4S3EA

Ispg in complex with inhibitor 7 (compound 1061)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 144
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3eA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3eA02
2YCKX 4MWAD 3NOYA 3H2CA 4NIRA 3TYEA 6GEPA 2Y5JA 1ZJ8A 5GEPA 3MM7A 4NL1A 3TR9A 3H26A 4HTRA 3MMCB 3VKSA 8GEPA 3BOLA 2Y0FA 4S3DA 4PZVA 3TYAA 2H9AA 3TYCA 3VM1A 3VM0A 4DJEC 3VKPA 3BOFA 4DJDD 3H21A 2OGYA 3OR2A 3B0LA 3MM6A 4MWAC 3OR1A 1AJ2A 3TYBA 4S3EA 2E7FA 3TYUA 3VKQA 3GEOA 1Q7MA 1Q8AA 4DJFC 3B0JA 1AJZA 3H2AA 3VLZA 2XSJA 4AOPA 1F6YA 4DJFA 3MMCA 3MM8A 1AD1A 2DZBA 3OR2B 2AKJA 4O1FA 2VEFA 4MWAA 3MMAA 3H23A 3AOPA 4DJEA 5AOPA 3H2EA 3TYZA 5JQ9A 1TWZA 3H2MA 3MM8B 3MCOA 3B0GA 2VEGA 4S3FA 3MM6B 1AJ0A 3MMAB 3H24A 3MM5A 4HB7A 2DQWA 4MWAB 1AD4A 1Q7QA 2YCLA 3K13A 4MWAE 4DJFD 4DB7A 4G9PA 2DZAA 2V4JB 1TWSA 3MM9A 4S39A 3VLXA 4S3AA 1EYEA 1AOPA 4DJDA 4DJED 3MMBB 2YCIX 4O0QA 2BMBA 3MM5B 4NILA 1Q85A 2Y5SA 3H22A 3B0HA 1TWWA 4C1NA 3MM9B 3OR1B 4GEPA 4DAFA 3MMBA 1Q7ZA 2AOPA 3VKRA 3H2FA 4D9PA 3B0MA 3MCNA 2YCLB 2V4JA 2H9AB 4S3BA 3TZFA 4S23A 4S38A 3VLYA 7GEPA 4S3CA 2GEPA 2YCJA 4CCZA 4G39A 1TX0A 4DJDC 3V5OA 3H2OA 3MM7B 3B0NA 4D8ZA 4D8AA 4NHVA 4O1EA 3MCMA 4C1NB 1Q8JA 1TX2A 3H2NA 3TZNA 2XSJB 4G38A 3VKTA 1ZJ9A 2VP8A 3TYDA 4DAIA
chains in the Genus database with same CATH superfamily
3FSTA 2CZEA 4KT2A 4HA1A 4DF1A 1JUEA 3B0VC 3EPMA 4ICNA 1BYDA 2OR2A 1ICPA 4H8NA 1UR1A 1HW6A 4MNKA 4CQAA 2ZX8A 3T07A 5AHFA 5GNYA 4GCAA 2FDMA 2HK1A 1Y5XA 3SY5A 2FTWA 4O13A 2Z6JA 4NAFB 2C1HA 4AC7C 1TMLA 4PCTA 3WNMA 3EB4A 2C16A 1DJZA 2X42A 3L0KA 2PLKA 1E3ZA 1CXLA 3GXPA 4UFJA 4FA3A 4JPGA 4OOZA 1H7WA 3KAOA 1QI5A 1R38A 2Y6ZA 4DJEA 2NT1A 4LX4A 1XYZA 1KM1A 4BEQA 1OJXA 3NQBA 4MSSA 3MVTA 4ZO9A 4Q4QA 1I6NA 1NQKA 4MPQA 5J5RA 1UJPA 1EUAA 2Y4SA 1VGAA 4YU1A 4EPBC 2R1NA 5DMMA 4MWAE 4DZHA 2Z2AA 2ISDA 1DWJM 1JCTA 4LNCA 1CPUA 4E8GA 3B8UA 1E4NA 3DGRA 4GZEA 5FJRA 1CXEA 3W1MA 1WUEA 3EX4A 3LUTA 4IG2B 7TAAA 3REQA 5HOSA 1I4NA 4M29A 1W37A 3BAJA 3OLDA 3NDYA 1L6SA 3B0MA 3QTPA 1JXJA 4WZHA 4OWGA 1IF2A 1EC8A 2EEXA 1GOIA 4AVNA 3WLQA 4R85A 5BYWA 5TAOA 2VUYA 1LDCA 3QR1A 4UIOA 3CL8A 3GB6A 2G3FA 1W3HA 1PTAA 1FQ0A 4MF4A 2WJEA 2AQVA 3C5QA 3UP8A 3C2EA 2J7BA 3S4TA 2FVKA 1S5TA 2XZ9A 5I0DA 3E5PA 3A5FA 1E6PA 4IMFA 4RW3A 5KZ6A 1Q7MA 2X16A 3KOFA 4H19A 3V3WA 4FIQA 4S3GA 2QF8A 1LL7A 3MMUA 3NUKA 5HMEA 3QC3A 3W82A 1XRTA 4GACA 4O1FA 4B4FA 3ORWA 3TYZA 4LH8A 6TIMA 1H61A 3G8EA 1BAGA 4UB9A 1GNXA 4AISA 5FF4A 4KIEA 1ZCOA 3CMFA 1MEWA 5H2ZA 2OB3A 3NO1A 1H62A 3BCDA 3MP4A 2YCIX 2BODX 3OA5A 3G1DA 4XISA 1E43A 2X1RA 1KBLA 1FHDA 3ARXA 1BLIA 2ASHA 1Q6RA 4QIUA 3EGJA 5DT7A 3H2OA 3QV6A 3MPGA 4LAOA 1KFBA 3WF1A 3BDKA 5HR6A 3ZS4A 3MM8A 2WAGA 2DZPA 6CGTA 3QW3A 4LCRA 1QTWA 3GAKA 4DO7A 1BQCA 4RDWA 4LRTA 5E5CA 3EWCA 3TW7A 3VNYA 4NJGA 3WJSA 3B04A 3SECA 3PG9A 5H91A 1AODA 3CL7A 3II1A 3OYXA 1O66A 3VDAA 4JZ5A 2E40A 1XH0A 4GHRA 3RLVA 3WK2A 3LDVA 4GJJA 3LNMA 4LUTB 3PBYA 4ZA0A 1E1CB 4DUOA 2ZRZA 4NT0A 1TTIA 4HCDA 2Z1WA 2GGJA 1F73A 1L8NA 1ZUAX 2JEPA 3TLQA 2WZTA 1U5HA 1FFRA 4DLFA 2XIQA 3KFTA 4PTVA 3GVQA 2CLLA 4JD4A 1X39A 1QPKA 1KV8A 3QZEA 3WQCA 4Z1CA 4DUXA 1Z48A 1SYTA 4HZMA 2J7FA 4EF8A 1K9DA 3PJTA 1ZL1A 3TC3A 3NA8A 1JPHA 2D2GA 2YOCA 3AWOA 3W83A 1E55A 1SMDA 1XFBA 4RZ5A 3KZSA 1JFXA 5GJMA 1XLMA 1LQ2A 3EWZA 2PF8A 4HU8A 4EX4A 1JR1A 3ZJKA 1W9XA 3TWBA 4GI6A 5J04A 1F6KA 2J7EA 3M0XA 1D3CA 4JQ1A 3DH7A 4X2PA 2DZUA 3SCVA 2ZX9A 2WMHA 4YCPA 1WDSA 3FLUA 3PTDA 3BOFA 3R10A 1QOPA 2XVPA 4P7RA 1AW2A 1E6QM 4FNTA 2XFRA 4QLKA 3MHUA 3SRHA 4TXEA 3ZO9A 3S0CA 2WSQA 2QIWA 2Q6ZA 3UESA 4Y9PA 1GG0A 3W73A 4JTJA 2Z6IA 4X0VA 2Z27A 1HT6A 1ICSA 4NYUA 2VYOA 3D3AA 1F3WA 2WKLA 3P84A 2VFFA 5AZ0A 4ENLA 1KFLA 2FZ8A 3S6TA 1A5BA 4I9TA 2EQDA 1EDTA 4JN7A 3FA5A 3EWUA 2NV1A 4HA0A 2V5LA 1XG4A 5D2WA 1XLFA 1XV8A 2PLCA 4IGNA 5FL0A 2NWSA 2XFWA 2P3ZA 3VOJA 3E96A 3RYSA 2UY4A 1XLHA 2VOTA 4XQ6A 2RDTA 3ENLA 7XIMA 5JU6A 3KL0A 4IJRA 2OPJA 2ZVIA 1WB0A 1QHZA 2FIQA 3K4DA 1BWKA 1BVZA 3GYCA 1I2OA 2PWEA 3TNOA 4ZE4A 4EXQA 2X09A 1BYAA 1K9FA 1P0BA 4YVXA 1ADOA 4EAMA 1OZQA 4PMVA 2PWUA 3LV6A 4HPHA 4JN8A 2A7NA 4UQCA 1VPYA 2JGQA 1NAL1 3EX6A 3VKBA 1WZLA 3SI9A 5CZTA 1PZ0A 3F2CA 3I7QA 3VOGA 4XBSA 4P7NA 4B5UA 3FA3A 5A5WA 4H8HA 4CD7A 1UA3A 2BY0A 4QGCA 3CHCA 1U30A 2NX9A 1QW7A 2GYIA 3R8GA 1FOBA 3WEZA 2V5CA 2OEMA 4AMCA 5D05A 5K4XA 4JTDA 5KZEA 1QPOA 1RPKA 1BHGA 5LYRA 4E8CA 4FSAA 4HK7A 3VNJA 1H63A 2PRLA 4UTWC 3OVPA 4KCTA 4KWUA 5EBAA 1DEDA 1OFEA 4V1XA 5E9XA 3BGGA 4ZODA 3CAKA 4KQNA 1A5CA 3LG3A 1ML1A 4O0QA 2BMBA 2CBVA 8RUCA 3D5HA 2AGTA 2GGIA 2PS2A 1LROA 4F66A 1JCXA 2DVUA 2KAUC 2HQAA 3S9IA 2GEPA 1Y65A 2E9LA 4AD4A 1C29A 3IPWA 1QO2A 3KM8A 4LUSB 1JF5A 1R6WA 1GOOA 3WQWA 4N42A 1C91A 2B0MA 1NSJA 5CZ0A 2WVSA 3VNKA 3NURA 5H8UA 2DZSA 2BHYA 3GDTA 4D72A 1IEWA 1Z7AA 2CZ5A 2HSAA 1LWJA 1P48A 1VYPX 8GEPA 1XYCA 2PDBA 2V68A 1KCXA 3ABRA 3WD2A 3P8IA 2VENA 3BG5A 3OHIA 3QFEA 4JGDA 3BLKA 3HG5A 1OK6A 1E0TA 5D2YA 5HWNA 1HTIA 3V0TA 4QE1A 4F9JA 4JX5A 5LIUX 2J79A 4IP5A 1HFBA 3G0XA 3OA3A 4R53A 9XIMA 3WYZA 3PN8A 3V1PA 1IEXA 1C93A 2O0TA 2O9RA 4YS1A 5LNSA 1XUUA 4C6FA 2VDHA 4R3UA 3LCWA 1ZPTA 4RZ6A 2ZXDA 1JNDA 3BWWA 1AZ2A 3MM5A 3T1GA 4AEEA 3KCLA 1WDRA 4GZIA 2WLYA 4AVFA 4ACYA 3HPSA 1S2WA 4G7EB 3GXTA 3V4BA 3VOHA 1NWSA 2FQIA 4IP7A 1J2WA 1XBVA 4MVAA 5HINA 4NNBA 1LLWA 2OZTA 1KBBA 3WF4A 3MCNA 3RMEA 1OYCA 4B9YA 3L65A 4AD0A 4X3ZA 1S46A 1P4CA 2QCCA 3L66A 1DJXA 2NXHA 1Y5VA 3V16A 4C60A 4RDYA 5FKYA 1K6AA 1UUQA 2WMJA 3BMVA 2ON3A 1QW8A 3ONBA 4KFNA 3SEPA 3WLOA 4AX6A 3QY8A 2RUSA 4I6KA 3ZOAA 1WKDA 3FFSA 2CCRA 2FDSA 4ZFMA 2F6KA 3DI0A 3PNUA 5BCAA 5E93A 3WH7A 1P6BA 2GWNA 4CNNA 3SCSA 1E5JA 2UY3A 4KEZA 3MMCA 1CGXA 3PR2A 1KRAC 3QJAA 3WK0A 4JX6A 1D9EA 3W7HA 2V2CA 4Y8FA 1W9VA 2D2OA 1KV5A 3LTSA 3VILA 1XLEA 2IXUA 1OVDA 3TJIA 3M0MA 5I03A 4PA8A 4GYKA 3S46A 1SJAA 3RRAA 1EH9A 3OLEA 1HKIA 4DUVA 2HXUA 2CYGA 2PWHA 5BU9A 3PJXA 3T0BA 1LT7A 1D7KA 4H9UA 4XAZA 1GHSA 1ELSA 5G4EA 4XAPA 3UZXA 4ADUA 3A4XA 3CC1A 3LPPA 4HQVA 5L6UA 1BF2A 4DJDC 2OEJA 5IDZA 1J0HA 3LHUA 1SFTA 1NWUA 2V82A 1L9WA 3AXHA 1H7PA 2VQTA 1DIDA 3GY1A 1VFHA 1XSKA 3F4VA 2RKXA 1MWOA 3WQ6A 3C2RA 3EPOA 2Z28A 1E56A 3ALGA 3DHDA 2JIEA 4IMAA 2Q8XA 3URQA 1LP6A 4AZBA 5GVJA 1G94A 1R85A 3UJEA 2WC4A 3TUUA 4FLSA 5C9RA 3G24A 3BLDA 4JHOA 3U2OA 2F7FA 2ZADA 3IWPA 2NSXA 2HNHA 3F03K 4AHQA 5EMYA 2W63A 3SIZA 3AXKA 1VEMA 5BROA 1UASA 1CW2A 3N11A 1FH7A 1B3OA 1ME9A 4AF0B 4L6HA 3GXNA 4S39A 4IXHA 3CT7A 5CAKA 3TONA 3CEUA 4DZIA 3GDBA 2A3BA 1ZY9A 4H9XA 4JFSA 3PHAA 2E09A 1BG4A 5DT5A 1IXPA 4L56A 2CZDA 4GUGA 1NY1A 2D0FA 2G4JA 4UR9A 2V6AA 3ZXWA 3WD1A 3T44A 2WLZA 4FALA 3QC0A 2ZRWA 3KBSA 3GDLA 1RJRA 1B5TA 4GH3A 5DF0A 3TLLA 4GX8A 3W01A 4IGSA 5DY3A 3WENA 2PDNA 1MXDA 1EB3A 1UH2A 1HL9A 1KBKA 4Q7NA 1W9UA 4I90A 1RAKA 1W5OA 3SRFA 5FESA 5IDIA 3OR2A 4GY0A 4WLCA 5CG0A 4ATDA 1HKMA 3NIYA 3ABZA 4RE3A 3UYIA 3KEHA 3MU7A 5G2IA 4OU1A 4GJ1A 4CU6A 1TPFA 4NRRA 3WMSA 3M16A 2GDUA 3H53A 4PFMA 4N9BA 1UD2A 1J10A 3KS6A 4NX0A 1EO7A 3MM6B 1MZHA 3ZM8A 1WO2A 3HG4A 1YNYA 3CIWA 4OV4A 1OX4B 1LOQA 4N2YA 2UV8G 2B7PA 4K8GA 2B7OA 1EIXA 1ZJAA 1HKKA 4E2VA 2QAPA 3I3DA 1G01A 4PMRA 3VX0A 4H9TA 4Y9AA 2ALRA 4WGXA 3ATZA 2QPUA 2VZUA 3ABXA 3UZJA 4CQBA 1Q2SA 1XIGA 3WQ5A 1D8WA 2YCJA 5I3JA 1XISA 1TX0A 1FWSA 1M9HA 1SW0A 2E1DA 2DZWA 5CPQA 1CGWA 2XH0A 5CZSA 5H6HA 1AW1A 3OLGA 5C9XA 3GNOA 4FR1A 2QUUA 3PK7A 2EO7A 3AZRA 1UWAA 1ZRQA 4GKTA 1US3A 4X22A 1WZAA 1BF6A 3F5KA 1S1RA 3WD3A 3DCPA 1W1TA 5CJMA 3W25A 3W02A 4C5ZA 1QWGA 4BWLA 3FN9A 2B31A 1F3TA 1VR6A 1LRNA 3VIOA 3LMYA 1F4AA 1GYLA 2VXNA 4M6UA 1BSLA 1JGMA 5LNWA 4CD6A 2XSJA 1Q3NA 3WSUA 4Q8PA 3GX9A 4IGMA 1FWFC 2CEQA 2PF0A 3DHUA 4C7DA 4R7JA 4GNVA 2A3AA 2WWCA 1QOQA 1E1EA 1JF6A 4ZQRA 4B91A 4GYJA 5I23A 3B0GA 1FXPA 4OECA 3VOCA 2QJHA 1XLBA 1TJRA 1ZP3A 1ITUA 1N8FA 3T2PA 4WDTA 2GQAA 3GG8A 1H4PA 4BF5A 3V1HA 4K8EA 3ZLFA 1M65A 1UQYA 3NSMA 3VUSA 1ZLPA 4HMDA 4NILA 1JDDA 5JMUA 3FJ6A 5LXEA 2WV8A 2OSWA 2J77A 3Q2DA 3MO4A 3DFNA 1JZ8A 4QS5A 4NZCA 3ABOA 4H6KA 3LX9A 4O0KA 3RCYA 1TPH1 2O92A 4LV9A 4RV3A 1MUMA 1GG1A 2PRHA 4CN1A 3OOQA 5I3IA 1TVLA 3OO2A 4C6JA 2A85A 3P60A 2EJ1A 4JTCA 4D6HA 1OC6A 2BGNE 3NOYA 3FDGA 2GGHA 2E8YA 2WQDA 5HNRA 4H2HA 3S3GA 3ZR6A 1F07A 3TN4A 1XPGA 3NVTA 2E8ZA 3NQDA 4FNSA 3FJNA 3VMOA 3UJRA 1XRFA 1QRQA 4ATLA 1T99A 4OE7A 4QDWA 5F7UA 4HJFA 3IVTA 4EXBA 4UQDA 2YYUA 4LFYA 2VFIA 3LS9A 1BYCA 1IEVA 4KRTA 5I79A 4B3KA 1TE1A 3QSRA 3MMAA 1AG1O 5CLTA 4M81A 2PP3A 4PBEA 3G1HA 1M6JA 2F6UA 4OOUA 2WJZA 2EPLX 4HMEA 1R9ZA 4O8AA 3K5XA 3W1LA 4QR6A 2PGWA 1GUVA 2E68A 3ECQA 4ZE5A 2GJNA 2HS8A 4C7GA 3ZMRA 2FZDA 3R4IA 4BK9A 6REQA 3EDDA 2GDVA 1SMAA 3FVDA 1FWBC 4QEHA 3L68A 1M41A 3BGJA 4LJ3A 1VBJA 2RFGA 5C5YA 1A5OC 1F9CA 1OABA 1W56A 2EG7A 4S3JA 4UFMA 2FPYA 5BXPA 4AQLA 4X61A 4LBUA 3AIEA 3EPNA 4G7FA 4FOJA 4H3DA 4L9XA 4F2BA 2FGLA 1GQKA 2IPWA 3PANA 3CWNA 4DO5A 1EJWC 2C15A 4I7WA 1W1B1 3LTPA 2YL5A 3C2OA 2QF7A 1UMYA 2YW4A 3DN5A 1ZBKA 1EGMA 2EJAA 5A3HA 5BRBA 2PDWA 1US2A 4LYQA 2OOFA 2VELA 4O28A 2DSUA 3GIYA 2DPEA 3P74A 3OVRA 8XIMA 2EF9A 4AW7A 3QN3A 5DEZA 4L1XA 3VXGA 4TVUA 1Q65A 3GIPA 2DH3A 1FKXA 4LAZA 2Z25A 5CBIA 1GJUA 3W84A 4W9TA 4DYEA 1UZDA 3KBVA 2DSWA 1Z3NA 3L5AA 1RD6A 5B7ZA 4JQAA 2YL6A 4PUDA 1FDZA 2IPGA 4FNPA 4OZOA 4U5IA 4IX0A 1JCNA 2WVVB 1TV7A 2UWFA 5XINA 4G2DA 3BAWA 5G1YA 2WNZA 1JDFA 2BXVA 2HZGA 5U7SA 1Y7VA 2CXEA 3HV8A 5A8OA 1B1YA 3WJXA 2R8WA 2ISWA 1VRDA 2NWRA 4DF0A 3DGBA 4LVAA 4Q7BA 4PUKA 1B9ZA 3DYOA 4RNIA 1UD6A 2B4GA 2Y89A 3G1YA 3VE9A 4TU1A 2CHOA 3QR3A 2J6VA 3N17A 1JDCA 2QW5A 4IQDA 4D8ZA 1OG6A 3NGJA 3GUGA 2V0TA 3M6DA 2VTFA 5A6BD 1H51A 3GR8A 4FZIA 2FVLA 3M0IA 3BSMA 1L0PA 1OFDA 3IV8A 3UWZA 1Y5WA 5CSRA 5F4SA 3BJFA 3TYAA 1JG9A 2BASA 3WBWA 4Y8EA 2QMJA 1MEHA 1DYSA 3B0PA 2ALDA 5KINA 3OW1A 1SR0A 3OU8A 2R1KA 1LLOA 3WFAA 2PTWA 3VZYA 4U2YA 4AD2A 3LN3A 5BOFA 3STPA 4ZVJA 1ZU8A 3DFOA 3L2IA 3OYZA 3RPTA 3PC0A 1TWZA 2CETA 4DELA 3RJYA 3AISA 3UG8A 3JZEA 1DJQA 3AALA 4C6QA 1NFPA 2XSAA 4MZ8A 3QW4B 4J3UA 5HWJA 5E6ZA 4W7WA 4GBDA 1XBYA 1V77A 2WM0A 2VR2A 3RO8A 1UD4A 3GDRA 3S1UA 3LV5A 1PKYA 4CNTA 4GG9A 2Y5SA 1OC7A 4H7CA 1SO6A 4EANA 1FRBA 3VOIA 3HMCA 4HN8A 1UD8A 3I7SA 4S38A 3V18A 3AS1A 2EPKX 2DQXA 3VYLA 5ABFA 3WMCA 3MM7B 4ERAA 1X6UA 1B4EA 1MNZA 4B16A 4GGHA 3NQMA 4JIIX 4NSBA 1FXQA 2OQLA 3PS7A 1WDQA 3WJYA 3ITVA 1JAKA 1FCQA 5AHMA 2HK0A 2G4FA 3R8RA 3E74A 2Y88A 3WMBA 3GHUA 3I10A 4GH1A 3GWQA 4UTMA 4S2CA 1TJ2A 1XGDA 3L2LA 3CGTA 1AA1B 4V1YA 3S8HA 3OZYA 1ADSA 3H54A 1M5WA 2ACUA 1UWIA 1BTMA 3E5BA 1PX3A 1DWIM 3W1NA 3AOPA 4BJHA 1A47A 1TMQA 3QOKA 3W7EA 4GO9A 4Q6XA 2IXVA 1CNVA 2PWGA 3W1AA 4J9JA 1NFBA 2PZ0A 1GJWA 4JTEA 1MUWA 1B3ZA 3ZJ8A 1E40A 1QATA 1R86A 2NQ9A 3WH5A 4PUNA 3BVJA 1GZJA 1W1A1 1VC4A 3W1QA 4AZ5A 4D9PA 2VRJA 1PWLA 4GLEA 2YXOA 3MJYA 1IXNA 2XU2A 2Y5EA 4GIEA 4DBWA 4U10A 3T09A 4O1BA 4IHCA 3CM4A 3RX2A 1EJVC 3P80A 4TTGA 1DJGA 1W54A 1TIMA 4F2UA 3PF3A 3M5VA 3RX4A 4O12A 2ISFA 5HPCA 3QY7A 3IUIA 2HWGA 1TPDA 4INFA 1R5YA 1MQRA 1X38A 1N8WA 2AL2A 4KGLA 3DKLA 5A69A 4WKAA 3EDJA 3UWUA 4X9SA 3W27A 2P8BA 4EPDC 4KEUA 5EPDA 4NXKA 2CZVA 2IQTA 4F0RA 1I0DA 1PB0A 3H4XA 4J7RA 1F4HA 4LVBA 4OV9A 5FL1A 2J9ZA 1IHIA 1HJWA 4AF0A 4JTLA 3STCA 1MW1A 4MG4A 3C52A 2CLMA 1MXGA 3AZTA 1YNQA 1PHWA 2QUMA 3TVAA 3O1NA 3EX1A 1C7SA 3T6CA 3LCHA 4S2BA 2H8ZA 3B0XA 3CHEA 4REQB 3TC7A 1Q6GA 1E9YB 2R9RA 3NG3A 4PEKA 2OO6A 5D2XA 1TZ7A 3WFZA 6PTDA 4PMDA 5F4WA 1EJTC 2YDRA 1H5VA 1HIZA 2C91A 5KITA 1J96A 4GINA 4WY0A 2QV5A 1GCYA 3TFCA 3CNYA 1EP1A 2I5IA 2PDQA 1G1YA 3C6CA 5AHNA 3VMNA 3HGOA 4CD8A 3MMWA 3WNLA 5EYWA 1CIUA 4C6DA 4UMAA 3B03A 4QNWA 1G6CA 4AIUA 1G4TA 2OSXA 3DX5A 3EKLA 4Z1BA 2I56A 3TSMA 2ZDRA 1HL8A 4JTKA 3QY6A 3JS3A 1V0LA 2OGJA 3BO9A 3H4WA 5LNVA 2PURA 2WANA 3VGDA 3EYPA 1YXCA 2PAJA 3BGAA 1IT0A 5HNTA 4E4UA 1D3GA 2RJGA 3Q37A 3MUCA 1YTEA 4X60A 1NQ6A 3H21A 3S9ZA 1AUSL 1X7IA 3BLEA 3R89A 1HJVA 3J7HA 3LD5A 4LOCA 4O10A 3R12A 1JGIA 2QDDA 1F6YA 4U31A 3PZTA 3G0SA 4W93A 1WAUA 3M0VA 1YIXA 4NAFA 3BAXA 4H9VA 2O9TA 4XIAA 2J75A 4I5XA 4H83A 4AD5A 3CH9A 3QFWA 3VDGA 2VX4A 1B31A 3MMTA 5D37A 3R0UA 1B3YA 4GABA 5IOBA 1EYWA 1OM0A 4Q4RA 2CKSA 3UVAA 3WH6A 4AZCA 1YDNA 2C8NA 4GY7A 4ZO8A 1VEPA 4RKAA 3SCOA 3IACA 3PPHA 3UXLA 1E5NA 1QNPA 1DIEA 1E51A 4QRNA 1FHLA 3GFYA 2P0OA 4IL0A 1KWKA 4J3VA 1UD5A 3FY1A 4L9ZA 1FCUA 1CZ1A 3BL3A 2QPSA 5A6BA 4D8AA 3MCMA 3W28A 3JZUA 2ZC8A 4K7YA 3SSZA 3R0KA 1NFGA 3DHFA 3NQVA 5I02A 2GOUA 1TFVA 2PDFA 5MF5A 5FA5A 6ENLA 2Q71A 3DC0A 3P82A 1H3GA 2H9AA 1E4LA 4E3TA 3TCEA 2W91A 5C9WA 2ZVRA 4U5KA 3OEXA 1O7AA 1QAPA 5CJ5A 1F5ZA 2F2KA 2INZA 4K6AA 3L4VA 2DT2A 3L0GA 3B0JA 1V3JA 5HAOA 3T4CA 3L5LA 4JNZA 3S2NA 2CHRA 9CGTA 3F4CA 3GD6A 1OX6A 5H8MA 3DZ1A 4HPNA 3R2GA 1GVRA 2PEVA 1QASA 1XC6A 3PM6A 1REQB 3L7RA 4ZOAA 4QBXA 2FPTA 4UTJA 4DZAA 4F4RA 4CD5A 1KC7A 4MB1A 4QLJA 4DWSC 5C6MA 4HYVA 3MANA 1JFHA 3U57A 1O94A 5AN7A 3I65A 3GUWA 2YIHA 4JDBA 3N73A 1DJWA 4EP8C 2ZE0A 4A3UA 4NUWA 1UP3A 1Q6DA 4NY2A 4K8HA 5HBFA 1WKYA 4M5PA 1B90A 1FWNA 3VA8A 3W3OA 2QS8A 1ISZA 4H01A 3RN6A 3IJ9A 2D0GA 1EHNA 4D1IA 1SJDA 1H1ZA 1XD0A 4A2RA 2DW7A 4L4PA 4FR6A 1LBMA 3R11A 4REQA 3PTMA 2GVEA 5REQA 3HF3A 1S5MA 3N9RA 3B8DA 3C61A 4M82A 3FDKA 3OIXA 2Y62A 1U5JA 2EPOA 1RQBA 3KDOA 3TC6A 5EA9A 1V03A 3WQOA 1NP2A 1AJ2A 1HXJA 2V9DA 3GEOA 1YDYA 3U2ZA 3ZVIA 2YSWA 5D2VA 4Z0SA 1EFZA 4WX2A 1J0ZA 1RVGA 4TX9A 3UCDA 3E3HA 4QE4A 4LS1A 3SSJA 1V3KA 4AEFA 1EA9C 4YYCA 4BF9A 1B0IA 3EOOA 4FF7A 2QGYA 3P8JA 4RE2A 4F48A 1RK5A 1W2PA 4A8NA 4DI9A 4E3VA 2WJDA 2XGIA 1BRLB 3OIHA 1UR2A 3WDPP 3ABQA 3LCLA 4UTTA 4EAYA 1H0IA 3NNTA 2NV2A 3LHZA 1R2SA 4DYJA 1MDRA 3SJNA 4HVXA 3N6JA 4PTMA 3R8HA 2X8RA 1WUFA 3AIQA 7TIMA 1XIFA 1OCJA 2JBMA 5RUBA 4FS9A 3KUMA 5C7HA 1AL8A 5EFFA 4MLJA 5C71A 4RK8A 4YL2A 3GKAA 1FUYA 4AH7A 3URNA 3W23A 3VKCA 2A3LA 1CECA 3PZOA 1ECEA 4HT3A 4GYPA 3ZT5A 3P6LA 3AYVA 4CQCA 1UP0A 4LALA 3SO7A 5BXSA 3A4JA 1G7UA 4AIEA 4IJBA 2GDQA 4GNJA 2YB1A 3AICA 1DWHM 4BY3A 4UTUA 4EOUA 4PMYA 5M17A 2EPMX 1V0MA 3RUBL 1J2BA 4L80A 4TX8A 3TFXA 1GYMA 5F1UA 1H11A 2Q8ZA 1XRVA 2IS7A 5DCEA 3H23A 1QI4A 4Y9MA 5E70A 5I77A 1IWPA 1HO1A 1OGSA 3CS2A 4PTNA 1V3HA 3MCOA 3LM7A 1SQ7A 3OP2A 2J8TA 2PI6A 3SUVA 4FB7A 3WLKX 1DWFM 3LNPA 4EVZA 2GQ9A 4GPNA 3PWGA 3C56A 2WKGA 3NQ7A 3FAXA 4DM1A 4QHRA 1PSCA 3GAYA 3UR8A 2JQXA 5BNKA 1H49A 3CQKA 4D1JA 3KOXA 1A3WA 2INEA 1E6SM 3ZZ1A 3AZSA 2W62A 4U3CA 4IXXA 4AFYA 1I2PA 2OSYA 1ZGDA 4H8UA 3WBXA 2QUNA 5IBXA 3ZWTA 1E15A 3KP0A 4C1NB 5D4YA 4A05A 1VZWA 3ARYA 2FLIA 3MI6A 2IPFA 3SB0A 1S5WA 1J5SA 1R7OA 1VFLA 3T2QA 4HOWA 3WL0A 3IGHX 4Q22A 2WMIB 1E70M 2YLLA 2QYGA 4IZGA 4PUUA 4XZHA 2G0WA 3A12A 3BV7A 3H7RA 2BG5A 4BHYA 1C8YA 3JUGA 1VBHA 4MNMA 4UZSA 5I06A 3HFTA 3S2LA 5GNXA 3S5OA 3FNDA 5DFAA 3HB9A 1S38A 3WUBA 1FWJC 4D6GA 1HJXA 1X8FA 2OODA 1F7BA 3EOUA 4MY9A 3S6DA 4GRSA 1Y8BA 4ZOBA 4HNTA 1UBPC 4MMWA 2YYTA 4LUIA 1EBHA 3ONCA 4IFKB 2HPIA 5HUPA 4OBTA 4O1AA 4GXMA 4JTIA 4L4MA 2FZ9A 4QG8A 3SN4A 2OLSA 3E2VA 1HJUA 4HOZA 1M01A 3LPGA 3AYTA 3TQPA 3XISA 3DESA 3AFBA 1C9DA 1G7VA 1TVNA 2C19A 4HSOA 4ZEPA 1GQIA 1J0JA 4ZR8A 1JJKA 5D9OA 3EBVA 3L5MA 2ZDSA 3GDKA 5LHEA 2YCKX 2P0IA 4JIEA 3EZ4A 3M5ZA 2C0HA 3TXVA 3UNDA 1Q6OA 3URAA 1X1OA 4AXNA 1CGTA 2QJIA 1JL8A 2FH6A 3T05A 4BI6A 1BRLA 3LQGA 4WEVX 4F9DA 1TKKA 3KOYA 4JIRA 4XAFA 1X8CA 4AMAA 4EF9A 3B9AA 4ZQMA 3AXXA 1HX0A 3SY1A 4J2PA 2OG9A 2VO5A 4W7VA 2RDUA 4GNKB 3GNDA 3GR4A 3RM4A 3AMGA 4I5UA 3VCRA 4ZQOA 3WLNA 1BGAA 2P50A 5I5RA 4OJYA 2WKJA 3EWWA 2RDWA 3W71A 3RILA 3L0NA 5F4XA 1C3FA 4LS0A 2CBIA 2TYSA 3B9DA 6ALDA 1AD4A 2PB1A 4D6EA 3KCJA 1GVIA 4Y9OA 4CNUA 3HMJG 2V8ZA 3BPWA 2GJRA 3I3BA 1XM3A 1FHVA 1SFSA 2QCNA 4XKYB 4RR4A 2NUYA 1YXYA 2E5BA 4JN6A 4HYRA 3MYOA 2X7WA 1FWCC 1GHRA 3V75A 2AQOA 3BE7A 3OVQA 2I7GA 3KHJA 4JQ4A 4CEXC 1R30A 3W26A 4CN4A 1W3KA 4PRWA 2QIIA 1UBSA 2ABAA 2PE4A 2A7PA 3C0QA 3U6WA 3BZGA 3CHDA 3NQEA 2A6LA 3DYPA 4B5NA 1VBRA 3C0JA 1PDZA 3SBFA 4J40A 1X98A 4UNIA 4M8UA 1BTCA 3HJEA 5G4WA 4L1GA 1Q6FA 3RCNA 3KLKA 4PCPA 4LVGA 1SO3A 3EOLA 1LQAA 5TNVA 4JTAA 5FSDC 2C1GA 3U7BA 1DV7A 1NOUA 1SW7A 1XF0A 3KBMA 2ATSA 3OG3A 2NV9A 4H9YA 1M03A 5G1TA 1PKNA 3TN3A 3DXIA 3AHZA 3RM9A 1ME7A 3H2EA 1B4KA 1VEOA 2DIEA 2GJLA 4I9MA 4DWDA 2PTDA 2QJNA 1G69A 1BSIA 4MB4A 4C6PA 1QCWA 3OBEA 2BB0A 3DC8A 4C1LA 1T8XA 3SUUA 3DI1A 1Z44A 1GTHA 4DZ5A 2WHMA 5LKYA 1KXQA 1TV5A 3YPIA 4C7FA 3VD4A 4NJIA 1VYRA 3VKRA 4XZ9A 2I16A 4DWSB 3VLYA 4FNRA 1FWGC 4WD0A 4XAGA 4D6JA 1F6PA 3IEBA 4W86A 1UR3M 2HNEA 4LGXA 1PS9A 1QHOA 3ME3A 3CHFA 2I5QA 4A3YA 2PU0A 5EGRA 5TD4A 8A3HA 3B06A 1TWIA 1XJBA 2GOKA 1V5XA 1PO9A 3CO8A 4P8VA 4IX2A 1M68A 1S2TA 2YFOA 3AI0A 3KRBA 3NL3A 4MWAC 2E7FA 4M80A 4GCXA 3APTA 3CLWA 1S2AA 2Y7FA 4J4KA 2PDLA 1WBHA 4BA0A 3EOSA 1P5BA 4N7QA 2RJHA 1RVKA 3FA4A 5EB8A 1LL4A 5AHLA 1UQZA 4GC3A 4XBKA 3GC2A 4FAMA 1JAEA 1RH9A 1XCFA 2X1TA 2NVAA 4H7ZA 2OKOA 4ERGA 1K7FA 5M3WA 1PWMA 4QISA 3WD4A 5F2GA 1PV8A 4GWEA 4NZJA 2ZCGA 1LUCB 3W7CA 1J8VA 3S42A 3WY1A 3L4WA 1ZHAA 3CMJA 3GK0A 3P3BA 4ZMGA 3P81A 4GISA 3GU1A 1Y0EA 3UCCA 5G2WA 4LW7A 1MZRA 3PBWA 4I6VA 1MEIA 2OWCA 2Y63A 1B9BA 3SW6A 3K2GA 1ODZA 4CVUA 3LYEA 3POCA 2J24A 1QU4A 3DHPA 3EDFA 1D3HA 2A4AA 4K1GA 3C3UA 4FMVA 4KBXA 4TOQA 4W85A 1NIUA 3VKTA 4IP4A 3ZWSA 3GTNA 5TIMA 3P5ZA 1ZJ8A 1JZ7A 1VKFA 4DXVA 1OGBA 1QT1A 5I3KA 4H1ZA 3UW6A 4AWUA 4G56A 5CJNA 1V93A 2PBOA 2AKMA 4ERIA 1M7JA 2A6NA 1EEPA 3G77A 3TK7A 4O15A 4PSRA 3AIRA 3URBA 4YLWA 3ERPA 3RCMA 2GWGA 2ACRA 3QM3A 4O4VA 3BCFA 4HTYA 4J3WA 2V38A 4EWJA 1NOWA 4PMUA 1TCMA 1TQXA 4UTIA 3W2JA 5ABFB 1P6CA 4MKNA 1G4PA 2ATMA 3MJMA 3FSUA 2P53A 3VIJA 3EA3A 3JU2A 3R0DA 1A4LA 5D8WA 4TV5A 2FHBA 1M7OA 5BMXA 4KGJA 1AZ1A 5IHSA 2SFPA 2XGZA 4ORIA 1HG3A 3KRSA 3TV8A 3KTXA 4PB5A 1UD3A 1IXOA 4Q4KA 1LCOA 1R3VA 1X6LA 4LS2A 5A94A 2QVNA 2D23A 2Z24A 1OF6A 4IPJA 3TTSA 2J9YA 2G3MA 4JR5A 1AK5A 4NIRA 2ZKMX 1W0MA 3DBPA 3BK0A 1JZ5A 3B97A 2X41A 2XISA 3KRUA 1VFMA 4H6QA 2V5BA 3GFXA 3PSWA 2D3LA 4JY9A 3OR1A 3GLCA 1NWRA 4EIVA 3D3FA 7REQA 2I9EA 4WOQA 1V6UA 3N29A 1XS2A 5JUVA 3VO0A 4LAUA 1YE6A 3THUA 1UW9A 1YEYA 3QPYA 3O6YX 4IPPA 4LVDA 1JZ6A 4N4PA 2O7SA 1MFUA 2OCZA 4C6KA 1R3WA 3CZJA 5C8BB 1DQWA 4CNPA 1VIZA 4FO4A 3QMSA 3WJZA 1EDQA 5C2CA 4GKLA 4K37A 5HQEA 4WIWA 1Q7QA 3ATYA 4JEJA 1G5AA 2QCDA 2XHYA 3MO7A 5LGZA 1H5YA 3QOMA 4IICA 3TJLA 3STEA 4PBGA 1A53A 3REQB 4DAFA 4O16A 4L65A 1ZAIA 4XD4A 2BLEA 1TPB1 4GY1A 3LHWA 1XCWA 3W6LA 9RUBA 1VJSA 3HQPA 1DXIA 3UXDA 5FJUA 2GPTA 2WQPA 3DEQA 1TPC1 3RX3A 4O18A 3INPA 3JR2A 3N3MA 1KXTA 3RGTA 2ZXBA 4G8TA 3WELA 1K03A 5A2AA 1FWAC 4NNCA 1BVNP 1RBOB 4QDMA 3MBFA 2QCHA 4FLRA 5D9MA 1O5QA 1W8GA 4O53A 1XLGA 5ECVA 1EQCA 1DORA 1ZP4A 4YIWA 1JNEA 3SADA 1QNVA 2GJXB 3VUPA 2D3NA 4R7OA 4XUGA 1LQ0A 4UFKA 4HZ7A 4Z0JA 4Q8TA 1Q6QA 3A9BA 2X40A 4GE8A 3B0YA 3MWAA 5AKQA 1XICA 3QVQA 4LCQA 1BWLA 4BR1A 2MUCA 5M03A 2MANA 2BXZA 1UPMB 4M56A 4HU0A 2PTZA 3VNLA 1IZCA 3I4EA 2H90A 1CX9A 2ZX5A 5DRIA 4DB7A 3ZIZA 2I9UA 1IYXA 4EKJA 1WZKA 1UR4A 1RJPA 4P5UA 3C86A 4D6CA 1AMYA 2VKZG 3W2NA 1K3UA 3FGCB 4Q4SA 1KFJA 4LF2A 2HMCA 4UFLA 2J78A 5AVHA 5DMNA 4Z08A 1N7KA 2WMFA 3NDOA 3UU0A 5C55A 3L4YA 2QJMA 3DERA 4GX9A 2IQDA 1V6VA 2FFCA 3VIGA 3R5EA 3PBMA 3R25A 1ONRA 1VHNA 4IIEA 3W81A 1REQA 3QV9A 3LY0A 3RO6A 1XQKA 3W74A 3TYDA 5HANA 1XD1A 1WA3A 2P5NA 3KVMA 1FTXA 1J12A 3ITOA 3PWIA 2Z1SA 3WNKA 1O12A 3WH9A 1YYAA 3GU9A 2QXWA 2X30A 3B0LA 1OFAA 1V51A 4YTTA 1CLXA 1N2VA 2GLKA 4DJFC 4MZ1A 1G9HA 4YN5A 4UTKA 3O15A 4GZ7A 3O05A 3EDKA 1CYGA 5AYYA 2X1IA 3GO2A 3W1PA 4L64A 5A6KA 3LCFA 4IUOA 3QQ0A 1KXHA 1UROA 1JPDX 4OBRA 1HKVA 5H1WA 3CAWA 3IANA 2FHFA 3BLIA 1YNPA 1JCMP 3O06A 2DZXA 1XQLA 2FH8A 3W1TA 3W72A 1VFSA 3S5NA 3FS2A 1GZGA 3GW0A 4F3HA 2XM1A 1A4MA 5A6LA 2YLAA 3BG3A 2JEQA 5AB3A 4RX0A 3RU6A 4A8IA 2ZZ7A 3RXZA 3W38A 3BW2A 1JRBA 3GVRA 3UBPC 4D6IA 3U0HA 1XIJA 1DTNA 4O57A 5MKGB 2QCFA 1JYWA 2V3EA 4I3GA 4JBRA 4TMBA 4WDXA 5D8ZA 3EB2A 1EKOA 4DI8A 2RHGA 4KCUA 3WNNA 3WQEA 4J3SA 2IW0A 5AZ1A 3SQSA 2BY3A 4C6LA 1W31A 4IWWA 4MZYA 4TX6A 4DAIA 2V63A 6REQB 4IT1A 3ZT6A 1TE6A 4AY1A 5EU9A 4GO8A 3BMWA 4HTRA 1VD6A 3K1GA 3ZQ9A 3PPFA 4TIMA 1YPFA 3VDBA 2PODA 1S5VA 2PDMA 1U1JA 4KF1A 3CAQA 4UTTC 1E0VA 3BQ6A 3T81A 2Z26A 1EX5A 3D47A 2XIOA 3MT1A 3TSBA 4AOPA 2WZIA 3ITCA 1M7PA 2ANUA 2HXTA 2VEPA 1ISVA 2J74A 4KIRA 2QJGA 5AC6A 5HJXA 4ADTA 2R6OA 5K9XA 3A4AA 4A8RA 3N3TA 2WCSA 1E0UA 2PDYA 3SIMA 3I4KA 3O8AA 1TB3A 5E09A 2GGGA 2WNWA 3LI0A 2G97A 2WVUA 1A5MC 1UHVA 1KGXA 3B8SA 3LRLA 1B2YA 3W00A 4MIMA 2DGAA 5B80A 3MMBB 4R5EA 1UC5A 1ITXA 1F3EA 2Y61A 1HUVA 4ZQPA 1XC4A 1XIDA 1VAHA 4JYEA 3Q58A 3WMLA 2FZMA 2G5WA 3WDJA 3RF9A 1TELA 3L23A 3WG6A 4G38A 4H00A 1R7AA 3WZ0E 1PZ3A 3TDFA 1UOKA 2RH9A 3ID7A 3TWAA 2OZ3A 1ZJHA 1LG1A 3ES7A 1AFSA 4RUBA 1ZAHA 4Y90A 3W7PA 5XIAA 3KVJA 3GG0A 3C0SA 4N9EA 3QV8A 2KZHA 1MYRA 5CPTA 3E2SA 2VR5A 4BWLC 3OZOA 5FEPA 3T40A 3UWVA 4JTTA 4DWSA 1QNRA 3WNOA 2QQ6A 3BLPX 3GZAA 4D71A 3M7WA 2ZFAA 2REQB 4QP0A 1GW1A 3MS8A 1A50A 4W8AA 2QUVA 4LXFA 3VFLA 2J7GA 4AYSA 1OFOA 3CB8A 2OEKA 4MPKA 3WNPA 3R7MA 5FJIA 4XV0A 3TQVA 2NUXA 3PNZA 3WN6A 1J93A 2XVGA 5XIMA 2INFA 4DJDA 4WDWA 1O5KA 5IFTA 3CO4A 3F2BA 2R82A 5C7VA 4AAJA 3MTWA 3WLPA 4CEUC 2XPKA 4H4IA 2R24A 4IL2A 1ZNNA 3RAOA 4NAEB 3AIVA 4W4QA 1JCYA 1JQXA 3E0FA 3LBMA 1GEHA 3O6CA 1LOLA 3N2TA 3VMPA 3C3NA 4GUFA 6XIMA 1AQFA 2WXDM 3PB0A 3UWQA 1KFCA 1DE5A 1KWGA 5AYBA 5FEWA 3GE7A 3WBEA 1PIFA 2D20A 1CXIA 1EZ2A 3ARVA 1D8CA 3GIQA 3E1F1 1BYBA 3FYYA 4H6RA 3CL6A 2QDEA 2VURA 3EWDA 2Z4GA 2O4QA 1KM2A 4AWEA 2PDCA 2WSPA 3GS6A 1B3WA 3DFQA 4KESA 1KTNA 2AQWA 2PD9A 3TOYA 3W85A 3FVMA 5JXQA 2Z7GA 1E1CA 3ZJ7A 4JHMA 1HN1A 4JHZA 4X63A 4AZ7A 4GQ0A 2VUNA 1IT7A 2NUWA 2W92A 2ZUTA 4QSFA 2E6YA 4H9MA 3ITTA 4GI9A 1U1UA 2QDHA 3SUTA 2D0HA 3M0JA 4NI3A 3CPUA 1IR1A 3WQPA 4C6NA 3PWAA 2VWTA 2LLEA 1FA2A 1LUCA 6XIAA 5FD0A 4BI5A 4UNKA 2UBPC 4ZL1A 3VIKA 1I1XA 3FXYA 2WM1A 1L2QA 1UP2A 1PZ2A 5M2FX 5CPLA 1QK2A 5CZJA 4CCDA 1JULA 4AD3A 2DT0A 5A2CA 3PSVA 1RY8A 1VJIA 3AU6A 1KLYA 4IM4A 4YTQA 4HSNA 4GYFA 2PTYA 4M7TA 4P8WA 4UQBA 3IIOA 3MUIA 5E9AA 1V0KA 3WLRA 1JQVA 1PUDA 1YDOA 2AKZA 1R46A 3M43A 3O7UA 3QHNA 2XH4A 2NLIA 1U5VA 1KM5A 3VCCA 3QGVA 2FPVA 1OEPA 3HO8A 4O4WA 3NSNA 4ECLA 4Z2JA 4IUGA 5D33A 1ISWA 2BY1A 3BTNA 1GKQA 4FXFA 5FOOA 2D69A 5ABEA 1VCGA 3PZGA 1RCOB 2QR6A 5A8GA 1B57A 1QW9A 2FGZA 1ONWA 2ADAA 2C14A 1OINA 3CBWA 4QDPA 4QQ3A 1I1WA 4LTSA 2RAGA 2PCQA 1IGSA 4HCLA 5CGQA 3RM8A 2G50A 4JFVA 2BTMA 4Q8VA 2CU0A 1O60A 1WXYA 3M4HA 2VC6A 2ZE3A 1J0YA 4KPLA 4JX4A 4OUIA 1C8QA 2PCEA 3D46A 2VGGA 5AOUA 1WKEA 2PSNA 2YJQA 3VDCA 3W2UA 4J5NA 4A2SA 4UOJA 4JICA 3BMXA 3GTFA 2Z29A 1EJRC 1N82A 4WF7A 1KR0A 1GVEA 1W1PA 3UXIA 5I6SA 1Z69A 3TXZA 2DV0A 2WZEA 3G6LA 4KKXA 4IIHA 1KQZA 2QMKA 5HDRA 4UTWA 1XUZA 2I14A 3UG4A 3S1WA 4PMNA 5HATA 2E77A 3LCIA 3UY7A 4DN1A 2GVGA 1TZ9A 3NM3A 2PUZA 1KB3A 2GJXA 3BSHA 3HG2A 3P61A 5F1VA 4JFTA 3QZ6A 7CGTA 3UA4A 4Z1YA 3A4WA 1OF8A 4W84A 3ARZA 4QEEA 3W4RA 2BVDA 5T9BG 2W79A 1U33A 4IPLA 3T0CA 4QAIA 3RMJA 4GVGA 4I8DA 1FP9A 2W4XA 3VE7A 3VNZA 1HVXA 1UC4A 1VFTA 4HZ6A 3SQLA 3V0SA 3AQUA 1KKRA 3VLXA 1EL3A 3HV9A 1TMHA 2PDIA 3M44A 2DORA 4D6FA 4WVXA 2GQ8A 1OD8A 1EPVA 2PGRA 3NZPA 3WBYA 4DBDA 3TX9A 1SUXA 2B7NA 1UR9A 3BAKA 2PRMA 3EWYA 2GGEA 1H7XA 3K8KA 7PTDA 3EA1A 3E49A 3S1VA 2DIJA 1K4GA 4Q8MA 3L21A 4Z17A 3TZNA 4W7UA 3QGAC 2FJUB 2VCAA 2XN1A 5AYZA 4J27A 4NL1A 3H26A 2XJ7A 2WCGA 3RIKA 2Q3RA 3BOLA 4NJKA 3LHTA 4IQLA 1DQXA 2C1IA 3CK5A 1TPVA 2TSYA 4C65A 3WIJA 3VPLA 4YNGA 3KBJA 4OQVA 3PBUA 3CQ0A 3MV01 1H50A 5I24A 1LORA 4UNLA 4NG3A 4WGHA 5EMJA 3WF2A 4MJ4A 3EA2A 3W2MA 1I9CB 3NPXA 4LNYA 1HP5A 3MKKA 4ZO7A 1QWKA 5G2HA 2X05A 5CQ1A 1JZ3A 1F74A 4HMCA 5CLWA 3EKGA 5CPOA 3TN5A 3PBVA 3IK4A 2NQHA 4M1BA 4Q32A 1E71M 4W89A 1J01A 2C18A 3NL2A 2DJXA 1W6TA 4ACZB 4PB4A 1WYIA 2DUZA 4LYRA 1YBQA 5CZKA 4XD3A 4MDOA 1RA0A 1UIOA 4LRSA 3V36A 3AWNA 4WJEA 2VGIA 3QYSA 4W88A 4Q8QA 1GOMA 2XWEA 4HN4A 4JL1A 4I5RA 3TMLA 1K1DA 5AYXA 2CLPA 2W6RA 4W8LA 1DOSA 4IISA 3TE9A 2XFFA 4AX7A 4CCCA 1IZKA 3UJSA 1E4IA 1X7FA 3NL6A 3NJ3A 3WX7A 5G5IA 5A2BA 4OIFA 4LF1A 4DO4A 2X2YA 1EF2A 4IPNB 4I9AA 1DQUA 1RA5A 3G22A 1EX1A 2DFAA 5KEZA 4PUWA 1KRBC 1NDZA 2ODOA 1BD0A 3DKJA 4PR4A 2WVTA 3GHTA 5GJPA 3TYBA 4QTGA 5FAJA 2YCEA 5E0CA 5BWAA 1EC7A 6TAAA 2OX4A 1M04A 4WXYA 2AKJA 3H7UA 1K9TA 1MUCA 1QHPA 2CW6A 1NM9A 3GBDA 2ZUUA 1MO0A 2GQ3A 4JCLA 4Y2WA 1QPNA 3MUXA 3PPCA 2FB2A 1HQTA 4NRSA 2VFDA 4RV8A 2W0UA 1IEIA 1WXJA 5JBEA 2CWNA 2DZTA 2R1PA 3PJWA 5D9PA 1XIMA 2Z7KA 4OUEA 3B8VA 3BURA 1GW9A 4V28A 3U5YA 1AQ0A 1V0NA 3BLFA 4TUFA 4MJZA 4C1NA 5IHRA 3N04A 4ZCWA 3VIIA 3GNNA 4QNEA 4S3BA 4IMCA 1CTNA 3GH7A 4A21A 2WOQA 2YBTA 1KM3A 4KW2A 5I09A 1J9YA 4E4PA 2YKKA 3HPXA 3WDHA 3OGRA 4IIFA 1V79A 4MNLA 2REQA 1NDYA 2ZICA 3BOXA 3ZLGA 1HJQA 3MI2A 3HGJA 4FOUA 5DXYA 1EO5A 3W1XA 3WUFA 1V3IA 1VF8A 3JVAA 4DPPA 1RPXA 3BC9A 5EBUA 4EACA 4US6A 3AUOA 5I78A 1SZGA 2NXGA 3Q67A 3AROA 2A5HA 1QK0A 2BGSA 3KOZA 1B3VA 3W1UA 2OLHA 2OXNA 3MSRA 3JRKA 1UZ1A 1DHPA 1YBQB 1KM0A 1B30A 3G5EA 1Z8AA 3MW7A 3SDOA 3A3XA 3UR7A 2PDUA 1EDGA 2I1OA 4DJED 2W5FA 4ML4A 4DHGA 2V81A 2CHNA 2E6DA 3W37A 2PC4A 2XVNA 4YTUA 3P62A 1XIBA 1S2VA 4B3LA 2E5DA 3F5JA 5TQLA 2H8XA 2VI0A 1AQHA 2IKIA 1S39A 1KCKA 3HQOA 4UWMA 2V3DA 4MY1A 4I9JA 4XZBA 3SFKA 2AL1A 1SO5A 3B4UA 4NI8A 3Q94A 4ZQCA 4NJHA 1C92A 1GEQA 2WMGA 3TR9A 3BLLA 1OWQA 4TMCA 1BXBA 1GORA 1EWEA 3PZUA 3TYCA 1XSJA 4DJEC 2HEJA 3PUOA 4LEFA 5A8PA 1C7TA 4DNHA 4MYAA 4A3RA 3MC5A 4NYYA 2OT0A 1BKSA 1EQPA 2HCVA 1EBGA 2VT0A 3NQCA 5K2ZA 3WBAA 1XIEA 1IGWA 1O6IA 1WOAA 1EXPA 4HNLA 2CLOA 2QULA 1E6XM 3VZZA 4PMOA 4ZO6A 2DY3A 4AUBA 4W8BA 3B0UX 4JTFA 1PCWA 2PBGA 3UG5A 4GVFA 5HUOA 4Y9NA 1NEYA 3THDA 3DU0A 3T9PA 5I3DA 1WOBA 1WCGA 2V5DA 4H9ZA 4CN6A 4U2ZA 4XK2A 1XI3A 4JAWA 4KH2A 1Q13A 4DIAA 2R1MA 2D22A 4XTDA 2VZTA 3H2FA 1OFRA 3A3HA 4A6GA 1ZS2A 3RK8A 4RCXA 5CG7A 1H09A 5LA1A 1VLWA 5DMLA 2EAWA 3STGA 4FHAA 3HQNA 5LIWX 1UR0A 1NTHA 3CYJA 2WWDA 1X1NA 5HQLA 1KRMA 4G5DA 4JEQA 2XH7A 2PA6A 4KFPA 3CUIA 1W91A 3H6OA 2OOGA 4JFWA 1KKOA 5GEPA 1WDWA 4XZWA 2GUUA 1DPMA 4A35A 3E0WA 4WRHA 1LJYA 4Q8UA 4S3DA 4U33A 4NZFA 3HGRA 3P0XA 5JIPA 2X0YA 1BXCA 3PZ9A 5EFDA 4H7VA 4W5UA 3RPDA 4IGHA 4IMDA 1O4UA 2VZOA 3BXWA 3W2KA 1QVBA 3FYPA 2DZBA 2FHCA 3E0VA 5AECA 4FOKA 3W0KA 4C6BA 4JNMA 3RITA 3OGSA 1CI1A 4US5A 3F5LA 1PIGA 1RQHA 3VTRA 4HU4A 4CKQA 1XL9A 1KFEA 2POZA 2QCDB 3V35A 5D09A 4TVCA 4WJXA 4C5YA 3BANA 4K3ZA 5D03A 1XCXA 2OZ0A 1V6TA 1ISYA 4JIQA 4GI4A 2P88A 4KFOA 2FJKA 4QM1A 2EG6A 1Q45A 3TZFA 3TQKA 4IFKA 3T78A 3OGVA 2H3DA 5AC7A 2OX1A 2XZ7A 3B8IA 1J6OA 2XSJB 1TJ0A 2F38A 1XKYA 2ZZ5A 4E8DA 2IKHA 1TWDA 4E2BA 1ENUA 1PPIA 4DQWA 1VYSX 4Z2KA 3GXFA 4E5TA 3VIPA 1DE6A 3KP1A 1OFPA 3ZFHA 4CCEA 4E6MA 3SCRA 1EOKA 1YQ2A 1EC9A 4PSPA 1KLZA 3S6OA 3U5UA 3LHVA 4Q33A 3VM5A 2BHUA 1P0NA 3T42A 2NQLA 2D1ZA 1T40A 2MNRA 4V27A 1HVQA 2WB5A 1I60A 4GA8A 4P7OA 5FEXA 1K70A 3GTHA 3PB2A 3CJPA 1BVWA 4N6EA 3OZMA 4JTHA 5E1QA 2V3FA 3UZZA 1SVDA 2YA1A 1F3XA 1OSEA 4LWWA 3NTYA 3T0AA 4PODA 3GXMA 4ZXOA 1E6NA 2CLKA 1P7TA 3XINA 3WQ4A 4YYFA 3M5YA 5HNUA 3ITYA 5BWFA 4B5SA 3AMDA 3AS2A 1A5AA 1KM4A 1JYVA 1IZJA 2YXXA 3UNTA 8TIMA 4RNHA 1ICQA 2WNNA 2G3JA 2I17A 4LV4A 3STFA 1DTUA 4S1FA 5ENLA 5LIYX 2IPJA 3W7KA 2VFHA 7ENLA 3A64A 3RNDA 2JALA 1TA3B 2OKTA 3R1ZA 3L4ZA 1Q4NX 2DP3A 2PWVA 2CLIA 2YBVA 1UZHA 1UH4A 3EXTA 3LXCA 2XFYA 3WEOA 2A3EA 3G6MA 3UY8A 5DY2A 2D73A 3MVIA 2QLYA 1TRDA 1SJBA 3OQ8A 1W1VA 3CZ8A 3RFAA 2FB3A 4DJFA 1AL7A 4YHGA 1EGVA 4MB3A 8CGTA 3MUAA 1IWAA 3IRSA 1V3MA 3IGSA 5HNNA 4KRZA 1Q6EA 1UUOA 2A7RA 4XVDA 4RLIA 2ACSA 4S3FA 4Z2LA 4DBSA 3I68A 3GNPA 1W3TA 3MKCA 1KO0A 1XWYA 2BX7A 3DUGA 2VFEA 3E12A 3VNIA 4LB3A 1DIKA 3CWHA 2P1FA 4HPGA 1LOSA 1UZ4A 4KETA 1NELA 3VKAA 3SRKA 2CLFA 1T0OA 4C1KA 3M5XA 3UVIA 4HNVA 1QDSA 3IIZA 1TPUA 4Y6GA 3VI2A 3HPZA 4H6EA 4O50A 3SCQA 3VAVA 2Z2UA 3MSYA 3IJLA 3WDQA 3OZPA 1TJPA 2F61A 4F0LA 4O1EA 3CIXA 1KBJA 4JYFA 2UY5A 3CLMA 3WF0A 3TROA 3L4XA 5I07A 3IJ6A 1R3RA 3IK2A 1XPYA 3UGRA 3M47A 1LRQA 3LSBA 3BICA 2WZHA 3HIJA 2V2HA 1KM6A 3CZEA 5CC7A 1E73M 4AWSA 3N34A 2P76A 2HRWA 5EMUA 4DEFA 4PMXA 4NZ1A 1UPPA 2J47A 2OQHA 4XZNX 3NDZA 4HMNA 3KRZA 2Z2BA 3VK5A 3W2LA 2E25A 3PZIA 1XDLA 1GOXA 1GZ1A 1ZJBA 1FH9A 2FFIA 1TV2A 3GQYA 2PZNA 2PC8A 3H24A 4D8LA 3W7RA 1ZZMA 2OO0A 3P5YA 3CAVA 3GXIA 4B3ZA 1K8XA 3FHQA 4CQDA 2PU1A 4C6EA 4MFEA 3U2CA 3SM0A 3MI3A 3OBKA 3ICJA 3IAPA 4IQJA 1AOPA 4C91A 3FX4A 1H7OA 3CYVA 3MKVA 5HR7A 4UUIA 4MJMA 4N4QA 4PTXA 1WP6A 4U3AA 2EPNA 3OHMB 2WW5A 4R33A 1NP0A 3UR2A 2HTMA 1DHKA 1ZFJA 1V6YA 3O63A 1F2JA 3P93A 1L6GA 5HXMA 1XFCA 4E4FA 3AXIA 3QR0A 4YHEA 2CKRA 1TTQA 3AYSA 1JI1A 3T55A 3CQHA 4D2JA 1AMKA 2HE8A 1CLVA 2VJXA 1OYAA 4LC8A 4QXIA 5EMLA 3MMCB 4QJ3B 1R2TA 2YA0A 4M24A 4PZVA 3SGGA 1BGGA 2J8FA 3A23A 3W7MA 1V02A 2EKCA 1AW5A 3KDNA 4N0RA 5FACA 3LGGA 2RGMA 3CPGA 2FMOA 4HGXA 2BXYA 1EHAA 2OU4A 4GD0A 4BQ2A 1EA0A 4DM2A 2NLYA 4B5WA 3LA4A 4F8XA 1GK8A 4NXSA 3NZ1A 3N4AA 4Q8WA 1S2UA 4LY4A 3MM8B 5C2XA 4Y96A 4WY0F 1FWTA 2ZUWA 4K39A 2F8QA 1M53A 1KA9F 4E2OA 2VMFA 2V69A 4GXPA 4MY8A 1QXLA 1POKA 1A0CA 2R14A 4S3AA 1EYEA 1VS1A 4UQEA 2C7FA 1NDVA 4K38A 2NW0A 2AMGA 2WMKA 1RP8A 4D6DA 5BMWA 2CITA 4UTLA 5CC3A 3S1GA 2V4JA 2VC7A 4M6VA 2AL2B 4KEMA 1XRSA 1OCBA 4HD5A 2VWSA 4M0XA 1IE7C 3RLUA 3UZYA 4PYSA 1UMLA 1XYMA 1QPQA 3UWWA 3NZQA 5ABTA 3MP3A 4F79A 3VOFA 3P14A 1C8XA 4G1KA 4DLMA 4MB5A 1U2YA 1PJ9A 2OWXA 4CVWA 4L5ZA 3SZ8A 4X9YA 1R3SA 5B7YA 4HYWA 3ZR4A 1A5KC 1QBBA 3O0KA 1H41A 1MQPA 3TTYA 2EGZA 4KWWA 4S3EA 2G37A 1W3JA 2XN2A 5FEZA 2A3HA 4L9YA 5DXXA 1VHCA 1PYMA 3V7PA 1G4EA 1O5RA 1AD1A 5BRQA 4C6CA 3EXSA 3GU2A 3O16A 4QJ1A 3G3MA 2D24A 1P1MA 1YW1A 1WE5A 1VENA 2XH2A 5HPOA 4GIRA 3S5SA 5I2UA 3QV7A 4ZFCA 1VFFA 1JYNA 1E3XA 1SJCA 3EDEA 3CB3A 3CUJA 5LZLA 3UA3A 4L4OA 3NXFA 3NWRA 3A6OA 1FDJA 5F2MA 4M1RA 2EPHA 4V33A 2VCBA 3IRDA 4NKCA 2CFFA 4PL2A 2DIKA 3HURA 4XX6A 2Q01A 1UWSA 3HZ3A 3NM1A 4BZYA 3RR4A 5C0QA 4FLQA 3VM7A 2VD8A 4MUPA 1VJZA 4HHPA 3L9CA 2Q3OA 1VB9A 4KRUA 1WNOA 1U83A 3QLLA 3VVGA 2WYSA 1I2NA 5TF0A 3M1ZA 2UZ9A 5CGMA 1JI2A 4JKMA 4RXGA 1GYNA 2BOGX 3U2EA 3VX1A 3GRIA 2I57A 2YFNA 5AHIA 4GZJA 4F0MA 5BRPA 4ZTXA 3ARUA 2QDGA 2HBXA 5GPRA 1VP5A 2PTXA 1UKSA 2VGBA 3C2FA 4GUHA 2QCLA 3M9YA 3ZJ6A 1Z6KA 2HROA 3WQVA 3SFWA 4PH6A 4AB4A 5K7JA 1UH3A 3GC5A 5IRPA 3UD6A 4RL3A 2W27A 4MTVA 3W7OA 4ZENA 3NEHA 3W29A 3VLZA 5IM51 1DBTA 3E6EA 5C70A 3FAWA 1CGVA 5EKYA 4XUYA 4QFUA 4MWAA 1KGWA 4GIYA 3LHYA 2CC0A 4ZTYA 1K02A 1XLAA 4PB3A 2HVOA 2YDAA 4HA3A 4XSLA 4WDUA 4F0KA 5HWMA 3FEMA 3HJZA 3ISIX 4WXZA 3ZVHA 4ZSTA 1XIIA 4BKNA 4AXKA 2C71A 3GVVA 1OK4A 2OTDA 1RCXB 1E0WA 5AYIA 3G1VA 3TAKA 2V5JA 2BBFA 1FH8A 1RLCL 3E0IA 2QCEA 3MV11 3NPVA 1OQFA 1J4EA 2J7DA 2ZIDA 3P7YA 4PMJA 1DXFA 2ZRVA 2ZTKA 3BQ5A 1SZNA 4PUEA 2Z1KA 3QMRA 1DKWA 2DEPA 1SZRA 4TVDA 1XW8A 4IMEA 2A3CA 1L8PA 4UFIA 4ZGYA 1S5NA 1MW2A 3QH2A 4GXWA 1A49A 1K8ZA 2DVTA 3QKEA 3WQGA 4MWAD 2GSEA 2ZUSA 2BWGA 3L4TA 2R1LA 1FCBA 3FJ4A 2PDPA 1QNOA 4HNNA 1ZENA 2A79A 3WL1A 5CGTA 4M6PA 1VFUA 3IVSA 3T7VA 5D04C 4LT9A 3MBDA 5KMYA 1J5TA 2OJPA 3A9IA 3Q45A 4BCEA 2PP0A 3WD0A 1E9ZB 4P7LA 5E6YA 3LGEA 1E1FA 1EJ7L 1PYFA 2G8ZA 4QAWA 4FI4A 2XIMA 2BSLA 3IIXA 5E0KA 1V4YA 5CKSA 4DWSD 4FPSA 3MZNA 1WDDA 4G6CA 3AXMA 3FYOA 4QG9A 3CHVA 3SN1A 3CUXA 1J79A 1QOXA 4LYPA 4WJ8A 4Z2HA 4MWAB 5I3GA 3T0DA 4IIDA 5G1MA 2PDXA 2V5KA 4B92A 2OQYA 3QKZA 3G1SA 4KWVA 1WZMA 4O14A 1JD7A 1G4SA 1TWWA 4GQGA 4RPQA 2FTYA 3DFYA 1XHGA 3I6RA 3KOWA 4POCA 2CLHA 1W2VA 3ZSSA 1C90A 4I8YA 4JQ3A 3FEQA 2WBKA 1J0IA 3ALFA 3QHMA 1EF3A 4GQRA 4YVVA 3MY9A 4ZOEA 3VIFA 3KX6A 1OC5A 3KXQA 2JIWA 5CAHA 1ODUA 2YL9A 2D2HA 2J25A 5CXPA 1RUSA 2Y70A 2GJPA 1X6NA 4IFRA 2NVCA 3B9OA 5LIXX 4NQ1A 4JOMA 2BS9A 2VX7A 3MSDA 1YPIA 2VGFA 1N8IA 1E6ZA 3HA1A 1UWTA 3SRDA 2NZLA 2GFTA 5EMKA 3XIMA 3MM6A 4OTKA 5JH2A 2Z00A 4JNYA 1GONA 3VKQA 4XSMA 2ZRXA 4XO7A 1RXOB 3PZVA 5FF7A 2QHAA 4P8XA 4O17A 3EWXA 4P8UA 1P6WA 3UETA 4E38A 3FIGA 2BP1A 2OT1A 3PTKA 5CC6A 2EBNA 1LG2A 4ZBCA 4WKHA 2DUXA 1CGUA 2F6XA 5AC5A 4RDVA 3M0YA 4X2RA 2VEGA 3TN6A 5LNUA 1P0DA 4LC6A 4WSKA 4CU7A 3MMAB 1OD0A 3TU9A 4XZMX 4ILSA 4MYXA 3H12A 1O5XA 3W87A 3K13A 3PZNA 2VEMA 4XVEA 4GI8A 3NQ2A 4OFCA 5HQMA 4M6QA 3CZGA 2VFGA 1MMFA 4F0HA 3AHYA 1FDYA 2JE8A 3OB8A 3TNBA 3LRKA 4BEUA 1RLDA 4JTGA 2J62A 3P2VA 4QQUA 5D9NA 2J4GA 1W3NA 1JYXA 2QVHA 3UGVA 4PE8A 2G96A 2ZX6A 5DCBA 2PDKA 2WJFA 1K8CA 4Q8NA 4HIBA 2W67A 3B0NA 2Z1BA 4HNUA 3EEZA 3H2NA 5LXXA 1YTDA 3M0ZA 4GVIA 5MHBA 4NZ3A 1V7YA 4Q4MA 4QE5A 3IJIA 1ZSXA 3HPAA 3PUDA 1PVNA 3VCNA 2ZWZA 1GQLA 2QZRA 3LBOA 1M1BA 3UZ5A 1ISXA 2C6QA 2OGYA 3RDKA 3HTWA 3C2YA 2CZFA 4H8VA 3DG6A 4O54A 1JCJA 3AS3A 2Y7DA 3CUGA 3O0FA 4K36A 2DT3A 3NGFA 2H3BA 5CCZA 3CV2A 4HSHA 1FY6A 2VL4A 4WOZA 5D02A 4HNOA 4L6DA 2IUZA 1OT2A 4O19A 1CXKA 3VU2A 1DWGM 5LSMA 1ME8A 3PY2A 3MHGA 4OT7A 4DPQA 4FNUA 3COTA 2CWXA 2XTKA 1RBAA 3IIVA 5JBDA 1U22A 4AEOA 1V08A 2XSXA 3VFCA 1E4MM 1TCDA 1VFOA 2ZTJA 4WQ6A 3DECA 1XSIA 4CU8A 4OKDA 4IOTA 1DIOA 4QCFA 3HN3A 3I7RA 2OZ8A 4QLLA 2BNJA 3GG7A 3QEZA 4C6MA 3BAYA 4UXDA 4CCZA 3WUGA 3N1AA 4IH3A 3V5CA 1W5QA 4AHOA 3CV7A 1BQGA 4N02A 1L6FA 2AMXA 2WMIA 3OLIA 1QNQA 4PULA 2X0HA 1XBZA 4IG2A 4RJEA 4PMZA 2ZX7A 1F76A 1UA7A 1GWJA 3CASA 1EUNA 4Z1DA 3KHDA 4O11A 1W3IA 3B4YA 5JBFA 1HGYA 1E0XA 1GVFA 4NAEA 4QCEA 5T8GA 3ELFA 3LERA 4RDZA 4M19A 1H7NA 1QO5A 2VC5A 3VGEA 3QQWA 2W9MA 4B5VA 3LLXA 1Q8AA 3WEMA 1BPLB 5KZDA 1XBXA 2VRQA 4G1NA 3APGA 1FFQA 4TQTA 1OZMA 1W5NA 2QCGA 2QJJA 4HHLA 4PC8A 3TCSA 1W9PA 2DH2A 5C9UA 3B9NA 1DP0A 2G3NA 4Z1AA 1CWYA 3A22A 2WK2A 4CLMA 2QAFA 5FAGA 1EIBA 3N19B 3SAZA 3GH4A 1TR9A 4RZ4A 4R9OA 3TIMA 2VOMA 3S1XA 3HOJA 5GJNA 1TWSA 4LUJA 1SO4A 1MDLA 4R9XA 3PG8A 1T41A 3MM5B 3LZ3A 4EPEC 3VD3A 5AHEA 3MM9B 3A5VA 2WPGA 4XG1A 1JUKA 7REQB 1PAMA 1R3YA 2VEIA 3NO3A 4RZBA 5A8QA 4GUJA 3FJLA 2VX6A 3RU8X 3FCPA 1EP2A 3DFTA 3WQ8A 3UCQA 3LMZA 2F2HA 2DUAA 1H1YA 4AZCB 1C8VA 1XYLA 2BZNA 5L9FA 5FJPA 2HJPA 6GEPA 4C90A 3GW3A 2WNQA 3WO8A 4Q4OA 3CUFA 3UPMA 1CBGA 1TQJA 2XIIA 4PTDA 3AMLA 4K68A 1SU5A 3WDIA 4W5ZA 3PUGA 5LNRA 3ZR5A 3LZ5A 3OBAA 3GNXA 1SR9A 1W1YA 3MMDA 4ICMA 1UJQA 3T8QA 3WLMA 1WXZA 1FBAA 4QSHA 2JK2A 3ABSA 3NCOA 4LQ1A 1AH0A 3AIUA 2CXGA 5FF2A 1XKJA 1DJNA 5A6JA 1H60A 3DFSA 4V15A 4NVTA 5A6TC 1WV2A 4MLRA 1R87A 4O0ZA 1AVAA 1PE1A 1PX8A 1P43A 2VVNA 2ZZ4A 1YKWA 5A6MA 2ZRUA 3VNMA 4J2MA 3GYEA 4HB7A 2CLEA 4EE9A 2DZAA 2VQUA 1SZEA 1ZBWA 1GPFA 4QJ4B 3AJXA 3N2BA 4N9DA 2XGBA 1TV8A 1V3LA 4LYKA 1DVJA 1CT5A 1K8YA 3N25A 3QYQA 2YCLB 3CZLA 4W87A 2J9XA 7GEPA 3WLLA 1TV3A 3SUWA 2VC9A 1P7TB 2O9PA 1ZCCA 2WSYA 2PDHA 3KS5A 1FHUA 4NHVA 5HMFA 1A5SA 3LI1A 2CNCA 3TP4A 2YR1A 2ZA2A 4RNFA 5AC4A 3S5ZA 5FIPA 4CNOA 1JD9A 4B4HA 1IT8A 1KQYA 2ZOXA 2Z0IA 3DDMA 1B3XA 2ZUNA 3THCA 3AUJA 2E6AA 3BJSA 3NOEA 2YGYA 3MSGA 4XKMA 3A21A 1XIHA 3F1QA 2H6RA 3CZKA 5LA2A 3K4WA 4GJIA 1SM9A 3B40A 1D7FA 2VZSA 1HJSA 3QXBA 4AY7A 4AZIA 2NQ5A 4JIPA 3PPGA 2CPUA 1JZ4A 3ANVA 4BQ5A 3R13A 3QLDA 1OX5A 2EHHA 4NP7A 3GFZA 3T2OA 3W75A 3LBCA 4WUIA 1UG6A 3G2GA 1LZOA 2IKGA 3SQMA 2B7QA 3GXDA 1THFD 1QBAA 4YJ5A 4J35A 1E6RA 1VBGA 1Z89A 2W3ZA 1JDAA 2J6XA 3AJ7A 1XLJA 4AC1X 4ZQNA 1GOKA 3NAVA 3VINA 1OB0A 3B9EA 2Q02A 2GZXA 3HPFA 4Y7EA 4N6FA 2VR4A 1AQMA 3POHA 3HQ1A 5DANA 4MKSA 3SCPA 4AYGA 1EZWA 4GC4A 2NX1A 4NF7A 2ZZ1A 2WSKA 1Z32X 4FF5A 3S2MA 2ZA3A 1W9BM 2DSZA 3KVLA 4BI7A 3PZQA 2J27A 1FP8A 2GUBA 5BOEA 3AC0A 1JEZA 3M0LA 3S5YA 4A8LA 4GGBA 2PWFA 3BLOA 4UQAA 2OVLA 5CC5A 4ROQA 4B2DA 3NQFA 2O9OA 1Q2RA 3MP5A 3B8WA 3F7JA 2W61A 2VNCA 1NJJA 4A22A 5E0FA 4MNJA 4X0NA 5I00A 1IEQA 3NYZA 1VLIA 3GVGA 3MUZ1 3UXAA 4DXKA 2P10A 3UT0A 3N18A 2ZXQA 1LTDA 3N2MA 3AHVA 4YPJA 1W1IE 3L4UA 3EEGA 3VGGA 1K9EA 3B05A 4XD6A 4ROPA 2Q8LA 5FF0A 3TKFA 4LCSA 3O07A 3F2DA 1IWBA 4LPCA 1UIPA 3H70A 3LLDA 2WHKA 3SCTA 1UKQA 3MYPA 3M0HA 4QJ5B 1Q5MA 4KWOA 1Q7ZA 3OJGA 4PGLA 1FWHC 4XBJA 4Z2IA 5DCDA 1OYBA 4DRSA 3DG7A 2XVKA 2Y1HA 1EP3A 4L4LA 3VC5A 2J7HA 3SR7A 3KE0A 2E28A 3O6DA 1VCFA 4MHBA 1HKJA 3O6AA 3LPOA 4ML9A 1CCWB 4K2SA 1XLKA 1W5PA 3VGBA 3PUEA 1AH3A 4GBUA 2XIBA 1NWTA 1O1HA 1OIMA 4EXAA 1RBLA 3AU2A 1KTCA 1A3XA 3HFYA 1XYFA 2QEZA 4K7VA 1QPRA 4TR9A 1M3UA 4HOXA 1TJ1A 4UTFA 4J3TA 4HP5A 3F4NA 5C54A 2GK1A 4U4MA 1QJWA 2FZBA 3WF3A 1NH6A 3N6HA 1EXBA 3ITXA 3IAQA 2ACQA 2Y8KA 4JL2A 5HMSA 3EKZA 4XKYA 3JW7A 1GQJA 3IIPA 4A3QA 1NOFA 2TODA 5BZAA 3UR5A 2ZYFA 1F61A 5HA7A 6A3HA 3WLTA 3T08A 3M41A 3H4GA 3VIHA 1GQNA 4LEQA 3OTRA 1O95A 4FLOA 1XH1A 3K4AA 5CPMA 3GC4A 3ARQA 3BAIA 4PCSA 1SSDA 3O3RA 3LK6A 2X0SA 4G7EA 3PAOA 3WQDA 4L1WA 1HKWA 3VD5A 5HMDA 1SFJA 4B15A 5J5DA 3TAOA 4RPPA 4UFHA 4O1DA 4GOAA 5CSYA 2EG8A 2WSRA 5BU6A 3G1FA 3USZA 2HE5A 5A95A 4AHPA 5GQBA 4MKVA 5ABHA 2JFEX 2YDSA 3AO0A 3D6NA 1ESWA 3LXAA 3Q4DA 3MZ2A 3GG1A 2WC3A 4LVFA 3T8LA 3QGKC 3S2CA 3DG3A 3C2VA 3H2CA 3M7SA 1S3HA 1R47A 1UKPA 4LBSA 4E2DA 2XYLA 3VDHA 3PP7A 4HJWA 2BGQA 5ECUA 4MDPA 3RPMA 3R58A 3WDRA 3E38A 1A0DA 1UWUA 2TRSA 1PXGA 3APYA 3WLJA 3FGCA 1PEZA 1LF1A 4PMQA 3KVKA 2R94A 1PX4A 4PL1A 3PULA 3TSDA 1SFLA 1RJQA 1PKMA 1CB2A 1OCQA 3SCWA 2Y7EA 3MQTA 4L7ZA 3NQ8A 4F40A 5T91A 3FKRA 1AJ0A 1V02E 1CB7B 2DSKA 4JTUA 1OT1A 2GSJA 3CQIA 3QPEA 2VDGA 1YXDA 2GK1B 1FWEC 1K77A 4XZIA 4DX3A 1LLZA 1XYAA 1XLIA 4H04A 4I7UA 2PLJA 2ONEA 3AAMA 1LYXA 2HS6A 3QHOA 2JKPA 4B9ZA 1IQ8A 4DXXA 3B0HA 3TJXA 4DUWA 1ZBVA 1L2UA 4ZSUA 4JQ2A 1K4HA 2OWWA 2ICSA 4DYKA 1U1HA 2OELA 1VH7A 2C0AA 3TMQA 4HK5A 2DU2A 2R91A 4L61A 1SZFA 4HCHA 4LAKA 4CUCA 2Z1XA 5LHFA 2FGBA 1TX2A 5AVNA 5A8MA 3TTEA 4TO8A 5DELA 4ZB0A 1GVQA 1UUMA 2XDFA 1H7RA 3UERA 1TIWA 2HVMA 2TPSA 1KTBA 1BKHA 1TSIA 2X2GA 1Z42A 4UTHA 3USBA 4HHMA 5HJYA 4NU7A 3W70A 3BARA 2ZC1A 1HO4A 1JUBA 2GVYA 3QZAA 4KMQA 2XUCA 1I75A 3AS0A 4UC5A 3K1DA 3PFMA 1WBJA 2XIJA 3E02A 1L6YA 5KTLA 3NQAA 2E3ZA 3VZXA 4DO6A 7ODCA 2QPXA 5JQ9A 4WHBA 3HGSA 1XR2A 3H7VA 5KETA 4DVOA 1OFBA 3SURA 4JCMA 4A4AA 1RCQA 3CV1A 1GOWA 4PN2A 2V3GA 4HPJA 1XGZA 1YADA 4OHQA 4OGZA 2NXIA 3N13A 1PHQA 2B81A 5T26A 3BCJA 4UMBA 1EPXA 2O55A 3TA6A 4LBRA 2PFHA 1Z9AA 1ZALA 3PBGA 2OYKA 5DMYA 4PCNA 4E0CA 4O52A 2VZVA 2FKPA 4IFOA 3MUY1 4S23A 2ZXAA 3OQEA 1T7LA 3ARTA 2Y7GA 3U48A 3N9KA 3LLFA 3ANYA 1UR8A 3TA9A 3QRHA 3ARRA 3ZVHB 1MNSA 4ADSA 3RHGA 1X1ZA 3NYDA 5DO8A 3N4FA 2YL8A 3IV3A 1XYBA 1T96A 5DN1A 1LRTA 2JF6A 1H1NA 2CBJA 3OPSA 3I6EA 1KXVA 3EB3A 3C8NA 3EOEA 4LY8A 4IPIA 4HA4A 1JXKA 3AHXA 1J0KA 4QITA 2CIPA 1UKOA 3A13A 4YWIA 5HULA 2ZRYA 2OLAA 4FXRA 4O1CA 4JIHA 3GDMA 4PTWA 3ZT7A 3TEVA 1KFKA 3WQFA 4ASTA 1CLKA 3VKKA 1TTJA 3U4FA 3E2QA 4UCFA 1XGEA 1TVPA 1KW1A 3KL3A 5F2IA 2BVTA 3OODA 3CUZA 1ITQA 3GSMA 2ISSA 3LQLA 2PDJA 2DQWA 3C0LA 4DJFD 5JVLA 5DQPA 2WVVA 4NZ5A 1ECQA 1GVOA 1POJA 3MHFA 3W9ZA 4IMGA 4JTQA 4PBFA 2HDJA 4ORMA 5A1AA 4M7SA 3WFLA 3IUDA 2NT0A 1TA3A 1RK6A 1KFWA 3PFRA 4XWUA 1XH2A 1R9XA 3PAJA 3V5OA 3LM3A 3S83A 4AZHA 4YTRA 4YVPA 3AHTA 2BOEX 2XSBA 1EEXA 1MSSA 4YCOA 3MDUA 2AAMA 2CBUA 2Y5JA 4UZUA 3UF9A 4XIMA 4XD5A 1WKFA 1MFVA 3UFYA 1LM1A 4JTRA 4NNAA 3VKPA 3BG9A 3VGFA 4BS0A 3LU2A 3QF0A 5K4ZA 3EAUA 3GHRA 1IV8A 1W3LA 1Q4WA 1Q6LA 3GVWA 3HBLA 5K9CA 5G4HC 3Q65A 3THAA 4V2XA 1FWDC 4YWSA 1GJPA 1XXXA 3H2AA 3TR2A 3LXBA 2YZ5A 5A6AA 1S3TC 3OR2B 3ZLHA 3EMCA 1QR7A 4IQEA 3GKFA 4B90A 3UZWA 3NEVA 4ZZ9A 1ZTVA 3EX3A 5AC8A 1EWDA 3P0WA 1D2KA 3WUEA 2RGLA 1JPMA 1VPQA 2PGFA 4RE0A 4A29A 4FX6M 1RD5A 1IR2A 4B2DD 4JFUA 1P0KA 3W6MA 3CIVA 3S2JA 1TYGA 1UWQA 2V4JB 4PRTA 1XINA 3RRXA 1I0BA 5ABGA 3QBUA 3GBEA 3U3HA 5LIKX 1SPQA 2Y2WA 3AMKA 4M51A 4A3HA 2P3EA 1KNWA 3AIWA 2XVLA 3UXKA 3R94A 3KWSA 2W66A 2I5GA 3T4WA 4N9CA 5CPNA 1NU5A 1QMLA 3ITGA 3CU2A 3NQ6A 2POTA 1FCVA 2F9RA 1Q6CA 4KEVA 3LENA 3VKSA 1F8IA 1TRIA 3KTSA 3VM1A 4R88A 1H2JA 1JDEA 4DBEA 3LB0A 4R34A 3R6IA 4GFSA 2KX9A 5CEWA 3IUHA 4UR7A 1TG7A 1VIWA 2YZRA 3EMZA 3LOTA 5FJOA 1ONEA 3CXOA 2QCMA 3NXLA 5FCZA 1OG0A 4FNQA 3BV4A 4XZLX 1X97A 2ZA1A 3ZYZA 4NZ4A 3HU7A 4DBUA 1NF0A 2BY2A 3M6YA 1WX0A 1JZ2A 1L6WA 1GKPA 2J88A 4AZ6A 4IF2A 2JKAA 2QGHA 2GSHA 3N12A 1PKLA 2VM8A 3A24A 3FK4A 3IS4A 1I8JA 1DL3A 2YB4A 4HBKA 4JS3A 4B5XA 2E9BA 1R3TA 5IFPA 2ZWYA 4BQ3A 2O56A 1V6XA 2AOSA 2BVYA 2V30A 3ZSTA 1A0EA 1KGUA 3M07A 3QPZA 1F05A 4MOZA 1DJIA 3N9SA 1PBGA 3GR7A 2HBVA 3GTXA 5BW6A 1VRXA 3WH8A 3LTYA 2WBGA 3MA8A 4Q6JA 3NVDA 4LUSA 4WY0B 5IXEA 3DENA 3TTQA 3DAQA 2YXGA 5K3VA 3IJ7A 3L2MA 2C79A 9XIAA 1P1XA 3VABA 3W7JA 5F2LA 3TYUA 4US5D 2E6FA 2Q09A 5DX7A 4H2CA 4C6IA 4PCFA 2AGKA 1NARA 4CQ9A 3OG2A 2DSVA 4J1OA 3ES8A 3N6QA 3CT2A 2BDQA 4F0SA 5LA0A 4Q3MA 5HJLA 4MM1A 2VCCA 3KLLA 4NJJA 3KWXA 1T5AA 1PTDA 5FSEC 1UYQA 3TH6A 4WKFA 1CXHA 2J13A 4L6OA 3O2LA 4RXFA 1W17A 2HV5A 3FXGA 3VIMA 7A3HA 3ITLA 4G9PA 3U8GA 2V2DA 1K7XA 1QI2A 4BQ4A 1WDPA 5M5DA 3WLIA 3H22A 3G8RA 3CH0A 2ZZ3A 3TQ0A 4EK7A 3FOKA 1W5MA 3MDWA 3T0TA 1GOQA 3C4UA 4H41A 4R27A 4F2TA 3LCGA 3N2XA 2C13A 1XDJA 3K46A 1X96A 3NSXA 3I3EA 1R0MA 1JVNA 3DFPA 5DLCA 4ICCX 4GQBA 1ZAJA 1I2QA 1UCWA 5LGXA 3W7IA 3RR1A 3W6YA 4C6OA 3I6TA 3NFUA 2HISA 2J7CA 2JF7A 1YRRA 3QTGA 2ZBTA 2HVNA 1E9LA 1MVYA 2PWDA 2J66A 1EJSC 1SW3A 4WSHA 2IKJA 3FV9A 4MGGA 1IIGA 1OY0A 2TAAA 3KBNA 4WSJA 3SUSA 2A0NA 3L67A 3LRMA