DXFA 3D47A 3W2MA 4JXCA 4U4MA 4LS1A 4Z0JA 2WXDM 5KZ6A 2HQAA 1JNDA 4IMDA 2YA1A 3D3AA 2QCMA 4LS0A 3G1FA 2DUAA 3V36A 3QHMA 1DQWA 4JX6A 2Y70A 1DEDA 2G3MA 4C6LA 1H7XA 1POKA 3S46A 1B9BA 3B9AA 2XUCA 3T2QA 3IJ7A 3ITLA 4MZYA 2F6XA 5HNNA 5KZMA 3ABZA 1JQXA 3VIMA 1GYMA 4Q8QA 1CCWB 4OOZA 3M0XA 1G1YA 4FXJA 3KP0A 4JYDA 4LY4A 3QLDA 3MM8A 3L7RA 4XUYA 4TUFA 1DJGA 1XIJA 3V16A 3ITOA 3UCCA 3QVQA 3W1PA 4XKMA 1XLEA 1RD5A 3V4BA 5IM51 3VLZA 2FVKA 2ACUA 3E12A 3W25A 4FF5A 2PEVA 2PAJA 5BROA 1TTJA 3WO8A 4F48A 2GJRA 5CSUA 3WBEA 3KOYA 1X1OA 3U5YA 1K8XA 3FSTA 2WMGA 3CJPA 3U5UA 1PO9A 5AHEA 3TSDA 1JPDX 3VKKA 1OK6A 4YCOA 1XD1A 4ZFCA 2YBTA 2DSWA 4GVFA 4AC1X 4IUOA 3KTXA 4J3UA 4IXXA 4HBKA 2CCRA 4B5VA 1X6LA 1DKWA 4YU1A 3NWRA 2VRKA 3LMZA 4NX5A 2VC9A 2VEIA 2RGMA 4DJEA 2Q6ZA 3C8FA 4S3EA 4HKPA 7CGTA 2V6AA 3W07A 1H1ZA 1LUCA 1EJUC 1E4LA 3N2OA 4E2VA 2E5CA 5AYYA 3SAZA 2VZVA 2NXGA 1H2JA 3RM8A 3T08A 1O6IA 2QPSA 4K8GA 3WG6A 1G67A 4IWWA 4NT0A 3IGHX 1UA7A 4K1WA 4S3KA 4HPXA 1Q6RA 5G1MA 1UWIA 4DF1A 1KCZA 1T5AA 3I68A 1E73M 2OJPA 2Z4GA 3KBSA 3M0VA 2XIMA 5CSRA 3ARSA 1BPLB 3QBUA 2A79A 1HKKA 4MKVA 3BH4A 4UTWC 2ABAA 3BGGA 3LRKA 4H9MA 1YW1A 5HQMA 4UR8A 4LVFA 2Y88A 3T0DA 5DLCA 4CCCA 3VVGA 3SGZA 4Z08A 3JW7A 3BTNA 2BODX 2ZICA 4PUEA 3M07A 7REQA 1T41A 1E6SM 3M0JA 2E4TA 4HZ8A 3GVGA 1U1JA 1CGTA 3FIGA 5LGXA 3TC6A 2XM1A 4XSLA 1H1NA 3TAOA 2JKPA 1SFJA 3M1ZA 1S2AA 1AVAA 3DZ1A 4LUTB 1KBIA 1WE5A 3ZT6A 3AIVA 1RCQA 1JPKA 9RUBA 3EWXA 4G56A 2XFWA 4GH3A 3E0VA 3BAXA 5HATA 2EPKX 5ABTA 3R6IA 3MO4A 4N02A 3WYZA 3GQYA 2Q8XA 4LEQA 1H5YA 3C4UA 2QYGA 2ZQ0A 1T8XA 4X0NA 2ZTJA 4FPSA 3BDKA 4O0ZA 1GOKA 3T2OA 1RXOB 4JN8A 1OC7A 3DFTA 4WY0B 4Q4RA 1AL8A 3L4WA 1J79A 1GGOA 4OIFA 2BG5A 1VYPX 4GBDA 2XDFA 2WSYA 4MMWA 4AZIA 3D46A 3NQ8A 4J40A 4NAFB 5CZTA 1G7VA 3EWUA 3KVKA 2GGIA 1FWDC 4Y8FA 4ZTYA 1ISXA 3PSVA 3QGVA 3URQA 1UC4A 1DJYA 5C6MA 3WJZA 4IGHA 3N2TA 4LOCA 3SDOA 3UYCA 5FEXA 2CXGA 2HSAA 3DG3A 3GUGA 4BF7A 1Q66A 4MKNA 1TTPA 1WDSA 4IH3A 3CQJA 2QULA 3PZIA 1FWGC 1Y65A 3VOIA 1POJA 1V08A 2JF6A 1J2BA 3UZWA 1YE4A 1R38A 9CGTA 4BWLC 3HURA 5LIUX 2RDUA 1SZRA 4EXAA 4GIYA 1S5TA 2B7PA 4OU1A 1JUBA 4AHOA 1A5AA 4P7OA 5I3FA 3HPXA 1N8IA 1J0JA 4PMUA 3MHFA 4AD2A 4OUEA 5FL0A 4XG1A 2HVMA 1QO2A 2PGRA 2R14A 3G1AA 3H2EA 2CITA 4S38A 4OQVA 4B3ZA 2PCQA 1FWTA 1XLFA 1C7SA 4UXDA 4WX2A 3K4WA 4O8AA 5TQLA 4LAZA 3FJNA 1ICQA 1E4MM 1JXJA 4KEUA 1OBAA 3OYXA 4FOKA 1Q45A 4BHYA 1XSJA 2ZX5A 1YPFA 2PLMA 3R25A 4JHZA 2G3JA 3TZNA 4DX3A 1FBAA 3BQ5A 5KETA 4LF1A 1IEIA 4KQNA 1E5NA 1EGVA 3KOZA 3LBCA 2LLEA 4F9JA 5HMFA 3KDOA 4ZQPA 1J01A 2D0GA 3KLLA 3CHDA 5E6YA 5EPDA 4ZENA 5BOFA 4NF7A 2R1KA 3PBGA 1KFBA 3IPWA 3BOFA 1I2NA 3DKJA 3DFYA 4H04A 3GNRA 3PTKA 3R1ZA 5KZEA 5LA2A 1EJ7L 4JL2A 3NXLA 1MO0A 2BASA 1ISZA 2FZ9A 3LQLA 3VGFA 1YKWA 4ZE5A 1EGZA 5D9PA 3OG3A 3OVGA 4HU4A 4BEUA 4JTHA 2DW7A 3NQEA 4ZXOA 3S4TA 2HK1A 1WKYA 1W1YA 2P5NA 2E28A 2Z0IA 3WFZA 2NWSA 5H91A 1GVIA 1B3ZA 1NTHA 2O92A 2X7WA 1NELA 1DBTA 5CLTA 4MKSA 4LB4A 4IPPA 1MEIA 1XRVA 1EUAA 3WNLA 3SSZA 4I5RA 1FTXA 3WH9A 1S39A 2GSEA 1ZJIA 3M5ZA 4RE2A 4JTEA 5DMLA 1Q5MA 3L23A 5G4EA 2V63A 2HDJA 4ASTA 1J18A 2WVTA 3I3EA 2A4AA 2WVUA 1H09A 1SMDA 1MMFA 3RM4A 1UR1A 1V02A 2PB1A 2QGHA 1T0OA 2EXOA 3QM3A 3HV8A 3L4TA 3FDGA 5DFAA 1RZMA 1QPNA 2R6OA 1FHVA 1HGWA 2XIBA 5LNVA 3M5XA 3DX5A 3RU6A 3AIBA 5CCZA 1SGJA 3W01A 7GEPA 2FJKA 1JRCA 3WNPA 1HVXA 4JR5A 3LI1A 4K7VA 3USZA 4TVDA 4BY3A 5CAKA 1WDRA 3SECA 3IRDA 3RLUA 3QHNA 1QNPA 1QJWA 1P1MA 4DN1A 3TW6A 1XYBA 1RLDA 2V5CA 5IOBA 5A2BA 4YCPA 3W7OA 5JQ9A 2Y8UA 4O0QA 2WK2A 3BJSA 3ANVA 3GNNA 3A22A 2FKPA 2J88A 4JIPA 2X05A 1H7NA 1AK5A 2Y2WA 1OJXA 5HA7A 3M47A 2E68A 4UCFA 3BAKA 2FZ8A 3KRBA 4AD1A 1VBRA 2FPYA 2GGJA 1PZ1A 3O6DA 4E0CA 3GIYA 1W3NA 4P7LA 3STGA 1UUQA 3R79A 1H7WA 4H00A 4DNHA 5TD4A 1EP1A 1BKSA 4EIVA 2R1MA 3KLKA 5TF0A 4DUXA 2ZX7A 4LUTA 1HP5A 2BGSA 3LTYA 3GZ3A 4GZIA 2WM1A 3HM7A 1WAUA 2TYSA 4BEQA 3G1RA 4J3TA 5G2IA 1YNYA 3HG5A 1M9HA 1KGWA 1UD2A 1OGBA 3BWWA 3EWBX 4CD7A 1XLJA 1TPEA 1UA3A 1L6YA 2H6RA 2ZOXA 2YA2A 3F4NA 3G6MA 2ACRA 1H4PA 1FY6A 2JEQA 3W86A 4ZB2A 1VEPA 2NSOA 3FHQA 4WY0A 2ICSA 2EKCA 1E0TA 1EWEA 3QOKA 3W29A 3SUWA 3NDOA 4XV0A 1PB0A 1XGEA 4NAFA 2H9AB 1EEXA 2NQ5A 2D2OA 4V1YA 1BRLB 1W8SA 4O19A 4IT1A 3W1AA 5B80A 5D03A 3SCOA 2OYLA 3CWNA 2PWGA 4UNKA 3WNKA 3EWWA 5EMUA 3MDUA 1QTWA 5A2AA 1XRSA 1NQ6A 1LWJA 3B4UA 4LYKA 1ZBCA 1CGXA 3CUXA 3G3DA 1R7AA 4M29A 3WIJA 1JNEA 3IS4A 4QEEA 3WD4A 3E2RA 2P0OA 3T0AA 1EPVA 3B8UA 2WYSA 5D05A 3B0JA 3XIMA 4H83A 4QTGA 2QJMA 5GEPA 3OGVA 2ZXBA 1C91A 5C9WA 2FZDA 1XLMA 3BARA 4TVUA 1H7PA 4NILA 3WQGA 3AUJA 3PZ9A 1X98A 4C6OA 5AY7A 4A3HA 3A13A 3A4XA 3CASA 3P2VA 1B9ZA 3VKDA 4E2BA 1H7OA 2E25A 1TWSA 1H1YA 1DE6A 3PBUA 5SWUA 4GQRA 5JU6A 2OLSA 2W0UA 5BRBA 1F73A 3NDZA 4NRSA 1I0BA 3TA6A 4WR3A 3TW9A 3GC4A 4QX4A 1RJQA 3EEGA 3G1DA 1KA9F 1OC5A 1CXFA 4KCVA 1EQCA 4DO6A 3TTSA 1M68A 4ADSA 3EWZA 1VFUA 3WFLA 2ZKMX 5AZ1A 2E9LA 1ZJ8A 4A22A 1BFNA 1D7FA 4QP0A 4ACZB 3VKQA 3GAKA 2NX1A 4BI7A 1B4EA 4IGNA 4O50A 4GZJA 1UMYA 9XIAA 4AIOA 1TRIA 4C6BA 1QO5A 3IJLA 4X61A 1UHVA 5AN7A 5M5DA 2IXVA 1VIWA 3L0GA 5BU9A 3SUVA 1DIOA 1TSIA 3E0FA 3MC5A 1JDEA 3EX1A 4R5EA 1ISYA 4NP7A 1FXPA 1UPMB 4LUIA 2ZX8A 2CZVA 4MADA 1LRTA 3OO2A 1K9TA 1LT8A 2CC0A 1PEZA 1VFSA 1S2VA 4H2HA 2JKAA 1UH2A 3LPFA 4UTTA 3RRXA 3VNMA 4LYPA 3ZJKA 2CHOA 1UZDA 4W87A 1AOPA 2E77A 3DC8A 7TAAA 2OQHA 4TIMA 4JZ5A 1FH9A 3NO3A 3F2DA 1V0KA 2B81A 3W72A 3QKZA 3UJEA 4C7FA 3ISIX 3VD5A 2ZDRA 4P7NA 3RU8X 1SW0A 3SQSA 1XLIA 4RNHA 3NR0A 1P5BA 1ZY9A 4ZO8A 1KTCA 4ZBCA 4PMRA 3F2CA 2PDUA 4NU7A 3WNNA 1ZCOA 1P0EA 1UOKA 1EGMA 3PBYA 3T0CA 2WLYA 2BXYA 4FNQA 5LGZA 1A5BA 1H50A 3ITYA 3U9IA 2GJXB 4YYFA 3QKEA 4XD6A 2IKIA 1GOMA 1QI5A 4OFCA 4UUIA 1TMLA 4N9DA 2PMQA 3XINA 4CQ8A 1AQFA 3VM1A 2XGZA 3VM5A 3VLXA 3QLLA 2WMHA 1WDDA 4A05A 2CBIA 5DCBA 3W74A 2Q01A 2XH0A 1FFQA 3IARA 2WJDA 3U57A 2PURA 5JH1A 2IKHA 3BW4A 4O1EA 3APGA 2XVNA 1FKWA 4L4OA 3W23A 5D4YA 4OT7A 5H8MA 1XH2A 3GE7A 5FF3A 4LS2A 3HG2A 4M56A 4MUPA 1FWAC 2JK2A 4RL3A 3THUA 1NOFA 4K39A 1YDNA 2WKLA 3UVAA 3VCNA 4WGXA 5JH2A 3M5VA 3PVFA 4X2PA 4TU1A 3F1QA 1F3WA 3VILA 4RNFA 3KVLA 3OGSA 3WH8A 1UW9A 1NOWA 4LVBA 2ZUMA 3LK6A 4HNLA 2EEXA 2ZADA 4E6MA 2IXUA 3ZWSA 3TJ4A 4FS9A 3O05A 4I5UA 1IR2A 5JBFA 3EA1A 1LG1A 4AHQA 3DHUA 4B16A 4HP5A 1GOIA 3GB6A 1KTNA 4QCEA 4MPQA 4Y96A 4CEXC 1W3IA 4I7VA 4D6GA 1ZQ5A 2RKXA 5AOPA 2GGGA 3A3WA 4KEMA 3KE0A 1BGAA 1AFSA 4Q3MA 4WHBA 2CERA 3VFCA 1VFLA 1XLDA 1OM0A 3ZJ8A 4GYFA 2E6DA 2YGYA 4C6QA 3VMOA 4PUWA 1IEVA 3TSMA 1HT6A 4Q4QA 1JCYA 1B3OA 3CUJA 5K7JA 5BXRA 3TX9A 3GDKA 3NSXA 3QY6A 5HWJA 1TV8A 1FCUA 2Z7KA 2I56A 5A6TC 3N9SA 4X22A 4XTIA 1FVPA 3S5SA 4HN4A 1HJWA 3IGXA 4MTVA 1H63A 4FR6A 4O1CA 4O53A 3P84A 2X7VA 2H9AA 4AX6A 1QMLA 4HTBA 4GZ7A 3MKKA 4MYXA 3VLYA 4D9PA 4AWTA 4UTKA 1BRLA 2JGYA 1XSKA 3HPZA 5D2TA 3TJXA 2RGLA 3CK5A 5CGTA 3BLPX 2J25A 4IP4A 2NLYA 2OWWA 4UMCA 3F7JA 4DM2A 4AQLA 2GDQA 4UQ9A 4I9TA 1AMKA 4QNEA 1SFLA 4QGCA 3V0TA 3VNLA 1KRMA 5I6SA 2VRJA 2V5JA 5LA0A 3POHA 1NOUA 5TIMA 1WV2A 1TJ0A 2GGHA 1HL2A 2E8ZA 3MMDA 2VD8A 2WC3A 3P93A 1B30A 3AOFA 4GJIA 3TR2A 3EWYA 4MLRA 1B57A 3TIMA 4A3YA 3PM6A 1O1ZA 1OCBA 2ZA1A 3OR1B 5AYZA 5ENLA 1VRDA 2XZ7A 2PP3A 3G8EA 3HJZA 3O8AA 4IOTA 3QSTA 2RAGA 1P0DA 2ZRVA 4HPNA 1UBPC 3HQPA 4M8UA 2FVLA 1T96A 3ZJ7A 4IGMA 3UWYA 1FHLA 2C0HA 4MB3A 5D8WA 5CBJA 4EANA 4DRSA 3IIXA 1FCVA 1ZL1A 4PL1A 4HCLA 3THAA 1UP3A 1ZP3A 4OECA 2DH2A 1YEYA 2PWDA 4IXHA 3A5VA 5F2GA 1HL8A 3LHTA 1F3EA 1J0KA 5BYWA 5LIKX 1LL6A 1XL9A 1N82A 2JFEX 4ZGYA 4KEVA 1BTMA 2AGKA 4BF5A 2GQ9A 4ACZA 3G0XA 3OGRA 4BR1A 3UY8A 1W3JA 1X38A 1YXYA 3LSCA 2WMKA 4GBUA 5BWAA 4J2MA 3N4EA 3NQGA 2DZAA 3GH4A 3OP2A 3CHEA 3WELA 3VMNA 2JKEA 1O95A 3W7QA 3CAQA 3OLIA 4JFSA 3EXSA 2ZRWA 2QV4A 3TQ0A 3FW6A 3VK5A 1HN1A 3B0YA 2GL5A 1RQHA 4GYPC 2VZUA 3S9IA 4NJIA 2D22A 4WD0A 5CPOA 1LOLA 2WQDA 3NEVA 2WOQA 1G4EA 2WM0A 5LIWX 1IV8A 3C5QA 3LGDA 3E2QA 3H70A 3VGDA 3ITVA 3GNPA 2YB4A 3G1XA 5DT5A 4GQBA 4IF2A 4JQ3A 3SCPA 1W1VA 1E43A 4XZMX 5U4NA 3IV3A 4Z1YA 1IEWA 2JQXA 3OTRA 1E4IA 1K4HA 2XVLA 3M9YA 4HU3A 4WIWA 4XISA 2ISWA 2DSKA 3UG8A 1YADA 1RBLA 2GJXA 3RUBL 1E6RA 5DO8A 3LYEA 3JZUA 3UZYA 1NFPA 5A2CA 1TJ1A 1YX1A 3DFPA 4IFOA 1EFZA 1TZZA 3RO8A 3AS0A 4WCJA 3QJAA 4O4VA 3TJIA 2KX9A 1MZRA 3SO7A 2E9MA 3IVTA 1HKVA 2IPGA 3V75A 1F5ZA 1JZ7A 1S5MA 1V0NA 2OXNA 2DVUA 3GTXA 2BVWA 3U3HA 4ATLA 4LCQA 4NASA 1PAMA 3TCEA 3FLUA 4N0RA 1X97A 1ECEA 5DELA 1VLIA 2XWDA 4S3GA 1IXQA 4BA0A 3NSMA 5BU6A 1SZGA 4BQ3A 1OFPA 1TPFA 4OTKA 3HG3A 3DG6A 4JFUA 4YTRA 3C6CA 2ALRA 1PTAA 3VO0A 5M17A 1MYRA 2Z00A 3TVAA 2XIJA 2XH2A 5A1AA 3T44A 2ZZ6A 4UB9A 3VD3A 1EDGA 4DXXA 1G6CA 4C60A 1CGWA 1T6MA 4Q33A 3SY5A 2J27A 3L67A 4A6GA 2PBGA 4HYVA 3TXVA 1PIFA 3LCFA 2PDPA 4GHRA 1V3LA 4JTSA 3VKPA 1EXBA 1PIIA 2NV2A 1XP3A 3VDGA 1L8NA 3PZGA 1ADOA 3QMRA 2OX1A 1LROA 2J24A 1AJ2A 5LSMA 1QDSA 1D2KA 2V30A 3SBFA 4KS0A 3KP1A 1UC5A 1QNQA 3MBDA 2XVKA 1NU5A 2JIWA 3G6LA 2VX6A 3A12A 3B8DA 3V5OA 3FVDA 4UTWA 4KBXA 2YB1A 3CO4A 1ITXA 3DCPA 4H9ZA 4NNCA 4MWAB 3VZXA 1TJ2A 2WPBA 2OFJA 4KCUA 1P4CA 4JEJA 5HWNA 2G41A 4BJHA 3NZ1A 1RJPA 2UY4A 4W93A 1BD0A 1OADA 1YNQA 3M0HA 1Z41A 4N6EA 2DIEA 3EDKA 2DP3A 4WSJA 1HL9A 2V3EA 4EAYA 1HO1A 3SUTA 2P8BA 4P2VA 1AQ0A 1QI2A 2PGEA 1I8JA 3B97A 3R4IA 4X9SA 5DRCA 4HTYA 1QBAA 3IV8A 1GJUA 3SCRA 4NNAA 3F5KA 4P8UA 2R1PA 5MF5A 4MJZA 1KQZA 3LX9A 2W9MA 4JFVA 1DJNA 4GCXA 3GKFA 1F6YA 2A6LA 5E9AA 3N2BA 3CAKA 4AD0A 3WMLA 3B9EA 2ZE0A 3NURA 3GKAA 4M82A 2CEQA 4JCMA 3AXXA 5A69A 1GOOA 4QSFA 3CQIA 3QZ6A 4GH1A 5E93A 1ICSA 2Z2AA 4RNJA 1SZEA 4H3DA 2HROA 2QJGA 3VGGA 4L9ZA 1Q7MA 4F2BA 2R1LA 3EB3A 3LSBA 2ZVIA 1SO3A 1OD8A 2VR5A 1K4GA 4RK8A 3OR1A 3CLWA 2IQDA 3IJIA 4GFIA 4I8YA 3RF9A 4B2DD 4FA3A 3C3NA 3KCJA 4J9JA 3QRHA 1ICPA 1YDOA 1RR2A 4H9XA 3LG3A 2OT1A 4Q6XA 3S9YA 3ALGA 1E56A 4CQBA 3UYIA 3N9RA 1XXXA 4C6JA 4B4HA 1ZGDA 2CETA 4Q6JA 3WF2A 5D38A 2GSJA 1HX0A 1W5PA 2I5GA 3MY9A 4BK9A 2FH8A 1Q13A 3ZYZA 1FWCC 4Z2GA 1VD6A 2Z25A 2G50A 3S1GA 5C9RA 3U8GA 4HD5A 2TSYA 1UD3A 3BLKA 4PUDA 1V51A 4U31A 4ZR8A 4BWLA 1F9CA 1EYWA 3UPBA 2UY2A 3D3FA 4OZOA 3NGFA 2EG6A 2W91A 4US5D 4IFKB 5IFPA 4LVAA 2OEKA 1U1UA 4A2SA 3B8SA 4NKCA 3H53A 3AISA 1AA1B 2PDMA 2VR2A 2NT0A 3TMLA 1GEHA 4CD6A 1EDQA 2O9RA 3CZGA 3DBPA 5I3KA 3RX2A 3ZZ1A 1W9DM 2PDYA 2C6QA 3KCOA 1NFGA 1UBSA 1OGGA 2HRWA 1RD6A 1Y7VA 1XRTA 2WSPA 4ZODA 2J7HA 4GNKB 5EBAA 3CUGA 3WK1A 1XLBA 3W7EA 1Q3NA 4B5TA 1TPDA 3TYCA 1XYZA 4J5NA 1E71M 1BG9A 4I6KA 3ZLFA 3G1VA 8GEPA 3WF4A 1KLZA 3SCTA 3ALFA 2Z2BA 4BCEA 3K5XA 1G4SA 4H8UA 4WY0F 2ZZ3A 4R85A 4PMJA 2CU0A 4PL2A 1GVEA 4J27A 4LYQA 1GZ1A 2GDVA 1JZ3A 1QUMA 3TWBA 5XIAA 1XIFA 2FTWA 2WC7A 4NL1A 2D69A 4PTXA 1RK5A 3OW1A 2ZFAA 3WQDA 4PTNA 1JZ4A 4GVGA 3A6OA 1VLWA 2DT1A 2CLOA 3U7VA 1JGMA 1J93A 1G94A 1GYNA 3UZJA 1UJPA 3Q45A 1Z32X 1DP0A 4DELA 2Y63A 3GVQA 3SJNA 1VRXA 3MANA 2DZWA 3N15A 1Q65A 3RCNA 1Z8AA 3VGBA 1L8PA 3O07A 2VGFA 3PFMA 3EA2A 5HWMA 3BAYA 4C6EA 1ZENA 1T8QA 3EZ4A 3N2MA 2Y62A 5FL1A 1K8CA 3EX4A 3PK7A 3ZSTA 2ZUTA 1EXPA 2CLFA 1UUOA 3WKZA 1XI3A 2VGGA 3R12A 1F7BA 4CNOA 4IL2A 4PMNA 1HKWA 5D2YA 4GEPA 1J0IA 4XK2A 4UFHA 2XN2A 2QCHA 2POTA 2AL1A 2C1IA 3DU0A 4KRUA 3BC9A 4WJ8A 3A4WA 3W2KA 3CM4A 3GK0A 2E9BA 3OBEA 3PPFA 4AIEA 3OJGA 1PBGA 1J0YA 2WJFA 1SZNA 5C2CA 3DFNA 1V3KA 3NNTA 5I23A 4J28A 5M1TA 4XKYA 1JYXA 3GH7A 1I0DA 2WQPA 5CH9A 2XFFA 3VYLA 3CC1A 4CNNA 3VM7A 2C3ZA 4GE8A 2QCDB 1RPKA 4AAJA 4X2RA 3VTRA 1E15A 4DO4A 1UJQA 3MHUA 1BHGA 1CBGA 1US2A 2J9YA 3ZOAA 2KZHA 1XR2A 4MWAA 3PFRA 2VI0A 3LA4A 1OYCA 3OQEA 1EF3A 3H8AA 3CNYA 4I7UA 2ATMA 3QGKC 3ARPA 3QXBA 3MP5A 1A5CA 5BMXA 2FZBA 1ELSA 2ZUSA 1WZKA 3KDNA 1MQPA 4TOQA 4YVPA 2FLIA 5DXXA 3H54A 4Z2IA 4Z1CA 2IKJA 5E0CA 2XISA 3RK8A 2PC4A 4HNTA 5FI8A 2Y5SA 3QQ1A 1P43A 1TRDA 4JIQA 4HN8A 4G7FA 4YHEA 1CGUA 3S3GA 1XJBA 4AEEA 2EPMX 3OYZA 2NQZA 5AOUA 1REQB 3W85A 3VOGA 3MWCA 4PODA 4QG8A 5AHFA 3S2CA 1Q6FA 1U30A 3ARQA 1OSEA 1E6QM 1OHLA 1QPOA 4PULA 1UUMA 4RUBA 1OFBA 4P8XA 5A6BD 5JBEA 2GOKA 2PLJA 3WH7A 2AMGA 2A3LA 3WLTA 1TIWA 3ME3A 4I8DA 4R33A 3CGTA 5DMMA 2PDKA 3VIGA 2ZRXA 4F9DA 4UMBA 4X9YA 2PDNA 4N9CA 4HU0A 2HJPA 2X1SA 2DZVA 3RPDA 3G24A 1KM5A 3EPMA 3KWXA 4GI4A 2QPXA 1S5NA 3AU2A 3Q94A 1IGSA 4XD4A 2INEA 2F84A 4ES4A 1XPYA 2AKZA 2AQOA 3MMWA 3WEZA 2WLZA 3B40A 3EOSA 4JQAA 4JTIA 2XIIA 2VCCA 4QJ4B 4AZCB 4NHVA 4ONVA 2GJLA 3WLHA 1VFHA 3STCA 3IIVA 1FH8A 3SM0A 3VUPA 1FHDA 4WDXA 3MWAA 2OWXA 1RY0A 4XD3A 3V3WA 1VPQA 1AW1A 1X8FA 1MNSA 4LNYA 1ADDA 4Q22A 4UTMA 2EJAA 4IFKA 4HNOA 1C29A 3LBMA 1PYMA 3WLPA 3M0YA 3IJ9A 3MUAA 3VIJA 1Z3NA 3N73A 4XZNX 2OTDA 5HAOA 2PRLA 2VGIA 4GJJA 3BAIA 5A8GA 2P88A 1SR0A 5AHLA 2RFGA 3SR7A 1NIUA 3VDAA 4M51A 3NPUA 4AZGA 3PUEA 4A21A 5C7VA 1GW1A 3CS2A 1TYGA 4AWEA 1IHIA 2UBPC 4EPDC 1NWSA 3FVMA 2PWHA 3W1NA 1H7RA 2VUYA 4BQ2A 2GQ3A 1FWBC 2V2HA 1NM9A 3B05A 1JCJA 4GUGA 3SGGA 3UA4A 2I16A 5HMSA 2ISVA 3NVTA 1FQ0A 3QC3A 4U5KA 4KERA 1TVNA 3BAJA 3PJXA 4AVOA 1OX6A 1GG0A 1UROA 4MB4A 1XCXA 5A6SA 1JCTA 4UTLA 2Y7GA 3NPWA 2J74A 4J7RA 1O68A 4N7QA 1TUFA 2QJNA 2HBVA 4IMAA 2DT3A 4Z0SA 1OF6A 2DH3A 3LGEA 1XIEA 2YCKX 1J96A 2BTMA 1J8VA 2VZTA 3PJWA 3KL5A 4MUZA 3BCFA 2XIQA 1UWAA 4HU8A 4BF9A 4DZAA 2Y8KA 3V0UA 7A3HA 4AOPA 2OGYA 8XIMA 1E6XM 5LXXA 1EP2A 3PANA 1ZCCA 3FHAA 4JKKA 3KBNA 4MFEA 1VR6A 2HVNA 4YTTA 3T81A 4B9YA 1A4LA 3W1RA 1H3GA 3RYSA 2POZA 1YHTA 3GR8A 5JUVA 1WNOA 1U22A 1ZBWA 5EMLA 3WX7A 3E49A 2NW0A 2Z27A 1MQQA 3KTSA 3B9DA 1I2RA 4L1GA 1GQIA 3MMBB 3LU2A 1EZWA 4JX5A 3IAPA 2WCSA 3HG4A 1JRBA 1SW7A 2I57A 2JF7A 1OABA 4O16A 2OKTA 4PMYA 3NCOA 2W4XA 1HG3A 3QV9A 1WDQA 1GOXA 3TC7A 4AXKA 2PDQA 4H41A 2GZXA 3WUGA 4QLLA 4LBSA 3U0HA 1HVQA 3RX4A 2AOPA 3C0JA 2QCDA 2ALDA 2F8QA 1L6GA 1GVRA 2FH6A 2PLCA 3UWUA 4TV6A 1JEZA 1IXNA 3NO5A 1BXBA 4D6JA 1TCDA 1XUUA 4WJEA 3T9PA 1A5SA 5F1VA 1H5VA 5AC6A 4K38A 3ZLGA 3RLVA 4M6VA 3T07A 3AS1A 5CSSA 3LV5A 4PMZA 4HGXA 3EX6A 4PMXA 1CIUA 3ZFHA 3JR2A 5AKQA 4PFHA 1XC4A 3W7HA 4LNCA 1DJIA 2GDUA 3LDVA 2BDQA 2FIQA 3C2EA 2XVPA 3RIKA 1QWKA 3BOXA 1UR4A 4GY0A 4MLJA 1WA3A 3OA5A 1DWFM 3W1MA 4LW7A 1KWGA 4MDOA 3CPRA 4H9UA 4XO7A 4ZB0A 2NUWA 8A3HA 3Q2DA 6REQB 1CXIA 4ZSUA 4NRRA 1REQA 3F4WA 4FNPA 1KRAC 3M5YA 4HYRA 4QSHA 1LBMA 1F4AA 2GQ8A 4PCFA 3ZXWA 5LNSA 3ENLA 4NG3A 3TONA 3RM9A 5A5WA 1Q6QA 4A29A 1A80A 1PHQA 1Q8JA 2E7FA 4B9ZA 3HOJA 2OR2A 3SIZA 4EPEC 3HQOA 2MUCA 5AZ0A 1JI2A 3CTLA 5D9NA 1I1XA 3WMCA 1V6YA 3EKGA 1PL9A 2QUVA 3C61A 3USBA 2G3NA 3VU2A 3VABA 2VFEA 4LVGA 7TIMA 1IXPA 1KM3A 4ZOBA 4ENLA 2CLEA 3E02A 4UQCA 4NZ1A 1XD0A 1LTDA 2EBNA 1IT0A 3GLCA 3RXZA 4WSKA 4QG9A 3TQKA 4LALA 1KCXA 4H19A 1R9ZA 1LG2A 1P7TB 4GGBA 1OCQA 1VYRA 2OB3A 1GQLA 3PG9A 4AZCA 1K6AA 3VMPA 3MI6A 3W1TA 3WDPP 1GQNA 4N9BA 4ADTA 3KWSA 2NXIA 1XG4A 1WBHA 4CLMA 1A3XA 2X2YA 2E09A 1P0NA 1UZ4A 3MUCA 1LDCA 3SRKA 3JS3A 4LJ3A 3CMJA 2D3LA 3T0BA 1KFJA 4DZHA 1I2PA 3GC5A 1CT5A 1FWSA 3GTHA 2EPNA 3WDJA 3GDRA 4D1IA 4NXKA 2A7NA 1XFBA 3DKLA 3FOKA 1O4UA 2WHLA 4GY1A 1F8MA 1P48A 4UNIA 4DPQA 2V82A 3HJEA 2D2HA 5L9FA 4O14A 4MIMA 1Z44A 3W1XA 4MNMA 3SN0A 3UETA 1VFOA 2ZUNA 1RPXA 1EWDA 2ZRUA 1G0CA 1M03A 1DTUA 4M3PA 2PDFA 1OD0A 3SFWA 1OGSA 3ANYA 4YJ5A 3NQCA 4H6EA 3CEPA 1CB2A 3QH2A 2OEMA 5HINA 4XSMA 2GPTA 3L21A 3EB4A 4DIAA 2CZFA 4DF2A 2FZMA 4UWMA 3A5FA 3PBVA 3SCSA 3QHOA 1EHNA 3F2BA 1QPRA 4D2JA 4C5ZA 4JIIX 1B2YA 4NAEB 4Y7EA 1Q2RA 3UCQA 4O10A 4HHPA 4YS1A 1LORA 3B9NA 4MYAA 1W6TA 2WBGA 2WZHA 5T91A 3W70A 3FAWA 1RV8A 4ZOAA 1F8IA 1EL3A 4N6FA 4GMEA 3HFYA 2FB3A 5CPMA 4U5IA 4GYPA 1Q6CA 3E1F1 1DJWA 4PB3A 3NXFA 4RW3A 1MQRA 2VEGA 3N6HA 1VP5A 2D73A 1FXQA 3WUEA 1DHKA 3VXGA 5LIXX 3PNUA 1TQJA 4IHCA 2PE4A 4S3DA 4LAMA 2OGJA 3STPA 2VRQA 2Z2UA 2DUZA 2AQVA 1J0HA 2CZDA 3AZRA 1PX8A 3LXAA 1JIBA 1JYNA 5CQ1A 3F4DA 3UJSA 1WZMA 3UPMA 4HNVA 4A4AA 1QHOA 3GVVA 1W9BM 1RVKA 3WLJA 4UQBA 2V8ZA 3AJ7A 2JIEA 3MMBA 4BI5A 3P5YA 1YQ2A 3K30A 1E5JA 2E67A 2WB5A 4C6MA 2V4JB 3NZPA 1DVJA 4GOAA 3O15A 2P8CA 2FTPA 4IPNB 3MKVA 5IHSA 3ABQA 3GW3A 4KKXA 4KESA 4ZOEA 2HE8A 3H21A 4P8VA 4F66A 2ZBTA 1E9ZB 4AYGA 3QQ0A 2I7GA 3OHIA 2NVDA 1OK4A 1F3TA 1J11A 4DO7A 3MKCA 4E8GA 1M1BA 4P5UA 2VXNA 4PBGA 3G77A 4QS6A 4KWVA 2DIKA 4W8AA 2WSQA 2ISFA 2V3DA 5M03A 2BSLA 3WBWA 4Z2LA 1R86A 1Z48A 3B04A 2NQJA 4ERGA 3GU2A 1E51A 3N14A 2PGFA 4YWSA 1DHPA 4MY8A 1YXCA 2PRHA 5MHBA 2O4QA 4ZQNA 3II1A 5C5YA 1W3KA 1KM4A 1RAKA 4IJCA 3W27A 4F79A 2QDEA 2PTDA 3KOXA 1EA9C 2CKRA 3TU9A 2PS2A 4MJ4A 4IGSA 4IIHA 4GFSA 1UQZA 2XFRA 1TELA 2GYIA 5I0DA 6REQA 3MI3A 3SGUA 5J04A 1AODA 3NSNA 4XAPA 1PCWA 3PN8A 5A3HA 4HK6A 3IJ8A 3SADA 1DQUA 5IBXC 2VEPA 3GIPA 5ABHA 1PIGA 1XIHA 3CWOX 5FJRA 3W82A 4V1XA 5IHRA 4GG9A 3KRUA 1XC6A 1XCFA 1W5NA 3GHSA 4XUGA 3AHTA 4RE4A 4EWND 4CGTA 4H4IA 4JTLA 3NQ2A 1C9DA 3NYDA 3E0WA 1KFKA 5CC6A 3HFTA 5D33A 2Y6ZA 6TAAA 1NDZA 5FEZA 2WJZA 3LHUA 3GTNA 4QDMA 3WMBA 2A3HA 2D1ZA 4ZB5A 1QI3A 3AFBA 1OB0A 4JKMA 1BVZA 5BMWA 3UNTA 5FIPA 3BQ6A 2HPMA 4C91A 4O57A 2X09A 4WZHA 3GFXA 6TIMA 3KUMA 3MSGA 2I14A 1TQXA 1ZRQA 4RDVA 3HMCA 3O06A 5HQEA 3S1WA 3HIJA 2C18A 1P7TA 3LBOA 1X96A 3N3TA 5FSEC 1KGUA 3L12A 1KW1A 1LBFA 1QNSA 3IRSA 3S42A 1UZ1A 3VGHA 4L64A 3VD7A 3BO9A 1N8FA 3KS6A 1YYAA 3BXWA 2YW3A 1W1A1 1AZ2A 1IYXA 4CKQA 2C15A 3TAKA 4B3KA 3CTTA 1XIMA 1JZ2A 1WZAA 1R7OA 2DSUA 1V93A 2RHGA 3BANA 2EO7A 3ZMRA 1O7AA 3AUOA 1KWKA 3QTGA 4JICA 4JTAA 3RILA 4O4WA 2WW5A 1XM3A 4ATWA 1QU4A 4X60A 4FX7A 4LXFA 2IQ0A 1PKNA 1MUMA 2DJLA 3WLKX 4NZCA 2PDGA 3I7SA 2PDCA 2CLPA 4HVXA 3E0IA 5C8BB 3KHJA 4MZ8A 4HPHA 5AVNA 4LUSB 3TW7A 3WMSA 3PZVA 1GHRA 1X6UA 1GNXA 2PU1A 5LNWA 3V7PA 2GOUA 4R3UA 2EPOA 1KKOA 2V3FA 2D0FA 1NDYA 3MS8A 4LU0A 3UXLA 4HOZA 1CLKA 2RDXA 1BWKA 1KO0A 2GJNA 4AZ5A 1B3VA 3PB0A 4UTHA 5EB8A 4JIHA 1V6VA 2ZWYA 3M64A 2GVEA 2Z1KA 3LY0A 4NAEA 2QPUA 1ADSA 3LCXA 2BY0A 5J5DA 1IIGA 2VC5A 3H2AA 4Y9PA 3R13A 5D2WA 4DWSD 1M04A 5H1WA 2XGBA 3GG0A 3WLMA 1KFLA 3TWAA 1GEQA 3O9NA 1PZ2A 2A3BA 2WO5A 2ZX6A 1P1XA 3NL3A 2OEJA 3KBWA 3SCVA 2OPJA 4Q8NA 1GPFA 2BOEX 4AY8A 4HK5A 4J3VA 1L2UA 2VENA 2YA0A 4CEUC 1MW1A 1YTDA 2E0PA 3CLMA 2AKMA 1KQYA 1OIFA 3DOPA 2JEPA 1LF1A 2YXXA 1OZQA 2VJXA 8RUCA 5FKYA 3NPXA 1PHWA 4HIBA 2H3DA 3R8GA 1GKRA 4IQEA 1EO5A 3P62A 1KB3A 7ODCA 3WLNA 4MM1A 1TMQA 2EKGA 3LD5A 3FJLA 3LPOA 1UCWA 3U4FA 1JUEA 2V4JA 3F4CA 1FCQA 3MCOA 1QNVA 3K8KA 5AC5A 5DQPA 3LB0A 1Q63A 4Z1AA 1E9IA 2E1DA 2G3IA 4L65A 1DXEA 4PRRA 2ZCGA 3WEMA 3KBVA 1H41A 1OX4B 3L4XA 3GR4A 1K77A 3QV6A 1HXJA 2OG9A 2QUNA 4O1DA 3N29A 2XJ7A 1VIZA 1VCVA 2DFAA 3WQPA 2BP1A 2XSJB 3EGJA 1CXEA 3UR8A 1RBOB 1PJ9A 4DF0A 3E96A 1LQAA 3MUXA 3CHCA 1L6WA 1SZFA 1VBJA 3R8RA 2DQWA 4C65A 4NZ3A 4BKNA 2ZRZA 3BLOA 1XDLA 2D2JA 5DBUA 4D6CA 2DW6A 2V3GA 4LUJA 3WF3A 3MMCA 3UBPC 2NQ9A 3VOJA 1QI4A 4NXSA 4C1NB 4W9TA 1EQPA 4AB4A 4K1GA 1FWWA 1A5MC 3SQMA 2OQYA 2NX9A 4BFAA 4YNGA 4JYFA 4CCDA 2QJJA 2ZX9A 1V3IA 1XYFA 1O5RA 4IFRA 3ARZA 1PKMA 1T40A 4K37A 1TWWA 5CKSA 4JD4A 1DE5A 5A6KA 4XIMA 4WXYA 5D04C 4PN2A 1XHGA 2QIWA 4ORMA 4S3JA 3DFOA 1ALDA 2QVNA 1DIEA 1Q6OA 1BF2A 2DGAA 2CLKA 4GC4A 2INFA 3W24A 2E5DA 3W3OA 3WK3A 1TO3A 4D8AA 2Z1BA 5C0QA 2VMFA 3ES8A 4CN4A 1JGIA 4OBSA 3THDA 3CL7A 3A9IA 2Z28A 1W31A 4CNPA 3F03K 3L0NA 3L4VA 1KC7A 1GKQA 1JUKA 5D8ZA 2P3ZA 3GTFA 5BRPA 3S2JA 3NQAA 6XIMA 4Y6GA 1G4PA 1G01A 3B8WA 3VDHA 4O15A 2VFDA 2QVHA 3THQA 2NSXA 1XSIA 2DY3A 1BYDA 3OZPA 4GXPA 3GDMA 3RR4A 3PAOA 1W1TA 2W63A 3SUSA 4ZTXA 4HPJA 4Z2HA 1AMYA 3T05A 3W71A 2V69A 3P8IA 2REQB 3P80A 4JFTA 3UNDA 4K68A 4RDWA 3PUOA 1CTNA 2XIOA 2X0YA 5TNVA 4QE5A 1UR2A 3TTYA 3EKLA 4GQ0A 4Q8VA 2XINA 2BS9A 3AYVA 3POCA 1N55A 3MCNA 1EF2A 5HMDA 2CBUA 4JTRA 1A5OC 4GABA 4E3VA 3BUVA 4LUSA 5DN1A 1A3WA 2OU4A 2OT0A 5CJ5A 1Z9AA 1LRQA 4OV9A 2ODOA 5I79A 1OFEA 4M5PA 5I78A 3QGAC 1IEXA 3HTWA 4WKHA 3EDFA 4L7ZA 4B5XA 3FYPA 2BHYA 3EXTA 3AHVA 1DOSA 1QOXA 3W26A 4D1JA 5I3GA 1MW2A 6A3HA 4FEZA 4UR9A 3IIOA 1MFUA 1WCGA 4FSAA 5HR6A 1QXLA 1EOMA 4D8LA 1B3WA 3NEHA 1EA0A 4JN6A 1B90A 3LZ5A 3LPPA 3BGJA 1C8XA 4HOXA 2QQ6A 5CAHA 1EJXC 5CXPA 3W81A 4DYJA 3CWHA 4IIGA 3BK0A 4B2DA 4PTDA 2W92A 1YE6A 1O5QA 1A5LC 3OR2B 3DFHA 4UQAA 4G7EB 1JAKA 1VEMA 3QFEA 3LTSA 4QBXA 4KWOA 3AYRA 4TTGA 5EU9A 5EMKA 2PPGA 4JTKA 1D7KA 3P3BA 4JCLA 1THFD 4GQQA 3OEXA 1HJUA 4GC3A 3EKZA 3SCNA 4Q4KA 2V5LA 1UWQA 4RE3A 1ZHAA 3ARRA 3B3DA 2X41A 4QAWA 2VUNA 3O6AA 1I9CB 3P0XA 2FGLA 2QEZA 1Q2SA 3QF0A 4M80A 4IIBA 4US5A 1GW9A 3QN3A 1IE7C 4IIEA 2F6KA 3MB9A 5EGRA 3BSMA 1M41A 3SZ8A 4DLMA 1E3ZA 3PZQA 1H61A 2W3ZA 5BCAA 3WK0A 3URBA 2BZNA 4M6UA 1QK2A 1LWIA 5REQB 1W5QA 1ZAJA 2GQAA 3EMQA 3MHGA 4O11A 2INZA 2CESA 5CGMA 2CLHA 1OX4A 1V4YA 4ZO9A 3VIOA 4H9TA 2O4MA 3QOMA 4MJ2A 3PWIA 4DWSC 2V5BA 3N18A 3EOUA 3WCZA 2H3BA 1UB3A 2XSJA 4UIOA 3MI2A 2VDIA 1CXKA 1BGGA 2SFPA 2O9OA 3OVQA 3GEOA 2PWUA 2Y1HA 4QCFA 3MW7A 2OCZA 1AQHA 3U6WA 2VKZG 3B0UX 4W4QA 3SI9A 3UG5A 4B5WA 3GXDA 3FDKA 4RLIA 1GK8A 3MSDA 3WD0A 1ME7A 3T8QA 1KM1A 1LLWA 3DBNA 4FNUA 3JRKA 4B3LA 3FA3A 4MDPA 4AWUA 4G2DA 4FF7A 3C2OA 5EMJA 4LTSA 4C1NA 3VOFA 1DPMA 1W32A 1BXCA 8CGTA 5KINA 2J8GA 2XSXA 3KVMA 3AOPA 3AS2A 5E1QA 3UWEA 1QPQA 1JI1A 4ZMGA 4G1NA 1KBLA 3OODA 4FAMA 3Q65A 4WK9A 4W7WA 3N4AA 1I6NA 1ZJ9A 5RUBA 3HO8A 3W7KA 3ICJA 2NV9A 3IGUA 1BF6A 1CW2A 3H55A 3W83A 4I90A 3VM0A 1PVNA 4GPNA 3INPA 4S39A 4JS3A 1RHCA 4OUIA 2O55A 3IUHA 1A5KC 1UD8A 3E2SA 4XVDA 3CV2A 3LQGA 3W22A 1SO5A 4CQ9A 3HGRA 1PCKA 4OHQA 5FESA 3TNBA 3EMCA 1UKPA 4LRTA 4TV5A 3T40A 3W7CA 3KL0A 2BHUA 2GVLA 3AWNA 2VHLA 2VCBA 4WRHA 2A6NA 2QS8A 3W75A 1A5NC 2HMCA 5I7GA 3K13A 1E1FA 4JTUA 1K7XA 3I6EA 2OYMA 4F0KA 3WQ8A 2WHJA 4W85A 1W9VA 4RXFA 1KLYA 3PPCA 2W6RA 2CHRA 4NIRA 1ZU8A 4C6KA 3WJYA 2ZC1A 5A6LA 1RCOB 1MXSA 5BXSA 3URAA 4JOMA 3T2PA 4C6PA 2ZUWA 1CWYA 2WKJA 3LHZA 4YTSA 4J1OA 4MWAE 4EF9A 4OE7A 3IGSA 5KEZA 1ZJHA 2RJHA 4F40A 4E2DA 2VDGA 2PLKA 2FVMA 2REQA 1E3XA 2OOGA 4E38A 2XM2A 2IQTA 4O0KA 2J8FA 3MCMA 4RV3A 3C2RA 2X16A 1XF0A 3I3BA 2E1WA 3BLLA 3LN3A 1YDVA 3HGSA 5I3JA 1IGWA 1AD1A 1KM6A 3E5BA 1WUFA 1OC6A 3O6YX 4PYSA 1X1NA 2VTFA 4QQUA 4EWJA 3PPHA 1VZWA 1W9UA 1Q6EA 3REQB 3T8LA 2AAAA 1GZGA 2VT0A 3K2GA 1WOBA 1O12A 4J3XA 2YL9A 3LRMA 4TMCA 3QR3A 4UOZA 4XO6A 2A5HA 4RZ4A 1AQMA 4DXKA 5A6BA 1MSSA 1GOQA 3WF1A 3KW3A 3M0ZA 1C8VA 1PYFA 2PTXA 3WLOA 4FNTA 1BWVA 4IIDA 5F4SA 3MM5B 3ZLHA 1KR0A 2J7FA 2OZ8A 1ZP4A 3GBEA 4DBUA 2CFFA 1WKFA 4LYRA 2YSWA 4HHHA 1GWJA 2YCJA 3GX9A 3H7VA 1UPPA 2XG9A 5A8QA 4G9PA 5LYRA 1B4KA 2VFGA 3HMJG 3WDRA 1ONRA 3R2GA 6ENLA 3CZKA 4A2RA 4W89A 3V1HA 3OR2A 3BW3A 4G7EA 4C5YA 1UKQA 2PZ0A 3KOFA 1W2PA 5KTLA 1QK0A 4G39A 1JCLA 3BURA 5CC3A 3GFYA 1EC8A 2Y8VA 1TPWA 4PSPA 4ICCX 4E2OA 3AXHA 3U2ZA 4L1XA 1PZ3A 1TV7A 4NJJA 5K9DA 2W66A 3HB9A 2NQLA 3B4YA 3EX2A 3E3HA 4LAOA 3TK7A 3SCUA 3N6JA 3W7MA 4JQ1A 2XH4A 4F0RA 3EPNA 1E1CB 2WSKA 3KBJA 1HGYA 1GQJA 4XZWA 4ROQA 5EKYA 2WPGA 2BY3A 4DLFA 3QPEA 2QUTA 2CLLA 5REQA 2ATSA 2XFYA 3R0DA 3LHWA 1AH3A 3E38A 3TTOA 1EJWC 2G97A 4IX0A 1K02A 3NM3A 1FWHC 3H26A 1V7AA 3ABSA 5C9XA 4BS0A 3CV6A 1VGAA 7XIMA 5EA9A 4HNCA 1JCMP 1KXHA 3NM1A 4Y90A 5G1YA 1M6JA 2EQDA 1GG1A 3GVWA 1V3JA 3CH9A 3RITA 1YBQB 4I9MA 4DAIA 1S1PA 3AMGA 1W5MA 3FKRA 3H2CA 2VL4A 2DZUA 3BSHA 2CNCA 3AIWA 1ZBVA 1Q4WA 2J66A 2YDSA 2ZTKA 2OSYA 5EL1A 3K8LA 3ES7A 2R91A 4FO4A 2W61A 4G5DA 4M24A 4S3AA 3VNIA 1X7FA 1GZJA 3MJMA 4NYUA 4PRTA 3Q58A 2YDQA 1R2TA 2WMFA 1FP8A 3KVJA 3GAYA 2HWGA 4KMQA 3NZQA 5LHFA 2WCAA 4JDBA 1SJBA 4RKAA 3TQPA 3DERA 4UBPC 1OWQA 1SUXA 3APTA 3LS9A 3BLDA 4KIEA 4F2UA 1U1HA 3ZIZA 1R2SA 1QRQA 4NI3A 1BYAA 1YTKA 4FOJA 3L0KA 2WSRA 2QCFA 3KEHA 3QZEA 3ZR6A 3TTEA 2J7DA 1P6BA 2DVXA 3HPFA 4XAYA 4L6OA 3DUGA 1QATA 5DANA 4C7GA 2WBKA 2D20A 5I24A 1Q6DA 3QSRA 3IAQA 4DXVA 1ECQA 4JTJA 3J7HA 1K9FA 1F07A 3VE9A 1CLXA 1SU5A 3FEQA 3PWGA 5H6HA 2QV5A 1WUEA 1D3HA 1EPXA 3WLIA 1UD6A 1MRAA 3LXCA 4ECLA 3HQ1A 4PCSA 4LV9A 5CPLA 4INFA 4PMOA 1DIDA 2V38A 1W9XA 4GVIA 5C71A 1EX5A 5IBXA 5JIWA 2PP1A 5HXMA 4I6VA 3ATZA 3L5LA 4ZO6A 1EDTA 2TPSA 3ARTA 5E5CA 1EX1A 5EMYA 1ZTVA 2CBJA 4W5UA 1D3CA 1U2YA 1W56A 3PZOA 2ZA2A 3W6LA 2OLHA 3MZ2A 2VDHA 1XBXA 5TAOA 3WQVA 3MVIA 5A8NA 1GVYA 5AYXA 3EOLA 4NVTA 1RQBA 1CNVA 1R9YA 1BVNP 4LC6A 2NT1A 4U3AA 2F2HA 4Z1BA 4UFLA 1LRNA 5FOOA 1K6WA 1QHPA 2NV1A 4WSHA 3W7RA 4Q8MA 1JG9A 1K03A 1Y5VA 1NDVA 1WPCA 3D0CA 4H8NA 4RZ5A 4EACA 1RY8A 3PC0A 1KKRA 2ZXAA 2IPWA 1DJHA 3W73A 5EBUA 2OO0A 1NWUA 3C86A 1VENA 4QIUA 2YL8A 4PEEA 1S2TA 3TYUA 2OLAA 1SSDA 3A24A 2WHKA 1B54A 3S9ZA 2ZC8A 5GJMA 3DHFA 4W88A 3SRDA 4TX6A 5LXEA 1Q7QA 2OWCA 3REQA 2DZBA 3O2LA 1R47A 1NEYA 1SO4A 3TTQA 4ML9A 4Q8OA 2Z24A 3PWAA 1JZ8A 1PTDA 2J75A 4LY8A 2EAWA 4PTMA 4Y9MA 1FWNA 1IZCA 4C90A 2D24A 3WL1A 4WVXA 4XD5A 5AHMA 1AW2A 1PDZA 1RP8A 2WANA 3UWWA 1DJQA 3MM5A 3MM9B 2EJ1A 3AICA 5FEPA 4AH7A 4E3TA 3P8JA 4JTQA 2YCLB 3QYQA 3MMUA 4S23A 3HU7A 3R89A 2VEFA 1RQEA 3MO7A 3GHTA 5I5RA 2DU2A 2F61A 4I9JA 1UIOA 4WEVX 3W37A 3CQHA 4WKFA 2IW0A 4PMVA 3T78A 2WNWA 3R0UA 2HXUA 1OF8A 2WMJA 4FR1A 5D9OA 3Q67A 4Q8UA 3A4AA 2CKSA 1KGXA 2E6FA 1BVWA 2IPFA 3AO0A 2WVSA 3T1GA 1ODUA 2Q8ZA 4O1BA 3W2NA 2PDXA 3P82A 1W1ZA 2Y0FA 3D5HA 1KXVA 2VWTA 1VQTA 2Z29A 3BE7A 3NTYA 2R82A 1BSIA 1C90A 4GX8A 3CMFA 3C52A 3P61A 2O0TA 4GWEA 1OFAA 4YTQA 4J2PA 3IJQA 4A3QA 4ICMA 5IRPA 3BMVA 2A3EA 4HK7A 1E1CA 3M0IA 3FA5A 5CPSA 1XWYA 4LGXA 5C70A 4XTDA 1X7IA 4P8WA 2QF8A 2C1HA 3N9KA 1XRFA 2HVOA 1E4NA 4N9EA 2QXWA 2QCCA 1K9DA 3N6QA 1CYGA 3FSUA 2WNNA 3UG4A 3W1QA 3G2GA 3FXGA 1BLIA 1VEOA 3TA9A 4RXGA 2C79A 1UD4A 5FJJA 3AHYA 1S1RA 2J4GA 1R0MA 4CQDA 4D6FA 1UR8A 4K8EA 1YBQA 3TOYA 5K3VA 4AF0B 4UMAA 2WV8A 3NQVA 5A8PA 3DI0A 2X1UA 4GI9A 1PXGA 3VNYA 1RA5A 2G4JA 1TWIA 3BJTA 4QXIA 5HK4A 1EC9A 4DNMA 2XSAA 2WCGA 3B0LA 3GU1A 4AXNA 4FI4A 4XAGA 4EX4A 3MM6B 3WL0A 4AEFA 6GEPA 4JHOA 5FF2A 3RMEA 3A47A 4EAMA 4XBSA 3VPLA 2AOSA 3PJTA 4KW2A 4AFYA 4MPKA 4D6IA 4GO8A 4JGDA 3MQTA 4DWSB 4QJ1A 2GLKA 1FUYA 4YWIA 3P81A 1G7UA 4TX8A 2YPIA 1HKJA 2QCLA 2ZXDA 3G1HA 5AECA 1JDDA 4U28A 4HA3A 5CC5A 3GW0A 1GVFA 3LM7A 4E8CA 4Y9AA 5HULA 4A8RA 1PTGA 3M6DA 3I4EA 1XLLA 3A21A 5HUOA 3GWQA 3R43A 4O54A 1GTEA 4ZE4A 3APYA 4B90A 1J9YA 3RJYA 4KF1A 3CV1A 1S5WA 5I3IA 4P7RA 4ZSTA 3CO8A 3OU8A 4RR4A 5HOSA 3BOLA 3LNMA 4S3BA 5IDIA 1E6ZA 4AZHA 3LENA 4MWAD 1NH6A 1UR0A 5DX7A 3F4VA 2DIJA 3THCA 4YXGA 4ZQCA 4YL2A 1J4EA 1E40A 3UCDA 1DORA 1US3A 3GG7A 3H2NA 4QDPA 3DYPA 1US0A 3UXKA 4QR6A 2NVAA 2VO5A 2B0MA 4WF7A 5I02A 4JHMA 3L2IA 3OZMA 5I09A 3PULA 3VNDA 4PMQA 3CBWA 1TPUA 4C6NA 1CPUA 3H4GA 1OYBA 2PF0A 8TIMA 2PI6A 3BPWA 3L9CA 1V03A 5EFDA 5CLWA 2BVYA 2H8XA 3S1UA 1W37A 1WXJA 3G18A 1CLVA 3UZXA 1IZJA 2QHAA 3K8MA 3NYZA 4LH8A 3LUTA 3CHVA 2A21A 2F2KA 4UTIA 1JAEA 4PUJA 4NZFA 4M7SA 4GUIA 4MFDA 3M6YA 1VCGA 1EP3A 4NNBA 1ZBKA 1R3QA 2YFOA 3AIEA 3KRZA 3E5PA 3DYMA 1BG4A 2G3FA 1EJVC 4I7WA 1PWLA 3MP4A 3PHAA 4UCGA 2PDWA 5D02A 1I45A 1OFDA 3HGOA 1YLVA 3FCPA 1YPXA 1Q6LA 3G5EA 4CNSA 4F4RA 2Q02A 2GUBA 1D9EA 3ZSSA 3LCIA 1WQ5A 4XKYB 3UU0A 2VD9A 5CSYA 5LKYA 3ITGA 2FZNA 4PGLA 1GKPA 1JVNA 1PUDA 3MT1A 4JTTA 2RJGA 4XZIA 2ZWZA 5FJOA 3GUWA 1XYCA 1KR1A 4D8ZA 2RUSA 2CW6A 3AWOA 3ZR5A 1YMYA 1AH4A 2QJIA 4YHGA 5BOEA 4HQVA 5F2IA 3BLIA 4BI6A 2CZEA 1G5AA 3VKTA 3RX3A 4DZIA 3GHRA 3S2LA 5JXQA 5CEWA 2HNHA 5D30A 3MM9A 3WUBA 3NQBA 4DUOA 2PA6A 4KPLA 4KWUA 2YCLA 2FDMA 1TREA 2FHCA 3EBVA 3KRSA 4JIRA 4FXSA 4DJFD 1ENUA 2O7SA 1UOZA 3ORWA 1ONXA 5HNUA 1XLCA 4KWSA 3N04A 4HOWA 1IWPA 1UYQA 3GXNA 3PB2A 4F3HA 4Q8TA 3AMCA 1TUXA 3A3XA 1W3HA 3ONCA 3SN1A 6ALDA 1SPQA 2I1OA 5G2WA 1KV5A 3QMTA 1UWUA 1GJPA 4FOUA 5GQBA 3ZS4A 2NLIA 1F61A 1W9PA 2F7FA 1IQ8A 1HQTA 4PBFA 4F2TA 1J6OA 3EXRA 1GORA 1WX0A 2DT0A 1VYSX 1MDRA 1JL8A 3LHYA 3N17A 3RCMA 2VOMA 3VKBA 4NZ4A 4MB1A 1UP2A 4X63A 1S38A 1UKTA 4S2CA 2PTWA 1M7OA 2G37A 3T4WA 2R24A 2J7BA 5FACA 4GQGA 4XQ6A 3SCWA 3VKCA 1BXNA 1T7LA 3M46A 2DZXA 3AI0A 4MGGA 1R3RA 2FMNA 1HW6A 3GXIA 2OQLA 1I4NA 3BLEA 1EJRC 1JF6A 3RAOA 3SW6A 3TROA 3GZAA 3SN4A 3GY1A 2QNEA 1OCNA 1WKDA 4IPLA 4AF0A 2TRSA 1M5WA 3CQ0A 1FX6A 3MP3A 4BQ5A 3TJLA 4QLJA 4M1BA 4GVHA 4O18A 5AC8A 3S2MA 1GYLA 3S1VA 4QITA 3BVJA 4JNMA 4OV4A 5K9CA 4QE4A 1SSGA 4TQTA 4E4FA 3MV11 3LCWA 1CECA 4H6KA 3M0MA 3T4CA 1HP4A 1SJDA 4IICA 1XUZA 3MM6A 3ATYA 1WXYA 4GJ1A 3B03A 3O0KA 4JY8A 3S8HA 1NF0A 3H4XA 2QLYA 4N42A 4YVVA 3UXDA 3ABRA 4S3FA 1VBHA 1EH9A 4EXQA 3ABXA 2AMXA 4UFJA 3BGAA 4DWSA 1XPGA 2BWGA 4AYSA 3GDBA 1GCYA 1PPIA 1LOQA 1V3HA 3PZUA 3N2CA 4HSNA 3KFTA 1W8GA 4GISA 1XBVA 1B31A 1GTHA 1VFFA 4KETA 5FAGA 1D3GA 5EMMA 4PA8A 1E9YB 1EEPA 1GQKA 1W1IE 3GSMA 1EO7A 2Y7DA 1F3XA 4PSRA 2J7EA 1LQ0A 4R9XA 4AISA 1RALA 4N4QA 2PDIA 1O5KA 1VKFA 1U5HA 2C19A 2V68A 4B91A 1VFMA 4P61A 3S5YA 2OO6A 4EPBC 2GVYA 1NWTA 4JKLA 2DJXA 1B5TA 1XFCA 1I60A 2OSWA 1HFBA 3TV8A 1U5VA 4FLOA 6PTDA 5BNKA 4KGJA 4H9YA 2C91A 2Y5EA 3WNMA 3UJ2A 1EIBA 4OWGA 1P0BA 2PWVA 2OMAA 2J6XA 1OZMA 4UZUA 3SY8A 3S6OA 3DYOA 2GFTA 3PJUA 3FEMA 2Y7FA 3W2LA 3FS2A 4C1KA 3QW4B 4A8LA 1NP2A 2HBXA 4HYWA 2BY1A 2TMDA 4M19A 4NI8A 3UVIA 3OIXA 1WKEA 2V9DA 3W7LA 3WJSA 4IP5A 4K8HA 4PC8A 1IR1A 4E4PA 4QAIA 3W7IA 4TX9A 2F38A 3TXZA 5C9UA 3NQDA 3HPSA 4NJKA 4WQ6A 1V79A 3WUFA 4UQEA 4HJFA 5DBTA 1Z7AA 4FXFA 2PTYA 5GJPA 5HPCA 3I6TA 1XDMA 2WZIA 2W79A 3I7QA 4C6CA 3G3MA 3T42A 1EZ2A 4CD8A 1C93A 3O16A 2YLLA 1FDJA 1J5TA 4RNIA 4A35A 1JPMA 3NL2A 1OT2A 3SRFA 2HPIA 2G5WA 4MWAC 4PCTA 2FTYA 3DG7A 4V15A 2C71A 2QUUA 2VFFA 3GDTA 1SQ7A 4PE8A 3WSUA 2CBVA 1CENA 2I5IA 1R2RA 3ELFA 2GVGA 3OIHA 1FWRA 3CUFA 3W7GA 2ZA3A 1NARA 2QAFA 3H2FA 1HO4A 5F4WA 4G1KA 2OYKA 2ONEA 4HHMA 4KFPA 1XBYA 4LX4A 3IWPA 5D2VA 4MAVA 5CBIA 1DTNA 4ZVJA 2FYMA 1PX3A 5TBOA 3QPYA 2B7QA 3AIRA 1IT8A 3CB3A 3LCHA 5I06A 1Q85A 3AU6A 3CL8A 1A4MA 2C16A 3EDEA 3N34A 4XZBA 5F7UA 1IWBA 1M7JA 2FDSA 1XDJA 1XKJA 1Y0EA 3P67A 1TFVA 3AQUA 3O63A 5K9XA 2XH7A 5CZSA 5FF0A 3F5LA 3AC0A 1C8YA 4EPKA 1CI1A 4CCEA 3TEVA 3CU2A 3MU7A 1DQXA 2C8NA 3C0QA 3IANA 1K1DA 3PTDA 4OBTA 3NOEA 2Y85A 3TP4A 2QDGA 3VE7A 3AIUA 2A2IA 3SB0A 1LCOA 2QCGA 1W2VA 4JFWA 4DYEA 4DPPA 4H7CA 1V6XA 2P53A 3HPAA 3M4HA 3MUIA 5FAJA 5DCDA 3H22A 2WZTA 4PB5A 3H23A 3D6NA 3O0FA 3GVRA 1KFWA 3TQVA 2XGIA 2G96A 2QUMA 5HJXA 4B4FA 3I6RA 4KGLA 4GY7A 1WZLA 4JYEA 4ATDA 1AD4A 4NZJA 3I10A 2EG7A 2QT3A 3W2UA 1ME9A 2HE5A 3CAVA 2CWNA 4AHPA 4L9XA 5I77A 3TE9A 3NQMA 4KH2A 3WQOA 3FA4A 3A4JA 3YPIA 1X8CA 2NQHA 1K70A 3N3MA 3DGBA 4GRSA 2JBMA 2VFHA 1EJTC 3UGVA 1LOSA 1NWRA 3PZNA 4DJFC 4YYCA 3NVDA 4FIRA 4W8BA 1ZJBA 5LIYX 1TTQA 1C7TA 3NOYA 3JU2A 3C0LA 2VX7A 1F76A 3WN6A 1H49A 3GNXA 3MDWA 3W1LA 3TC3A 1RK6A 2DVTA 5F2LA 5BW6A 3U7BA 1SJCA 4PUKA 3W00A 3EDDA 3EWDA 2PC8A 3UJRA 3W7PA 1M01A 4GIEA 1QT1A 3M7WA 2NZLA 3OBKA 3GR7A 4CQCA 3TOPA 3NIYA 4LV4A 3KZPA 3H4WA 3PY2A 3IK2A 5IFTA 3G0SA 1ME8A 1B1YA 1ISVA 4FNRA 2YZRA 4IL0A 3V1PA 3CUIA 3VIPA 2QAPA 2X1RA 1MW3A 2PU0A 4RCXA 3DENA 5IDZA 3FGCB 1OEPA 2J62A 1RSCA 1VJSA 3W0KA 2VC7A 1XV8A 1JXKA 4ZQRA 3LI0A 4Q4MA 3AALA 2J7GA 3B0PA 1AUSL 3NG3A 2O7QA 5ABFB 1A47A 3DHPA 2BXVA 1IZKA 4PR4A 4TO8A 2CZ5A 3FJ4A 3DGRA 1E72M 1V0MA 4L6DA 1PZ0A 3QMSA 2V5KA 4LF2A 4G8TA 3UP8A 3HF3A 3FNDA 2C13A 4TVCA 1ZJAA 4O8RA 2CWXA 3UXIA 4O1AA 5I3HA 4W7VA 4DBDA 1YTEA 1XH0A 1UR3M 1U83A 1WYIA 5FJIA 3VIFA 3PZMA 4AW7A 2OODA 5DEZA 4O1FA 4OJYA 2EPHA 3MA8A 4AMAA 2JALA 1TWDA 3DIPA 3WQ4A 4HA4A 2DPEA 3SSJA 1YDYA 1TE1A 2OZ0A 3VNJA 4DVOA 4N4PA 2YFNA 4DI9A 2VVNA 3GHUA 1TR1A 2HCVA 4PUNA 1VHNA 4LEFA 4LBUA 4PTWA 3V5FA 5XIMA 4XVEA 3GXTA 3VFLA 1DXIA 2ASHA 3NL5A 1A50A 3PR2A 3SY1A 3C3UA 4F0MA 1JCXA 2X42A 4MB5A 1CB7B 4MNLA 3LPGA 4HMCA 5A8OA 4UOJA 1RVGA 4R7OA 2Z1VA 2WVVB 3RLGA 3AMLA 5C54A 1GUVA 4JPGA 4FHAA 2Z26A 1M7PA 2PBOA 3VX1A 1BTCA 4WOQA 4GI6A 1VF8A 2VNCA 4ERIA 1WP6A 2XVGA 3GYEA 4YIWA 1DV7A 4LBRA 3VZYA 1ZALA 3AXKA 1J12A 3QY8A 3IVSA 2VC6A 2YKKA 4CU6A 4ERAA 4HB7A 3MTWA 3FYOA 6XIAA 3OA3A 1LM1A 4E5TA 1DJZA 3I3DA 4L5ZA 4PB4A 4LRSA 3VC6A 4LANA 4HMNA 3IACA 3W88A 1GPWA 3SURA 1WB0A 5LZLA 1JDCA 1ZLPA 3E6EA 2Y5JA 1FWJC 1XBZA 3TFCA 3CAWA 5DT7A 5CZKA 4FP1A 1WAWA 3LXBA 5BXTA 1AZ1A 1MZHA 5M2FX 3O6CA 2ZUVA 2IKGA 5GNZA 1H51A 1L2QA 4CD5A 4I9AA 1ODZA 4O13A 4IPJA 4ZOCA 1PE1A 2ZZ7A 4MY1A 4D71A 1UH3A 3SRHA 4RV8A 1GT8A 2Z1XA 2JGQA 3RJXA 4R9OA 1EJSC 4RDZA 4AUBA 1ZS2A 3RN6A 1NFBA 2NVCA 3WEOA 2Y89A 1V6TA 3BW2A 2GEPA 1FDZA 1N8WA 2VWSA 3P74A 4Z2JA 4AD3A 2Z1WA 5B7YA 2VOTA 2DZPA 4NX0A 4LVDA 1CEOA 5HJLA 3GS6A 4Z17A 1ITCA 4DUWA 2WKGA 3KCLA 2I9UA 2OSXA 3RMJA 1EIXA 1E0VA 1AL7A 2YJQA 4V33A 4GUJA 3VA8A 3W1UA 1V02E 4FLRA 4FLQA 5K4XA 2HS8A 5KZDA 4Q8WA 1EHAA 3M41A 1MXDA 2PD9A 4DJDD 1XIIA 5I03A 2UY5A 5T8GA 4ZL1A 5DY2A 1WDWA 3CPUA 1S2CA 4NZ5A 3KTCA 2CYGA 4HHLA 3GG1A 4GUHA 1S46A 4Q8PA 1AG1O 2DT2A 3NZRA 3L65A 3LHVA 1XX1A 3GNOA 5CGQA 5EY5A 3AS3A 4H8HA 3W87A 2V2CA 4AMCA 3VKAA 4GKTA 4F0HA 3N19B 1PDYA 3WF0A 4F8XA 1J10A 1QVBA 3WD2A 1BQGA 3BJFA 4UQDA 2TODA 4C6IA 1IIHA 1E0UA 4DBEA 4RE0A 3ONBA 1E55A 4EK7A 3BSGA 2J77A 1OYAA 3FX4A 1UKOA 3WBXA 4L4LA 1FCBA 5FA5A 3ZO9A 2D23A 5F2MA 5J8LA 2R9RA 1TR9A 3DN5A 1K9EA 4M81A 1MDLA 2PDHA 4AVNA 2JE8A 2PRMA 4K36A 3CZJA 1OFQA 1A0EA 1S2WA 5IXEA 3FYYA 1F6KA 3JUGA 4DO5A 2A7RA 4L9YA 5HNRA 2O56A 3UR7A 5BRQA 3MYOA 2AL2B 2D2GA 3JZEA 4L6HA 4QLKA 4Z1DA 4PUUA 5T9CE 3ECQA 4L80A 5A8MA 3U2CA 1KBJA 3NO1A 4JNZA 2E6YA 4OGZA 3QFWA 1BYBA 3XISA 1TX2A 5FSDC 4PZVA 3T55A 2VZSA 3FGCA 2X30A 1DWIM 3UD6A 2YBVA 2EG8A 1GVSA 4DUVA 3UFYA 4CQAA 5ABGA 3DEQA 1HF6A 2WJEA 4KCTA 3ZJ6A 5ABFA 4Q4PA 5FJUA 4DI8A 4U10A 1Z42A 4RPPA 4XBKA 1TJRA 1K3UA 5HNTA 3O1NA 2OZTA 3H6OA 4Y2WA 4MHBA 2GGEA 1TA3B 4R27A 4AD4A 3VIKA 5HUPA 2FGBA 2WAGA 1YXDA 1XQLA 4W5ZA 4HCHA 4AY7A 4NJGA 2PUZA 3C8NA 1TPC1 1U5JA 2HNEA 1XGDA 1K7FA 1VJIA 5K4ZA 4W86A 1UWRA 1QCWA 3F5JA 2G8ZA 1MI3A 1TPH1 1P6CA 1Y8BA 3CB8A 1LJYA 2PGWA 1ITUA 4LB3A 3P60A 3QV7A 3MVTA 1XW8A 1WOAA 4ML4A 3PTQA 5T26A 3VCRA 2AQWA 2ZDSA 4PH6A 3DFQA 4Q7IA 3NDYA 4GGHA 3VX0A 1A3HA 4QJ3B 3FKKA 2EF9A 2C1GA 3WQ5A 4QE1A 5E09A 2WVVA 4IISA 3CZLA 5L6UA 4XAZA 3B9OA 1JDFA 4Q32A 3IUDA 1EOKA 3ARWA 2DQXA 5JMUA 4TMBA 2J7CA 5GNYA 3BZJA 2V81A 3LERA 2ZZ2A 1JFXA 1L9WA 3UY7A 4U3CA 9XIMA 2VZOA 3NGJA 2ON3A 3FAXA 3S6TA 3B8TA 4W7UA 3O7UA 4CNTA 3VDCA 3VD9A 5FF4A 4J35A 2QKFA 1KRCC 5ECVA 3BMWA 1K8YA 2OZ3A 4H9VA 1NJJA 3LZ3A 1TCMA 2OX4A 3TLLA 2B31A 3OLEA 3S5ZA 3MPGA 4K3ZA 3PBMA 4FIQA 2BV9A 2P1FA 3I7RA 3UERA 3VZZA 1WDPA 3H2MA 4FX8A 2DEPA 1W1B1 4RZBA 3M0KA 1Q8AA 3CUHA 4AEOA 4XZ9A 5EFFA 4DJED 4H8VA 3WLLA 3H2OA 2ZIDA 2ESCA 4G38A 1M3UA 3VOHA 2XWEA 3FV9A 3IVUA 3LRLA 2EGZA 2AAMA 1Q6GA 5M3WA 3AJXA 4F0LA 1PX4A 4NSBA 4CU8A 4WKAA 1RLCL 5D9MA 2OOFA 3BCJA 1SMAA 3W28A 2QF7A 2ZZ5A 3QYSA 4DQWA 1DJXA 4R88A 5T9BG 4WXZA 1SYTA 1LLZA 1W5OA 3OLGA 5LNUA 4ALDA 4HPGA 2PWFA 3OB8A 2PDJA 2A1YA 2CLMA 1E6NA 1TMHA 2PODA 4V27A 3GRIA 4Q7NA 3A9BA 3LLDA 3KOWA 3MMCB 1M7XA 1F74A 5JBDA 4UFKA 3PP7A 1XLGA 2ADAA 4EXBA 1AH0A 5ECUA 4LUYA 1NQKA 4DZ5A 4HZ7A 5HANA 2X1TA 5G5IA 3ZR4A 3OLDA 3B0HA 2XPKA 2YX0A 1JDAA 2FHFA 4IG2B 3V5CA 1JPIA 1HJQA 1JF5A 2DSVA 1JZ6A 3A3HA 5GPRA 4UTUA 1FFRA 4IMCA 3BL3A 4GD0A 3CIVA 4U2YA 1UWTA 4JTCA 3MUZ1 4IPIA 1GHSA 3MSYA 4JN7A 2J9ZA 2C14A 1FDYA 2BXZA 2J78A 3VKJA 1T99A 3H7UA 1O94A 4GK8A 4XIAA 1MXGA 1ZB5A 4US6A 2P50A 3GG8A 4RDYA 1XH1A 4RJEA 4F0SA 4UTFA 1JULA 3ZQ9A 3HQNA 5KMYA 2DDXA 2R1NA 1QW7A 4NQ1A 3UWQA 3URNA 1ONEA 2BVDA 5E9XA 1JYWA 1M65A 3QW3A 1HUVA 4FLSA 4FB7A 4B5UA 1WXZA 2BOFX 1N2VA 5F1UA 3ZT7A 1NY1A 1HZYA 2QGYA 4LAUA 3WDIA 1S3HA 1QBBA 4XZLX 2VM8A 1HTIA 2BY2A 3TN5A 4GUFA 1EBGA 3G8RA 4WDUA 3UWVA 3WNOA 4DJDC 3VC5A 2ZE3A 2B4GA 4ILSA 2YZ5A 2BGQA 5CZ0A 3W7JA 1H62A 3R58A 4M6PA 4Q4SA 3EOOA 4HZ6A 5DRIA 2HISA 3AHZA 1I75A 4KIRA 2NXHA 3BV4A 6CGTA 3MMAB 1XLKA 2VVSA 2AL2A 1I2QA 1YRRA 2UZ9A 1RP9A 3OZYA 2RDWA 5BXPA 3B8IA 4CN6A 4ICNA 4GKLA 4QHRA 1K8ZA 2BFGA 4O17A 2VFIA 5A6MA 1RBAA 1XINA 3VGEA 1V6UA 1E9LA 1CDGA 2W67A 4JL1A 4V2XA 4V28A 5H8UA 4Y8EA