4S3FA

Ispg in complex with inhibitor 8 (compound 1077)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 136
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3fA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3fA02
1Q7ZA 3TYZA 2YCLA 2V4JA 4DJEC 1ZJ9A 4AOPA 3MMCA 5JQ9A 4NILA 4HTRA 1TWWA 4NIRA 1EYEA 3B0GA 3MM8A 1AJ0A 1Q8JA 3MMBB 3TYUA 2DZBA 1AD4A 4DAIA 1TX2A 3VKPA 4G38A 4O0QA 3NOYA 4PZVA 1TX0A 2VEGA 8GEPA 4DB7A 4S3AA 4NHVA 4S3BA 4D8ZA 3H2AA 3H23A 3K13A 1Q85A 3TYAA 3H24A 4S39A 3MMBA 3OR1B 3H21A 3MM6A 2OGYA 1Q7MA 3H26A 3VKSA 4O1EA 3MCNA 2DQWA 4DJED 3TYBA 2H9AB 3MM7B 3TR9A 4MWAC 4DAFA 2XSJB 4HB7A 1TWSA 1ZJ8A 3BOFA 4DJDC 4S3EA 3B0HA 2DZAA 3MMAB 2E7FA 1AD1A 4MWAD 3OR1A 4MWAB 1F6YA 3MM9B 4DJDD 3H2MA 4DJFC 4GEPA 2AOPA 4S3CA 2YCKX 3TYEA 2H9AA 4DJEA 2BMBA 2AKJA 2VEFA 3OR2B 5GEPA 4DJFD 1Q8AA 2Y5JA 3MM5B 4G9PA 1AJZA 3H22A 3TYDA 2YCJA 3B0LA 3TZFA 3VM0A 2VP8A 4S3FA 4S38A 4MWAA 3B0JA 3B0MA 2Y0FA 3H2OA 1TWZA 4DJDA 2YCIX 4C1NB 3VLXA 3TYCA 4CCZA 4S3DA 3H2NA 3OR2A 2Y5SA 3MM5A 4O1FA 4D8AA 4MWAE 4DJFA 1Q7QA 3V5OA 2YCLB 5AOPA 3VLYA 2V4JB 3H2EA 3MM7A 2XSJA 3MCOA 3MM6B 3VKQA 4D9PA 3BOLA 3GEOA 3B0NA 3MMCB 7GEPA 3VM1A 3VKTA 3VKRA 3MCMA 3MM8B 3AOPA 2GEPA 3H2FA 3MMAA 3TZNA 4C1NA 4G39A 3VLZA 3MM9A 1AOPA 1AJ2A 3H2CA 4S23A 4NL1A 6GEPA
chains in the Genus database with same CATH superfamily
4AEFA 3TJXA 2OWCA 4H1ZA 1Q6LA 3NPWA 3UG5A 3E0FA 3AALA 1EJTC 3SW6A 4D71A 1FWAC 1AD4A 5K7JA 3UG3A 3M5ZA 2INFA 4PMQA 3L0KA 5D03A 4QJ4B 1CGVA 3RM8A 1EO7A 4OHQA 2J27A 4IQJA 3A5VA 3NQDA 1G4PA 3PK7A 3GTXA 1XF0A 4B5XA 4NAFA 4CD8A 1ZP4A 4RV3A 3WH6A 5BRBA 1NOFA 3BWWA 5GNYA 2QIIA 3RRAA 2P50A 1QT1A 1QWGA 3G22A 3Q37A 1O5KA 5SWUA 2IPFA 4XZMX 3WYZA 3TOYA 3M0MA 4OUIA 3GNRA 3VIJA 1EP2A 6REQA 8A3HA 1IQ8A 4E8DA 3F4WA 2ZTKA 1UBSA 5AC4A 4I7WA 3AS0A 1FWJC 2QIWA 4G8TA 2E68A 3VM0A 4GKTA 3SADA 1GQLA 2ZRVA 3LCGA 4MNLA 1W9XA 4NXSA 4JKMA 2FDSA 5A8NA 4GQBA 1GW9A 3RG6A 4BF9A 3PSVA 4LW7A 1IEWA 2ZX9A 3WK0A 2W63A 1ZAJA 2J47A 5BMXA 3MMCB 1GVOA 4HA1A 3NPUA 1PHWA 1ISYA 1X1ZA 4FXJA 1JYVA 4FF5A 1MYRA 3GDBA 2ZA1A 2VD8A 5E93A 2VL4A 3VM5A 4FXSA 5HINA 5AC5A 2PTYA 3MHFA 1X1OA 4YYCA 1XDJA 1S2CA 4QLKA 3M43A 1QW8A 4ONVA 3TH6A 2WJZA 4JTSA 2O9TA 1EQCA 3N9SA 3HN3A 1QMLA 4O0QA 4WDUA 3QZEA 1V6WA 2R8WA 2XH7A 1E0WA 4ADTA 3RO6A 3CWHA 3KP0A 4AFYA 3WKZA 3WQ5A 1EEPA 2HS6A 3M7SA 4Q4MA 1V0MA 3NQAA 2BXVA 4MJ2A 1Q7MA 1KNWA 1TMHA 1WYIA 4Z08A 1DXFA 3LXCA 3AS1A 3DENA 4P7RA 3GO2A 4DXKA 1D9EA 3AMGA 1J0HA 3UYCA 1XICA 4MWAB 4J4KA 3FAWA 5LNVA 3CHDA 3NNTA 1AW5A 3UZJA 1FHUA 3MDWA 3OQEA 4N6FA 5EPDA 5CEWA 1KCZA 2WLZA 1NFPA 1SSGA 3VO0A 2C0HA 4J5NA 4RLIA 1TWZA 1XSKA 2WOQA 4C6DA 3CUZA 1P7TA 2G96A 3ABRA 3TC3A 3APGA 3OVGA 2X7VA 3B06A 4IGMA 4IPLA 3H2EA 3MM7A 2XWEA 1FWFC 2VR5A 3DC8A 3N4AA 4XAPA 1QNOA 3HB9A 2NZLA 2CCRA 1R38A 3ZJ7A 4JNZA 4EXAA 5BU6A 3DGBA 4S3JA 2HTMA 4L65A 2OX1A 1TWIA 3AIVA 4YJ5A 3ME3A 3E74A 3R2GA 1LRNA 3ARPA 3GYCA 4XZLX 3HQOA 3VKPA 2GK1B 4FB7A 1UA7A 2IPJA 2VQTA 3R5EA 4QG9A 1HL2A 1Q45A 2Y2WA 4OUEA 1LCOA 1I75A 1H61A 3OG2A 4JIPA 1OT1A 3KCOA 4GIAA 3P0WA 1OVDA 5DT7A 4QQ3A 3PFRA 1P6WA 1ADOA 3XINA 1L2QA 3N12A 2ZYFA 1LM1A 2UY4A 3AHZA 1JI1A 1KGUA 1QO2A 2HBXA 5FJPA 1DWJM 3NYDA 3PBUA 1XLAA 3I68A 2IXUA 3TJ4A 2P5NA 3EGJA 5AYIA 2RDXA 4IXHA 1ESWA 1XCWA 4HNCA 1FWWA 1G9HA 1OF8A 2QLYA 3PUOA 3W25A 3GLCA 3OHMB 2QDEA 3EX2A 2VX4A 3OLDA 1DWFM 4ML4A 3VGGA 3B0MA 1E40A 3M6YA 2OB3A 3SUSA 4PBEA 3H2NA 3HPFA 4GC4A 5D09A 3LHVA 1NP0A 5CJNA 2WVTA 3OGRA 1V3HA 1C8YA 3TU9A 2NQLA 4NNBA 3I7QA 4GACA 4RDVA 1IT7A 3GBDA 3T81A 4G39A 1PX8A 4K8HA 3T4CA 4XIMA 2E5BA 4GNJA 4DO5A 3TA9A 2ZRWA 2XZ7A 1QATA 5FSEC 4E4FA 2F7FA 1E3XA 4KFOA 3E2RA 1H7RA 2X7WA 5CPLA 4NNAA 5CZSA 3S2JA 3VKAA 3H2AA 3LY0A 7ENLA 1V6TA 3H24A 4KWUA 4S39A 3ZVIA 2WKJA 3V18A 2Z1KA 1KXQA 1NY1A 4FX8A 1P0BA 3WCZA 1EUNA 2XVGA 1TPEA 3ZJ6A 2VI0A 3WBAA 1HO4A 1VPYA 3ZT7A 1UWRA 2W9MA 4DJFC 1JXKA 2DSUA 4OBRA 3MHGA 4TVCA 3UVAA 4GFSA 3ANVA 4N9CA 3FJNA 2OKTA 1J96A 5DEZA 3SGZA 1DQXA 3QW4B 4HU3A 2EPNA 1W6TA 4MG4A 3N6HA 3VDGA 5CBJA 2QQ6A 3MUIA 3FEMA 2XGZA 3H6OA 3GTNA 5FA5A 1TWDA 1Q6RA 4TIMA 5BOOA 5DRIA 1Z6KA 4IX0A 2GDUA 5D2WA 1PJ9A 1J12A 1SFSA 4S23A 3D3AA 3BAYA 5I02A 4J3TA 3W26A 4L4PA 1UC5A 4AEEA 4XVDA 2XFRA 4GO8A 2C1IA 4H7CA 2CKSA 1E51A 3CASA 4GYJA 2RGLA 2WVVB 2ZA3A 2ZXBA 3A3WA 2DSWA 2QCEA 4UMCA 1F61A 4RX0A 4NVTA 3ARUA 2Y7FA 2D0GA 4LH8A 3WLMA 1SFTA 2ZADA 1V3IA 7CGTA 4N9BA 5E6YA 5HJLA 3F4CA 3ITYA 1RP8A 1V79A 1G5AA 1TRIA 3ITLA 1TVLA 1QI3A 3UY8A 1EP3A 1GUVA 3MM9B 3FDGA 2O92A 2WW5A 3S6OA 3LCIA 2IQTA 3WMLA 4DM2A 1E72M 3B8TA 1OCQA 1MUMA 2VO5A 4PCFA 3UPMA 1ZJHA 1W1VA 2P10A 1ADDA 1PZ0A 2YCJA 4M0XA 3RF9A 3ZSTA 3VZYA 5I00A 3DEQA 1JAEA 3HV9A 4E3VA 3DCPA 1JGIA 3M0KA 1FBAA 4ZQPA 4RZ6A 5MKGB 1KFKA 1M1BA 3I7SA 4IL0A 1WUEA 1BWLA 1PUDA 2E8ZA 3S4TA 2ZXQA 1UJQA 1W2VA 2W92A 1Q4WA 2V6AA 4RUBA 3GX9A 3MMAA 4MKSA 3W23A 2VFFA 3SRFA 3RX4A 4UQ9A 3CV2A 1QI4A 2PDNA 3TONA 3M5YA 7ODCA 4QGCA 1FX6A 3P8IA 3L2LA 5MF5A 3APYA 2CLHA 4HN8A 2BVWA 3EWZA 4Y96A 2PP1A 3RJYA 2AL2A 3VKBA 4IMCA 2V5LA 3LSCA 3UWQA 3LV5A 4I5UA 3QTGA 3W00A 2CLLA 3RFAA 2VC5A 2OELA 3HU7A 1GVIA 1EL3A 1BHGA 4PB4A 4JFWA 1DV7A 1BQGA 4X9SA 1Q66A 4HJFA 3GM8A 3BOFA 3W2UA 1I1XA 1R46A 4EXBA 3GG8A 5HATA 4ZQCA 1IWAA 5KMYA 5I23A 3KZSA 3C6CA 1K8XA 3A13A 3SGUA 4WHBA 1FWSA 4WOQA 2GVJA 3IGSA 3WK3A 4PCTA 3ARYA 1CDGA 1BKSA 2BFGA 1SO6A 3N17A 1NDWA 4L61A 3VKTA 2I5QA 1TUFA 2E77A 1Y5XA 4IM4A 4MY1A 4GY7A 4L6HA 1ME7A 3LNPA 2A2IA 1QK2A 4O8RA 1SJBA 4DI9A 3WNOA 4MM1A 3LGEA 1MRAA 1PTGA 5BRQA 3P6LA 5G4EA 1QCWA 4PTDA 1BD0A 3CEUA 6TIMA 3GNOA 1PE1A 4ORMA 5EL1A 1K9FA 1J0ZA 1DJYA 5BWFA 5HQMA 3MO4A 5C54A 3VINA 4ZMGA 1VHCA 3WLTA 3CH9A 4JNMA 3GB6A 3QKZA 2QZRA 4J3VA 3NUKA 2WNZA 4HHHA 3EOOA 1XCFA 2QYGA 1N7KA 2DZPA 4PTXA 4MADA 2POZA 4EAMA 5REQB 4L1XA 4GH3A 1BGGA 3NM3A 3LI1A 4WK9A 2X2GA 4JXCA 4XUGA 1B57A 1XUZA 2VELA 3L0GA 3KBSA 2YA0A 1U1JA 1BWKA 5C8BB 2AAMA 4JTTA 3CM4A 1UH2A 3NZ1A 2QW5A 3P62A 1LBFA 4LYKA 3QOKA 2TODA 3PZUA 1SJAA 3CQ0A 3PN8A 2Z1VA 5AY7A 2E4TA 1R2RA 1GG1A 2A7RA 4X60A 3WUBA 4Q8QA 1KCXA 4HNUA 1IR1A 4BHYA 1JF5A 1HL8A 3N14A 1GPFA 4XX6A 2J25A 3I3EA 2R6OA 4HZMA 3WLPA 1KA9F 3WD1A 3UR5A 5EU9A 4QXIA 3GDTA 3MSRA 4FLOA 5TBOA 1H63A 1I0BA 5CCZA 3C2FA 3FVDA 1ZBVA 4WGHA 5D4YA 5BYWA 2HNEA 1XDLA 2WMIA 3QPEA 1KTCA 2C18A 1QNPA 1XPGA 2FQIA 4AZ5A 2Y6ZA 4LPCA 1W9DM 3W75A 2J8TA 3PZTA 5TNVA 3W1QA 2CHOA 2FIQA 2H8ZA 1RVKA 3L0NA 4O11A 5T8GA 4R34A 1OD0A 3O6YX 2Z1SA 2ZZ1A 5HNTA 1EJ7L 4WCJA 1RVGA 3BLOA 2TSYA 2Q71A 4IFRA 4UFHA 3H12A 4E8CA 3VGHA 3LTSA 4KT2A 2IPGA 1PKLA 3EX1A 1XR2A 4GYKA 1OSEA 4LCQA 2QGYA 3WELA 4KWVA 3W73A 4NG3A 2VRQA 4DHGA 1GZGA 2ZWYA 3ZMRA 2Y63A 5E1QA 3FLUA 3SBFA 4H9XA 1JCXA 1OGGA 2XZ9A 4FLSA 2PDBA 4LTSA 4X63A 1JZ3A 3W1LA 4AZHA 4H2HA 1IEVA 3U5YA 1EX1A 5FSDC 3BLFA 4IJCA 2HJPA 5D05A 3TLQA 2ONEA 1EBHA 3OVRA 5HA7A 3S1UA 3FSTA 4CNNA 2XN0A 1OEPA 2UZ9A 4UR9A 7TAAA 4LJ3A 1D3HA 3SDOA 5CC6A 2VGBA 1C92A 1CIUA 5CSYA 1PKMA 4IPPA 1J0YA 1QO5A 2HEJA 2V5BA 4AG0A 1XLLA 2YL9A 3GK0A 2WJEA 3GUWA 3FGCB 2WNNA 4R33A 2PZ0A 4TV5A 1WAWA 1EFZA 3CL8A 4JDYA 1TO3A 1UR4A 5CG7A 5T91A 2XIOA 4OU1A 1EJVC 5BMWA 3GVQA 4DWSA 1TJ2A 4UTFA 4LBSA 5C9ZA 3VXGA 4ZB2A 1VFLA 4FNPA 4GBDA 5BXTA 3KBWA 3OYZA 4BJHA 5JIPA 1PX4A 3QM3A 3Q45A 1FXPA 3VLXA 3MUAA 5G2IA 2WKGA 3EDEA 2DY3A 4HMEA 3H4XA 2HVNA 2X1SA 1WP6A 1VBGA 4QNEA 1R87A 2E9LA 1TPWA 2Z26A 4DZAA 4XISA 5F1UA 5EKYA 2IW0A 1GVSA 2PDMA 4PRRA 4Q4SA 3V3WA 3EX6A 4WOZA 4YCOA 1HXJA 2TAAA 1E0VA 3W87A 4ZO9A 3B9EA 2GFTA 3B0YA 3E0IA 1AJ0A 3GZAA 3TR2A 3FHQA 3FSUA 3UCQA 4P7QA 1E0TA 4P8VA 3TIMA 3SY5A 4ALDA 1FWGC 2KX9A 4HNVA 4H01A 4F9DA 1P1XA 1JG9A 3B97A 2PDCA 1OHLA 2VUNA 1JL8A 4ADSA 3EEGA 2C79A 3PAJA 4OZOA 3VD5A 4ZOCA 2JF7A 1K77A 2JEPA 1K6WA 4LGXA 3W02A 3SCSA 2IKJA 4WR3A 3R0KA 2VJXA 4PUWA 1ONRA 1LQ2A 2GWGA 2C6QA 2FVLA 2OT1A 4KIEA 1S5VA 3NQ7A 2NV9A 2PTZA 4LY4A 4JY9A 1NFGA 3OBAA 4JIEA 4D6CA 1CECA 3KOXA 5LKYA 1TRDA 4U31A 4DEFA 5EBUA 3G5EA 1E9ZB 2OFJA 4HYVA 3OW1A 4H9VA 1NDZA 1V6VA 2VFEA 1BG9A 4Q8NA 3W1NA 1EEXA 7PTDA 3KHJA 1XYFA 5D9MA 2V63A 3BURA 1BTCA 1C8QA 3WL0A 4NZCA 3BARA 4HPXA 2DV0A 1E4MM 4RDWA 4IP5A 4JQ4A 3VK5A 4WXZA 1A5MC 2REQB 3B3DA 4DWDA 1S5NA 2C8NA 2D3LA 2YDAA 4JTUA 5D8WA 2B81A 3PWAA 3HG3A 1PYFA 1AFSA 4FMVA 3F2BA 4XVEA 4R27A 5H8UA 4EVZA 4YHEA 1F74A 3M0XA 1VBHA 3VC5A 2RAGA 2DPEA 3G1VA 3PZ9A 1NEYA 1EO5A 4GC3A 3RHGA 3UG8A 3T8QA 3SM0A 3VNLA 2NV2A 1PZ2A 1EA9C 3QTPA 5FAJA 4W86A 2B7OA 1ICQA 4P7LA 3VNMA 1JUEA 3PSWA 4Q4PA 2OGYA 1SZNA 4US5D 2BSLA 3UP8A 4JTFA 2CFFA 3C2EA 4ZZ9A 3MU7A 4I90A 4Q3MA 4KERA 3DG3A 3UNDA 3TQ0A 2RUSA 1UWIA 4D6JA 1MVYA 4PB3A 4NJGA 1LRTA 3FJ4A 1LWHA 4O12A 1VP5A 3WN6A 1QPNA 1V8EA 1K8CA 2NSOA 1A4MA 4LBRA 3NJ3A 3JUGA 3CMGA 2RKXA 2NV1A 1I6NA 3GVWA 3IEBA 1JF6A 3A9IA 3IANA 2XTKA 4X2PA 2VCAA 4LAZA 3MKCA 3MI2A 1JZ2A 4ZENA 5F4XA 3FYOA 3VX1A 3WL1A 2Y85A 3VNKA 3MMDA 1JPHA 2I1OA 2O4MA 3MBDA 2WC7A 1REQB 4IFKA 2EAWA 5A1AA 2G5WA 2YCEA 3V16A 3ENLA 5CPTA 3NO5A 4GNKB 4DYEA 4AY1A 3HJZA 1KC7A 3T42A 2F2KA 4PE8A 4PC8A 3D46A 3R1ZA 2PUZA 3TX9A 1TTPA 1GHSA 3BW3A 3C56A 4HD5A 4JDBA 4ZQOA 1TV8A 4QQUA 2Y61A 3O05A 3SCNA 4AXNA 1J93A 1J8VA 2X41A 3JU2A 1XIIA 4D8LA 2CBJA 1ISZA 3JW7A 5JH1A 5A2BA 2XVKA 5D38A 3GBEA 4HOXA 3MMUA 3PTDA 3VCNA 3S2NA 3R58A 2HPIA 4M80A 3CK5A 4H8NA 1X8FA 3SUVA 1TREA 4QDPA 3U5UA 1F6PA 1XPYA 4XKYA 1U5VA 1ME9A 2MUCA 1OF6A 3CV1A 3LTYA 4QIUA 3SJNA 4PMYA 2Y8UA 2PLCA 3AXXA 4W89A 2UY5A 4MYAA 5BXSA 2BBFA 1M41A 2ZWZA 3XIMA 1CGUA 1OCBA 4A29A 3CQHA 7REQB 1XLIA 2W0UA 3UWZA 1YBQA 4HQVA 5CLTA 3VLZA 2EG6A 1VJSA 3HGSA 2PF8A 4JFVA 1JQVA 2OX4A 2D20A 5EYWA 1GWJA 4JPGA 2VFGA 3POHA 4PMZA 3MY9A 3RR4A 5A8PA 1O5QA 1UIOA 3QGKC 3VABA 2O9OA 1M7PA 2VHLA 5CBBA 4IP7A 2YIHA 4W7UA 5A6JA 3E0VA 2VX7A 1ZHAA 1VPQA 3URAA 1JDFA 4K7VA 2AQVA 3DFOA 4HA0A 2H8XA 1XLBA 4FOKA 1A49A 2PDYA 1HKKA 2GL5A 3WD3A 1E56A 1YNPA 2VEKA 4MB3A 4CD5A 3UW6A 1M7JA 4GVFA 4AMCA 3E5BA 2ISDA 2FGLA 3H2MA 1YE6A 4MNMA 3UA3A 1VKFA 3RCMA 3OJGA 3M64A 3EPNA 1KM0A 2J7EA 4CLMA 5I79A 1U30A 2FPYA 1JFXA 4KBXA 4S3FA 3AIWA 3OZMA 2Y0FA 1GZ1A 3B03A 2NT0A 2DJXA 2R94A 4C1NB 3L12A 4Z0JA 4JX6A 3FK4A 4MKVA 4TR9A 1T96A 2YCLB 2INEA 2DT1A 3B0UX 2XPKA 1EXBA 1LL6A 4ICCX 1QHZA 3ELFA 2PWGA 2ZXAA 4JN6A 1P0EA 3L4WA 1IXQA 3PR2A 3NQFA 2Q01A 3A12A 4X22A 5HDRA 4RK8A 3RM9A 1UH4A 4EWND 1MZHA 4AZCB 1CTNA 4J3SA 1ZENA 1PAMA 1F2JA 3GC4A 4AWTA 5LIWX 4TMBA 4B4FA 5LIXX 4FZIA 4IP4A 3PWGA 4PZVA 2XYLA 3LEPA 3T2OA 3D5HA 3ABXA 4FLRA 1UBPC 2WV8A 3M0IA 2XVNA 3R6IA 2CLMA 4IQEA 3MYPA 5JU6A 3PC0A 4PUNA 5D9PA 2D24A 2QS8A 3EWCA 2YBVA 3EB3A 3EWUA 2P88A 3ZT6A 4HK7A 2FH8A 5I2UA 3U4FA 1RJRA 1H1YA 1IZJA 1J0JA 2V2HA 3W7OA 2RDWA 1P4CA 3AROA 3W37A 3ONBA 2NSXA 1AMKA 1TV7A 1PX3A 4DELA 2P0IA 1VFSA 4G9PA 1AVAA 1Q6OA 4KETA 3WD4A 4IQLA 4Q22A 4ECLA 3NZQA 3KTXA 1FH9A 2R1NA 2PD5A 3THUA 3CBWA 3AZTA 2R9RA 2I9UA 3HA1A 4M56A 2OT0A 3FDKA 3VZXA 3W2JA 2Y24A 2PCEA 3FHAA 1FCQA 4MAVA 3W84A 1Z9AA 3W7HA 1N8WA 1LOQA 3M0HA 1TZ9A 1QNSA 2VVNA 5C0QA 4M6VA 2XN2A 3I7RA 1W1TA 5FACA 3U2CA 3LNMA 4M7TA 1Q5MA 3DHUA 1UJPA 3EDFA 5D2XA 3RU6A 1GJWA 8XIAA 4QJ1A 3AHXA 2YXOA 4OT7A 1DWHM 3WEOA 4NF7A 4IIHA 1ADSA 1O60A 3CV7A 1HKJA 5GQBA 1SO5A 1UD6A 4CQCA 4E6MA 5H91A 4CN4A 2VFIA 3IAQA 1E1CB 4N7QA 4X0NA 4F0RA 4I7UA 2ISVA 3F2CA 1VH7A 2CLKA 3NEVA 2V2CA 1F8IA 4QG6A 1V51A 3ARXA 1E5JA 4OVXA 4E4UA 3MJMA 2NUXA 3KRBA 2Q09A 4WX2A 1H3GA 3DFHA 4YVVA 2E6FA 1KW1A 3OVQA 1WZAA 4YPJA 2O9PA 3W7EA 4IGHA 3CHFA 3N18A 2A3EA 1QHOA 2CERA 4CD4A 4GEPA 5AYXA 2V8ZA 4RV8A 1NTHA 1OX4A 1NQ6A 2PTDA 3U48A 4E38A 1TG7A 3G1YA 1HVXA 2CHNA 4IFOA 3AIUA 3AO0A 4PSRA 4U4MA 1TE6A 4CUCA 3VOJA 1GYLA 1CW2A 1O94A 3K4AA 4U2YA 3LHWA 1A3HA 4HNTA 4MLRA 2PRMA 2XSJA 2IPWA 2DT3A 2TYSA 3PBGA 1ITUA 2WQPA 4RE0A 4W87A 3BLDA 1UG6A 3PZVA 5I3IA 3WK2A 1R30A 1WNOA 4GZJA 3WQFA 2ZUNA 4LS0A 5I03A 1S2VA 3GIQA 3CPUA 5DCBA 4Q8OA 3N13A 5I24A 3P2VA 1TWWA 4UFMA 4D6IA 1A3XA 4H19A 1XCXA 4UWMA 2JE8A 1XXXA 4AF0A 2VR2A 1UMYA 4RE3A 1VCVA 3UZ5A 4Y7EA 1JXJA 3C8NA 4FOJA 4O54A 1QR7A 2UBPC 1ZCOA 3PUGA 3GNXA 3ABOA 4PGLA 3ZT5A 4OQVA 4H9TA 1XINA 3NGJA 4NZ4A 1Q6EA 4PBGA 3GDKA 4C6QA 4HK5A 3SSJA 4GNVA 2CZ5A 2NWSA 2AOPA 4JR5A 3AXMA 2GGJA 2BMBA 2X05A 1QJWA 3NZRA 5D37A 5D9NA 5J5DA 3S83A 2PU0A 3TDFA 1UA3A 1PCKA 3S9ZA 3VOGA 3S2MA 3DBPA 2QXWA 1EB3A 3FA4A 4O1FA 4HK6A 4B2DD 1H09A 3DFNA 1X39A 4KS0A 3VKRA 2G3NA 4UQBA 1V3MA 3WK1A 5KZDA 4R88A 2Y5EA 1DJIA 3LLDA 2PWDA 2PAJA 1YKWA 3U3HA 3EKLA 5HR7A 2Y88A 4N4QA 1A5AA 4TX8A 2Z28A 1MXDA 4LSBA 3CAKA 5HMSA 2J7FA 2DZBA 4OBTA 4HMNA 1NWTA 1E9LA 3KAOA 3P0XA 4IJRA 4UZSA 2VXNA 1KCKA 4GHRA 4XZIA 1TVPA 2FTPA 2JGYA 2QR6A 3V75A 2YZRA 3QMTA 4YMZA 5CZTA 3TC7A 4ICMA 5CZKA 2WMJA 2NQJA 2PURA 2PDLA 3VD4A 1VZWA 1A50A 4UIOA 5E5CA 2WSRA 5KTLA 1GQNA 4XUYA 1X97A 2FZBA 3W53A 2Z0IA 1XI3A 1WKDA 3B40A 4WY0A 3T7VA 1YIXA 4XAFA 1I2NA 3CGTA 4CQ8A 3ZQ9A 2PWEA 6A3HA 1P7TB 5HMEA 4QS5A 1KFWA 5G1YA 1PKNA 3BGAA 4ZCWA 3ZR5A 3K5XA 5AC7A 4LCSA 1XBYA 4JQ3A 3W81A 5K9XA 1K02A 3RCNA 1Q6DA 1UR0A 4S3DA 1DORA 2CBVA 4DO6A 2DT0A 3L4TA 4EXQA 3MM6B 2EPOA 3F1QA 2DSZA 2IKIA 1B30A 1YHTA 4FALA 3TN4A 1W8SA 2QCLA 4JQ1A 3W1TA 3FYYA 7A3HA 4H2CA 2QF7A 2V4JA 2A6NA 1TPH1 4HTRA 1LYXA 3MWCA 4AVOA 1GQKA 2PDGA 4FR6A 1TX2A 4XK2A 2CZFA 4AIUA 3M16A 3PANA 5LNWA 2VEGA 2CWNA 1HUVA 3UXDA 5HBFA 4RE2A 4TX6A 4EAYA 1G01A 4M3PA 3BZJA 5E9AA 4W7VA 2XG9A 9XIMA 1N55A 4LYPA 4TUFA 2E5CA 4MB5A 3APTA 4JICA 3QY7A 4D6FA 3G1DA 1C7SA 3GXFA 3N3TA 2AMXA 3JZEA 1ZJ8A 5CXPA 3NA8A 3WDRA 4B5TA 4MWAD 1ONWA 1WX0A 1LG2A 1E3ZA 1EH9A 1WZLA 2EKGA 3KL5A 3MSYA 1GOQA 1V4YA 1A47A 3W1XA 5AHNA 1JQXA 3UPWA 8TIMA 2EPKX 3MYOA 3S5NA 4N9DA 2VP8A 3L2IA 2QPUA 3W7MA 2YBUA 4CKQA 1W31A 1KRMA 3NWRA 2G41A 3GTFA 1G4EA 3ABZA 3BXWA 4L4MA 1VB9A 1XP3A 3DHFA 2Y5SA 4KEUA 5CJ5A 1E6SM 2J7DA 5BNKA 4AD4A 1V03A 3UBPC 4D6DA 3RJXA 1Z3NA 1RY0A 2FTWA 2D0HA 2YLLA 2CLIA 2DEPA 1MW0A 1R3WA 2WXDM 3CIXA 4UFIA 3WQDA 5CQ1A 3MZ2A 3TEVA 1OC6A 3GKAA 3VKKA 5CSSA 1UW9A 2Y7GA 1JRCA 3WNLA 3DFQA 4GI6A 4MDOA 3B4YA 1EF3A 3HMCA 2GUYA 3OBEA 3FA5A 1OGSA 3QPYA 4JGDA 2WC3A 1W1YA 3CIVA 2X1RA 3QGVA 4H00A 3Q94A 3TMQA 3TUUA 3HMJG 1W5QA 2FVMA 4H4IA 4ACZB 3VYLA 1VF8A 3W1MA 3WLKX 4Z2HA 3QZ6A 3SO7A 2ON3A 3GKFA 4LS2A 3L66A 3FKRA 1XIHA 2FZMA 1RP9A 3FOKA 4L5ZA 3KL3A 1W9BM 4J1OA 3QQ0A 3PG8A 1PL9A 1LLOA 1V0NA 3IVSA 4OTKA 4GYPA 5I3FA 1XH1A 1H11A 1EIXA 4FAMA 1PIFA 3TXZA 4MNKA 1E6ZA 1BXNA 3BSMA 3K30A 4DYKA 1RLCL 1IIHA 1ZBKA 1M7OA 1Y5VA 4M81A 1O66A 3C3NA 1TZZA 5DY2A 1QPOA 1R0MA 4DYJA 4MVAA 3FIGA 5JBEA 4LBUA 1TPVA 1CXIA 1DWGM 3NPVA 4Q8VA 4PCPA 2OLAA 4U3CA 4JFSA 4OE7A 5XIMA 2Y7DA 4GMEA 5HWNA 3W7NA 4MAZA 4YXGA 2ISFA 4RNFA 1W3NA 1FDZA 5A6AA 4PH6A 1Z69A 2YL8A 3MDUA 1J18A 4V1YA 4LB4A 1YTDA 1BSLA 5LNRA 3A24A 5A6BA 2B4GA 2DIKA 4MF4A 3KLLA 4P8XA 3NXLA 2BHZA 3NIYA 3TNOA 4HU8A 4BQ4A 2QMKA 5M3WA 3WLQA 4HU4A 5IDZA 3ITCA 1KM3A 2E28A 3VGBA 2CHRA 3K1DA 2AKJA 2O55A 2RGMA 2VRJA 1SJDA 2C0AA 1DTNA 3NQVA 3RPDA 5CC3A 3VCRA 2FGZA 3LS9A 2JQXA 3TE9A 5D2YA 3T0DA 1GONA 4O50A 4A3YA 5HNUA 4R7OA 3HGJA 2PWVA 4DF0A 5AC6A 1BRLA 3KRSA 1J6PA 3DHPA 2E1WA 3L9CA 4US6A 1MQRA 1SO4A 2PDUA 1UD3A 2VDIA 1H7NA 4RDZA 4LRTA 3WQWA 5XIAA 4PMDA 3B9DA 4Y8FA 4LFYA 2J66A 3DN5A 2A21A 4G5DA 4QLLA 3O0FA 4ZXLA 4AU0A 4W8AA 2GJXB 3KXQA 2J75A 3BCFA 4QJ3B 2E6DA 3DUGA 1XHGA 1B5TA 1XYBA 1F4AA 2E9MA 1Q6FA 4A4AA 1NWSA 3S1VA 4HPNA 2EG7A 1WPCA 1VRDA 7TIMA 3FYPA 3IJ6A 4RW5A 5I06A 3O8AA 3U57A 2WHJA 2YDRA 3ICJA 3L4UA 1X7IA 3WMCA 1W56A 2A79A 3BCJA 3ARZA 3LPOA 1JI2A 3PZIA 5F4SA 1HO1A 1K8YA 3AYRA 3VIIA 1HKWA 1Z48A 2A85A 3DYOA 1HIZA 1DJNA 1LTDA 2Z1WA 1H7XA 4F0MA 1XKJA 4GA8A 5D9OA 3SRHA 3DI0A 2W61A 1L2UA 4ZXOA 3W71A 3BGJA 4X2RA 4Q8WA 3L4ZA 3GWQA 3MSGA 3BAJA 1HW6A 3G1AA 3EEZA 1VCFA 1TIWA 4D8AA 2R1MA 1VBJA 5CG0A 4R5EA 3G8EA 3BTNA 3BOLA 3GEOA 1VFOA 5D04C 1GOOA 2E3ZA 5M17A 1JRBA 3PJXA 2FGBA 1ZU8A 2OU4A 3TN3A 3KVKA 3UVIA 3LGGA 5IHSA 3OA5A 5TF0A 4CEXC 3ORWA 4IG2A 2XFWA 3DOPA 1EGZA 5DT5A 4ZFMA 2Q6ZA 4TTUA 3E2QA 1TCDA 3N2BA 1Q63A 1DQWA 1W3HA 3R25A 2AMGA 1VLIA 3VIOA 1MEWA 1PWMA 3DKJA 9RUBA 3MA8A 2V2DA 4C6OA 3UXAA 2I56A 5CZ0A 3OB8A 4BR1A 3IGXA 3GVRA 5EY5A 1JDAA 2WO5A 3KOWA 1TPUA 4LVDA 5KEZA 4HMCA 3CT2A 1VYPX 2G4JA 4UCGA 1FRBA 3R79A 3PVFA 5A6KA 3ERPA 2QCDA 3S5YA 3R10A 2X0YA 3H4WA 2FLIA 2ZZ7A 3AHVA 3W1RA 1JZ4A 4ERGA 4D6GA 1DE5A 1M6JA 4O4VA 1MQPA 2PI6A 1SSDA 3QV8A 4KF1A 1JYXA 1XC6A 4FA3A 5CBIA 1IXPA 3NQ8A 2IKGA 3QR0A 5DY3A 3THQA 2CWXA 4DI8A 4DPQA 5HPCA 3DYMA 3AU6A 1W1B1 2J24A 1A0DA 3AHTA 3EXSA 1J0KA 4Z2GA 5DFAA 3C0LA 3HM7A 5K3VA 5HMDA 2JK2A 1WZKA 1H7PA 1THFD 2R24A 4D1JA 4LAUA 1E4LA 2DVTA 1F3XA 1SJCA 3ZS4A 1NARA 3S47A 4PN2A 4AMAA 4IMAA 3CUIA 4A3RA 2E09A 1K7EA 3BSGA 3JVAA 5I7GA 3BW2A 4AOPA 2HCVA 1PTDA 4GISA 5EB8A 1C29A 4UR8A 3WF1A 1EC8A 1WUFA 3CQJA 4ZOBA 2PDJA 2FB2A 1G94A 1GNXA 1JPDX 2WMIB 3U0HA 3HGOA 4HNLA 1DE6A 4AYSA 4D2JA 4C6CA 4WF7A 3L23A 1R9ZA 1RV8A 3CZLA 4NI3A 3L2MA 3WH7A 4PUJA 3DFSA 1I0DA 3S6TA 2P76A 1EC9A 1QVBA 1LL7A 3H7VA 2BTMA 4UTMA 4S2BA 4Z1YA 2OEJA 2FYMA 1KRBC 3W7QA 1WKEA 3PTMA 1ZLPA 3Q4DA 2DZSA 3GIPA 3N1AA 4FSAA 5C9UA 2BV9A 1YDNA 1W8GA 4AZIA 4WD0A 4GFIA 3TCSA 1HKIA 3O6CA 2JBMA 3JR2A 4HGXA 4GJ1A 4CCDA 3O7UA 5CPOA 3WEMA 2Z2UA 1JAKA 3GZ3A 3CUGA 1O1ZA 1G69A 1TUXA 4HYWA 3ALFA 2PGEA 3AYSA 3E12A 2ZXDA 4AZGA 3A3XA 5AYYA 3ISIX 1RPKA 1IF2A 3TV8A 4D9PA 1HGWA 4D6EA 2PC4A 3MCMA 3GG0A 2NUYA 3NEHA 1GHRA 3GAKA 1DIKA 1I2OA 3QYSA 3L4VA 4AHPA 4Q7BA 5FJUA 4QR6A 2DT2A 2QUMA 3W28A 4PUDA 4UMAA 1ZBCA 3O1NA 1RXOB 3TTEA 4HJWA 4A05A 2F6KA 3OO2A 3CTLA 3PJWA 2WSPA 4V15A 3IRSA 1XS2A 1Z89A 3QH2A 1WV2A 1RQBA 3S5ZA 4H8UA 3QPZA 2PLJA 3AZSA 1IT0A 4DQWA 2R91A 5BXRA 3S42A 4DWSB 4AW7A 4V27A 4NJIA 1TIMA 4RKAA 1X7FA 1YTKA 1ZJAA 2B0MA 1BXBA 1JDDA 2VM8A 5IHRA 3N3MA 2NXGA 1TV4A 4AISA 1ECEA 5U7SA 3F4VA 2GDQA 4S3CA 1GTHA 4QDWA 4F9JA 5DX7A 3T1GA 2PDHA 2NQZA 2GSEA 5A8OA 3KOYA 2J77A 3QYQA 3QN3A 1F5ZA 2QDDA 4I3GA 1CWYA 1DBTA 3U2ZA 4HSOA 1JDEA 1ZBWA 3IJDA 4KEZA 5AOPA 1AL7A 2NT1A 2V82A 5BROA 5H8MA 4HP5A 5FCZA 1R47A 3KWSA 1AJ2A 2PP0A 2ZZ3A 4L1WA 2YXXA 4FNUA 1OZQA 4AHOA 3F5JA 4OGZA 1JFHA 1ITCA 5CGQA 4DX3A 4RCXA 3B0GA 2E5DA 4Z1AA 3QMSA 1QW7A 1FHVA 5F2IA 3UQNA 2ZRXA 5LZLA 2P3EA 2XVPA 3EMQA 1O12A 3QVQA 3L5AA 1GYNA 4XZWA 1QBBA 2GVLA 4Q32A 2RH9A 1GKQA 3UCCA 2A3LA 2ZZ6A 5H6HA 3AHYA 1XLGA 4Y6GA 1XLKA 4Z1CA 2G37A 4PTMA 2OWXA 3SRDA 4PODA 4QCEA 3GS6A 1R3RA 4UMBA 3VZZA 9CGTA 1YDYA 1ICPA 1OG0A 2HSAA 1PWLA 2Y8KA 4S1FA 4B92A 2ZA2A 1ZAIA 2W91A 4UFLA 3TJIA 3W7RA 5GJMA 4KWSA 3HQNA 1YPFA 3BG9A 1US0A 1S2TA 1W1PA 4Z1DA 4LX4A 5ECUA 1XKYA 1W9PA 3EPMA 4CU7A 1EOMA 2YX0A 3IJ8A 3WDQA 4QP0A 3ZM8A 3VIMA 4DZIA 3CV6A 1LF1A 2VYOA 4JCMA 3DZ1A 2GVYA 2XWDA 4UCFA 4DZ5A 5CPNA 4JNYA 5HPOA 2VDGA 3RU8X 3WQ8A 4XBSA 4XAYA 3W0KA 2HROA 3RLVA 4O28A 4HYRA 2Q8ZA 1OFOA 4ZODA 2D3NA 3SUTA 3RLGA 3ARTA 4AD1A 3AAMA 1OX5A 5BW6A 2PLKA 4F0HA 1I2RA 2GUBA 3O6DA 4ZR8A 4A35A 3LERA 1QAPA 3LDVA 1PPIA 3GHUA 3RYSA 1ME8A 1J2WA 3SY1A 3TW6A 1S46A 3U7BA 3CMJA 1RY8A 4P8UA 2XSXA 3PG9A 1KQYA 1UZDA 1S5TA 3U4AA 3F7JA 3VA8A 2QVHA 1IWBA 3E38A 4REQA 3E0WA 5M5DA 4DJEA 5J8LA 1TE1A 4UTTC 4H6RA 3STCA 4DBUA 3UERA 2QCCA 2HXUA 4HCDA 3AXKA 5G1MA 3BMXA 4GCXA 1E6RA 5AFDA 3RLHA 1PZ1A 2WHLA 2QNEA 4DJFA 3RUBL 2WVUA 4TXEA 4GUJA 4MGGA 2CLPA 2O0TA 3ZWSA 4C6EA 4PTWA 5LSMA 5L9FA 1HFBA 2GGHA 1LOLA 1F05A 2YKKA 1XIDA 3LRMA 3WUFA 2C1HA 4C90A 2XM2A 3MM8A 5HR6A 2A3HA 2VZOA 2I14A 4DBSA 4B5VA 3I6TA 4KRZA 3NOYA 3AWOA 2JFEX 4W93A 3IVUA 3QGAC 2QULA 1VEMA 4F79A 3VE7A 1E6QM 3LM3A 4F4RA 1OK4A 3MSDA 3VM7A 1H5VA 1YNQA 4UOJA 4JN7A 3ES8A 3UJ2A 4MKNA 4LV4A 4GXMA 1E70M 2DH2A 3CYVA 5LA0A 4MY9A 1K6AA 1O95A 4J3UA 3TROA 3TYBA 1VEOA 2WJFA 3OIHA 1XFCA 1E0UA 2OOFA 5FD0A 1ZALA 3C2YA 3QV9A 4IHCA 2QCHA 3P8JA 3EPOA 4P2VA 3VFCA 3CUJA 4C1LA 5IRPA 1XD1A 1GZJA 3SY8A 4LF1A 4FPSA 4NT0A 1XM3A 2WHKA 1YBQB 2WSKA 4XG1A 3IRDA 4R3UA 4QISA 1HJXA 4Y8EA 1TKKA 2WZMA 3AYVA 1UZ1A 2J9XA 1T6MA 4IZGA 3OGVA 3G0UA 2WSYA 2FHCA 4WEVX 3WD0A 1W9VA 1KFEA 3WDJA 4GI8A 5BRPA 1GQJA 3MM9A 4JY8A 1J6OA 4C6BA 3CMFA 3MKVA 4TQTA 2YZ5A 3E0LA 4M19A 2HE8A 1CXHA 1QWKA 1MZRA 2A3BA 1DHKA 3E49A 2BY2A 1KO0A 3PTQA 3WJWA 3LXBA 2OPJA 2RDUA 3D47A 2YJQA 2BVDA 2GQAA 3NGFA 3HPAA 4JHMA 5AHLA 1GTEA 4QROA 3M5VA 3FN9A 1MDRA 3HJEA 2A3CA 4BS0A 2Y70A 3WH9A 4H7VA 4QSFA 4PL1A 5ABTA 2NUWA 1YPXA 1T8QA 1LBMA 5CC5A 1BFNA 4HB7A 4L4LA 3MUXA 5A8MA 3K1GA 3CHCA 3CL7A 4MPQA 3VD3A 4W7WA 1T7LA 1I9CB 4TMCA 1EDGA 3MJYA 3LPPA 1XYLA 2HDJA 3PPCA 1NF7A 4NJJA 4OBSA 1PVNA 2Z7GA 3NQ6A 3VCCA 3H55A 2I16A 4LYQA 3PB0A 2WMKA 3OYXA 3ZZ1A 2BXZA 2FZ9A 5F2MA 3LK6A 1NJJA 4O8AA 3PZGA 3TSDA 3EKGA 4TV6A 1LROA 2YXGA 3MC5A 5HUOA 1HKMA 1BSIA 1W5NA 3THCA 2BVTA 5I07A 5EMMA 3B0NA 1J9YA 3CQIA 1W3KA 4XD4A 3TKFA 3FJ6A 5DO8A 2OJPA 1YXYA 3H2CA 1FXQA 4FO4A 1NP2A 1PTAA 1YNYA 2GGIA 2BASA 3WJZA 1QW9A 2EO7A 1Q6QA 5A8GA 3ZSSA 1OCNA 3O0KA 3MUCA 2W67A 3M1ZA 4O17A 1VS1A 3BAWA 3W22A 5CC7A 1D7KA 1MMFA 4KW2A 3GXNA 4H41A 2SFPA 3GR8A 1SUXA 1BTMA 1WDPA 2C19A 2QMJA 3GC2A 1DPMA 3IIZA 3K4WA 3UWUA 2ZC1A 3H8AA 4FF7A 3R11A 4BI5A 4JN8A 2DZVA 3VKJA 1AUSL 3C8FA 1UASA 2F84A 2W3ZA 3K8KA 3UWWA 4MWAC 3N25A 4UTIA 2WZEA 3MBFA 3RITA 1E9YB 1EQPA 3VIKA 4CNTA 3RPMA 3GDMA 1OFPA 1R86A 1DP0A 3J7HA 1LRQA 1GOKA 1SFJA 1HJWA 1KBLA 1J2BA 1I45A 3MMTA 4FK9A 1EWEA 1E71M 4IQDA 3VIFA 3DIPA 1T0OA 3VNZA 3IGHX 2ISWA 3DFPA 3VKQA 4HTYA 3DI1A 3BLIA 2QUUA 3VU2A 2VVSA 4UTHA 3W7CA 1T40A 1AOPA 4NJKA 4NL1A 3WMBA 4HOWA 5REQA 4B5NA 2NLYA 3PY2A 4LOCA 3RLUA 3BL3A 3BAIA 1C8VA 1ZJ9A 2VNCA 4D72A 1UQZA 2EG8A 1D8WA 3CWOX 3KE0A 1F07A 5HQEA 3A64A 3N15A 1HGYA 3MW7A 3WBYA 2MNRA 2NVDA 3CJPA 2OMAA 4DB7A 4Y90A 1XIMA 4X3ZA 2V81A 1ITQA 1OIFA 3A9BA 3SQLA 4H9ZA 2X0SA 4MJ4A 3VOIA 2Q8XA 3G1HA 4DZHA 3RMJA 3UWYA 4L6OA 3KUMA 3T40A 4LY8A 5CGMA 1DKWA 1OX4B 3IUHA 3ZIZA 1ISVA 1UPMB 4LUSB 2D69A 3B0XA 3EA3A 4DJDD 1ODZA 5C2CA 4MLJA 2FMOA 4NX0A 2WK2A 1I8JA 3MB9A 1TCMA 2PDWA 3WLIA 1OYAA 1P1MA 3O16A 4HNNA 4NI8A 5CPQA 4C60A 4EF9A 1ZCCA 3ZR6A 3CEPA 3LBMA 3I10A 1S5WA 1V5XA 3DECA 3V5CA 5K4XA 1RBAA 3GH7A 3RX3A 3AMLA 5IBXC 1WXJA 3VI2A 1M5WA 1C8XA 2PDFA 3VD7A 3M5XA 3HGRA 3BMWA 3A4WA 1ONXA 3AFBA 1JCMP 1B1YA 4FX6M 5JMUA 1POJA 2D2OA 3QFEA 3JZUA 4DJEC 4LWWA 3R12A 4FR1A 5JQ9A 3VGEA 1RD5A 3UR2A 1XG4A 4DNMA 3ATZA 3BDKA 2E9BA 4N0RA 1FWDC 3W2KA 1M3UA 2YW3A 4YU1A 3B9OA 3UZYA 2DZWA 3LGDA 3I3BA 3SCOA 3NDZA 2ODOA 3WLLA 1OWQA 2CBIA 2XIBA 3WF0A 3C86A 5EMKA 2ZRZA 1IXOA 1V93A 2D2HA 2VUYA 4V33A 3B0PA 1RJPA 5HMFA 4DXVA 1GEQA 4O13A 1OZMA 3A4AA 1CT5A 1JYWA 4JQ2A 3VMNA 4F0KA 5C70A 2QUNA 4GIRA 3WD2A 1UOZA 2BVYA 4MB4A 2OZTA 3QC3A 1F8MA 5GEPA 1Q6GA 4PTVA 4N4PA 1FDYA 4UQAA 1GGOA 4L7ZA 1KGWA 2VOMA 2EKCA 4ILSA 3W27A 2FH6A 1QASA 1LP6A 4QM1A 2BOFX 1HT6A 5C2XA 3VLYA 3AQUA 1XLMA 5BU9A 7GEPA 3VM1A 1SO3A 4B91A 3OOQA 3FGCA 4ROQA 2F8QA 5FJRA 1XIBA 4U5KA 4ZBCA 4O4WA 3GH4A 3NZGA 4A8IA 3R8RA 3YPIA 2B7QA 4RNJA 4Y9MA 4KESA 1U1HA 3R4IA 4R85A 2BGQA 4OIFA 4EOUA 1UR1A 2O7QA 4I5XA 1Y8BA 2ZBTA 1VYRA 1PB0A 3N4FA 1GOMA 4CQ9A 5AB3A 2FB3A 2JKAA 4G1NA 1PS9A 2QCGA 3PBYA 2OYLA 1G1YA 1DJXA 1QPQA 3V4BA 3V36A 5ABFA 2P0OA 3K4DA 1KWGA 4L1GA 2CKRA 3AXIA 4GZEA 3W07A 4AEOA 2YFNA 3I4EA 2A4AA 3SN4A 3TA6A 4JFUA 4ZFCA 2YGYA 3MT1A 1DIEA 3QV6A 4NY2A 1G67A 3BG5A 4O19A 3T2PA 5K9CA 5DRCA 1ZAHA 5AYZA 1G7VA 4R7WA 1ZNNA 2V4JB 3HURA 4JD4A 2G3FA 4HPGA 1JCTA 3BZGA 2NLIA 3KDOA 4A8RA 2XM1A 2EGZA 1Y5WA 2HK1A 4RXGA 5JBDA 3WNNA 2CXEA 1WQ5A 2CZEA 3O3RA 2Z1BA 4UTWA 1AH0A 4W8LA 2X40A 2NW0A 1XRTA 3WBEA 4ZSUA 2FHBA 4FIQA 4IT1A 3RK8A 4R9OA 3T0AA 5T9CE 2G97A 2AKZA 2UY3A 5A6LA 4ROPA 3W1PA 2DU2A 4ZOAA 1KD0A 4Y2WA 5EBAA 1CPUA 1VPXA 2GPTA 1FWEC 3VDAA 3AC0A 3B04A 4XZHA 1S3HA 3F4NA 1E4NA 3CQKA 1EBGA 1B4EA 5E6ZA 2DUZA 2PZNA 4PL2A 2QPSA 2VMFA 2QHAA 1QNRA 3GFXA 4LUJA 1CXEA 5D02A 2R82A 4LCRA 1CENA 1BEUA 4UBPC 1UD2A 3HO8A 2A5HA 3IVTA 4P7OA 1QNQA 2BOEX 3W86A 1AQ0A 4C6MA 1DWIM 5GVJA 1MW3A 2V5JA 1VFUA 1VJZA 3SCWA 1MUCA 5HJXA 1NU5A 4PA8A 1UZHA 2D73A 3AMCA 1NQKA 2PBGA 4ZTYA 2EPMX 3MP5A 1O7AA 3KRZA 2OSWA 1C90A 3OP2A 3FX4A 3T0TA 3GXPA 4PBFA 3WO8A 2ZOXA 1LZOA 3GSMA 3LB0A 1US3A 4LC8A 3TWAA 2A3AA 3BW4A 2QPXA 2WAGA 3ARVA 3ITVA 2W6RA 1XX1A 2I5IA 1BYDA 3T07A 1Z32X 1KM2A 3HG4A 2DFAA 2PGRA 2CZDA 4XQ6A 4LEFA 4RNHA 1W5OA 4MYXA 3IS4A 5FI8A 2ASHA 5HWJA 2OG9A 1V6UA 4JZ5A 4W5ZA 4NHVA 3LQLA 3OZYA 3B8VA 5CPSA 3B8IA 3BLPX 4J7RA 3AOFA 1L6SA 1GEHA 3W72A 4H3DA 2VURA 4H6KA 4O1EA 3GFZA 1HF6A 1NOUA 2ALRA 2PEVA 5HWMA 1PIGA 3NL3A 5MHBA 2OQYA 4GG9A 1FP9A 4GUFA 2YR1A 1MW1A 3Q67A 2YBTA 1XIEA 1XRFA 2DGAA 2VCBA 3EBVA 3CUHA 3R8GA 5BOEA 3W7JA 4PUEA 3V0SA 5JIWA 1HG3A 4DNHA 5HAOA 5CJMA 3DESA 5E70A 3N2XA 2E6AA 2XH4A 1M65A 3INPA 4CU8A 2V3FA 1VGAA 4LU0A 5C9WA 2OQHA 1XW8A 3ZO9A 4CNSA 2NQ9A 2R14A 2FZ8A 1ZP3A 2ZUTA 4Q8MA 3PP7A 3M46A 1S2UA 4NKCA 2PDPA 3U2OA 3NQ2A 3L4XA 2E8YA 3EMCA 4XWUA 1MNZA 4AHQA 5BOFA 3TMLA 1DEDA 6GEPA 5ABHA 4K39A 4QS6A 1CLVA 2BOGX 3C52A 3SCQA 4JCLA 1NF0A 3OU8A 4F66A 4QAIA 4IPJA 5JUVA 3AUJA 1S2AA 3EWBX 3F5KA 4BCEA 1CLXA 4A2SA 1JZ5A 4AVFA 1WDWA 2QGHA 1HKVA 1OC5A 3PZNA 4P5UA 3BV4A 1FWHC 1XIGA 2P53A 2J62A 1MRQA 2ZUSA 1CYGA 1KKRA 1HL9A 3C3UA 4Z1BA 1BWVA 2BY1A 3WLJA 5U4NA 1SM9A 4DF1A 3GHRA 1UR9A 5RUBA 2ABAA 3IIPA 4S3GA 2YYTA 4GQGA 4P7NA 4TU1A 4BEQA 3OR1A 2GJNA 1KFCA 4F40A 4ZE5A 4CQAA 2PGFA 5LIKX 2VC7A 3BAXA 3SRKA 1BRLB 3LXAA 2L5HA 1L6YA 4IGNA 2VC6A 4WJ8A 4ACYA 1FHLA 1KLYA 4B4HA 3VAVA 4B9YA 4WDXA 3PS7A 3IUDA 1OGBA 2VTFA 3T55A 3PM6A 4AWSA 3AJ7A 3W3OA 1FH7A 3M9YA 3P82A 1TPFA 2I57A 1E4IA 5TD4A 3QV7A 4G2DA 3TSMA 4LAOA 1TELA 2VR4A 4EPBC 2CNCA 1VEPA 2DIEA 3R94A 2BODX 4G7FA 3LTPA 1GVQA 1WBHA 3A23A 4DAIA 4URIA 2OYMA 4GUGA 4J27A 1IZCA 4ZOEA 4PUUA 1WDSA 2V5CA 1L9WA 3K13A 5LHEA 1CB2A 1L8NA 2VZVA 1GYMA 2GDVA 4ADUA 3R8HA 3W82A 5B7YA 1RJQA 3RNDA 3ZLHA 4XD6A 2BLEA 4C5YA 4NU7A 3WDIA 1DVJA 1NWRA 3IJQA 1GVFA 2C15A 3BPWA 2GGEA 4AZCA 3TW9A 4LV9A 2AQWA 4ORIA 4EX4A 3W88A 3G6LA 1OG6A 1A5OC 4UQEA 1FWNA 1K9TA 3C4UA 1FY6A 3KP1A 4GGHA 3M44A 1OY0A 2HS8A 3K46A 4ZQRA 3U9IA 1AH4A 3S0CA 3BC9A 4L6DA 4CCZA 2YYUA 1JD9A 3MQTA 4OOUA 1GKRA 4E3TA 2VEMA 2ACQA 3FV9A 1TR1A 3TN6A 2OQLA 4IG2B 4U10A 2GVGA 4GVHA 1BG4A 4M6QA 1L0PA 2ESCA 2QJMA 4WVXA 2XISA 5H8PA 4YYFA 4I9MA 3QXBA 1HJVA 4GQ0A 2V38A 3MV11 1O5RA 3OIXA 4OOZA 2V0TA 3OZPA 5C6MA 4JTJA 5AECA 3NVTA 3ONCA 1Y0EA 4PMNA 4LF2A 3I65A 4AD2A 3QFWA 4GBUA 4MPKA 3OPSA 3K8LA 1OCJA 2HXTA 3CL6A 3H21A 1UWAA 1PZ3A 2RJGA 1E55A 2NVAA 2J8GA 3DKLA 3E2VA 4AC1X 1AG1O 3HQ1A 1B3OA 1KM5A 3TR9A 2HBVA 4HA4A 1EC7A 5DMMA 1AD1A 4UTWC 4EF8A 1MNSA 3NO1A 3T05A 2BDQA 2YCKX 4BI6A 3ID7A 3THDA 2EBNA 3OBKA 3R7MA 4F2UA 4W4QA 2XSBA 1RZMA 4TVDA 4OWGA 2WBKA 3UJFA 3NQMA 3DYPA 3SFWA 4DRSA 3P7YA 2JGQA 3NL5A 4LUTB 3SR7A 3LHZA 3XISA 5CKSA 1XYMA 1ZRQA 4M6UA 4IUGA 2X16A 4JTLA 4JIIX 4MMWA 1ZZMA 3NXFA 1H1ZA 1UWTA 5M03A 4HTBA 4GYFA 2OODA 2NX1A 4K68A 2WM0A 3Q58A 1EZ2A 1A5BA 3TW7A 3P5ZA 3G1RA 1Q2RA 5G4WA 1CGTA 2V3DA 1KBIA 4W88A 3O63A 2VZTA 3POCA 5CZJA 4E2OA 5H1WA 3E02A 2XSAA 3L4YA 4ZE4A 4H7ZA 4OECA 3SGGA 1SZRA 3T4WA 2TMDA 3M47A 3AIEA 1R3VA 3S3GA 4FEZA 4N9EA 3VKSA 3BANA 3BGGA 1OFQA 5LYRA 3GY1A 3L65A 3T8LA 2BX7A 3WZ0E 3ITXA 2INZA 4NSBA 2GGGA 1ISXA 1VAHA 3ZVHB 3U2EA 4JTHA 1F6YA 4UFJA 4UC5A 2D0FA 2D23A 4Y9NA 2QAFA 4FS9A 1X6UA 2X2YA 1TB3A 2YOCA 3WNPA 2QV5A 4YNGA 4DLMA 5CAHA 3AUOA 4PFHA 1IEQA 1NDYA 3EOUA 3BICA 4S38A 1W1IE 1XSIA 4NXKA 3KVLA 4PRWA 5JXQA 3GR4A 4JIHA 1AQHA 3M0JA 2UV8G 1W0MA 3C2RA 3N9KA 3GXMA 5FJTA 1Q7QA 4NQ1A 4GK8A 4LVGA 1J5SA 3KCLA 1GORA 1YDOA 3QOMA 3VDHA 1XQLA 2HWGA 3E2SA 4CD7A 5AZ0A 3NSMA 4POCA 4AYGA 4AIBA 1UKQA 3EDJA 5A8QA 1PEZA 1XIFA 3DERA 2KAUC 4NP7A 4R9XA 3IPWA 1Z44A 1Q3NA 3TP4A 1CX9A 1F9CA 1WDQA 5FEXA 2XINA 4U33A 1Q13A 1PV8A 1EYEA 4FLQA 3W6MA 3DXIA 6XIAA 4JX4A 3ALGA 3VNYA 3KM8A 2AQOA 3H7RA 3EDDA 3KS6A 3SFKA 1X6LA 4GLEA 3DG6A 1LLWA 1K03A 4LANA 4Z2IA 3H26A 1XISA 4HCLA 4JBRA 1Z41A 2Q8LA 3QLLA 1ODUA 3QY6A 1YPIA 4B16A 2F61A 3S9YA 1VFTA 1HJUA 3P93A 1XL9A 1RSCA 1GCYA 3UD6A 2O7SA 4WSKA 2DZUA 1UCWA 4L4OA 4LXFA 3O9NA 3M0VA 3CIWA 1VFHA 4DUXA 3IIXA 3G0XA 4XO7A 2A7NA 2CITA 2JIEA 2XN1A 1RH9A 4H9YA 3PJTA 1X1NA 3WJYA 4FNQA 5GJNA 3OLGA 1DOSA 2OVLA 3UWEA 3MVTA 3DBNA 2PDKA 1NAL1 1GG0A 4KPLA 3IUIA 2W62A 5C71A 2J8FA 1A0CA 4QAWA 2EXOA 8XIMA 5E0FA 5E9XA 4RDYA 1QI0A 3G8RA 3NDOA 2C7FA 2DP3A 4DBEA 3ANUA 2GQ8A 1K4GA 4XD5A 4BA0A 1F3EA 1I2PA 2ZZ5A 4LEQA 3CC1A 3OLEA 4G38A 4FNTA 3NL2A 1FWRA 3CLMA 1DJZA 2D1ZA 4QE1A 2Y62A 4XAZA 3SN1A 4ASTA 3CO4A 2NVCA 2PE4A 1VLWA 2ALDA 2EQDA 3S1GA 4DUVA 3I3DA 3MM6A 2IXVA 3N11A 4DWSD 3DDMA 2IQ0A 5AZ1A 4PTNA 5HULA 3VFLA 1GW1A 3M6DA 4CVUA 3ES7A 1SR9A 3BLLA 1RPXA 2C91A 4HVXA 1UH3A 1VJIA 1DIDA 1XLEA 3RCYA 3W76A 2VGIA 1DXIA 1AA1B 2Y5JA 4I7VA 4X61A 4HHPA 4GJIA 1KFJA 1VBRA 5DN1A 1W91A 2J74A 3T78A 3EXRA 3GQYA 3ECQA 3VUSA 3WQGA 4EIVA 4EPDC 1GK8A 2HISA 1K70A 1K7FA 4CN6A 4M1RA 5E0KA 1EX5A 4HMDA 4RJEA 3ANYA 5LA2A 4QJ5B 3WNKA 5FAGA 4WSJA 3MMWA 2XH2A 1IEIA 2D22A 2X09A 1GVRA 2J7CA 2NWRA 1FTXA 3II1A 4H83A 1OADA 4TTGA 4QFUA 2V69A 4GUHA 4PR4A 3TZNA 2WVSA 3QHNA 3N9RA 3TQPA 5KZEA 4C6LA 3C0QA 4QDMA 3LHUA 3RGTA 1HP4A 1VHNA 1B31A 1YADA 3NSNA 3T09A 2OYKA 2ZUMA 5LNSA 1EA0A 2XJ7A 3VC6A 1XJBA 1FFRA 3GNPA 4WIWA 1LORA 1SGJA 3PJUA 3NFUA 5A6MA 2D2GA 1EUAA 1T5AA 3LZ3A 1R2SA 2ZE3A 4GXWA 1P48A 1OFAA 2BWGA 3B8DA 3FEQA 2KZHA 2FTYA 4REQB 1F6KA 2HPMA 3AIQA 4U3AA 1DJHA 1ENUA 1RCQA 1J79A 5BCAA 2HK0A 4DJDC 1NIUA 1IV8A 2EPLX 2TPSA 4NYUA 3QJAA 1ZUAX 3EDKA 1FCUA 1K9EA 3PBVA 1W9UA 4RZBA 4DPPA 3ARRA 5J5RA 2ZVRA 3OVPA 3QR1A 2V3EA 4GI9A 4BQ2A 1QNVA 5AKQA 2NX3A 3U6WA 4ACZA 4PULA 4A22A 5IOBA 4AIEA 1ICSA 4IXXA 4ZO8A 4JIQA 1FOBA 4IMGA 4ZQMA 4M6PA 1MQQA 3MM8B 2RFGA 2BP1A 4O15A 3CXOA 2ZUVA 4A8NA 1XYZA 1I60A 4MFDA 4DO4A 1H50A 1YQ2A 1BF2A 1YX1A 1G4SA 1M9HA 1P5BA 2VENA 3R43A 2JKPA 3CZEA 1KXTA 1R3YA 1UR8A 1KR1A 2XFFA 3LPFA 3S1XA 2GWNA 2J78A 3FXGA 1XBZA 2J88A 2H6RA 3PFMA 2BG5A 1UYQA 3SI9A 1YYAA 1W1ZA 3GDLA 1AQMA 1V3LA 1FWCC 1BYCA 4N2YA 3TOPA 1AL8A 1XUUA 1TQXA 1B54A 4UOQA 2BGSA 3NM1A 4B90A 4JL1A 1RA0A 1V0LA 1UKOA 4F0SA 3G24A 2YSWA 4PMUA 3HTWA 4JTKA 3VKCA 3FW6A 4LS1A 4B3LA 5DMLA 1P6CA 1OD8A 2J7GA 3P67A 1R6WA 2QKFA 1JNEA 1LL4A 3BOXA 4C7DA 3PPHA 3EZ4A 2OOGA 1UKPA 2PTWA 2PSNA 4RXFA 3H2OA 3GIYA 2Z27A 3N2TA 5FL0A 1JIBA 4GVGA 1MEIA 1SFLA 3DFYA 2W79A 3R0DA 3NDYA 1L6FA 4GCAA 5PTDA 4NAFB 4UTLA 2DW6A 1WKYA 4LAKA 1TTJA 5HNRA 1KM1A 4AB4A 1E6NA 3SIZA 1TJ1A 1LUCA 1OQFA 3LI0A 3PTKA 2ZCGA 3RRXA 1JZ8A 1QU4A 1W3IA 3SAZA 4UQDA 2XVLA 2G50A 1RALA 6REQB 4C6JA 3TTSA 3HV8A 4JTAA 3IJ7A 4LUYA 2IMRA 4E2VA 1GOWA 1UUMA 3GG1A 3UPBA 2XU2A 4ZEPA 4NASA 4IOTA 1KWKA 4XZNX 4KMQA 2H3DA 1EZWA 3KVJA 1I4NA 1KRCC 3TNBA 3PBMA 1TJ0A 4CNOA 2IQDA 3N2CA 1TMLA 2R1KA 4O57A 1LLZA 1LT7A 1VIZA 3QSTA 2OSYA 2DZAA 2CLEA 1TVNA 1E1EA 3WDHA 3LCXA 2FFIA 2GJXA 1N8FA 1B9BA 2GOKA 3QZAA 4NJHA 3CNYA 3CT7A 3W7GA 2VGGA 2WYSA 1QOPA 1UUQA 2FPTA 4BK9A 3H22A 3UGVA 2CU0A 2PP3A 2Q02A 4XSMA 1QHPA 1Q4NX 5A2CA 1S2WA 4FI4A 1NELA 2ZZ2A 4CU6A 1XYCA 4IJBA 3B8WA 3ZXWA 1EHNA 3TK7A 1V7AA 3WQVA 3BH4A 2PC8A 3SCTA 3BLEA 1FP8A 2GQ3A 1VR6A 5IDIA 1H60A 3NOEA 3QF0A 3TTQA 2HV5A 2CYGA 1WKFA 2J7BA 3OTRA 1JEZA 3EX3A 3SSZA 4BQ5A 2Z2AA 3LSBA 4F8XA 4BQ3A 4AY8A 3A47A 3AISA 2I7GA 2YL5A 1KTNA 3QSRA 3UJSA 4C5ZA 2JKEA 4OV4A 1VD6A 3WFLA 3GR7A 4XBKA 5I3HA 1H5YA 5C9XA 5LXEA 4NRRA 8GEPA 4ZA0A 4O52A 4D8ZA 4WZHA 4PMJA 1OFEA 1GQIA 3LBCA 1KGXA 4YTQA 3OZOA 1GT8A 2V3GA 4O1CA 2YFOA 1O6IA 1RAKA 4JKKA 5DCEA 5GJPA 3MM7B 4NUWA 3AIRA 3KBNA 2VFHA 1K8ZA 3RXZA 2CLOA 2V5KA 4G56A 3JRKA 1KV5A 4R53A 4HSNA 4J3ZA 4US5A 1W3TA 4RPQA 2HRWA 1JCNA 2BHYA 3ZR4A 4K3ZA 1RA5A 2QF8A 3SURA 2GOUA 1B90A 2PF0A 1KBKA 1P6BA 1Z42A 5F2LA 1R2TA 1EWDA 4Q8TA 1JZ6A 1P0NA 3OR2A 2VOTA 2PD9A 1JJKA 3MM5A 1XC4A 3P14A 1EHAA 3ABQA 3KOFA 4OFCA 4UFKA 3HF3A 3AS3A 1XRSA 1FCVA 3O15A 1PKYA 3W7DA 3T0CA 3WLRA 3KL0A 2FZDA 1PO9A 3STEA 4Y9OA 2Z6IA 3DH7A 3WUEA 3M07A 1UMLA 4CN1A 1BPLB 1DXEA 1PIIA 2BXYA 3KLKA 3UA4A 4WKFA 4B3KA 3M41A 4H6QA 4KCWA 1QBAA 3MMBA 1WO2A 4NZFA 3QRHA 1S39A 4DN1A 4LT9A 1VFFA 4Y9PA 4Q7NA 1AW1A 1K3UA 2WZTA 4RR4A 1TV2A 1IT8A 2FDMA 4GX8A 4DBWA 3C0JA 4CVWA 3E96A 3S1WA 4KCTA 4JEJA 3NQEA 4O18A 3RIKA 3FCPA 5A95A 4AAJA 3PZQA 1MW2A 3BJSA 3W24A 4AWUA 3UCDA 1OFDA 5C9RA 5FESA 5G2WA 5DLCA 3ITGA 1TJRA 4W84A 3PWIA 1OYBA 4KFPA 3W6YA 1BVWA 4U5IA 3CAQA 4KCVA 2VRKA 4P61A 1UC4A 1NFBA 1TSIA 4YCPA 2ZX7A 4I9TA 3T44A 2VT0A 4YVPA 3T08A 3CHEA 1BYAA 3AOPA 5A2AA 3IK4A 1MFUA 3THAA 1IEXA 3G3DA 4L9XA 2ICSA 2WANA 3EAUA 3UEQA 3VNIA 1J4EA 4QNWA 4Q8UA 4E0CA 4I9JA 5XINA 4LVFA 2ZKMX 4AZ6A 3CZ8A 1XLCA 1ZJIA 4GZ7A 3PULA 5F4WA 2EPHA 1EKOA 3ZFHA 4NAEA 3G1FA 1RBOB 3GNDA 2PMQA 3WNMA 3CPRA 3TQVA 1DJGA 2BHUA 1DQUA 5I0DA 2YB1A 4BKNA 2QEZA 2J4GA 1QPKA 5GNXA 4GABA 4J28A 4F48A 4JL2A 3G77A 3WENA 4Q6XA 4GXPA 2DUXA 5FF0A 1TPDA 2WPGA 4GIYA 1S1PA 5A94A 1G4TA 3ITOA 2XIMA 1W2PA 2PWFA 5FEPA 1AQFA 1LWIA 3SB0A 3OA3A 3UY7A 1W3LA 2DQXA 3LMYA 1Q6CA 3KCJA 2E0PA 1HVQA 4LC6A 3MS8A 1O5XA 5LA1A 4QEEA 4YN5A 1RK6A 4GIEA 4K2SA 3T9PA 3BV7A 1FA2A 1K9DA 1RD6A 3P81A 1IHIA 4FXFA 4BF7A 3A3HA 3BSHA 1YE4A 1QTWA 3BVJA 1UUOA 4L9YA 1EPXA 1LJYA 1UZ4A 3P5YA 2BGNE 1TZ7A 2Y8VA 4O1DA 4GZIA 3W29A 5CSUA 4YTRA 4L64A 3EWDA 1LG1A 4TOQA 5HNNA 1F3TA 1F7BA 3EKZA 1XGEA 5ENLA 2G95A 5H2ZA 1CXKA 3NPXA 2YLAA 2VZUA 1TA3A 3NQGA 4CGTA 1NDVA 5ABFB 1KM4A 2ZDRA 1QDSA 1HX0A 1P0KA 2C13A 4ATWA 4GINA 1BKHA 4FP1A 1D7FA 3R0UA 1V3JA 1FDJA 1F76A 4JS3A 3VDBA 4A21A 2NXHA 2W5FA 4M1BA 4Q6JA 2QJNA 3MMAB 2YL6A 1SW0A 1UQYA 2FVKA 5I5RA 3CPGA 2GSHA 5HK4A 2H9AA 3CB8A 2DZTA 3BE7A 2CPUA 3PPGA 3D3FA 1MFVA 4IMDA 4CEUC 2J9ZA 5FKYA 4Z2JA 4GOAA 3GNNA 3QKEA 4LVBA 1AZ1A 2PU1A 1E6PA 2AL2B 4WQ6A 5IFTA 4ZL1A 3W7KA 1OABA 4G7EA 2QAPA 1U5HA 4QSHA 1BVNP 2DORA 3N6JA 3REQA 2F9RA 4HU0A 3COTA 3S2CA 3FFSA 4Q4KA 4P8WA 1V08A 1X38A 4J40A 4QBXA 1FHDA 5LXXA 1PYMA 1NOWA 1V7YA 4LB3A 4UQCA 3AXHA 1CNVA 2JF6A 5CGTA 2O4QA 3CUXA 1EJRC 2PRHA 1MUWA 5DMYA 1A5KC 1G6CA 3T6CA 2JIWA 1BXCA 3GH5A 2X42A 3G0SA 6ALDA 4GPNA 4R7JA 2ZTJA 4WGXA 1PDYA 1CXFA 4O1BA 2V30A 1IXNA 1OB0A 4LYRA 4FXRA 3WBWA 1CGWA 2AOSA 2X0HA 3C2VA 1LQ0A 5BWAA 1A3WA 1ZGDA 5EMUA 3KTCA 3SN0A 2VGFA 1MXGA 2YPIA 4DF2A 3UFYA 1QI5A 5FF4A 1C9WA 2OO0A 4L56A 5KITA 3ARWA 3VMPA 3BJFA 2ZRYA 2ZX5A 3NO3A 4EWJA 3VD9A 3ZLFA 4A3UA 4IH3A 3TAOA 1XD0A 4KEVA 1W32A 2FJKA 4MNJA 1ZY9A 4MFEA 3UU0A 2ZRUA 1A5UA 3QY8A 4C6NA 3GU2A 1A5SA 1NM9A 5CSRA 1Q8AA 4RZ4A 3AYTA 3SQSA 1JGMA 2R1LA 1JNDA 3B0LA 1OX6A 3TTOA 3GRIA 1WDDA 3V35A 4V2XA 3I6RA 3PAOA 1EXPA 3NVDA 3AZRA 3W6LA 5AOUA 3RR1A 5K9DA 3W9ZA 1ISWA 3RO8A 3CHVA 3TFXA 1VENA 3QQ1A 4WDWA 4WJXA 5D30A 4UTTA 4NZJA 4K1GA 1RQEA 1EOKA 4PCNA 1WOBA 4PUKA 3LHYA 3NCOA 3GXIA 1E1FA 2B7PA 4YTUA 1U22A 4MZ1A 4XZBA 1TR9A 2ZE0A 2D2JA 2CBUA 1OFBA 4J3XA 1JD7A 1MSSA 2C16A 4PEKA 2OSXA 2VEPA 4YL2A 2HVMA 1R3TA 4XTIA 4EE9A 2AL1A 1UKTA 2F6UA 1X8CA 3AWNA 2G3IA 1T8XA 4XSLA 5A3HA 1FCBA 3A6OA 1L8PA 3HFYA 5G4HC 5CPMA 2PODA 2VEIA 4IPNB 2EEXA 4JTRA 3EOSA 1J11A 4KGLA 2OZ3A 3IJIA 2HE5A 3VIHA 5I78A 2EF9A 5B80A 4E2BA 4XBJA 4YIWA 1OYCA 5FJIA 2POTA 1WBJA 4DIAA 4AX6A 2OGJA 4C6KA 3TYDA 3G3MA 2OR2A 2J13A 3M4HA 3U8GA 4JAWA 4MDPA 4MIMA 4JKLA 3G1XA 4UR7A 3WMSA 3N29A 2B31A 1B3ZA 5G5IA 1A5LC 3CLWA 4B5SA 2XFYA 4XD3A 2CEQA 4LRSA 2Z00A 4Z2KA 5A6TC 7XIMA 2DSVA 3MUY1 3VE9A 1X98A 2BY0A 3BQ6A 1Q7ZA 1VIWA 3D6NA 3TYZA 4D1IA 4J9JA 4J2MA 4B2DA 1NWUA 3VMOA 1U1UA 1H7WA 4K7YA 4I8YA 2WMFA 4JQAA 4XO6A 5C2GA 1RQHA 4AXKA 1R5YA 1XLJA 3USBA 3P84A 3TLLA 1J10A 2PWUA 4PMVA 1FKXA 1GVYA 4CCCA 3W7LA 3OR1B 1GPWA 4IIFA 3KOZA 3FKKA 3HFTA 5KSWA 1JZ7A 1S3TC 4QE5A 4A8LA 1P43A 1AW2A 1RLDA 1E9IA 1VRXA 5TQLA 4KCUA 5I6SA 5IFPA 4XB3A 4F2TA 3URNA 1SZEA 3GTIA 4ERIA 1UWSA 3FY1A 1JYNA 3PF3A 2Q3OA 1CB7B 4H04A 2JALA 3WIJA 2WWDA 3FXYA 1G7UA 4ZSTA 5GNZA 1WXYA 4GRSA 3F4DA 3GTHA 1KB3A 2AKMA 2PA6A 2VWSA 5ABGA 4IIGA 1YXDA 4JIRA 2PWHA 4B15A 4MWAE 3TJLA 3V5OA 3MPGA 3VGDA 2GJPA 3L68A 5D33A 3S6DA 4FOUA 4HNOA 5DQPA 4B5UA 3CU2A 1VC4A 3BMVA 1DWAM 2GVEA 4W5UA 1IIGA 2PLMA 1CZ1A 4Z0SA 5KZ6A 1UPPA 2XGIA 1G0CA 3AU2A 1DHPA 4O0KA 3SUWA 4MY8A 1OM0A 3MMCA 4NILA 1V77A 2CW6A 5AHIA 1KLZA 3H54A 3L5LA 1ZB5A 3UG4A 5A6BD 4AWEA 3N6QA 2ZX8A 4PUMA 4IICA 4U28A 3CAVA 3E6EA 1S38A 1QXLA 4DWSC 3OEXA 3FA3A 3WF3A 4DUWA 2DW7A 1JCLA 2A7PA 2ACUA 1YRRA 4E8GA 2GSJA 4RE4A 2NQ5A 2PS2A 5LGZA 1YEYA 2ZIDA 4K38A 1QOXA 3B0HA 1MI3A 5LIUX 5KETA 2E7FA 2UWFA 2EJAA 1EYWA 1B9ZA 2ISSA 3I4KA 4AD5A 3KFTA 2V5DA 3KBJA 2PB1A 1J5TA 6TAAA 3V1PA 1F4HA 3VIGA 2BZNA 2DVUA 2VC9A 1C91A 4AVNA 3IJLA 4JYEA 3MUZ1 1OC7A 2BNJA 4YVXA 3TZFA 4ZB5A 4MWAA 4C91A 1SW7A 1WE5A 3MTWA 4AC7C 1XG3A 4JEQA 1LOSA 1B3WA 1WAUA 3M0YA 1SW3A 1AMYA 1M01A 4JFTA 3N2OA 1AZ2A 3AMKA 3LCHA 4UOZA 3GUGA 2XDFA 2XH0A 3EMZA 4J2PA 1SMDA 3B9AA 3ABSA 4JYFA 1JUKA 1CI1A 3N4EA 3GD6A 3VOFA 2Z1XA 1V3KA 3HG2A 4L80A 1R8LA 5G1TA 2YA2A 1V0KA 4O10A 5B7ZA 2GQ9A 3LBOA 2B7NA 1TX0A 1CLKA 5DBTA 5IXEA 2PDQA 3L7RA 1EDTA 4NZ3A 4Q7IA 2GJRA 1WB0A 2XIQA 2WB5A 4TX9A 3ARQA 3G18A 2ATMA 4AZ7A 2PBOA 2GK1A 1ZPTA 4AZBA 1I2QA 4D6HA 3KRUA 4S2CA 3KDNA 4HZ8A 5DBUA 3KVMA 1UP3A 4INFA 6CGTA 1M53A 3NTYA 3FVMA 3TYEA 1FQ0A 4EACA 3NYZA 3VNJA 2CXGA 4WKAA 4NYYA 3CB3A 5EMYA 1IGWA 3NG3A 3C0SA 5CH9A 1RCOB 3V0UA 1HJSA 3MVIA 5BZAA 2C1GA 1AK5A 2WZIA 1JR1A 1J0IA 3S9IA 3S5OA 4FNRA 3QC0A 3CAWA 3EA2A 2RDTA 3MI6A 5HANA 1GJPA 3VDCA 4LUSA 5HJYA 4PRTA 4JX5A 2ZFAA 1J01A 4DM1A 4V1XA 3GYEA 4BI7A 2IS7A 1KXVA 1L6WA 5IBXA 3VX0A 3F03K 1U33A 4I5RA 4W9TA 2VCCA 1YDVA 1R3SA 4GKLA 2XUCA 2X1TA 1RBLA 4NZ1A 3NQBA 4BY3A 4AX7A 3RILA 2WSQA 1U5JA 4K8GA 4EK7A 2X1UA 4ZB0A 3DGRA 1HP5A 4JTCA 1IE7C 3EXTA 3GU1A 1MEHA 3W7IA 1YLVA 2OLSA 3QEZA 1YTEA 1EIBA 4HKPA 3E9AA 2GYIA 4I6KA 4ENLA 1SYTA 4XKMA 1Z7AA 3RDKA 3SCVA 4IFKB 3CH0A 1UROA 4DO7A 3AMDA 4YLWA 1VBUA 1LQAA 1JPKA 3G6MA 4GVIA 4GQQA 1KBJA 3HQPA 4HPHA 2RJHA 3WQPA 2WM1A 4UB9A 4G6CA 1C3FA 4EANA 5F2GA 3V1HA 1UB3A 2IUZA 3TSBA 1L6GA 5I77A 1CBGA 1DL3A 1FVPA 4AD3A 2IKHA 4Y9AA 4GY0A 3E1F1 1S1RA 4QX4A 2GEPA 2C3ZA 3LM7A 4O16A 3URQA 1SPQA 3KBVA 4MZYA 1QUMA 3LUTA 2ADAA 3B8UA 4K36A 4ICNA 3LG3A 1OFRA 4F3HA 3EWWA 2NQHA 3GXTA 3KX6A 3LCFA 4QG8A 4YTSA 2OZ0A 4X9YA 3SZ8A 4UNIA 3UNTA 4WY0F 5FJOA 4E2DA 3M0ZA 1ITXA 3QR3A 4WKHA 3C2OA 4WLCA 1E43A 1TPC1 4OJYA 4C6IA 1KCLA 2QUTA 5FEWA 3NL6A 5LHFA 2H3BA 4XKYB 3N34A 4JTQA 1K1DA 2WVVA 2VWTA 4MHBA 3USZA 5D2TA 1MXSA 3HZ3A 1A5NC 1PXGA 2BY3A 2DQWA 3PUDA 3QBUA 2ACRA 1D2KA 1EGMA 4HN4A 3MANA 5DELA 4HSHA 2ZC8A 2OLHA 4LUIA 1JVNA 1AH3A 2PFHA 3AS2A 1CEOA 5EGRA 2G0WA 3EX4A 1QK0A 2G4FA 1O1HA 4GWEA 2QDGA 4MOZA 3P74A 4S3KA 3DAQA 2VEFA 2J6VA 3IV3A 4O0ZA 5AN7A 2CZVA 1OT2A 4E4PA 5FF2A 3BCDA 3DU0A 4RNIA 4ZO7A 3WH8A 3ATYA 2A6LA 4O1AA 4RPPA 3N2MA 1LDCA 4HOZA 2ANUA 1BQCA 4GI4A 3WF2A 4WXYA 3B9NA 4KKXA 4H9UA 1FWBC 1WCGA 1XLHA 3WLNA 4MB1A 5GPRA 3WFAA 4GH1A 4LVAA 4EPEC 1U83A 3ARSA 1KQZA 3HPXA 2C14A 5MKGA 1H2JA 2QJJA 3URBA 3MKKA 4GJJA 5DXXA 2ZZ4A 2FHFA 3UZZA 3W74A 4NIRA 4IL2A 2FKPA 3I6EA 2RHGA 2ZUUA 4JTDA 1OIMA 4QE4A 2QT3A 1N2VA 1Q85A 1YXCA 2Y1HA 1FH8A 2FJUB 3BUVA 4H9MA 3P61A 3L67A 1UD4A 4KFNA 5I3GA 1ECQA 3Q2DA 1XH2A 3LCWA 1KM6A 2ZX6A 4C6PA 1YW1A 4Z42C 3GE7A 1WDRA 4QHRA 3TAKA 2VQUA 3VOHA 5DCDA 4RZ5A 2QJHA 3LPGA 3AI0A 4FIRA 1IYXA 3VNDA 1T41A 1CGXA 4BFAA 3HOJA 1R9YA 3D0CA 3KEHA 1XSJA 3VKDA 1PBGA 3KTSA 3A22A 4KRUA 1EDQA 3KWXA 2GLKA 2UY2A 2Y4SA 1PCWA 2A0NA 3O07A 4GE8A 3W83A 1ZTVA 4EP8C 1R7AA 5EMLA 3H7UA 4MTVA 4QEHA 4V28A 4EPKA 5AC8A 1ELSA 3L5MA 3UJRA 1F73A 1HZYA 3HIJA 1RR2A 1XDMA 3KBMA 3TXVA 4QRNA 1A53A 4RL3A 3CTTA 3SEPA 3WX7A 1GJUA 1JPMA 2VZSA 2WHMA 3WQCA 3A21A 4YHGA 2GJLA 3VGFA 3SQMA 3QMRA 4H6EA 1DJQA 2VD9A 3HG5A 3IAPA 5EMJA 3DFTA 3E5PA 3N04A 3NAVA 4JTIA 4J3WA 5IM51 4IUOA 2DH3A 1D3CA 3B0VC 3GFYA 1TTQA 2YA1A 4PSPA 4Q4OA 4IWWA 3IIVA 2VKZG 2OKOA 4IMFA 1E5NA 4KH2A 3IWPA 1JULA 3SECA 1ZSXA 5AYBA 4QTGA 1US2A 3RAOA 2DIJA 3UESA 1WOAA 4HBKA 3HBLA 3PZOA 3OODA 3LLXA 4QCFA 3TCEA 3RM4A 3GW0A 2WC4A 4PCSA 2YCIX 2VX5A 2YDQA 3CWNA 1A5CA 1DJWA 3QHMA 3QW3A 3O2LA 2Z6JA 3EYPA 4G1KA 2DSKA 3KW3A 3W2MA 2J9YA 4I8DA 4C65A 1R9XA 3KS5A 2V68A 3IACA 4GO9A 1MO0A 2O56A 3VILA 2QDHA 4HZ6A 4PYSA 3W1AA 4BEUA 4PFMA 4WSHA 3TYUA 1UP0A 1FWTA 4LNYA 5LIYX 3LLFA 5T26A 1NSJA 5D32A 2MANA 4YWIA 3K8MA 3B4UA 3TYAA 1UP2A 3P3BA 3LMZA 4OV9A 4ML9A 3SUUA 3V7PA 5CAKA 3WFZA 4NNCA 4DJED 4QLJA 2DDXA 2XSJB 2ABBA 1K7XA 4IPIA 3WF4A 1LBLA 3EA1A 1H41A 1W17A 3STFA 4UUIA 5LNUA 2E1DA 4XZ9A 5G2HA 4CNUA 3M7WA 3E3HA 4MJMA 4DJFD 1KFLA 2ATSA 3WQOA 1UR3M 2HVOA 3EOLA 5HOSA 4AF0B 1B4KA 3F5LA 4LALA 2P8BA 1LUCB 1QRQA 3LOTA 1BVZA 1V6YA 3IV8A 4HCHA 3M0LA 3IARA 4WDTA 2DUAA 1JCJA 1UR2A 1RUSA 2J6XA 2YDSA 3FJLA 2X30A 1FUYA 4IIDA 5I09A 3SCPA 3VOCA 3WJXA 1XH0A 1UD8A 1EJUC 1KFBA 2OEKA 3WH5A 1K4HA 2F38A 1QFEA 3CUFA 4LNCA 1JUBA 1MWOA 3TC6A 1LWJA 5FIPA 4K6AA 3GU9A 2WMGA 4NRSA 5A6SA 1O68A 5A5WA 3EWXA 2CLFA 3F2DA 1B2YA 4W85A 4ERAA 4ZQNA 3MP4A 1R7OA 1UOKA 4DUOA 3UYIA 3DC0A 3LENA 3W38A 3WLHA 1KBBA 1VQTA 3GHSA 4S3EA 3PNZA 2FMNA 3CZGA 4GUIA 4HZ7A 1KKOA 1MDLA 4BWLA 3S46A 3UT0A 3LV6A 3WLOA 1EJXC 3MZNA