4S3FA

Ispg in complex with inhibitor 8 (compound 1077)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
401
structure length
400
Chain Sequence
b'MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 136
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3fA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3fA02
4AOPA 3H22A 3K13A 3MMBA 4S3AA 1TX2A 2YCLB 3VKTA 2AKJA 3MM6A 3TR9A 4DJDD 3MMAA 3VKPA 4NIRA 3VLZA 4GEPA 2H9AA 2V4JA 4O0QA 4S38A 4D8AA 1AD4A 4DJFD 3MM7B 3TYDA 3AOPA 7GEPA 4G9PA 4G39A 4DB7A 2AOPA 3B0HA 2DZBA 2OGYA 4MWAC 3B0JA 2YCIX 5JQ9A 8GEPA 3B0LA 3NOYA 6GEPA 2YCJA 3MM9B 3VKQA 3H2EA 1TWZA 3H23A 1Q8JA 4DJEC 3VKRA 3VKSA 1EYEA 3BOFA 4O1EA 3H21A 3TYUA 3V5OA 4MWAE 3MM7A 2Y5SA 3TYBA 4O1FA 4DAIA 1Q85A 3TZNA 3VM0A 4MWAA 3H2FA 4NL1A 1ZJ9A 3GEOA 1TWSA 1Q7ZA 4S3EA 3MMCB 3TYZA 5GEPA 4HTRA 4DJDC 4MWAB 2XSJB 3H2NA 4D8ZA 4DJEA 2VEFA 2DZAA 2GEPA 3MM9A 4S23A 2BMBA 1F6YA 4S3BA 3VLXA 4DJFC 2DQWA 4S3DA 4S3CA 1Q7QA 2YCKX 3MCOA 4S39A 3H24A 3TYCA 2VP8A 3TYEA 3BOLA 4C1NB 1Q7MA 3MMCA 4DJDA 4DAFA 4HB7A 2XSJA 4D9PA 1AOPA 3MM8B 3OR1A 4DJFA 3OR2A 5AOPA 1TWWA 3MM5B 3H26A 3TYAA 4CCZA 1AD1A 2Y0FA 3H2OA 3B0GA 3B0MA 3OR1B 3OR2B 4S3FA 3MCNA 3MMBB 1AJ0A 3VM1A 4C1NA 1TX0A 4G38A 4MWAD 4NHVA 3MM6B 3VLYA 1Q8AA 3MMAB 4PZVA 2VEGA 3TZFA 1AJZA 2H9AB 2V4JB 3B0NA 3MCMA 3MM8A 4DJED 3H2CA 4NILA 1AJ2A 3MM5A 2Y5JA 2E7FA 2YCLA 3H2AA 3H2MA 1ZJ8A
chains in the Genus database with same CATH superfamily
2HS8A 3ANYA 4HCHA 3BSMA 1T40A 4K8GA 3B9AA 1OFQA 1EZ2A 4DJFD 3GVWA 1DIOA 3HURA 4N7QA 2C71A 3DFHA 3EMZA 3EEZA 2CLFA 1JAKA 2DPEA 3UGVA 3BAXA 4GOAA 1TVNA 3KCLA 3F03K 3XISA 4E8DA 4BQ3A 2WSYA 2A7RA 1K7XA 2ZUNA 1D8WA 3C2OA 4C5ZA 4IFRA 2X2GA 1ZPTA 4GQBA 1WDPA 1JD9A 1PE1A 3KBNA 2WKLA 3N9SA 4KH2A 2AL2A 3M16A 3V0TA 3ZZ1A 4U4MA 4DUVA 1YDNA 3N9RA 3N4AA 4TOQA 4U5KA 3W22A 2XWDA 4XUYA 5PTDA 4HOZA 1LCOA 3WJXA 2OLHA 3JUGA 1NQKA 4H7CA 2VM8A 3WIJA 4P8UA 3M0VA 2ZUWA 4ROQA 1TE1A 3FJNA 3LD5A 1ZGDA 4J4KA 5HNUA 5C2CA 3PK7A 1QI3A 3GG8A 4EPKA 4GIRA 5F2IA 4G1KA 4RZBA 2I16A 3CUXA 1ITCA 3R89A 4M24A 2H8XA 5IXEA 3DCPA 4IPLA 4ONVA 3VE7A 7A3HA 4EF8A 5DCBA 1XM3A 3AIUA 1F8MA 1MVYA 3FGCA 4ZXLA 3HQ1A 1SFSA 3UCCA 5JBFA 3T40A 2MNRA 4GBDA 3M6DA 1ZJAA 2PBOA 3CHEA 4UOZA 2V2DA 4FXJA 1TA3B 2GGEA 2KZHA 8XIAA 2Y89A 2YL8A 2EG6A 3GXMA 1J01A 1OYBA 4D8LA 1QHPA 1QOXA 1OCNA 3P67A 3B8VA 1T99A 3IS4A 1E1CA 4A3QA 4B16A 1VQTA 4XZWA 4Q8UA 3DBNA 3PANA 3LLXA 4HN4A 4DAIA 1UWQA 2C91A 3EOOA 5LYRA 1TIWA 1O12A 3GAYA 3V16A 1KFLA 1V0NA 4DLMA 3BO9A 2CITA 1W1ZA 2G4FA 1KM5A 1EWEA 4H01A 1UPPA 5F4WA 4E38A 2OOGA 1GWJA 1DVJA 3LCGA 5DXYA 3BDKA 2REQA 1JCJA 2NUWA 2OZ0A 5E0CA 3OZOA 4N02A 3W27A 3KL3A 2GUUA 4JR5A 3OJGA 2DQXA 3GTXA 4BKNA 1CEOA 3RYSA 4B2DD 4C91A 5BXSA 1RUSA 2E9BA 4NXSA 3W2JA 3K13A 3KM8A 3O6CA 3IIVA 3N4EA 1PBGA 2F61A 3WLMA 4J3ZA 4GE8A 1UWTA 3DFPA 2JEPA 1EDTA 1OFRA 1C91A 4A3UA 3UXDA 2Z1KA 1XYFA 3WKZA 2BY3A 3EPOA 3L21A 4IPJA 1HL8A 3PR2A 5C71A 4M8UA 1SYTA 1E1CB 1XISA 1OCBA 3M6YA 2P10A 3B8IA 3TYZA 2RH9A 2GVJA 2XM1A 1XI3A 4JEQA 2EPMX 5DN1A 5EL1A 4H83A 1XIJA 4HN8A 3MY9A 1UJQA 4M29A 1B90A 5GPRA 3KHJA 1XCXA 2CBIA 2IQDA 3D3FA 3UVAA 4EE9A 5LNWA 1V93A 2VWTA 4C6CA 4PFMA 1ZBWA 3NDOA 3N2BA 2E6FA 3B0YA 3GXIA 5F2GA 3TC3A 4F9DA 2GSEA 2REQB 1B4EA 1OG6A 1DPMA 1EUAA 4C6OA 1VPQA 3KOFA 1OC5A 1OZMA 1Q6OA 1E56A 3KAOA 4KEZA 4O19A 4NX0A 4IMCA 2V67A 4QHRA 4DIAA 1N7KA 1MFUA 2CLPA 5D04C 3MMWA 4MNLA 2TAAA 3KHDA 1UBSA 3S6TA 4C6LA 1OWQA 1HKIA 3QSTA 1R85A 5EU9A 1Z48A 2OJPA 4GA8A 1U1JA 1Q4WA 1CW2A 4NZ4A 4DWSA 4R7JA 4NUWA 4ZOAA 1QU4A 3MTWA 3KVJA 5CGQA 1G7UA 2GQ3A 3DECA 2D22A 3OLGA 2J13A 1GHSA 3M47A 4OV4A 3ZFHA 1K9FA 4S3KA 3S9YA 1YHTA 3HIJA 1KM3A 1HGWA 4BQ2A 2ZX8A 1UR0A 3CC1A 2Q3OA 4CQBA 2HISA 2ZXBA 1J18A 1LG1A 3CTTA 3QFEA 5AYIA 2NX1A 4IH3A 4E8GA 4C6PA 3VFCA 3GRIA 4ZQOA 5KEZA 5FA5A 2DT1A 5K9DA 3M5YA 1IGSA 2JK2A 3IV3A 5AYZA 4MZ8A 2Q3RA 3PBVA 3GO2A 4AHPA 5KZ6A 1TPB1 4LVGA 4PBGA 3MQTA 3UERA 3W6YA 3PZNA 2B0MA 2PDKA 1TX0A 3NEVA 3ZWTA 1J96A 3S2CA 3T1GA 4GABA 1R0MA 1LDCA 5DRCA 1W3KA 2A3CA 5CAHA 1AMYA 1G4EA 2R1PA 1WE5A 4KPLA 5A6BA 4HMCA 2WKJA 1B30A 4M7TA 2ONEA 5CC7A 1A5AA 1MXDA 1VD6A 1N55A 3GIYA 5E6ZA 1KBKA 3U2CA 1FXPA 3S1XA 3T81A 3W7GA 2F6KA 5LA2A 2D23A 3OG2A 1P0DA 4OFCA 2Y61A 3ZJ6A 4HJFA 3DZ1A 3G3DA 4JTEA 5F2LA 3TN3A 3P6LA 3UVIA 3H2EA 4TV5A 1EOKA 2ZA2A 1K9TA 4LEFA 1YTDA 1NDWA 1TPVA 5GVJA 3EX6A 1XUUA 2UZ9A 1Z8AA 3AJ7A 1FWIC 2J4GA 1LP6A 2WJDA 2WMFA 3V5FA 2CETA 1Q2SA 1WZMA 2YCKX 3RJYA 4PCFA 4WJ8A 2NLIA 3WENA 5DELA 3EOSA 5C0QA 2P0IA 5HWMA 2HPMA 1B2YA 4JN8A 2P0OA 2BY1A 3NZRA 4NRRA 3I68A 4Z2LA 1QOQA 4L64A 4HHMA 1XYMA 4CGTA 1Q63A 1LM1A 1VHNA 3V75A 3GH4A 5BMWA 3G1DA 1CI1A 4OTKA 4JY8A 2QCLA 4UTIA 1A80A 1ZFJA 2J8FA 2NW0A 3CV1A 3TJIA 4DJED 4GPNA 1OGSA 1D3GA 1V7AA 4XAPA 3TAKA 4WY0F 4UR7A 3GUGA 1MRQA 1FWTA 1NH6A 2BOFX 3PBYA 3SUSA 1UD3A 2Q01A 4IIFA 3LOTA 3QMRA 1B0IA 1E4IA 3E0LA 3OEXA 1IIHA 2QCMA 1N2VA 3VMNA 2DFAA 4LYRA 1HXJA 3WF3A 3OLEA 1I2QA 1UWSA 1O95A 3T05A 3V7PA 1V7YA 3OZPA 3W53A 5AHIA 4OBRA 4O10A 3B0LA 4XD3A 2QULA 3W7KA 1KM1A 3IJ7A 4MUPA 1BEUA 5I78A 1XFBA 2DZSA 2DUAA 1Q66A 2DU2A 1MQQA 2WZTA 1Y5XA 5BOEA 1D9EA 1FWCC 4GUJA 5EMYA 1XL9A 4WY0A 4LH8A 1KFEA 3IJLA 3GTIA 1F6YA 1G6CA 2QJMA 4ZO9A 2OELA 1YRRA 1A5LC 1P0EA 2BV9A 3LM7A 5A6KA 1GVRA 1VYPX 4I8YA 3HG2A 1EQCA 3UZJA 1AG1O 3MKVA 3LXBA 3GU1A 4MJMA 4MMWA 1XCWA 4DBUA 3T2PA 5A8NA 1GOQA 3SEPA 4TIMA 3SRKA 2XUCA 2UY5A 4WJXA 4H9ZA 1DOSA 2G5WA 1JZ8A 4JTKA 2YYTA 4MY9A 4CKQA 2A5HA 1E3ZA 4FEZA 3DFNA 4W86A 1GVEA 2PMQA 1U2YA 2PTYA 2X2YA 4UTWC 2YCLA 4ORIA 1KGUA 3CQKA 3WQWA 1Z42A 4AD1A 4ECLA 4ZVJA 2JGQA 3ZVIA 3L5LA 5C55A 2GUBA 2ZRZA 3AYSA 1IT7A 2FZDA 1DQUA 3W38A 1EXBA 3WNLA 2D2JA 3PWAA 1NFBA 1J6OA 2R1MA 4YVVA 1VGAA 4L6DA 1AA1B 3N2MA 3ONCA 1OT1A 1DORA 3CLMA 4N6FA 4MNMA 2CKRA 4IOTA 1AQMA 4PODA 4Y96A 1RJPA 1VKFA 1WKDA 1S2TA 1GVOA 4H6EA 1H0GA 1NF0A 3DH7A 4H6RA 4MFDA 4MB4A 4F0SA 1RCOB 3I7QA 1SJBA 3GXDA 2OEJA 4BFAA 3RG6A 3ZSTA 3PZQA 3ABRA 4KKXA 1E0WA 3R4IA 3UNTA 3UXKA 5M03A 4B4FA 2WCGA 4DLFA 3DG6A 3S5NA 4R27A 3FXYA 4JY9A 2WC7A 3TYCA 2NV9A 4Q8WA 5CPLA 5HQEA 3VD7A 3S0CA 2XPKA 3IJ8A 3BW4A 4U28A 4RZ6A 1M53A 5HMFA 2QCDA 1EPVA 4O11A 4A21A 4JQAA 3RK8A 4ACZA 2DSUA 2ACRA 4G38A 4R5EA 2E9LA 3A5FA 4HHLA 3RU6A 3W6LA 4TVUA 3CO8A 2XIQA 4NRSA 3PZOA 3OQ8A 3QQ0A 3XIMA 2YCLB 3MDUA 1WBJA 2VX4A 4HU4A 4H9UA 3NXFA 3W86A 3NTYA 2PB1A 4OGZA 3IGUA 2JIEA 3UWUA 4YPJA 1H5VA 3HG3A 3SRHA 1ICQA 4RPQA 7XIMA 3GHTA 4L4OA 2NLYA 4FXRA 2WW5A 5HJLA 3W01A 2BGSA 2RGMA 3FDGA 4XZBA 1E40A 2P8BA 1R2TA 5FEZA 4JN6A 2AQOA 4AEFA 2PGEA 1M5WA 1RPKA 1WDSA 3H4XA 2B7QA 4YL2A 1XDMA 1KKRA 2YYUA 1KFJA 2D73A 1BGGA 3VA8A 3PPHA 1PAMA 3CB8A 2Q02A 2PLCA 1W56A 2JEQA 2PDBA 1GOKA 2J9ZA 2FZ9A 4EAMA 5AC4A 1E6RA 1Q5MA 3VABA 3BLKA 1J10A 3VC5A 3UR8A 2BHYA 1LQ0A 4FIQA 3CHDA 1YTKA 3AIRA 4WGXA 1G01A 2VQTA 1HKWA 3MMBB 4PCTA 2QCDB 2VCCA 1GVSA 4QGCA 1VFOA 3GIPA 3MZ2A 3UFYA 4ACZB 1FDZA 4K37A 1ME7A 1XC6A 3VNKA 1JAEA 1K6AA 5A6LA 1UZDA 1GEHA 3M9YA 2X30A 4GUIA 5AC7A 2ZOXA 4YTRA 2HTMA 1OX6A 2Z1XA 1XGEA 3IUDA 5CGMA 3EWWA 3TNOA 4JEJA 3LCXA 1Q4NX 4RR4A 1W3TA 4HA0A 4AWSA 2GSJA 5J8LA 2I9UA 2WHKA 1X7IA 3T08A 5A8QA 2J8TA 2QF7A 3EKGA 1M9HA 4HSNA 4LALA 2VO5A 3WLKX 4ADTA 4B2DA 3CEPA 1MQPA 5I3DA 2NX3A 3LNPA 2QAFA 2IQTA 3VKRA 3DHFA 3LLFA 1X39A 2WQDA 3QLLA 2UV8G 3V36A 3WQPA 3VILA 4GIEA 3UCDA 1WCGA 2PE4A 1OYAA 1S5TA 4DZIA 3CZKA 1K1DA 3ITXA 4IGSA 1XLIA 2EGZA 3P8IA 3DHPA 3IAQA 4NXKA 5AHFA 3E96A 3W85A 3WH7A 4Q4RA 9XIAA 3WQCA 4KETA 4ZO8A 3NL2A 3SGUA 4OUEA 3BLEA 2XVKA 2FPTA 4MZYA 1XYAA 1KR1A 4IHCA 1F07A 2PC4A 4FLOA 4TR9A 1DJXA 2CPUA 3WUFA 2ZZ7A 1AJ2A 2QUMA 2F8QA 1US0A 1EHAA 1HJXA 2A3HA 1FA2A 1FHVA 3MI3A 4IP7A 2GSHA 1XWYA 5A6JA 1JPHA 3TFXA 5T9CE 4MKNA 3TTSA 1YEYA 4W5ZA 1NTHA 1PJ9A 1KBIA 3STEA 3LPFA 4GHRA 3VDHA 3VM5A 3H7VA 1EH9A 3VX1A 4BI6A 1A3XA 2YFNA 1T8XA 5RUBA 3D46A 3HJZA 4LUTA 2A0NA 4WD0A 3ZLGA 2CLMA 4KWSA 4WK9A 4CCEA 1PPIA 6ENLA 2VUNA 3M0ZA 2HSAA 1I0DA 3SSZA 3VCNA 1S38A 2HWGA 4MVAA 2PC8A 4NJGA 3NQ7A 3CH0A 1QI2A 3W1LA 3W74A 2QIIA 3MHUA 3CL6A 1IXPA 2DUZA 2WVSA 2I5IA 3N11A 2EEXA 1WPCA 4AXKA 3OR1A 4MNKA 3C0JA 1FWDC 1QNPA 3GYCA 5CSYA 3NOEA 4GC4A 3G18A 4F0RA 1GYMA 2ISFA 4MIMA 4Y9PA 3SUVA 4PZVA 3W83A 1NWTA 1C3FA 3GR8A 3MU7A 4NNBA 1IIGA 3FKRA 3QKZA 1VF8A 1JULA 5FL1A 4W88A 3O7UA 4J2PA 4NIRA 2O7SA 3BG9A 2H9AA 4BQ5A 6XIAA 1US3A 2DZTA 3IWPA 4JQ4A 1E9IA 1B4KA 3FN9A 1JDDA 1ZY9A 1PWMA 4AAJA 4BCEA 5HJYA 3OU8A 2QPXA 1GONA 3TNBA 4JKLA 4PSRA 1M04A 4GIYA 5I00A 8A3HA 4JL1A 2NVAA 3CHCA 4H9VA 3EBVA 2J7CA 2FB3A 3R5EA 4UFMA 3LZ3A 4K8HA 3LI0A 1RH9A 4KRZA 3S46A 3THUA 4JQ2A 1QI5A 2BGNE 4QCFA 3BSHA 4BWLC 2H90A 1C93A 4OV9A 1G9HA 3VIIA 1A53A 1GKRA 2HBXA 2ZZ5A 4YVXA 2GJRA 4YS1A 4G7FA 2XSJA 4LPCA 1FUYA 3KRSA 2W5FA 3P82A 2ZZ2A 1H2JA 1PIIA 4IX0A 4UCFA 4JD4A 1DWIM 4AIOA 1F74A 4AZGA 2V3FA 3OR1B 2GOKA 4ILSA 4XO7A 3QYSA 2PDLA 4C1NA 2OYKA 2PODA 1VCFA 3IUIA 4ZR8A 3R13A 2A3EA 3RRXA 2D1ZA 1BWLA 1LWJA 3QGAC 4NILA 2JKPA 1KQYA 3AHZA 3H2MA 1REQA 3TOPA 3ITLA 3RM9A 7REQB 2H8ZA 3IPWA 1JCMP 2NQLA 4P7QA 2V82A 3UNDA 1LWIA 3OZMA 5A8GA 3UA4A 1PKLA 2OZTA 1VBUA 2WQPA 2I14A 3BANA 4TVCA 4AFYA 4H00A 5FOOA 3VGGA 1OJXA 3KZSA 1TMQA 4P61A 4AMAA 3G8EA 4Y9OA 4AWTA 4TTGA 2P88A 1HKVA 4JKMA 1UZHA 3CAKA 5F1UA 3G24A 3BICA 1TO3A 3EX1A 4Q8VA 1XLBA 3B05A 2OZ8A 1O5RA 2X0SA 3GTFA 5CEWA 4WHBA 3A4XA 4J27A 1TWIA 2HQAA 3KCOA 3TVAA 2GUYA 4ZSUA 2DDXA 3EOLA 2ZUMA 2YB1A 1YNQA 3DHDA 3WY1A 4C7DA 2E6YA 4PL1A 1EJWC 3WEOA 5C6MA 4UTMA 1DXEA 1CCWB 1FH8A 4A29A 3IJQA 1FVPA 5C8BB 4ZB5A 3TH6A 4KCVA 3N3TA 3TR2A 1YTEA 4H04A 5D38A 1C8VA 1PUDA 3FNDA 1M1BA 1UIOA 2XYLA 2CZVA 3KOWA 1E6XM 4L6OA 2J88A 3LHZA 3ID7A 3FS2A 5TAOA 4FK9A 3AHTA 3WLIA 4M1BA 2EPNA 3TSBA 3CQJA 1XIBA 5FEPA 2VQUA 2O4QA 1QR7A 1JVNA 2JBMA 4E4PA 4OJYA 2J25A 7GEPA 3W7IA 4N9BA 1GZGA 4JPGA 3EB2A 3KOZA 4L1XA 1J9YA 4O17A 4IQJA 3DAQA 5C7VA 1DJQA 1NWUA 2PP3A 4HA1A 1YW1A 1H41A 2O4MA 3ARXA 2BASA 4RZ5A 2VDIA 1F7BA 3LTYA 3W7PA 1W54A 3IVTA 4JHOA 3YPIA 1KXTA 1VPYA 1ADSA 4Y90A 1JCNA 1Y65A 4LVFA 1W37A 3LHWA 2OFJA 1Z41A 2WANA 4E8CA 1BGAA 4F48A 1XHGA 4W7WA 3VOGA 1ISXA 1JNDA 3UYCA 1TV5A 4NF7A 1JQXA 3CZEA 3D6NA 1J2WA 4E3TA 1TR1A 3M5VA 3IAPA 3AU6A 4UXDA 3RCMA 4O4WA 4D9PA 4DM1A 1TTIA 1KRAC 4WXZA 5SWUA 2QVNA 3ZT5A 2D20A 5E0KA 1IF2A 1AL7A 4PCSA 5MKGA 4F66A 1UA7A 3WQ5A 2QUTA 3VNYA 2VEGA 3NSXA 5A6SA 4QJ3B 2VL4A 1FHLA 4LV9A 3WFAA 3TMLA 1CGWA 5FIPA 1EDQA 4Y9NA 2FZ8A 1CT5A 1GOWA 1GEQA 4HP5A 1BWVA 3W72A 4PMYA 2WCSA 4QR6A 4UZSA 1LBMA 4BQ4A 3QH2A 3M44A 3S1WA 3TX9A 3CEUA 1SZRA 3W2NA 2G95A 5C70A 3CMJA 1KM0A 4HOWA 5AVNA 2ZZ3A 1D3HA 1JDCA 1XD1A 3P61A 1F4HA 1E4MM 1W6TA 4FXFA 3DC8A 4W87A 2JALA 3BURA 2GJNA 4RK8A 4MJZA 2C13A 1EFZA 3PC0A 3UR5A 3BJTA 3FSTA 3CMFA 2V5LA 4FO4A 1DE5A 4UCGA 1UKOA 4PMQA 4LYKA 5M1TA 3LLDA 3CZGA 2QMKA 1E9LA 4I9JA 2VT0A 2YXXA 2OB3A 2DEPA 4MWAD 1RD5A 1Q3NA 4HZMA 3TZFA 1W5QA 1FDYA 4OIFA 3B0UX 1B54A 4POCA 2FPVA 3EKZA 4L4MA 4NYUA 1C90A 1F3TA 3BOXA 1PX4A 2HVNA 5HK4A 4KEVA 5FJUA 5KMYA 4PC8A 4JNYA 1I1XA 1VPXA 3TR9A 1ENUA 3LTSA 4P8XA 3NXLA 1V0MA 3CO4A 3NQEA 3CWOX 2ACQA 1B3YA 2BXZA 1SFJA 1XW8A 1E9YB 4MLRA 3CUZA 2Y62A 1OFAA 1GKQA 1EJRC 3ISIX 1CX9A 2V63A 1ITQA 4V28A 3MM9B 4O14A 5LKYA 3VIFA 1C29A 1NOFA 4B9ZA 3WNNA 3TYBA 2IPFA 3JZUA 1F73A 2PDPA 3OHMB 1VFTA 1CENA 3L2LA 1Q7ZA 3V3WA 3WLLA 3RLHA 3WUEA 1OSEA 3E2RA 2BMBA 5HWNA 4MNJA 2GVYA 3TYEA 4MJ2A 4HB7A 4I9AA 4MZ1A 3H12A 2YA2A 4PB5A 4ML4A 2R8WA 4ADSA 1EP2A 1I2OA 2A3BA 1IXQA 4IMFA 3VDCA 2QW5A 1HN1A 3LRLA 1R9XA 4QS6A 1P6WA 1IWPA 1TE6A 4X61A 2FQIA 4KFPA 1XINA 3BCFA 1JD7A 1M41A 3U57A 2PPGA 5AHNA 3UR7A 1HKKA 3PUOA 3VOFA 4FNPA 3TAOA 4BI7A 1C92A 4FP1A 4H8NA 5CQ1A 4Q4KA 5FF2A 4GVGA 5HNRA 3MP4A 4RV8A 2QPUA 4XZ9A 3E2SA 4AEEA 3CT2A 4R33A 3APYA 3P0WA 1L9WA 2WC4A 1JUEA 3UETA 1FWEC 4QJ4B 1FBAA 2ABAA 3PJUA 4YWSA 3LG3A 1WUEA 4REQB 5A8MA 4YN5A 4L6HA 1W1A1 1TPC1 3BMWA 5I7GA 1ZB5A 1NIUA 3H2FA 1JJKA 3VO0A 5DLCA 3R79A 4QE5A 4DBDA 4HTRA 4RCXA 3LRKA 1M3UA 4B90A 5I02A 1CIUA 1E1EA 4RNFA 3CASA 5JMUA 3ALFA 3WQGA 1PDYA 1GOOA 2VWSA 3UZXA 1Q7QA 4MDPA 3UWZA 5BMXA 3S1UA 2VR5A 3SRFA 2WWDA 1GHRA 1KNWA 1BF6A 1LT8A 5TQLA 1SJCA 4Q3MA 3QXBA 3OYXA 1NM9A 5DBTA 1GOMA 3MCNA 4PMJA 4A05A 4Z1DA 1R3RA 3M0MA 4QDPA 3TN5A 3ZS4A 3Q94A 2VELA 1O7AA 1G94A 1X6NA 3IGHX 4OU1A 2QT3A 4NJJA 1ZBKA 3F4DA 5A69A 1TQXA 1XX1A 2QKFA 3VD5A 1GTEA 3R0DA 1JXKA 3W24A 4A2RA 4LCQA 1Q6EA 2X1TA 2EQDA 4Q6JA 2UWFA 4G1NA 4NZCA 4LX4A 3FOKA 3B8DA 1HIZA 2YX0A 5D2VA 3ALGA 2QNEA 2V5BA 2CXGA 4QJ5B 3WK0A 1R3SA 3W7HA 3KE0A 1UMLA 2XFWA 1XSIA 3GW3A 3QF0A 4QG8A 1OABA 3SN1A 5D4YA 4PE8A 2QPSA 2Z24A 1MI3A 1TWSA 1ODZA 5XINA 2XVLA 2QUVA 1GJWA 4CU6A 1RLCL 3GE7A 5FEXA 2DZAA 1B3ZA 3KS5A 1DIEA 2IPGA 3LPGA 4G2DA 4H7VA 2FH8A 3BLOA 5TD4A 3STPA 1TJ2A 1OK6A 1IT8A 1L6FA 3GK0A 4XSLA 3C2VA 4C6FA 1WDDA 4YHEA 1QW8A 4IISA 1G7VA 3NCOA 5A3HA 1QNRA 2I7GA 4P7NA 1EPXA 2C16A 3UWQA 4R85A 3UR2A 5LXEA 4Q8TA 3FYOA 4O54A 1XRTA 1SVDA 4FX6M 3PUGA 3JR2A 1KC7A 4GY0A 2DORA 1TZZA 2PUZA 4A8LA 3GC5A 1N8IA 3AISA 2BBFA 4XZHA 5EY5A 1AD4A 4WUIA 3COTA 1FP8A 1XF0A 3ITGA 3ITYA 4O16A 4JOMA 4QSHA 3CM4A 3UY7A 3P62A 1QHOA 3N2CA 1JCLA 1H63A 3QR1A 4M6UA 3LHYA 4JHMA 4Q4SA 1OFEA 2PU1A 2P76A 1RQEA 1Q6QA 3N73A 1E73M 2F2HA 3W2LA 1F5ZA 3L7RA 2IMRA 1QW9A 3S6OA 1ZJ9A 1SZGA 1DJWA 5KINA 2GZXA 5ABGA 2OTDA 3NO1A 1E51A 1MMFA 4ZOEA 2VX5A 2INFA 4AYGA 1E55A 4QROA 3RX3A 3DX5A 3IJ9A 1LRTA 4E6MA 3MYPA 3W7RA 4BF9A 4KEUA 1DP0A 3VNZA 2OQYA 1BRLA 1WO2A 5G5IA 1OEPA 1TCMA 2OKTA 4LV4A 2IPJA 2ZTKA 2ZA1A 2QJIA 3GZAA 2OX1A 3B40A 1R3WA 1KGXA 1RPXA 1VIZA 1R5YA 3MM5B 1WP6A 1L6SA 3V0UA 2YDRA 4I9TA 3E9AA 1GYNA 1RA5A 4DXXA 1UR4A 2Z7GA 1XBXA 1OGBA 1VBGA 1MDRA 3FVMA 2YDQA 2OSWA 1DIDA 3W1TA 4IGNA 1H09A 2OSYA 2YZ5A 2VURA 3TUUA 2Z26A 1G4PA 4A8RA 3F4CA 1E5JA 1JNEA 2WSPA 4GJ1A 4GI6A 1SPQA 1R87A 5ECVA 3B0JA 4I7WA 4P2VA 2W62A 5A2AA 3VOJA 1JZ2A 1V3KA 3A13A 1XLDA 2B31A 2FLIA 4PBFA 3MBFA 2GL5A 5HAOA 1DHKA 1JF6A 3H2NA 3GKAA 2B4GA 5KZMA 2ACUA 4Q8QA 3W87A 3ARQA 2X40A 3TMQA 2DZPA 3REQB 1WKYA 3RUBL 3T0BA 3LGDA 1V77A 4PTWA 2OLSA 5KZDA 5G4HC 4PL2A 5I3GA 4EPEC 1BRLB 2BLEA 1NVMA 5F1VA 3TTOA 4GCAA 2OEKA 4GI9A 4N0RA 5CGTA 4J40A 4K7VA 3URQA 1E1FA 2H6RA 2RKXA 1UMYA 4PTVA 4XIMA 3RM4A 4IL0A 3WQ4A 1ZLPA 2HK1A 1ML1A 2WKGA 1XPYA 3CLWA 3TW9A 1ZL1A 1EB3A 3VKTA 3SRDA 4GXMA 1T8QA 4OQVA 4ZB2A 1AVAA 3NUKA 3NJ3A 2J62A 5EMKA 4LUYA 2XJ7A 2E8ZA 3PM6A 5CZTA 1LWHA 3UWYA 3CHFA 1JGMA 3HM7A 4US5D 2NV2A 3WBYA 2BX7A 2QUNA 3BZJA 5DO8A 2R6OA 3H21A 4R88A 2Y7DA 4AZIA 5BRQA 1EIXA 5IDZA 3PNZA 1DV7A 4D6CA 1KXVA 3BMVA 4LYQA 5GEPA 2UBPC 3ZJKA 5I5RA 2NZLA 3CUHA 1RJQA 3AZSA 3O1NA 2W27A 2WHJA 2WZIA 1JG9A 1FX6A 1XIDA 2VUYA 3DG7A 2TRSA 2VDHA 3VLXA 4DJFC 1D2KA 4LYPA 1VFLA 2WSKA 2A3LA 3WF0A 3SAZA 3WMSA 4Q8NA 4ZE4A 3NQFA 1ITXA 1EWDA 4FHAA 3NFUA 3DERA 3TP4A 8TIMA 2ZZ6A 3HV8A 1QPOA 4W5UA 3TTQA 4B91A 2ACSA 1NAL1 3THCA 2VKZG 1W5NA 3CU2A 3B3DA 4ZL1A 2ZE0A 4JN7A 2B7PA 1X97A 3CYJA 5FKYA 1UR8A 4EXQA 2X1RA 3WFZA 3R10A 3U4AA 3EKLA 1QDSA 4K6AA 4URIA 3MANA 3G1YA 3BJFA 3R0UA 2Y5JA 1ADOA 1I60A 1TUXA 1JZ6A 4AOPA 3AIBA 3VCCA 2G41A 5CJNA 3EDKA 4DJDD 3SCUA 2X16A 1U5HA 1PEZA 2ISWA 3V18A 1IYXA 4IXHA 4D6GA 3MM7B 4O50A 4NZ5A 2BVYA 5BRPA 4GCXA 3RF9A 4ZXOA 3JS3A 1ISZA 3KW3A 4JYDA 2FKPA 1EJXC 5HMEA 1J0YA 1HUVA 4QISA 2YBUA 1YE6A 3VIPA 3NQCA 3BC9A 3W7CA 3PFRA 2CXEA 3SBFA 1ZHAA 1ZCCA 2XH4A 1HVQA 1BD0A 1P6BA 2DSVA 4GINA 4RLIA 5DMNA 5JH1A 3VNLA 2VEFA 2ZWYA 3C8FA 3Q58A 1K9EA 1P0BA 2DW7A 3NR0A 3ZLFA 4IXXA 4M82A 4ZFMA 1RSCA 3DIPA 3SCVA 4GFSA 1HQTA 4DVOA 1EJVC 3MV01 4AVFA 5BU6A 1NP2A 3N17A 4ZO7A 4PULA 1WAWA 4EX4A 5ABHA 3AUJA 1EYWA 2ISSA 3NAVA 4B3KA 4OUIA 4L80A 1EF3A 2MANA 3PULA 4CNSA 4GYJA 3MJYA 4NHVA 2WNWA 5LNVA 3MCMA 1K8ZA 4RPPA 2OT0A 1VEMA 2HK0A 5C9WA 1G5AA 2X1IA 1Y5VA 3WDHA 2NXGA 1KXQA 3GNPA 4IFOA 3KDOA 3Q2DA 1W5MA 3B97A 3DBPA 4ZZ9A 2V4JA 1B3XA 2VVNA 4D2JA 3LA4A 4HPNA 4M6PA 4BJHA 3IJDA 1YADA 2YPIA 2E6AA 5FESA 4DWDA 2QF8A 4UB9A 3UEQA 3IVUA 3OVQA 1TB3A 4KT2A 4QE1A 4AY8A 3D5HA 3MBDA 5FD0A 1S3HA 1EX1A 1PX8A 4F2TA 2Z1WA 2AAAA 3IIZA 3HN3A 4QQUA 3AHXA 2QV5A 5C7HA 4MSSA 2NX9A 5C2XA 3Q45A 4DRSA 3C4UA 4DZ5A 4UNKA 1QNSA 4JTFA 2AAMA 5HJXA 3W1RA 3ZVHA 3OOQA 3QVQA 1Q7MA 1SO6A 2F9RA 2EPLX 2BHZA 3DENA 3PHAA 2BVTA 5TIMA 1JDFA 3UPBA 3AWOA 3UG4A 4JZ5A 4IPIA 5EBUA 4Z1CA 4G7EA 6PTDA 2G50A 2JF7A 2QDGA 5IRPA 1V79A 5DEZA 2QAPA 3M0IA 2PWGA 3GNOA 2PU0A 4GQGA 1TMLA 3LCHA 4TMBA 5EFFA 3PVFA 3A9BA 1ME8A 2Z28A 4CU7A 4NI3A 1OF6A 2W3ZA 3FFSA 1TJ0A 3LBOA 3EB4A 3VZYA 3R0KA 3HO8A 4ENLA 5CLWA 4J9JA 3APTA 4ICNA 1WXYA 4ES4A 2ATSA 3GR7A 1UC4A 3ZR5A 4JYFA 4G9PA 5FJOA 3I6TA 1ZAIA 1JDAA 3W7LA 1LORA 5LGXA 5CPTA 4HA4A 3EA1A 1LQ2A 3S8HA 1FCBA 1G69A 3THQA 1Q8JA 4K36A 3ZO9A 3MUAA 1KV8A 3QM3A 4XTIA 4IIGA 4O1FA 5DY3A 3G77A 3KWXA 1L0PA 4XKYB 3M7WA 3MMCB 3OP2A 3MUIA 1T6MA 3PPCA 3M1ZA 4GZJA 5E6YA 3HV9A 2Y7FA 2WHLA 7ENLA 1UW9A 2E9MA 2FDSA 2TYSA 2QV4A 3ABOA 4HPHA 4S3BA 1E0XA 2PWFA 3G1XA 4R7WA 3KS6A 4DUOA 3FYYA 1L2UA 2YCEA 1OVDA 1XCFA 2GVEA 3H24A 3MSGA 3L5AA 4QX4A 4LBSA 2AKZA 4WR3A 3ZVHB 3TCSA 4QLLA 3N13A 4RE3A 1J79A 2GPTA 1SZFA 5I3JA 3VGDA 3AZRA 4PMOA 5F4SA 4E2OA 4G7EB 2V30A 1RXOB 1H62A 3V0SA 1OC7A 3MMAB 3P74A 4HNLA 1J12A 2ZADA 3S5OA 2NQHA 1DWFM 2POZA 4WGHA 4HJWA 3E49A 2GGJA 3CZ8A 3UWVA 4KF1A 1YNPA 4XAZA 2XGIA 1N82A 3A64A 1EC9A 4WXYA 3NPXA 2VC7A 3QTGA 3UF9A 1E6ZA 1Q6GA 1H1YA 3K4WA 2VCBA 3EYPA 2QJGA 3U2EA 1KV5A 3L2IA 3W7DA 3S5YA 3BLPX 3QY8A 4B5UA 3CTLA 1BVZA 1GNXA 1QNQA 4WX2A 2D24A 1KBJA 1JPIA 3AXIA 2FTWA 4CD4A 4LAZA 3LCLA 3W1AA 4J3VA 4JS3A 5BRBA 2XVPA 4GNVA 4N42A 1ISWA 3SCRA 3HU7A 3A4WA 3PBGA 2UY3A 5B80A 1R9YA 5G1MA 3DDMA 1L2QA 3M64A 3M7SA 4GC3A 1EUNA 1GOIA 4DWSD 4RW5A 3GYEA 1PKMA 3GG0A 3AXKA 3ABZA 3OQEA 5CBBA 5H6HA 1Y0EA 1KW1A 5I3IA 3FA3A 2F6UA 4PMZA 4PSPA 4EAYA 3Q65A 1FDJA 2PTDA 4HKPA 1PCKA 2EBNA 2ZZ1A 2OLAA 3A5VA 3WNPA 4NZ3A 4GZEA 2PSNA 3A24A 3AIWA 5DCEA 1KTBA 1UPMB 4A8IA 1FP9A 4BHYA 2PP1A 4XQ6A 3UPWA 5FACA 3ARPA 5FJJA 2EXOA 4CD5A 3NNTA 3O0FA 3KX6A 4FF7A 1YDVA 3H7UA 3GS6A 3ENLA 1VFUA 4DO7A 1I0BA 1OT2A 4IPNB 1OADA 5TBOA 3C52A 1M6JA 5JUVA 3C3NA 4ICCX 5C2GA 4AX6A 2ZX9A 2EF9A 4WEVX 4LRTA 1PV8A 2Y8VA 2ISVA 2RUSA 3UG5A 2Z25A 3SCSA 4J3WA 3U5UA 3WLOA 1V03A 4AISA 4DJEC 2GDQA 1CLVA 4ZA0A 3TQVA 3PZ9A 2DGAA 2CZ5A 4DN1A 2DJLA 2FMNA 3XINA 3CNYA 4LUJA 3B9NA 5B7ZA 3F4NA 3VDGA 2O9OA 5A6BD 2GQ9A 5E9XA 2YA0A 1JRBA 3SW6A 4GI8A 5D9NA 2ZUUA 1CBGA 4UIOA 3EZ4A 2OX4A 1CXLA 2D0HA 3QZ6A 4GG9A 3W26A 4LCRA 2BNJA 3FAWA 4FALA 4GUHA 4FS9A 4QS5A 2DH2A 3L4TA 3W00A 4GIAA 1FFRA 4UQDA 3V35A 4PUWA 3USBA 1FCVA 3C0QA 3BCJA 2QCEA 3S1GA 3UW6A 4TMCA 2V81A 3LENA 1VC4A 3CIVA 1JUBA 3L68A 3QJAA 2DV0A 4AMCA 3VOHA 2HRWA 4B4HA 3L12A 4NAEA 2Y1HA 2O55A 4Y8EA 2QGHA 1GQKA 2ZUSA 3G1VA 3E5PA 1W17A 2C18A 2DSWA 2CWNA 3EMQA 3QYQA 4JTQA 2OVLA 2HPIA 1PCWA 2J66A 4B92A 2ON3A 4DB7A 2A85A 3KBWA 4AVNA 3LQGA 4LNYA 3LU2A 1K7EA 3VDBA 2WYSA 5FF3A 1U5VA 4J28A 2FFIA 1C9WA 4P7LA 3MV11 3MWCA 3UPMA 3I3EA 2OCZA 3SCOA 3N6JA 3W7JA 1MYRA 2RFGA 4JX4A 3UYIA 3TN4A 3M0JA 1Q85A 4HNOA 2W61A 4JL2A 1P48A 2BOEX 1RV8A 3PB0A 3UWEA 5LNUA 9XIMA 5TNVA 3WD2A 1WXZA 2JE8A 2R1KA 1KFKA 3SCNA 3HMCA 6A3HA 4OBTA 4KCWA 1VEOA 2GWGA 3DGBA 4DHGA 4B5WA 4EANA 4AZ7A 2IXUA 2VYOA 5FF0A 3NL5A 1UP0A 4ZQRA 3N6HA 3OLIA 5C9ZA 3MP3A 1IEWA 4RZ4A 3QPEA 1AJ0A 3WUGA 4UTTC 5CPNA 2OXNA 3VD9A 4CN1A 1LOSA 4JAWA 3SSJA 2ZX5A 3ZT7A 3Q67A 3AO0A 1RP8A 3EX3A 4FI4A 4KWVA 5CC6A 2X1SA 1LOLA 1QRQA 1MEWA 3W6MA 3AIQA 5LSMA 4MM1A 3N9KA 2WZMA 4YTTA 1S39A 1UR3M 3VKAA 3LUTA 1T96A 4G56A 4DXKA 1UD8A 4CQ8A 4I5RA 2PDWA 1U33A 1PHQA 3KFTA 3EDEA 4LSBA 3BE7A 5CPSA 3CJPA 4Z1BA 5I3HA 1QK2A 2GLKA 1XYBA 5A2BA 4HIBA 4AD0A 1NFGA 3S42A 2W66A 4MB3A 4KWUA 3M0HA 4UQ9A 1DXFA 5FSEC 1FOBA 1KR0A 2XIMA 1S5NA 3L5MA 3QHMA 2FB2A 2R94A 2QCCA 4FOKA 3KL0A 2E3ZA 1RZMA 4DYKA 3RDKA 1A5KC 1XH0A 1N8WA 4HNTA 1NQ6A 4TUFA 3WMBA 1CTNA 1XIEA 3MM8B 1NY1A 1D3CA 3HPSA 2CHNA 4TQTA 1MXGA 3A6OA 3B0MA 1DJHA 5H8MA 2XGBA 2DT2A 2A21A 3B8SA 1UUOA 4O12A 5HPCA 1W1TA 3WLSA 3ATYA 1IWBA 4XAFA 1PIGA 3WDIA 1OFOA 3CL8A 3V4BA 3N14A 3OVRA 5EA9A 1W5PA 5BU9A 4HGXA 1RBLA 5I09A 4IUGA 2VGIA 3WF2A 4QIUA 2G3IA 4MF4A 4PB3A 1OIMA 5A94A 1UKPA 2X1UA 1KWKA 4OE7A 1YYAA 3MW7A 2VCAA 5IDIA 3E02A 3UXLA 1TTPA 3SCPA 2I5QA 3BXWA 7TAAA 1LROA 1KTCA 4HSOA 3BLIA 2BTMA 3WQDA 4AZCA 4WLCA 1DJGA 1DWGM 1E70M 2CW6A 1QWKA 4JQ1A 3GBEA 2FVKA 3PAOA 3G6LA 5CC3A 3LI1A 3KRZA 1D7KA 1FQ0A 2ZX7A 2G3NA 4H6KA 1JR1A 4KBXA 1UA3A 4LEQA 2VRQA 4F3HA 4N9EA 5FEWA 2L5HA 3I6RA 4R34A 2F7FA 2NUXA 1JYVA 4X3ZA 1UCWA 3NA8A 3W28A 3UJEA 4Q6XA 3Q4DA 4C1LA 4N4QA 4ZCWA 5FAJA 1A5UA 3BJSA 1M7OA 4AEOA 3U48A 4LAKA 2YB4A 1CLXA 2YFOA 1OFDA 4JCMA 2WBKA 4ATDA 2CERA 3CYVA 1VRXA 4H8VA 1HJWA 5LA0A 4ZEPA 3L67A 1OHLA 2Q8LA 3G1SA 1T5AA 1YNYA 3N19B 3ES7A 1XBYA 4UQBA 4WIWA 1X8FA 1WZKA 4XK2A 2E8YA 4E2BA 1BTCA 2KX9A 1BXBA 4QG6A 3M41A 2Y6ZA 3VOCA 4WF7A 1HZYA 5D9OA 4JFTA 2E28A 1EQPA 2YR1A 3MM6A 2ZKMX 1IGWA 3ARTA 2CLOA 3OYZA 3UD6A 3ZM8A 2WM0A 5K9XA 1B3OA 2PDCA 4OZOA 5JXQA 2GGHA 4H2CA 3IK2A 4XBSA 1QMLA 2E09A 1FWGC 1J0ZA 3ANUA 1ZP3A 3L4XA 3VVGA 4O15A 2HXUA 3RMEA 1R2SA 3DKLA 1ISYA 1S2CA 2JQXA 5HNTA 1IWAA 2PF8A 2IKIA 2AL2B 4Q7BA 3HMJG 4AU0A 3NQBA 4UUIA 5LNRA 1M7XA 4NI8A 2XN2A 4UR9A 3T4CA 3BAYA 3B4YA 2YXGA 1V6TA 4R53A 1LG2A 4E0CA 3URAA 1CPUA 4C6JA 3RM8A 4I6VA 2SFPA 1ALDA 4BA0A 1JFXA 1VLIA 3W84A 2P8CA 4C60A 5JBEA 4DO4A 1JYWA 2PDXA 4N6EA 3W2UA 3VGFA 5AVHA 1YBQA 3QTPA 2V3EA 5D2XA 3N29A 2ODOA 5LNSA 5HUOA 1AQFA 3A21A 1P43A 1QWGA 1AL8A 1T7LA 2JGYA 3LNMA 4PYSA 1HW6A 1I9CB 5CBIA 1H7PA 3FGCB 3VIKA 2YL9A 1JIBA 4LT9A 2HDJA 2BSLA 4YTUA 4DI8A 4TU1A 3PJXA 1WKFA 5CZSA 3OODA 1JYXA 1LZOA 2RDWA 4B5VA 3EXSA 3RO8A 4DO6A 4TX6A 2E67A 5FAGA 1RVGA 3QQ1A 2PS2A 4GJJA 1B3VA 4FPSA 3UG8A 1GORA 5I24A 1VLWA 1NDYA 1K8YA 1X6LA 7ODCA 1VJIA 4XUGA 1K6WA 3QKEA 4IIHA 4DF0A 2FYMA 1I75A 5D03A 4AIBA 4G39A 1XSKA 4CQ9A 2ZTJA 2A2IA 1O5XA 2J78A 1EJ7L 1G4TA 5JQ9A 2X05A 4FNRA 1KGWA 3O0KA 3R2GA 3O3RA 4GYKA 4IIDA 2X7VA 2ZBTA 4NL1A 4Q4PA 1YPXA 3GKFA 3PS7A 4AD2A 3A3HA 3HG4A 3PNUA 4Z0JA 2DVTA 1RBAA 2ZICA 3NM3A 4P8VA 3W1UA 3IK4A 1MFVA 3WMCA 1WA3A 4Y7EA 3SCWA 2YL6A 5D05A 2G3JA 5MHBA 3GHUA 1K9DA 2FPYA 3ARZA 3WMLA 3AAMA 1CNVA 3CPGA 1YBQB 2WVUA 4ZQPA 3W7MA 2YBVA 1EO5A 4S3FA 4ZOBA 5BWAA 1XYLA 2XH0A 3ITCA 3T2QA 1ESWA 3BAKA 1ZBVA 3WD4A 2PTXA 3PY2A 4W84A 1K02A 4XAGA 1DTNA 3ZIZA 2PI6A 4O52A 4XG1A 1LUCA 2J7BA 2WZEA 1P1XA 3SZ8A 1YPFA 4OKDA 4UTWA 2VI0A 2PAJA 1XLCA 3G5EA 3DFOA 4Z2KA 3WUBA 1TPH1 3ELFA 4UC5A 4H2HA 3MMUA 4HZ8A 2TPSA 3QEZA 3P0XA 3WEMA 2INEA 2X0HA 4FX8A 1TV4A 4TTUA 2CKSA 1QO2A 3G3MA 4YVPA 3LCIA 5HA7A 2QUUA 4Z1YA 1TWZA 3DESA 1MWOA 5D8ZA 4W8BA 1F2JA 3PJTA 1EJTC 5IFTA 1X8CA 1TYGA 4HZ6A 4KIEA 3UBPC 3N04A 4U31A 3B9OA 1ZBCA 2WMIA 3ZJ7A 2C14A 4S39A 4JX5A 3TE9A 1XICA 3W9ZA 1R7OA 4LU0A 3AMKA 1HVXA 2P3EA 1VH7A 3KDNA 1A5NC 3U0HA 4QLKA 1AUSL 1GQIA 2VFEA 3GAKA 4M3PA 4JIHA 2G8ZA 3LPOA 1IE7C 4F4RA 4O1BA 4PMRA 3OGVA 1OCJA 5D30A 3H4WA 3S5SA 3K4DA 4C5YA 1W1VA 3T42A 3LRMA 4QDMA 3B0NA 4AIEA 4ASTA 3T7VA 1ZJ8A 1NOUA 4DWSB 4QJ1A 1B57A 1P0NA 4KERA 4US6A 6XIMA 1UQZA 1LL7A 3M5XA 3KTSA 4F2BA 3K4AA 1L6WA 1VBJA 3LGEA 2Q09A 2WSQA 5HMSA 2V5JA 1DWJM 3N15A 1F9CA 5C5YA 4K2SA 1I2NA 1QI4A 2ANUA 2WV8A 2CLHA 3LHTA 1VYRA 3H23A 1U1HA 1AMKA 3V5OA 1KLZA 1UWIA 3P93A 1M01A 1XBZA 1EBGA 4TV6A 4LVBA 3U2OA 5KETA 1FFQA 4PA8A 4MB1A 3QZAA 4NAFA 3L2MA 4QG9A 4RJEA 2GJLA 4KWOA 3A4AA 5DMYA 1CGUA 3SJNA 4WCJA 2W92A 4IMAA 4U10A 4C6DA 3QOKA 1H7XA 4LCSA 2FHBA 1TR9A 2WMGA 2WMIB 3ZT6A 4WKFA 3BMXA 2DZUA 3M0LA 1KFCA 3I10A 3VIMA 4B5NA 4G6CA 1MDLA 4ZENA 2VFFA 2Y70A 1N8FA 5HATA 3VU2A 1MSSA 4GVHA 4ZODA 4AYSA 2OKOA 5U7SA 3OPSA 4MAZA 3GFZA 1DEDA 4QRNA 4PH6A 4JFUA 1R8LA 3S47A 2NXIA 1RR2A 3W75A 4UNLA 4WZHA 3R8HA 2QMJA 3P3BA 3N12A 5F4XA 1XJBA 4CNTA 1TV3A 2XIOA 3NDZA 1MRAA 3MJMA 3GBDA 2V2HA 3E0WA 2JIWA 3GXTA 1VB9A 3ZR6A 4LW7A 2PDQA 4IQDA 3PTMA 3MUCA 1RAKA 3HPXA 2AQWA 4HMNA 1WOAA 2VHLA 1ICPA 2X09A 4WQ6A 2VTFA 2ZDRA 4LC8A 3HFTA 4PCPA 4Y9AA 2J9XA 4G5DA 3TSMA 5ABTA 2ZVIA 1ZTVA 1CGYA 1J5TA 4LFYA 2B7OA 3FJLA 3GVGA 3RLUA 1CECA 1HO4A 4TXEA 3GDMA 3U8GA 1ADDA 1HL9A 3E0FA 2O92A 3GM8A 4NAFB 4CUCA 4A4AA 4GYPC 4ZSTA 3SQMA 2BZNA 3SO7A 9RUBA 3CUIA 4R3UA 2Z6JA 5A1AA 3A4JA 3WLNA 3WN6A 1FHDA 3ZLHA 4YXGA 3PZTA 3NPUA 1TIMA 4JTJA 1NARA 3W07A 2DP3A 1O5KA 4YYCA 5CJ5A 2WMJA 2Y7GA 5BW6A 5H91A 2PF0A 2C0AA 1BYBA 1DQWA 1W9PA 1QUMA 5AC8A 3PSWA 4GQRA 4GXWA 4Q4QA 1Z9AA 3TU9A 4HU8A 1WDWA 2E6DA 4Z17A 4S3AA 1JPDX 4S1FA 3ZXWA 1S5WA 3M4HA 1YXDA 4GX9A 2AKJA 3MC5A 1VBHA 3HQOA 3TN6A 3UESA 2NVDA 1LLZA 1LLOA 3P80A 3KWSA 1CLKA 1S5MA 4DPPA 2D2GA 1CZ1A 4LF2A 1O1HA 4LGXA 3PP7A 2WB5A 3VMPA 4MWAC 1A0CA 1MZHA 2NQZA 3ABXA 4IG2A 3N2TA 3JU2A 4WY0B 4AQLA 1VFFA 3G0XA 4MY8A 1KCLA 1XLMA 4O1EA 4U2ZA 3WQEA 1FHUA 4LNCA 3N34A 4IJCA 2NT1A 1Q6CA 4E5TA 1UR9A 3S9ZA 4ZGYA 2F6XA 3NGJA 1UJPA 4YMZA 1S46A 2EHHA 4QNWA 3PFMA 4MKSA 2VX7A 3BAWA 4PUJA 4IP4A 5DCDA 4AG0A 1AOPA 2QCHA 3G0SA 4CEXC 2GGGA 3CPRA 4DUXA 1BG4A 5AOUA 4UQEA 3UXIA 3QC3A 3WLRA 4LS0A 4EWJA 3WK3A 1NDVA 1PXGA 1UZ1A 3BV7A 3KUMA 3URNA 4PCNA 2IW0A 2V69A 3SURA 4DUWA 2O9TA 4MDOA 1IQ8A 3EDJA 2BVWA 3HGJA 4ML9A 3RGTA 4XB3A 1H49A 5HUPA 5JIWA 4GO8A 1A50A 4XD4A 5E70A 3C2RA 4XO6A 1H1NA 5DMLA 3EDDA 1PYMA 3MI6A 4MB5A 1CGVA 2WBGA 1Q6LA 3B04A 2I9EA 3SUUA 4FSAA 4O28A 2PWUA 2DZWA 3DEQA 3HPAA 2NWSA 4LBUA 4IG2B 3KLKA 1P7TA 1YLVA 1S2UA 2VEKA 3VPLA 3WK2A 1OX4A 1JFHA 5U4NA 3GDBA 4Q4OA 5F7UA 4QAIA 2W4XA 2WWCA 1TV2A 2BXVA 2R82A 4F79A 2ICSA 4M7SA 2O56A 2XZ7A 3JVAA 4IPPA 3GDRA 4TVDA 4DAFA 4BWLA 2FTYA 1PL9A 1FTXA 3CAQA 4GNJA 4F2UA 2J7HA 4IFKA 2A1YA 1E6QM 3MSYA 3TYAA 4H41A 4HA3A 2XN0A 1UIPA 4L9XA 2HE8A 4PTXA 2YW4A 2YXOA 2D0GA 1A5MC 1NWRA 1OX5A 4O8RA 1RY0A 1F4AA 3OBKA 3CBWA 4O18A 4M0XA 2VRJA 4YTSA 3EOUA 3RRAA 3VKPA 1A5CA 3OLDA 1FWJC 1VR6A 4NT0A 4XAYA 1I8JA 5DRIA 5JBDA 1A0EA 1I6NA 1Q6FA 1YXYA 3AZTA 2QXWA 1YDYA 4PUNA 3WJSA 4C7GA 1KCKA 1HFBA 1AODA 1QHZA 3PWIA 3T6CA 1H5YA 1W31A 4EWND 3W37A 4HYWA 3VKBA 2NQ9A 1P7TB 1KCXA 1LOQA 4GZIA 2XN1A 4YWIA 3H55A 1KD0A 4ZB0A 1V6UA 1XSJA 2G3MA 4Z08A 1R9ZA 2DQWA 4XIAA 4KCUA 3TTYA 2VP8A 2RAGA 4L4PA 4I3GA 4DBSA 4F0HA 1J4EA 3PUDA 8CGTA 4ERGA 1JI1A 1Y8BA 1RCQA 3LK6A 2O9PA 3A12A 2Z1VA 2GJXA 3UJ2A 3MMTA 2OWXA 1GJUA 3ZYZA 4MPQA 4IFKB 2HE5A 3IEBA 1Y5WA 2XIIA 4TX9A 5FCZA 1KLYA 1DE6A 2ZRUA 3QY7A 1SJDA 4FR1A 3R12A 3TFCA 4JFWA 3WEZA 1WUFA 2HS6A 2AMXA 4PRTA 4O57A 3T0CA 4C6KA 3N25A 2ESCA 3FY1A 4JTGA 4GH1A 3STCA 4L9YA 3NL6A 3QR3A 5AKQA 3N18A 1J5SA 1XRFA 1TELA 3C2EA 3NVTA 1DJYA 4YU1A 3EWYA 1HF6A 3HF3A 4C6BA 1IR2A 5EMUA 3CK5A 1P6CA 4AZBA 3O05A 3O2LA 3WQVA 4MKVA 4AWUA 3W7QA 3UWWA 3UZ5A 4MGGA 2OWCA 1ZAHA 3BW2A 4IIEA 5LIYX 3W0KA 3FLUA 4NYYA 1ZALA 4K68A 5CPOA 1MO0A 2Z7KA 3WK1A 2PDHA 2YZRA 4HVXA 3R58A 4N2YA 3BUVA 3IACA 1OY0A 2GDVA 3KVLA 5J5RA 4U3CA 4JTUA 2VZVA 3OIXA 3AIEA 3C86A 3TQ0A 3H70A 3L66A 2VFDA 4A22A 2GJXB 1MW3A 4JICA 4GUFA 3QMTA 3TWBA 3C3UA 3NQDA 4GQQA 1SGJA 4R9XA 2D0FA 2V9DA 2RDTA 2WCAA 3VE9A 4N9CA 1ZSXA 1Z7AA 4QE4A 4D6EA 4CD7A 1SO4A 3CGTA 4GWEA 4GBUA 2X0YA 4DI9A 3CV2A 3FAXA 3IVSA 1IEXA 5A6MA 3L4UA 3AOFA 1NELA 1ZJIA 1FCUA 3OGRA 5IBXC 1T41A 3UQNA 3FDKA 4LUTB 2GFTA 1F3XA 2A3AA 1XDLA 1XIFA 1R7AA 3CQHA 3MVTA 1QPQA 3WJYA 2BWGA 3EEGA 1PZ1A 4MAVA 1OCQA 2FIQA 1UQYA 4LUIA 1PTDA 1SW0A 5CLTA 1TA3A 4LQ1A 4UTKA 1NFPA 1LL6A 4IJBA 3KP1A 2VR2A 3WBAA 4D6FA 1OIFA 2F84A 1AZ2A 5CZKA 3DFQA 1UC5A 3K8LA 3GXNA 5KSWA 3TOYA 3OG3A 3RN6A 1VFHA 2ZQ0A 4X63A 2OOFA 5CKSA 2CYGA 5H8PA 1SQ7A 3CQIA 3HQPA 4GJIA 1PB0A 3W7OA 3Q37A 1GJPA 2FFCA 4Z1AA 4M6QA 2G0WA 4NG3A 4UOQA 3GD6A 2PDGA 5CSSA 3W73A 2Y0FA 3NO3A 3C2FA 5I6SA 4A35A 1EJSC 5D33A 2XH2A 4WJEA 5EYWA 3TEVA 3H53A 2H9AB 3MWAA 1W32A 1V5XA 4DZHA 2Z2AA 4E4UA 2GGIA 3KL5A 2DIEA 3GVRA 4AZ6A 1U83A 1EEXA 1JF5A 3GLCA 2QJNA 3QW3A 4B3ZA 2EPHA 1ICSA 5M3WA 4PRWA 3VZXA 3GG7A 1A47A 3WD3A 1CGTA 3CQ0A 1W3IA 4U5IA 2ALRA 1ITUA 1W3HA 3WX7A 2XGZA 2J47A 3W2KA 5BXTA 2XWEA 2X41A 3CS2A 5IM51 2IUZA 3C0SA 4S3EA 1LBFA 3GU2A 5E5CA 3FX4A 3B8TA 4AB4A 2XSJB 2UY2A 1W2VA 2AOSA 3BAJA 4YIWA 1W9VA 2PRMA 3T8LA 4JTTA 5K2ZA 2VFIA 1VCGA 2VX6A 3OHIA 4W89A 2ZC1A 4C1NB 2WPBA 3STGA 4E4FA 2Y4SA 4AHQA 4MADA 3CWHA 4PB4A 3POCA 3MDWA 1PKNA 1U30A 3UP8A 1F6PA 5AHLA 4ERIA 1OD0A 1I4NA 3GX9A 3MP5A 1REQB 2WSRA 2BODX 3RFAA 1Z3NA 4FXSA 4BI5A 2OO6A 2W9MA 1BFNA 5J5DA 1SSGA 1X98A 4C90A 1X38A 2CBVA 4IX2A 5BROA 2YKKA 4CNNA 4ERAA 1ONRA 1V6WA 2GDUA 2DIJA 2EPKX 1WB0A 3R8RA 1OM0A 6REQA 4J5NA 3VNJA 4S38A 4WVXA 3WCZA 3VCRA 1RALA 2HVMA 3RIKA 3I3DA 4QLJA 4FR6A 3E1F1 3L4YA 2QDHA 1OG0A 4ROPA 5I77A 3VKQA 4ZOCA 3DYMA 1V3LA 4DO5A 2H3BA 4LVDA 3DGRA 2WNNA 3VM0A 3ARSA 1M7JA 2WJEA 1POJA 4DJDC 1RVKA 1Z44A 1XFCA 1SFTA 1SMAA 2J75A 2B81A 2PP0A 4AX7A 1ODUA 1BLIA 3B06A 3FCPA 2C8NA 1E6SM 4GRSA 4UQAA 4M19A 3S9IA 1TTJA 1VHCA 1KM4A 4JGDA 3OW1A 1PZ0A 8RUCA 4FX7A 1XLLA 5FJRA 2YL5A 2DY3A 2VDGA 1UWUA 5E09A 3PBMA 1J0KA 2VC6A 1TZ9A 2ZUVA 3H2OA 1ZAJA 3AMCA 1G1YA 1WQ5A 4NJKA 1K77A 2EKGA 1X1NA 3V5CA 3PZVA 2OODA 1SW7A 5DT7A 3NIYA 3TONA 3PZMA 3GFYA 2C79A 3U5YA 1KO0A 1TX2A 1V3JA 4ZTXA 1TPDA 3CZLA 3DN5A 1FWWA 3NZGA 1H11A 4ZTYA 6REQB 1F76A 4HCDA 1EOMA 1DHPA 4GY1A 4M6VA 4LB3A 3QGKC 4C6QA 2WAGA 3SB0A 1KM6A 1BF2A 3LV6A 1WZLA 1MXSA 4GVIA 4TO8A 3SY5A 3KRBA 4H7ZA 1B3WA 3EWZA 5D09A 5AZ0A 4AUBA 1GKPA 3HOJA 2WO5A 3T9PA 4F8XA 1LLWA 1R86A 2I56A 4KCTA 4F0LA 3QFWA 1XLJA 5CJMA 1TQJA 1DKWA 2G37A 4D72A 1EC8A 4DBWA 3R1ZA 3TROA 1BYCA 5BXPA 2FGBA 2CZFA 1W9UA 1L8PA 1WZAA 2J7FA 4PTNA 5G2IA 1BXCA 5MKGB 3KBSA 1EEPA 1SO5A 3RMJA 2AQVA 2OMAA 3RO6A 1B5TA 1H51A 4W7UA 1AD1A 4GKLA 3SI9A 5D2TA 4E2DA 1SJAA 2CU0A 2CEQA 2ASHA 3G1AA 1BYDA 4IF2A 3U2ZA 3P5ZA 2PLJA 2OR2A 4XD5A 1JL8A 3URBA 4W7VA 3H8AA 4NP7A 3VAVA 4YYFA 3FXGA 1AW1A 1BKSA 5EGRA 5IHSA 3E2QA 4GLEA 2XU2A 3AXHA 2J79A 3TXVA 1LT7A 4LS2A 1A4MA 3BLDA 2WVVA 1WX0A 3EMCA 1UP2A 3BLFA 1W5OA 3RR4A 3AOPA 4HOXA 1SUXA 3R11A 4GUGA 3ZWSA 2WNQA 1J0JA 3WBEA 3WO8A 1OGGA 1NDZA 4GVFA 4GO9A 4RXGA 3VTRA 2Z27A 1HX0A 3G2GA 4Q7NA 4OECA 1QFEA 1SSDA 3IRSA 4V33A 2DH3A 3C56A 1JRCA 3HGOA 4AXNA 2GVLA 1M03A 5HWJA 4V1XA 1PS9A 1AQHA 3PUEA 2E40A 5GQBA 1Q45A 4S23A 4JFVA 3VINA 4UTLA 4RE4A 5IHRA 1UG6A 3BARA 2CIPA 3RPTA 1CXIA 2AMGA 2C0HA 1TZ7A 3SGGA 4QQ3A 4UTJA 2DZVA 2XINA 3LXCA 1MQRA 2R1LA 2CCRA 1QNVA 2PLMA 3WDJA 3VFLA 1TWWA 4D6IA 1BXNA 2Q71A 3TJLA 2VRKA 3P14A 4J1OA 1DJZA 1F3WA 1K70A 2HROA 4FNQA 5BOFA 1QXLA 1GTHA 3GTHA 3A47A 2EPOA 1B9BA 4O1DA 2PCQA 3DFSA 1IEQA 4H9MA 3GW0A 5C54A 3LMYA 1A5BA 5CSUA 2CLIA 2QLYA 4JNMA 5K4ZA 1UYQA 3P84A 4L4LA 4PN2A 4NJIA 3DU0A 4UMCA 2CLEA 4UFLA 2DSKA 4RXFA 4BEQA 1Q6DA 2BGQA 3GFXA 4C6MA 4LJ3A 2WVVB 1DJNA 3BH4A 1PWLA 4LS1A 1PTAA 3BL3A 1F8IA 2YSWA 3SCQA 4J3TA 2AGKA 3FHAA 4GXPA 3M43A 3OBEA 1JCXA 3AHVA 3R8GA 3C6CA 4R7OA 1A49A 1A3WA 3WDPP 5I2UA 3KXQA 3TZNA 1E72M 2VEPA 4JIRA 1JPMA 1E4NA 3D47A 3SFWA 2INZA 1SZNA 1FH9A 1H61A 1IV8A 3RNDA 1SZEA 4R9OA 3AS3A 3JW7A 3HGRA 3FSUA 1AH4A 1ZJBA 1XGDA 3A22A 4WDWA 2A6LA 3RR1A 5GNXA 3CIWA 3FA5A 1K03A 4C1KA 1RD6A 2JF6A 1E9ZB 5E1QA 4NASA 3AI0A 4M51A 2X7WA 5CZ0A 2RDUA 4PMDA 1UUQA 3HPZA 3ARUA 3MHFA 3AYRA 5FL0A 4Z2JA 3SGZA 3NO5A 3CAWA 1OC6A 4X0VA 4DWSC 3IJ6A 3T55A 3L9CA 3DYPA 4D1IA 2FDMA 2F38A 1PVNA 1ZP4A 4O0QA 4OWGA 3EXRA 2R1NA 5ENLA 3P7YA 3G1FA 3PPFA 3NPVA 5AC5A 5CSRA 4WDTA 4L65A 1JZ4A 3B0HA 4CVWA 4DPQA 2Y5EA 4K38A 1W1PA 3EX2A 4J2MA 3NURA 2ATMA 5D2WA 2YCJA 2QJJA 4ZQMA 4UFKA 3VKSA 2PBGA 5HULA 1EA0A 1FWRA 1TKKA 4IL2A 3WBWA 3CUJA 3O15A 2A7NA 2NT0A 2YA1A 3LV5A 3PTQA 1XG3A 1HGYA 3W70A 2ZXAA 4MG4A 4HPXA 1GPFA 1V08A 4A3YA 1ZNNA 3GXFA 1JDEA 2F2KA 3IARA 3UXAA 3MCOA 2TMDA 1X96A 2Q6ZA 1QOPA 3WL0A 3RITA 5GJNA 4H19A 3LHUA 4DJFA 1O94A 4GX8A 3UG3A 4EKJA 4UNIA 2DZXA 3A3XA 2CZDA 5ABFA 4PUMA 5HR7A 3EOEA 1Q8AA 2OPJA 1AFSA 3LSCA 2E68A 2PD5A 1QO5A 4Y2WA 1R2RA 3BV4A 3HQNA 4XWUA 3NQ6A 1EGMA 1PHWA 4J7RA 3MMBA 3UJRA 3EX4A 1EC7A 1W3JA 4RDWA 1OZQA 3SJ3A 3TTEA 2QCNA 2Z2UA 1KFBA 4KMQA 1TVPA 2CBUA 5T8GA 1UH2A 5M5DA 1K7FA 4UFJA 3BGGA 3SFKA 2BDQA 3H6OA 3V1HA 4D6JA 3E0VA 1ZUAX 2QEZA 4BR1A 2XFYA 3MO7A 1TPEA 3IIOA 1XH2A 1BSIA 3MMDA 3BG5A 3NSNA 2ZVRA 2E4TA 4C65A 4XD6A 2JFEX 1FKXA 3UZWA 2R14A 3GEOA 3VNDA 2Y7EA 4K7YA 3T07A 4D71A 1XLGA 1JPKA 3J7HA 3NVDA 4H4IA 2WM1A 3VGHA 4O1AA 1UWRA 2P50A 4FF5A 3TA6A 2IS7A 1XIHA 3FA4A 3RX4A 4Z42C 3DYOA 3FKKA 4NNAA 1HKJA 3AS1A 2HV5A 2W79A 3RPDA 1X1ZA 5K9CA 1GK8A 3FVDA 3DI0A 1TPFA 4HYRA 2C1HA 4K1GA 2XFRA 3HZ3A 4HT3A 4KEMA 1D8CA 1TWDA 5A6AA 5ABFB 2QIWA 4JIQA 4AVOA 3EGJA 4IM4A 4KIRA 3EWDA 1S5VA 3EWUA 4C7FA 3CV7A 1H0IA 4AW7A 3R43A 3MYOA 2EJAA 2P53A 3T2OA 1YX1A 1LF1A 5DF0A 1YPIA 3HA1A 1TV7A 1NF7A 1YIXA 4I8DA 4UTHA 1XLHA 3UA3A 4BK9A 3L23A 4FAMA 1BYAA 1EL3A 4YNGA 2P3ZA 3RHGA 2FZMA 3N4FA 4KWWA 1XD0A 2NUYA 4UR8A 3W1XA 5C9RA 2PTZA 3MB9A 5GNYA 3GZ3A 2OSXA 3NGFA 1O1ZA 2WC3A 5K4XA 3I3BA 1E5NA 4H1ZA 1VJSA 4KGJA 5REQA 3C0LA 3K1DA 3VKKA 4RL3A 3VIHA 4LRSA 1JXJA 1P5BA 3RX2A 2WOQA 5EB8A 5AYYA 3ARYA 3A9IA 4HHPA 4CNUA 5BXRA 5T9BG 2Z29A 3TIMA 3VUPA 4JFSA 1VRDA 1J8VA 2W0UA 5EBAA 3B0XA 1S3TC 3NDYA 3OVGA 4OOUA 3QBUA 1GYLA 2CC0A 1WAUA 3AXMA 1H7WA 1H4PA 2ZUTA 1XV8A 2PWHA 1UKTA 2Y8UA 3WQ8A 1SR0A 2BY0A 4IGMA 3WELA 3LTPA 3WJWA 3U9IA 2V38A 2VC9A 3G0UA 1WXJA 5AY7A 1CXEA 1JZ7A 1UD4A 1W2PA 1TREA 3ZR4A 3CWNA 3KOYA 3O6AA 2Y88A 4HBKA 4X0NA 1TFVA 3OA3A 4UWMA 3OIHA 5HPOA 1MUWA 1O4UA 1FWBC 3G1HA 1QT1A 2NQJA 3LCFA 1JCTA 2XH7A 2YCIX 1FWAC 4GQ0A 2XFFA 3NOYA 4DEFA 1EXPA 3HB9A 4E3VA 3FIGA 3GY1A 2Z1BA 1XQKA 4AD4A 4GI4A 5T91A 3PTKA 3KBJA 2GWNA 5REQB 4CQAA 2Z4GA 1U5JA 1XDJA 2RDXA 1H7NA 1UKQA 1YMYA 5FF4A 4LBRA 1E43A 2V5DA 1Z6KA 4M80A 2FHFA 4YHGA 1F3EA 5BYWA 4DBEA 5LIXX 1OFPA 1AZ1A 3SIMA 2NWRA 1EO7A 3EA2A 3FYPA 3WLPA 3P8JA 2YW3A 2E0PA 3L4ZA 2Z1SA 1E0UA 2ALDA 3B0GA 4O0ZA 3TQPA 4OOZA 1UUMA 1TG7A 5H8UA 3TK7A 3TC6A 5JIPA 1QASA 4HQVA 4Z2GA 1NWSA 1QVBA 2QJHA 3KRUA 1W8GA 2X42A 4RKAA 3EA3A 4DF1A 4RNIA 4XISA 1HP5A 1FKWA 3I4KA 4L56A 3MA8A 1V6YA 1VYSX 1XYZA 3AS0A 1PX3A 1EDGA 4JTDA 2PGRA 2ZE3A 4A3HA 7REQA 1US2A 3F5JA 3AICA 4JIPA 1CWYA 4U2YA 3K8MA 1ZQ5A 1U22A 1KTNA 1VP5A 3WLTA 2A6NA 5HXMA 1GVFA 4PUUA 3S2MA 4AH7A 1DWAM 1G67A 2HJPA 2YIHA 4D1JA 1PKYA 3R25A 1RP9A 2XSXA 3QHOA 4XVDA 5CPMA 4WRHA 5D2YA 3QN3A 3LN3A 3ITVA 5CAKA 3BOLA 1AQ0A 3IV8A 1RHCA 3D3AA 3NM1A 2V5CA 3LEPA 2PRLA 3E12A 5FJPA 3SY8A 1JUKA 1QCWA 1EIBA 1E4LA 3GH7A 2C7FA 5LGZA 4IICA 2HCVA 3GHRA 1XH1A 1KFWA 1W0MA 1O5QA 2DT0A 1IEVA 3LM3A 3B4UA 4L1GA 3PG9A 4LB4A 2ZXDA 1OD8A 2JKAA 4I90A 2E7FA 1D7FA 4JYEA 3QPYA 2XISA 1QATA 4ADUA 2E77A 1YDOA 4WKAA 4Q32A 4XTDA 3VKJA 5M17A 4LOCA 3VKDA 2WZHA 2Y8KA 5H2ZA 1H1ZA 1EA9C 3O8AA 5DANA 3VNMA 4PMNA 4MFEA 2XG9A 3OTRA 3LMZA 2PWEA 3GUWA 1J6PA 1EJUC 4XSMA 2HNHA 3I6EA 3PTDA 2Q8ZA 2EJ1A 3O06A 3WD1A 3LS9A 2P5NA 1IR1A 3H54A 3U3HA 6ALDA 3TC7A 1KQZA 4HK7A 2Y2WA 3OGSA 2V6AA 3VIOA 3CPUA 4DJEA 3BQ6A 2PEVA 3GVQA 4MJ4A 3PWGA 1UR1A 1SR9A 4M81A 4CQDA 2FVLA 2IKGA 4BS0A 3W4RA 3T09A 2XDFA 4QNEA 4QCEA 3RXZA 1BG9A 2A79A 3ZSSA 3B8WA 1XYCA 1R3TA 4WSKA 3L0NA 3OO2A 3KOXA 4WOQA 3N2OA 1IT0A 2LLEA 4GKTA 2V4JB 4J3XA 1ELSA 3NEHA 4S2BA 1GGOA 4JDYA 3B03A 3CIXA 4GMEA 3TA9A 2QCFA 1JZ5A 3AYVA 3QQWA 1GQLA 1SM9A 3ARRA 5D8WA 5FJTA 3HFYA 4D8AA 3CH9A 2CFFA 4C6IA 2FJUB 3PSVA 4LC6A 3LB0A 4JQ3A 4I7UA 2ZRYA 1TTQA 2C15A 4ATWA 1A5SA 1ZS2A 2BHUA 1HO1A 2PZ0A 4NZ1A 4YLWA 3DC0A 3DUGA 3GNDA 4B9YA 1Q2RA 3GNNA 1XBVA 3CUFA 4PEEA 3O9NA 2ZC8A 4O0KA 4Q33A 1TJPA 2J6VA 5AYBA 5GNZA 1SO3A 3F5LA 5AHEA 2IKHA 2WNZA 4NU7A 4KRTA 3QV9A 1EKOA 3WDQA 3K8KA 3SY1A 3UZYA 3NL3A 3VXGA 5LHFA 3SCTA 2VZTA 5IFPA 4WOZA 3MUXA 3ZJ8A 1GT8A 3RCNA 1M65A 2ABBA 3GTNA 4HD5A 4EIVA 2ZCGA 4DYEA 2E5CA 3EPMA 1I2RA 4LAOA 4FA3A 4KQNA 1L6GA 3ABSA 3W02A 3BAIA 3QGVA 3ZMRA 3LCWA 4J35A 3P5YA 3HBLA 1THFD 1XPGA 3VZZA 2I5GA 3RILA 3DKJA 3AIVA 1W9BM 3GXPA 4ZFCA 1C7SA 2PDJA 1FH7A 4GYFA 1TV8A 4FIRA 4UTTA 3TLQA 5A8OA 1X7FA 4DZAA 4DELA 4A8NA 1NU5A 4X60A 3WDRA 2ZRWA 3SUWA 3B9DA 2D3LA 3VLZA 1ZU8A 3NQ8A 4PGLA 3NQVA 1UWAA 3WNMA 1VFSA 1KBBA 4AC1X 4W4QA 4O8AA 6GEPA 1BPLB 2VGGA 5E93A 1WYIA 3OA5A 5FSDC 1Z69A 3IGXA 5EMLA 1V6VA 1F61A 1UP3A 4LAUA 2OWWA 3RLVA 2I17A 4QITA 4ZO6A 1R6WA 3WBXA 1K3UA 1JI2A 1XUZA 4AY7A 1BQGA 1UKSA 3M0XA 4ZMGA 3UJFA 1I2PA 3MM9A 1DWHM 3BG3A 2XM2A 4ATLA 3KVKA 4JTRA 1DL3A 1W9XA 1MW0A 2J27A 2ZIDA 4UMAA 1UB3A 2TSYA 3GWQA 1DTUA 1V8EA 2DJXA 3EWCA 2XVGA 3WLHA 4L1WA 3HGSA 2ZZ4A 5BCAA 1SFLA 4AC7C 1YQ2A 3L0KA 1NEYA 1NSJA 1FRBA 3N6QA 4CU8A 2J8GA 2FTPA 5CH9A 1XLEA 5I03A 4IMGA 3HJEA 1AK5A 3T44A 4GY7A 5EFDA 4EP8C 2J7DA 3CHVA 3LHVA 1OF8A 2V2CA 2NSXA 4M56A 5HBFA 4W85A 4ZBCA 3TQKA 4PUEA 1VENA 1Q6RA 3TLLA 2V5KA 3MVIA 2I1OA 2C1IA 3GDTA 2NVCA 3LX9A 5AECA 5KZEA 3SR7A 3GNRA 4XZIA 1R3VA 1QPNA 2OGYA 5G2HA 2D69A 2PCEA 1JEZA 1ONEA 3DI1A 3F5KA 1MW2A 5DXXA 1GQJA 1XKYA 1WOBA 5CPQA 1E15A 5BZAA 4NQ1A 4QSFA 4UZUA 4UQCA 1BTMA 2PTWA 5CC5A 2CZEA 3SIZA 2FGLA 3I7RA 2PWVA 4REQA 4FNUA 4CNOA 3AHYA 1JZ3A 3NSMA 4DYJA 1LYXA 2GVGA 3PZUA 4HHHA 2QDDA 4HNCA 4YCOA 2DVUA 3BTNA 3TV8A 5CCZA 3IGSA 1HNYA 2MUCA 4HK6A 5I06A 4IMEA 3QMSA 4PMUA 3K1GA 4EACA 1XIIA 2HXTA 1W1YA 4KRUA 3BW3A 5AOPA 2Z2BA 5A5WA 5HNNA 1SMDA 1HL2A 4K3ZA 1U1UA 2E25A 3KTCA 4MYXA 1B1YA 5J04A 2XHYA 5BNKA 4FZIA 2GK1A 4I5XA 3ABQA 3LSBA 4DF2A 1YE4A 2ZX6A 5HDRA 4IQEA 2FHCA 1DQXA 1P4CA 3E3HA 2VGFA 5EMMA 1CXKA 2R24A 3LBCA 2ISDA 3DOPA 1GQNA 4PMXA 4JTSA 2WMKA 4JDBA 1TMHA 1HKMA 4H8HA 2ADAA 3LZ5A 1ZCOA 5HINA 1LTDA 3GU9A 1I45A 2PDMA 4X2RA 3BGAA 1FCQA 3BLLA 4NX5A 4L7ZA 4C6NA 4E2VA 2BS9A 5BWFA 4F0KA 2AKMA 2Q8XA 2HEJA 5IOBA 4LF1A 3SDOA 3IUHA 2QVHA 2DUXA 2WVTA 1C7TA 4UOJA 4HSHA 3W76A 1KWGA 1CB2A 2ZRVA 3CL7A 3W2MA 1TCDA 3AXXA 1WDRA 3SADA 4HZ7A 2YGYA 2HVOA 2CWXA 1OK4A 3HPFA 4RDYA 4S3DA 3SN0A 4CN4A 3AWNA 3FEQA 2WPGA 2HZGA 3RCYA 1LBLA 1XXXA 3I65A 4AZ5A 1QBBA 3W1PA 4X9SA 5LHEA 4IIBA 4XVEA 4NVTA 5G1TA 4PTMA 3VKCA 1OFBA 1PZ3A 1VCVA 4NAEB 3S1VA 2W63A 2VMFA 2QGYA 1TPUA 1EF2A 3S5ZA 1KRMA 5LA1A 1GCYA 4IWWA 2BG5A 3VD4A 4H9XA 4KS0A 2V68A 1GZ1A 3G8RA 4DM2A 4Q8OA 3AROA 3EXTA 1PTGA 2IKJA 1OINA 5KTLA 4ALDA 4IT1A 3PBWA 3WH8A 2GK1B 2G96A 1LRNA 1O68A 5DQPA 4CN6A 1TUFA 4RX0A 3DFYA 3APGA 3PB2A 2QZRA 3VK5A 3CMGA 2BB0A 1XRVA 3PJWA 4ORMA 3S6DA 3A23A 5JU6A 1H7OA 4QM1A 2ZFAA 1KM2A 1XS2A 1AH0A 3W1QA 4HMDA 4FB7A 4H9YA 1XLAA 5XIMA 4PTDA 3KZPA 4B3LA 3WL1A 3O16A 2VOTA 3W88A 3I4EA 3M0KA 4DNHA 5G4EA 3O07A 1P1MA 2QS8A 3B8UA 1B9ZA 1O60A 3RLGA 1QPRA 3CV6A 3AYTA 3PG8A 2X8RA 4P7OA 2NQ5A 2G3FA 1V6XA 1UD5A 2ZYFA 4DNMA 3B0PA 4CLMA 3TW7A 2RHGA 4S3CA 1S2AA 2KAUC 2CNCA 3DFTA 4JHZA 2PLKA 1TVLA 4FLRA 4DXVA 4PEKA 5T26A 3L4WA 1AH3A 2ZRXA 5LIUX 3NQGA 4Z2HA 1KRBC 3LBMA 3V1PA 4BF5A 2OT1A 3ME3A 3FW6A 3UT0A 2GJPA 1C8QA 3QSRA 1XR2A 2WK2A 1CXFA 3N2XA 4CD6A 2IPWA 4AZHA 2VEIA 2RJGA 3ICJA 3MKCA 4QP0A 1R47A 3INPA 4M5PA 3AMGA 4FOUA 4I5UA 2WJZA 2PA6A 4IP5A 3VM7A 3MO4A 3MM5A 2V0TA 1IZKA 4HTYA 3BCDA 3LYEA 3H22A 4A2SA 4XV0A 4MLJA 2QYGA 1EGZA 2GOUA 1QTWA 1BQCA 6CGTA 3ES8A 3PBUA 3WLQA 1K4HA 3MZNA 5AC6A 4EK7A 1HG3A 3S3GA 2VOMA 3T0TA 1Y7VA 2A7PA 2BVDA 4S2CA 9CGTA 1W3LA 3WG6A 2V8ZA 4B5TA 1K8XA 2PGWA 4V27A 3P2VA 3ITOA 2ZXQA 4YTQA 1H60A 1XG4A 4RW3A 4NSBA 3EB3A 2W67A 4O1CA 1G4SA 1EZWA 1MNZA 1DBTA 2YLLA 2BFGA 3FJ4A 1EP1A 3LGGA 4X9YA 1R3YA 1POKA 2XIJA 5CZJA 1GG1A 1HP4A 3GG1A 1ZRQA 2Y85A 3QV7A 2VR4A 3M46A 4IGHA 3QPZA 4H3DA 3W1NA 1UD2A 3NZ1A 3REQA 2XTKA 1VJZA 5AB3A 3E2VA 4UFIA 1I1WA 1XC4A 2O7QA 1M7PA 4PMVA 3G1RA 1Z32X 2VZSA 4PFHA 2JKEA 1PDZA 4QEHA 3F7JA 3WF1A 3GDKA 5LIKX 1W8SA 3UZZA 4I7VA 2PDIA 2WMHA 3WNKA 4H8UA 3M0YA 3NQ2A 4AZCB 3MUY1 4LTSA 1JQVA 3GNXA 2QR6A 3P81A 1PSCA 1E6PA 4QDWA 5GJPA 1EP3A 4AD3A 1NP0A 3SN4A 3E5BA 4FMVA 4Z0SA 3WD0A 3IIPA 3IRDA 1ZZMA 4ZQCA 3MSRA 3CUGA 1HT6A 1SU5A 4FNTA 1EGVA 3VI2A 2CHOA 3UGRA 2R91A 4B5XA 1WBHA 4V2XA 2BY2A 2FGZA 1ONXA 1TJ1A 4WKHA 6TIMA 4D6HA 4Z2IA 3MPGA 5DT5A 1RK6A 3PPGA 2AGTA 1WKEA 1V3MA 2VZUA 1OBAA 1V3HA 1J11A 3GDLA 4JIIX 1KB3A 1O66A 1RQBA 4Q4MA 2CHRA 3TJXA 4HPJA 3GSMA 3QLDA 4JNZA 4IMDA 3SUTA 3MM6B 2OYLA 1AJZA 2FVMA 1FWHC 1W91A 3T8QA 3E6EA 3E38A 4LY4A 2V3DA 3FHQA 3U7BA 4FNSA 4C6EA 4GH3A 3GHSA 1PZ2A 1CYGA 5HMDA 4GFIA 5CXPA 4HU3A 4IJRA 3AC0A 1FWNA 3CT7A 3VMOA 3BGJA 3N3MA 2VXNA 1A4LA 1T0OA 3W81A 3RAOA 1UBPC 4INFA 4Q22A 3C5QA 5H1WA 1LQAA 2EO7A 3IJIA 1KRCC 1K4GA 3MM7A 3PZGA 4QFUA 1UR2A 2VFHA 3VYLA 2H3DA 2J7EA 7TIMA 4AWEA 3WF4A 3EAUA 2CESA 2WHMA 1ECEA 2VD8A 1R30A 2PZNA 1XQLA 1HTIA 1RBOB 4K1WA 3TXZA 5HQMA 1WNOA 2FZNA 1WDQA 3WYZA 2J24A 3E74A 3F2CA 3W25A 2VD9A 1MEIA 2E5BA 4GYPA 5G4WA 3A3WA 1AW2A 3VDAA 5AFDA 4CCZA 4QXIA 1J0HA 4PUKA 4CD8A 2C6QA 3VLYA 3BWWA 4Y9MA 1LRQA 4NZJA 2HMCA 3KTXA 1QNOA 2XSAA 3GC2A 3TJ4A 3U4FA 5TF0A 4AF0A 2CLLA 1V3IA 4XKMA 3S4TA 3UCQA 1XLFA 3KP0A 3RU8X 3AMLA 2FMOA 3W1MA 3OBAA 1ONWA 3SQSA 2GQAA 3NPWA 4S3GA 1PIFA 3KBMA 3WJZA 1GZJA 4QBXA 4CEUC 3C2YA 1H7RA 2WLYA 1GW9A 3OVPA 3H7RA 2VGBA 2OO0A 5L9FA 2XIBA 4AD5A 1JCYA 4F0MA 1EYEA 3R7MA 5B7YA 4HTBA 4MWAA 4P7RA 4CNPA 3WZ0E 4EPBC 3W23A 1KBLA 1KA9F 3G6MA 1W1B1 1GOXA 2VFGA 3R94A 3AU2A 2UY4A 3BZGA 4WDUA 4GK8A 1MZRA 1CDGA 2OU4A 3CXOA 4CQCA 3MS8A 2Z00A 3W82A 1UD6A