4S3FA

Ispg in complex with inhibitor 8 (compound 1077)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 136
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3fA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3fA02
4DJEA 3B0NA 3TYAA 3MM7A 3TYDA 3V5OA 4NILA 3MM6B 3MM8B 3TYZA 3BOFA 4S38A 4DJDC 2GEPA 4S3DA 2YCKX 5JQ9A 4C1NB 4HTRA 3TYEA 4DB7A 3TR9A 3B0LA 1Q8JA 3H23A 2H9AB 3OR1A 6GEPA 3MM6A 4O0QA 3MM9B 4MWAE 1AJZA 5AOPA 4DJFC 4MWAD 5GEPA 4O1FA 2VP8A 3VKSA 2YCIX 4DAFA 3H2NA 2AKJA 3OR2B 4O1EA 4DJFA 2OGYA 4DAIA 4S3BA 2H9AA 3OR1B 3H2MA 4G39A 2Y0FA 4DJFD 3MCOA 4AOPA 4S3CA 1EYEA 4NHVA 3TYCA 1TX0A 4D8ZA 3GEOA 3VLXA 3TZFA 3H22A 3MMAA 2VEFA 8GEPA 1Q7ZA 3H2OA 2YCLB 3H2CA 3B0MA 4MWAC 1F6YA 3MCNA 7GEPA 4MWAA 1AJ0A 3H26A 3VM0A 3H24A 3H21A 4GEPA 3B0JA 2V4JA 4D9PA 1Q7QA 3MMBB 2YCLA 3H2AA 2DZBA 3TYBA 2VEGA 3H2FA 4S23A 1AJ2A 1ZJ9A 2Y5JA 4C1NA 1AD4A 3VM1A 3MMCB 2AOPA 4S3EA 3VKQA 1ZJ8A 1Q8AA 4DJDA 3TYUA 3MMAB 2Y5SA 3MM9A 4G38A 1Q7MA 3MMBA 3VLYA 4G9PA 3AOPA 3NOYA 1TWZA 4MWAB 2XSJB 3OR2A 1TX2A 3MM5A 3VKTA 3K13A 4S39A 3VKPA 4NL1A 4D8AA 3MM8A 2V4JB 1AD1A 3VKRA 4DJDD 2YCJA 4S3FA 1Q85A 4DJED 4HB7A 4CCZA 3MCMA 2E7FA 1TWWA 2XSJA 3MM5B 3B0GA 3BOLA 3MMCA 4S3AA 3MM7B 2BMBA 3H2EA 1AOPA 2DQWA 2DZAA 4NIRA 4DJEC 3VLZA 1TWSA 3B0HA 4PZVA 3TZNA
chains in the Genus database with same CATH superfamily
4Q4PA 5JBDA 2EQDA 3P6LA 5CPTA 4PMXA 3CUFA 4O4VA 4ZSTA 5AECA 5EBAA 1R3WA 3BDKA 5HNUA 2UY3A 1FQ0A 3L9CA 4AZ6A 3CZKA 2Y7EA 2NX1A 4I7WA 1N8IA 1JZ6A 2A85A 1RY8A 5XIMA 4GI9A 4P5UA 3KX6A 1XBZA 3VILA 2YL8A 3M0IA 1TJPA 3NQVA 4AZIA 3W70A 3TH6A 3TAKA 3S47A 3SY8A 4HZ6A 4BI7A 2NUWA 2ZZ1A 4ZFMA 3MMWA 4GI6A 1OD8A 4H6KA 1XRVA 3RRAA 5FEXA 1ZJ8A 5DRIA 3W38A 5I3IA 3VIPA 4NJIA 4XZWA 3THCA 4EWJA 3NVDA 3FY1A 1UD8A 1DL3A 1IEXA 3MM8A 2WKLA 2XVGA 3WQGA 3HQOA 4HOWA 3W85A 1R8LA 1TTQA 5G2IA 4OOUA 2FB2A 2WLZA 3QBUA 4ECLA 3BLIA 5CSRA 3T42A 4WJ8A 3T1GA 2DSUA 3N2OA 2OZ8A 2ZRXA 2CKSA 1BWLA 3CBWA 3TYAA 3KLKA 1V3MA 2XVLA 3NL6A 1RQEA 2XH7A 3G1DA 3V1HA 3TYEA 4YIWA 3BCJA 1MW3A 1W9XA 2D69A 3DFQA 4AG0A 4C5YA 3QC0A 4ACZA 4INFA 2UBPC 2P50A 3WBYA 4DJFD 1CLKA 4NSBA 2PRHA 4AEFA 3EX3A 4GOAA 3E0FA 3ONCA 4ZB2A 1PKMA 3OYXA 3WLKX 2ZZ6A 3PAOA 4AVOA 2NWSA 2OLSA 2ZRZA 4E5TA 3WD2A 2E9BA 3OGRA 4CD6A 3T6CA 3H53A 3ARPA 5CSSA 2Y70A 3RX3A 1VHCA 5BOOA 4HYVA 1WZKA 3VM7A 3L66A 1T8QA 3VOJA 3W7GA 2VZUA 2TRSA 2YBUA 3C3NA 2I5QA 1B2YA 2YYTA 5KZDA 3T0TA 4I90A 1GHRA 3UVIA 2XH4A 1GJUA 4HZ7A 1XLIA 3MSRA 3AZTA 1GOIA 1ZLPA 3EZ4A 4ASTA 2V6AA 3KBSA 1QATA 4PCNA 4YS1A 1DPMA 3W23A 4AMCA 1ZBVA 2QCDA 3M43A 3QLDA 5AYIA 2I5IA 3W27A 3ZS4A 1DV7A 4KCWA 2WC4A 1Q4NX 2FVMA 5C54A 1FWRA 2Y61A 4KCVA 1XRTA 5JQ9A 4Y9AA 4BQ2A 3GDMA 4BFAA 2QCLA 1LOSA 5IHSA 1I1WA 3LS9A 4LF2A 1KB3A 1R2SA 1RV8A 4GG9A 3HB9A 2OT1A 3B8DA 3L0NA 1ME7A 3U2OA 4MGGA 3WD4A 4PCTA 1VIZA 3P81A 4S3CA 1PX8A 3B40A 2W92A 2ZOXA 4FX6M 3ARSA 3C8FA 3H22A 3GNOA 1WBJA 4FLSA 4FX8A 2FJKA 1EHAA 3WK3A 3LBCA 3FJLA 3M0HA 2PMQA 1OX4A 4QNWA 3VD7A 1GOOA 3L4XA 3M07A 1SFSA 3VIKA 2YLAA 3G8EA 3PP7A 3SZ8A 2GYIA 1IT8A 1RP9A 3AYSA 1JYVA 2OYMA 2AOPA 1TELA 4XAYA 4K38A 2D2GA 1XIBA 5I78A 4HNNA 2TSYA 4HNTA 4IGMA 4F9DA 1UUOA 2YSWA 2WMKA 2ZE0A 3T0CA 4PCFA 2ZZ4A 1RY0A 3LPPA 5CPQA 3TXVA 4C6NA 4GXWA 5K9DA 3CMGA 4AY7A 3WDIA 4OV9A 2XSJA 2GUYA 1YQ2A 5CZJA 2A3EA 4AHOA 4RR4A 3HURA 3GTXA 3THQA 1VCVA 1GTEA 1MFVA 1H3GA 2V5LA 2E4TA 4S2BA 2GSJA 4H2CA 5H1WA 1Z32X 2WC7A 2FZ8A 2FZMA 1L6GA 3T4CA 5E70A 4KGJA 3FV9A 2Y85A 2HDJA 4YTTA 2PWVA 3C5QA 2NVDA 2ZVIA 4B15A 2DIKA 2Y8KA 4HTRA 1XDJA 1KFBA 4HSOA 2VC7A 4H9MA 1DBTA 4B5WA 4QNEA 4RZ6A 4A3UA 2OGYA 4CN6A 2Z1VA 8TIMA 2D23A 1VD6A 3HBLA 3GG7A 3O06A 2EG8A 3B8IA 1BHGA 4UB9A 4XVDA 3E0LA 4XAFA 4UQEA 2GFTA 1JNDA 4O8AA 1F4AA 3TUUA 1F6PA 1WKYA 4HOXA 4XO7A 3VUSA 2OR2A 5AVHA 4LVGA 4CUCA 3R8RA 5A1AA 1Q7QA 3FA3A 4KS0A 4OUEA 4GIAA 3USZA 1ZJ9A 1YEYA 1XICA 2H90A 4US6A 4LX4A 2VFIA 3FJNA 5I7GA 3WJSA 3GR7A 2JIEA 2J77A 1EEPA 1OG6A 1KQYA 4MM1A 4XQ6A 4IG2B 1I0DA 4O1CA 3A21A 4WY0B 3BC9A 2QIIA 1JCXA 3VVGA 1B54A 4UIOA 2OWWA 3UPWA 5AHMA 2OKOA 5M17A 4LPCA 5G1TA 4B5SA 3F1QA 1DHPA 3VLZA 4FHAA 4JTCA 4K2SA 3E9AA 1TIMA 3QY6A 4MJMA 4WEVX 4RPPA 4ZBCA 3MV01 3P62A 5FF7A 3WLOA 4ACYA 3VFLA 4PTWA 2WZTA 3PG9A 1Y0EA 4I7UA 3V0TA 5I00A 6ENLA 3SCQA 4HBKA 3B8SA 3BJTA 3PPGA 4F0MA 2CBJA 2G4FA 4HCHA 1A4LA 1JDCA 4U10A 3OIHA 1EYEA 4D8ZA 3U8GA 1ZALA 3N4EA 1V79A 3ZIZA 2Q8XA 3AHTA 4PL1A 1V3IA 1L6WA 1A5MC 2WVVB 3RM4A 3NQ8A 5DCBA 4QS5A 2CW6A 3GDTA 3CMFA 2VOMA 1TPEA 3QSRA 1J9YA 2XFRA 2BHUA 1NF7A 3CWNA 1F7BA 5AHIA 4LGXA 4PULA 1TVLA 1KM4A 2YW4A 5CC5A 3WQCA 1EFZA 1XUUA 4PYSA 4GYPA 4C7DA 1QOPA 3WEMA 4E2DA 1TJ0A 1FOBA 2ADAA 2WPGA 3KOWA 3U57A 2HE8A 1A5OC 3W1LA 3AS1A 3VZYA 4PCPA 1BXCA 4WSJA 3EPNA 3ZJKA 1KTNA 3WH5A 5A6KA 1GYLA 3IGUA 4DO7A 2WSKA 1SJBA 3CU2A 5CLTA 2CWNA 4IFRA 1QNRA 3LQLA 5A6TC 4KCTA 4LBUA 1ZJBA 1H51A 4NZJA 5M5DA 3ITVA 1IWAA 4AWSA 4UCGA 4ZOEA 1KM1A 3WMCA 3PPCA 4IPJA 1E6NA 3TYCA 1KW1A 3MI6A 4WGXA 3WUFA 5I03A 3GZAA 2WMIB 5ECVA 4BI5A 3NM1A 1JL8A 3GAKA 3RG6A 3T2OA 2BOFX 3ZJ8A 5KEZA 4U2YA 3QFWA 4OVXA 5BMXA 3Q65A 1XR2A 3VIOA 3MBFA 1PZ0A 2GJRA 3UR7A 4XZMX 3SQSA 1IF2A 1B0IA 2XIOA 4XUYA 4PUKA 1B3VA 2HCVA 2WVVA 1XKYA 1VLWA 3S2CA 3ZT6A 4D6EA 3W84A 3BWWA 2C6QA 4FF5A 4ICCX 3W7MA 5CPNA 1V3LA 3M0LA 1WDQA 2V9DA 1O6IA 3H7VA 3SFKA 5LIKX 4DJED 3OG3A 3CO8A 1JRBA 1VEOA 4GQRA 4OWGA 4GBDA 3BURA 3GZ3A 3B0PA 1QO2A 2YL5A 4YWIA 3BZGA 3C0QA 5FJIA 3E96A 4LAUA 4CN4A 1TRIA 1UIPA 1X7IA 2ZWZA 1O60A 1FY6A 1QBAA 1LG2A 4ATLA 2ZZ3A 1GZ1A 1J0ZA 1JXJA 3DFYA 1Q6CA 3IIXA 4I8DA 4F9JA 4WF7A 1NDVA 3GNRA 1A4MA 1Q6EA 4GI8A 1T7LA 1Q13A 3G6MA 3PUGA 3DOPA 4JQAA 5AC6A 4CCDA 4QDWA 1EL3A 4D6CA 4P2VA 2HWGA 3PFMA 3Q67A 4NNAA 1EZ2A 1E1EA 1OZMA 3REQA 4QE5A 3UVAA 2EAWA 5GVJA 5E6YA 5CJNA 4EF8A 1RD6A 4RUBA 2WZMA 3L21A 3M5VA 3KM8A 2DJLA 5HMSA 4Y7EA 1CCWB 3T78A 1WUEA 4CCCA 2HS8A 4TVCA 2GWGA 2BS9A 4DHGA 3ABZA 1MVYA 5EA9A 4A2SA 2VRKA 4AZBA 1GQIA 4B92A 2XHYA 3I4KA 3M0XA 4R85A 3WQWA 1XV8A 2VDIA 2PF0A 1RLCL 3PHAA 3RLGA 4GGBA 4J3UA 3M47A 4GFSA 3GXMA 4OBRA 3W1TA 1DHKA 1HP5A 1F6KA 5BRQA 4QAWA 2CCRA 4LBRA 1K9TA 4B5NA 4QAIA 5BNKA 1EYWA 3LRMA 3VNZA 1OWQA 4UTFA 1YTDA 2WSYA 1E71M 1XYMA 4WZHA 4GUHA 4CVUA 4YMZA 5E0KA 1QNOA 2YYUA 3P5ZA 5D2YA 2NXGA 2I56A 1VRXA 4LSBA 4US5D 3IV8A 1R7OA 1GZJA 4NI8A 1EJSC 1G4SA 4JKKA 5F4SA 1K4GA 1I0BA 3BH4A 3AALA 3TEVA 1E51A 3EBVA 2FH6A 5LHEA 3LGDA 3TN6A 3QW4B 2WMGA 3ATYA 3GXDA 4O53A 3GTFA 4EP8C 2I17A 2BGSA 2HSAA 3N4FA 1ZP3A 4HJWA 4PB4A 1S2UA 2OFJA 1JIBA 5BXRA 1BSLA 1BWKA 2A3CA 4B5TA 1PTDA 1JPIA 1XWYA 3PWAA 2VRJA 3CAKA 1Z3NA 4NJKA 1LYXA 1OCBA 3SB0A 1ZCCA 3TR2A 2VD9A 5C9WA 1RH9A 2KX9A 2FMOA 3HGJA 1OB0A 2YZRA 3TVAA 3N4AA 2GSHA 1V6UA 1EQCA 3RILA 1ONRA 4S39A 4Z1AA 1GVOA 4ZE5A 4PTDA 4RNFA 2QGYA 1BLIA 3VKBA 4GJIA 1X97A 4NYUA 2NWRA 4X9SA 2J9XA 3TXZA 3Q2DA 4G8TA 3POHA 4ZGYA 3TSBA 4LEQA 4B9YA 4C6EA 3EEGA 3NYZA 4DJEC 3EDJA 5PTDA 2EJ1A 3S8HA 2QJMA 4EIVA 4MG4A 3WLQA 1WB0A 5I79A 3B0NA 1EF3A 4Y8FA 3G24A 3F2DA 1W1ZA 3NQGA 3TTYA 5CLWA 4PRTA 3BGAA 1T0OA 4JKLA 5FI8A 4N9BA 2WHKA 2FQIA 1OX4B 4MNMA 2CLHA 5D04C 1PYFA 2OSXA 1VFFA 1GKQA 3FSTA 1IV8A 4LYRA 2C0AA 3GC5A 5H8PA 2ZWYA 1IR1A 4MPKA 1JCMP 3MU7A 3URAA 4BI6A 3ICJA 3AIRA 1SMAA 2DSKA 1XFCA 2ZKMX 3K5XA 4MSSA 2ZUMA 3H2CA 2VJXA 1MW0A 4W8AA 1C7TA 5TAOA 1OT1A 1D7FA 2OQHA 3NNTA 4KBXA 3ARXA 3NQMA 2ESCA 1ZB5A 2I5GA 4MJ4A 4MUPA 2F6UA 1UBSA 3GIYA 3UD6A 2FZNA 3LMYA 3WF1A 4TTGA 3H2FA 3H55A 2AL2A 2E5BA 3L4TA 4GABA 5CSYA 4YCPA 3PUOA 1V93A 2CC0A 2PDQA 5AZ0A 4GQBA 2ATMA 2QVNA 4Y8EA 3BQ5A 2A2IA 4W9TA 4N9DA 5FAJA 1XLJA 1BG4A 4Z0SA 4WY0F 4AIEA 3QZ6A 3WQFA 1SO6A 3U5YA 1J6PA 3ARVA 1S2WA 5LXXA 2QCMA 3NZQA 2GGJA 3WJWA 4MF4A 1V7YA 2XSBA 3NL5A 3IVTA 1E72M 3TZNA 3MM7A 3G8RA 4IL0A 1VLIA 2PDIA 4GZIA 1EDQA 4JN6A 3TWAA 1BXNA 2V5BA 3CB3A 3INPA 4RKAA 1Q45A 1QI0A 1SU5A 4IG2A 3P67A 3WG6A 1LUCA 3AIWA 1ICPA 1SW0A 4Z1BA 3LUTA 3I4EA 2XIIA 2J9YA 3TC3A 2BHYA 4U5KA 2PDBA 3CC1A 3URQA 1A47A 2BX7A 1Z44A 5LIWX 2DVUA 3TN4A 1GQJA 4TVUA 1GEHA 1B31A 1EHNA 2J27A 1IT0A 4DVOA 3LMZA 3NPVA 3VM0A 1FXQA 1J2BA 3MI3A 3TP4A 4IFKB 3LTSA 3CYVA 2OEKA 3P84A 5K9CA 4EAMA 2QDHA 4PMUA 3ES7A 1FCUA 1JPHA 1Q8AA 5EPDA 3WUBA 3AYTA 2EGZA 2KAUC 4WXYA 2FFCA 3WLPA 4MLRA 1H7PA 3ITTA 1SUXA 3GC4A 1FWSA 2Z1SA 3NIYA 5EMLA 4F2TA 3STPA 3QKEA 4MDPA 3EOEA 3WENA 4B2DD 5AHEA 1EJRC 5BXTA 1GNXA 4KRUA 2G8ZA 2Z4GA 3UWYA 1QNSA 4UQDA 4PZVA 1OYAA 2Z28A 4XO6A 3H7UA 2DFAA 5CGQA 4MUZA 3NTYA 4YVXA 3B9NA 3BZJA 4X0VA 3PSWA 4JL2A 3D6NA 1MUMA 2PP0A 5F4XA 1BQCA 3U6WA 2W66A 3OW1A 4Q8OA 1NQ6A 4O12A 1KNWA 4H00A 5C2CA 1S5NA 5RUBA 4J3SA 3VZZA 1CGWA 1MZRA 4L5ZA 4RZ4A 3CUXA 1NIUA 1UKSA 3EKZA 1QHOA 5IM51 1J6OA 1UQZA 3GH7A 3U2CA 5D4YA 3GU1A 1U83A 2JEQA 5EB8A 2WPBA 3F5LA 2Z24A 3LB0A 1W2VA 2R94A 2NT0A 4YLWA 1AK5A 4QIUA 1NU5A 4ZXLA 1DKWA 1P1MA 3ARQA 1M01A 3KOYA 3MYPA 1BSIA 4JQ1A 1QWGA 2E5DA 1N55A 1JAKA 4AXNA 5DELA 3M6DA 3UXIA 2ACUA 1X39A 1S2VA 5HOSA 3KWSA 1OJXA 1CGTA 3MHUA 1NELA 3R0UA 3STEA 2DW7A 4LV4A 1VBHA 3BK0A 3R13A 4FPSA 3P8JA 3O3RA 2ZTJA 1YHTA 3PTKA 4G7EA 4RX0A 3SO7A 5HQMA 1OG0A 1F5ZA 5LNVA 3WBEA 3MM7B 4LYQA 1XD0A 3BANA 5AN7A 1UKPA 4B2DA 1ZTVA 2EO7A 3AS3A 3LLXA 3MSYA 2Y6ZA 2HNEA 4IMAA 4X63A 2P76A 1Q6FA 1XH2A 1BAGA 1Z42A 1DOSA 1TIWA 4S3DA 4W89A 3PBUA 1ITUA 1QOXA 5HUPA 4Q3MA 1MYRA 4CNUA 3WX7A 4KEVA 3LCLA 3TJ4A 1GONA 3N6QA 4I6VA 1S3HA 3WFLA 4YHGA 1ZP4A 4HMEA 4YYFA 3V5FA 3PWGA 1I6NA 1W9VA 3CHFA 4ZQOA 1UP2A 3E3HA 4TX6A 3T08A 1E3ZA 3PJUA 3W74A 2OZ3A 3PK7A 3MHFA 4GVGA 3N2CA 1L6FA 1GVFA 3EB2A 3G2GA 4IFOA 2Z2UA 1ZJAA 1JQVA 3PG8A 1U1HA 2INFA 3W1RA 3WLNA 2RUSA 5HNTA 3G1FA 3VKAA 3W7CA 4KEZA 1E0XA 3O6AA 2CYGA 1XCFA 2ANUA 3FKKA 4LY8A 3WEZA 2V5JA 1FWGC 3NAVA 3EOUA 3F4VA 1KD0A 4GUGA 1G4TA 3URBA 1H0IA 3SI9A 3LXAA 4CKQA 3UJ2A 1IZJA 2VR4A 1Q6LA 5HUOA 4QLJA 2WSRA 4A6GA 3FVMA 3ALFA 4JZ5A 3ABQA 4C6LA 2YZ5A 3S9YA 3KVJA 6PTDA 1DIOA 1EA9C 1PWMA 3SGUA 4B3LA 3FGCA 1NWRA 1PV8A 4P7OA 2OJPA 1OBAA 3B0YA 3K4WA 4NXKA 3IANA 2GK1A 1M7XA 3VDBA 3EKLA 4UTHA 2X30A 1ITXA 1KWKA 4XSLA 2R9RA 5FF0A 3ZT7A 1NDYA 4YVVA 2Y7DA 1XKJA 3BUVA 4MMWA 1DTUA 4Q4RA 4AZ7A 4XAGA 1Q7ZA 1HL2A 4YJ5A 3TA9A 4KH2A 4ZQMA 4YPJA 3B4YA 4MNLA 3KVMA 3BG5A 3TAOA 4JY9A 3TWBA 1XYBA 4AZCA 1BYBA 1K4HA 3TW6A 2FLIA 2OYKA 2IPGA 3TJXA 2J8FA 3U5UA 1CYGA 1UWRA 2FHFA 3KUMA 2QF8A 3K8LA 4PUUA 3N9SA 3TMQA 1I2OA 5HANA 4D6DA 3PB0A 3P14A 3L5LA 3FJ4A 2SFPA 1D7KA 1KGUA 3RJXA 3KFTA 2A7RA 1FHUA 2VX4A 1QHPA 4C6PA 2HPIA 4JTQA 3WQEA 4A3RA 3Q94A 2FIQA 1TPUA 1RXOB 2QUMA 2X7VA 3WLTA 4C60A 1ONWA 2D24A 4TV6A 3D46A 5CGTA 2OLHA 4QRNA 1GK8A 2VCCA 1IE7C 3JW7A 2V38A 4JFUA 4A05A 1R6WA 1XW8A 2DVTA 1PIFA 2VO5A 4HCLA 4I3GA 2DT1A 1VFTA 2X8RA 3RITA 4KWSA 4DNMA 4PBGA 2ZC8A 1DWIM 3OVRA 4OV4A 3E02A 1V4YA 2XH2A 1XRSA 4ICMA 3VMNA 2Z26A 3DAQA 3DG6A 4A29A 3TSDA 1RCQA 5E1QA 3UBPC 3W1MA 3M0MA 3CZLA 4XIAA 5GPRA 1IQ8A 1YRRA 3D3FA 1EO7A 5JVLA 2RJHA 3IAPA 3EMCA 3GBDA 3OIXA 2J25A 2E77A 2JEPA 3WBWA 4U3CA 2XSAA 4CQCA 2OB3A 4B91A 1CXKA 3MUY1 1CXEA 3O1NA 4N2YA 3DC8A 2DUAA 2QJJA 1HL8A 1NARA 5FACA 2R82A 3N13A 2DSVA 2WW5A 3PWIA 2NT1A 1WZMA 2BHZA 1W1IE 5E93A 3RPMA 4M8UA 3VOHA 4P7RA 5K4ZA 2WSPA 3GWQA 3S2NA 5HR6A 1H09A 3BAIA 3M16A 4IOTA 4DB7A 4UTWA 3S9IA 5LA2A 2H9AB 4GNKB 4TMBA 2CBVA 1Z9AA 3JUGA 3MP4A 4MWAD 3T0BA 1OCQA 2G3MA 3LNPA 4RW5A 4ZE4A 1HVXA 4FOKA 5CPSA 3W4RA 1T99A 2RH9A 3VD5A 3QV8A 4ZOCA 3W2MA 1EX5A 1R46A 1HO1A 3W76A 1PVNA 2WVTA 4WIWA 1JCJA 4Y9NA 5HJLA 5HXMA 1REQB 2VEFA 2QYGA 2WV8A 4O10A 1VEMA 1SW3A 2G41A 3LZ3A 3DI0A 4N6EA 2V0TA 4EVZA 4PSRA 2ZUUA 3SBFA 3B0XA 1AQMA 2XU2A 2Y8VA 1FKWA 1XQKA 3EWBX 2QT3A 3UWWA 1UWUA 4PL2A 3B0VC 1G4PA 1XLGA 1Y5VA 5A3HA 4PEEA 3TMLA 1XGEA 2W0UA 3CHDA 1JPKA 1R5YA 4AYSA 1BXBA 1UR4A 3GW3A 4C6JA 1T96A 2GVJA 3LCGA 5DMLA 3HPAA 4QBXA 3QW3A 3OVGA 4FXFA 3O2LA 2J7HA 2PBGA 1U1UA 3WBAA 3C2EA 2NVCA 1LLOA 1DEDA 4BQ3A 5G1YA 3SGZA 1EXBA 1BKSA 1LUCB 2V2DA 3D3AA 5D9PA 1TB3A 1KXQA 5BRBA 4ATWA 1OIMA 1GZGA 4CU6A 2NVAA 1O68A 1IZCA 2Q8ZA 1AH4A 3TDFA 2AOSA 1OFOA 4G2DA 2PZNA 2Q3OA 2HS6A 2YCEA 1ESWA 1MUWA 1GQNA 3IRSA 4N6FA 4NAFA 2AL1A 1B1YA 4DJFA 1TE6A 1PZ2A 3RR4A 1A80A 3OODA 1N8WA 1XLCA 3QV9A 4UNIA 3LENA 3OO2A 4NY2A 2VFGA 3LK6A 4J27A 3QOKA 5DBUA 3T81A 4NAEB 3U7BA 3DC0A 1V6VA 1XIJA 5AHFA 2PTDA 4AXKA 1ZPTA 2X0SA 3E0IA 3H24A 4Z2GA 3KXQA 4XTIA 4IQJA 3EA2A 2WC3A 4O0ZA 3GAYA 3KCOA 3A5FA 1SM9A 2V63A 3KZPA 1XIDA 4KT2A 3UNTA 3WH9A 2DUXA 5HAOA 3SM0A 4KIEA 2PD9A 2BTMA 1WKFA 4MB5A 4PMJA 5AFDA 4JFSA 3GC2A 1W9BM 3MY9A 4FSAA 1RSCA 4GHRA 3RLHA 1FHLA 1V7AA 1DXEA 1T41A 1JULA 1ZJIA 4CCZA 3WELA 2PTWA 3ITOA 2WBKA 2YX0A 1OFBA 2Z7GA 2BFGA 3WMBA 5AYXA 3LCHA 1RP8A 3ES8A 4X9YA 2ZRUA 4JGDA 1BD0A 4H6EA 2NQ9A 4RE2A 4LANA 4OBTA 1BYCA 5K7JA 4RXGA 4A8NA 4Y9MA 3GH4A 1HQTA 1WBHA 2ALDA 1RQBA 2EJAA 3WK2A 1E0UA 4LEFA 5A8OA 4E8GA 1KWGA 1ADSA 2REQA 4TMCA 4GD0A 4HA3A 1J10A 1W9DM 3SGGA 2J7EA 3DDMA 1AH0A 3WL1A 2INZA 2AAMA 4H8NA 2WYSA 4JIQA 2FH8A 4E38A 3VOFA 1A49A 3PJWA 1G9HA 1V02E 4ZQCA 2FVKA 2VURA 4UCFA 1SJCA 2INEA 2QPXA 1J93A 5EFFA 1YMYA 4LYPA 2VGBA 4DNHA 4AD3A 3IWPA 4A2RA 4IF2A 2YIHA 3W7KA 3EDFA 4HU4A 2AGTA 4BEUA 3PANA 1S1RA 3RF9A 3VLYA 3KP1A 2D3NA 3UXKA 1WXZA 2W62A 3WZ0E 4PGLA 3A12A 1AZ1A 2X09A 3CTTA 2EPNA 1E70M 3UETA 2B4GA 3A4AA 2BXYA 1BRLA 3GE7A 4K37A 4E4UA 2GDUA 3MUCA 4F0KA 1C3FA 1TZZA 2P0OA 2B81A 3W0KA 4ES4A 1XCWA 4CEUC 4CN1A 3HO8A 4D6GA 2E25A 1IT7A 4JIPA 3PUDA 3LQGA 2P0IA 3QPYA 1F3XA 1O1HA 3W6MA 3W7LA 4G7EB 1YNYA 2GQ8A 1N8FA 3UXAA 4JS3A 4AU0A 3EPMA 2B31A 2Y88A 3IJIA 4UFHA 3EOSA 2QULA 2Y63A 1OIFA 3WL0A 3FEMA 4Q7NA 2IUZA 4ML4A 1YX1A 4UOQA 2XSXA 5DY3A 5C55A 1GW9A 1FDYA 1AQ0A 4QCFA 3N3TA 2J47A 1VJIA 2QCCA 3CUHA 1W5OA 3H26A 2R1PA 3IGSA 4H83A 1R87A 4RNJA 1EJUC 3FVDA 2JKPA 3RX4A 3WD3A 3EGJA 5ABGA 1G6CA 5M3WA 2CHNA 2GQ9A 3RO6A 4YXGA 3NGFA 1VPYA 5JIPA 2TODA 3ZLFA 2QR6A 3B97A 4QSFA 4LXFA 2Z6IA 1VFLA 1PJ9A 2V4JB 4MVAA 3VABA 4XV0A 3SIZA 3C3UA 5CZ0A 2B7PA 2QS8A 1HKIA 5B7ZA 1KLZA 2ZX9A 1F8MA 1DE6A 4QQUA 1I2QA 4S3AA 1AODA 1R9YA 4RW3A 4E8DA 2OSYA 2DZAA 1RR2A 1CIUA 4GJJA 4C6MA 1J8VA 2BBFA 1PWLA 5LA0A 3BLLA 3BICA 1VEPA 4DJDC 3TU9A 1CXIA 2CZFA 3IUHA 4LAZA 3F4NA 4M81A 2D1ZA 1XPYA 3RYSA 1SO4A 4QJ4B 2P53A 1N2VA 1G4EA 1L8PA 2HRWA 1K8CA 4ML9A 3QTGA 1KRBC 2GDVA 3FSUA 1VCFA 4WLCA 4QS6A 3RIKA 4FLOA 4W7UA 3MMAA 1UWAA 1WP6A 1S3TC 3NQBA 3GXIA 3AMLA 1IGSA 4TU1A 3B03A 3TN3A 4QJ3B 4ORMA 3GLCA 2PD5A 4O19A 5CPMA 1WXYA 2XN2A 1XGZA 2HNHA 1YXCA 4PMNA 1QPKA 1MXGA 3THUA 4QGCA 1SVDA 2DU2A 4AQLA 3WCZA 2PF8A 4GVHA 3ZT5A 4RE4A 3VIFA 1EIBA 1TWZA 2RJGA 3DYMA 1Q5MA 4PUWA 3GTNA 1ICQA 3EWXA 4WKFA 4U3AA 2PWHA 1TJ2A 3NL3A 1W8GA 4H2HA 2OELA 3OQ8A 1HJVA 3QRHA 1XG3A 2WKGA 3EMQA 4H8VA 1DJQA 1GUVA 1FP8A 4DZ5A 3LRLA 1L6SA 4GGHA 1R2RA 2ZUSA 4QEHA 4HHHA 4M6UA 4Z08A 4FOUA 1ZY9A 4DWSB 1ELSA 1L0PA 3U7VA 4FALA 4JCLA 1KFJA 1UR9A 6XIMA 4EE9A 3WFAA 3MM9B 1XIHA 4G7FA 1OK6A 3VKSA 2DZXA 1P7TB 2CHOA 3TV8A 2OEJA 3WF2A 1S1PA 3AHXA 5C7VA 1Q6OA 4L9XA 2DPEA 3MVTA 3R1ZA 1OFPA 1GVRA 3FXGA 3CL7A 4I7VA 1XLFA 3SQLA 4WX2A 3AHYA 3LG3A 3CIXA 4HYRA 4AVNA 1BVZA 1F9CA 1WOBA 3NQCA 2G5WA 3H21A 4YVPA 3NA8A 1R0MA 3L12A 1E9ZB 3WN6A 3AMGA 4YTSA 1RJRA 4MAVA 3LSCA 1JGIA 2WANA 1BF6A 3WSUA 3NPUA 1RALA 2OVLA 1GW1A 3RJYA 2PDXA 1JZ5A 1EUNA 5BXPA 2J62A 2QZRA 3MM5B 1BGGA 2QJHA 3N11A 3AXMA 3PS7A 3EDEA 2ZRWA 3SRKA 2PTXA 4ZR8A 3RPDA 1U33A 3F4CA 4IGNA 1VBJA 1UOKA 3E38A 3VI2A 1E4IA 3AOFA 4EPEC 4XZIA 3WK0A 1UD6A 1LQ2A 3DESA 3BSMA 3NOEA 4KESA 4R9OA 5EMYA 3S4TA 2DZUA 2OXNA 1TRDA 3ONBA 1CXFA 3UT0A 1NSJA 3A4WA 2ZUVA 3FKRA 1D8WA 3BLFA 1LLZA 3W72A 3IJLA 4R9XA 2RGMA 3KHDA 3DXIA 2WMFA 3PJXA 3VCRA 3MCNA 1F73A 4FIRA 3F5JA 1GVQA 1P0EA 3GU9A 3D5HA 1V3HA 1EOMA 3I65A 4QJ1A 1GVSA 3TJIA 3GDBA 1UIOA 4M82A 4HK5A 1FUYA 2C0HA 2PUZA 2BZNA 1EDTA 2CLLA 1W5MA 4UC5A 1JEZA 1O7AA 4FEZA 1B3YA 1GYMA 3CV6A 3M5XA 1OGSA 1Y5XA 2DY3A 4UTLA 5LA1A 4FZIA 1SSGA 3CB8A 3HV9A 1PS9A 4IP4A 4MFEA 3FCPA 3LCFA 1E6ZA 2X42A 3NDOA 5D02A 2VEPA 4MAZA 4FI4A 2QPSA 1I75A 2FPYA 3GXTA 2BP1A 2PWGA 2J88A 5EGRA 3O8AA 3QPZA 2V2CA 4CCEA 2OOFA 1K02A 2A6NA 4JYEA 4M6QA 1UWIA 1MXSA 3TSMA 3GDRA 2PU0A 3NZPA 3QQ1A 2D2HA 2ZA2A 4A3YA 1H60A 3V0SA 4L9ZA 3PULA 4K3ZA 9RUBA 2EKCA 4BR1A 4WKAA 4QR6A 1UWSA 2V3DA 2XDFA 3V1PA 2D0FA 5BYWA 3HV8A 4GXPA 3SN1A 2JF6A 4C6QA 1VCGA 3QFEA 3KCJA 4IZGA 2PWEA 3HM7A 4R53A 2ZFAA 5C2GA 1QR7A 3LI0A 1TVPA 1IHIA 3CQ0A 2Y8UA 3MS8A 3GNXA 3HG4A 4BF9A 2BVTA 4F2UA 4EK7A 5D05A 2BGNE 3S0CA 1AD1A 4M7TA 3TNBA 4CD7A 2JALA 2A4AA 1OABA 4H41A 1YNQA 3E6EA 3OGVA 1MW1A 1V8EA 4XISA 3WUGA 3FA4A 1WCGA 2VTFA 1PBGA 1ZENA 1POJA 2V30A 5EY5A 3FNDA 4O18A 2DUZA 2WJEA 1F8IA 1TA3A 5LHFA 2XH0A 1UQYA 1KGWA 4NQ1A 4X3ZA 2XVPA 4W86A 3GY1A 3NDYA 2EF9A 3E2SA 1ADDA 4W84A 3QF0A 3HN3A 8RUCA 5C8BB 5FEPA 4DJFC 1FWHC 3UCCA 2I9EA 1QXLA 3B8VA 1DWGM 4XZBA 3KBVA 1QI4A 4JNZA 5L9FA 4JHOA 2ISSA 4W85A 4TXEA 5G4WA 4GX8A 3NQ7A 4L61A 5ECUA 5F1UA 1GQLA 5DEZA 5CH9A 1E0TA 2OU4A 2VEKA 3GW0A 3L23A 4UTUA 1KA9F 3GG8A 4XZ9A 2D22A 2GUBA 2HK1A 5KINA 1MO0A 1XH0A 3OB8A 2G50A 1CGXA 3CT2A 2PWUA 3WQOA 3VNJA 5M2FX 2W67A 1KM3A 4UOJA 1P6WA 1NJJA 4F66A 3CV1A 1MDRA 3J7HA 5D2XA 3MQTA 1MXDA 4TOQA 1SFJA 1MQQA 2Z1WA 2FTPA 3MUIA 5JBFA 2QW5A 5CEWA 1A50A 5T91A 3P61A 5FA5A 1E9YB 3M0ZA 2YB4A 1X6LA 1EA0A 1EOKA 2VGGA 2WMHA 3GUWA 4HPXA 3FN9A 4NZFA 3E5BA 2ABAA 2P5NA 4NZCA 1QPNA 3TQVA 1P5BA 2NV9A 1G67A 2V5DA 3WDRA 4ZVJA 3OLEA 3I3DA 4ZFCA 3DGBA 1BWVA 4DF0A 4IUGA 2I14A 3WNNA 4MWAE 1AJZA 5IRPA 2QMKA 2NSXA 1KBLA 4I9TA 5CZKA 3LEPA 2YPIA 1SQ7A 2X1TA 3T4WA 3OHIA 1JZ2A 1XIFA 4NHVA 5DCEA 3E0VA 4Q8MA 3KRZA 3DUGA 4B3ZA 5C6MA 3EAUA 3ZMRA 5H8MA 4BF7A 2CLIA 4G5DA 2XWDA 4J3XA 1OYBA 2YFNA 3AMKA 1VIWA 3CIVA 5J5RA 4CD5A 1MSSA 4ZO6A 3T44A 2OSWA 2ZC1A 2E9LA 1LT7A 1C93A 3EXTA 4FXSA 3OEXA 3THDA 1MZHA 4YN5A 2GJXB 1GORA 1DXFA 1K8ZA 3AZRA 4EACA 3GR8A 1TZ9A 5AKQA 2WM0A 1ME9A 3PZQA 2WJFA 1C91A 4FF7A 3VNKA 1SFTA 2C79A 5MF5A 1B3WA 3KDOA 3NQAA 3K46A 4LRSA 1VQTA 1NAL1 3RFAA 1E6SM 3P3BA 4IGHA 3W29A 3UZYA 2FTYA 1ODUA 1V6XA 2WJDA 3Q45A 3KBJA 1TPB1 4FLRA 4LVFA 1CENA 3VCNA 2Z2BA 1HKVA 4IGSA 3PZNA 1U5VA 5CBBA 1J4EA 5KITA 1U2YA 2BSLA 1QNPA 4U31A 2FB3A 1KXTA 4UTKA 3MDWA 2Q71A 1WUFA 2XN1A 4V1YA 5G4HC 1R85A 2I9UA 4DN1A 1Q3NA 2YDRA 3N14A 2PLMA 4S1FA 3KOXA 4S23A 3RMJA 3W1QA 5FD0A 3MMAB 2VX5A 1S5TA 1FWJC 1F07A 3K1DA 2CFFA 3AOPA 1G01A 1W3LA 4RE3A 3TQPA 1LBFA 2OQYA 2R1MA 1UOZA 4O14A 5A8PA 4HGXA 1OC5A 4K7VA 3SRDA 5E9AA 2H8XA 4NRSA 4HA0A 2FJUB 3V3WA 4M0XA 4UQBA 3Q4DA 1H61A 4NIRA 2OZTA 3SSJA 1ISVA 1HGWA 1M7JA 1XIEA 3TC6A 4LC8A 4X22A 3N2XA 1FWFC 4I9JA 5HMFA 4D6IA 3HG5A 2O9RA 1Z8AA 3KBNA 4A22A 1H63A 4R7JA 1V0NA 3GXPA 1W91A 2JIWA 3O0KA 4LS0A 4NX5A 2R24A 3M5YA 2YL9A 4YTUA 4JQ2A 2WHJA 4AIBA 2IQ0A 2TAAA 2OYLA 4JTUA 1P1XA 4EXBA 5C0QA 3B9AA 5XIAA 4GH3A 1MWOA 8XIMA 2A1YA 5C5YA 2GK1B 2NQHA 1D3HA 4JTAA 4HTYA 3VX0A 3LCWA 4R7WA 3FDGA 3KW3A 5A8MA 4QISA 4JX6A 4MNKA 1XH1A 3T9PA 1WKDA 3LGEA 4NUWA 3S1XA 4O4WA 4ADUA 1Q2RA 1RQHA 5AZ1A 1NP0A 2XGIA 4O50A 1W17A 3PPHA 2CWXA 2XUCA 5A2CA 4WJEA 5CBIA 1MFUA 2DZSA 4WQ6A 3TROA 2ONEA 3IIPA 1KFLA 2CBUA 5IDZA 1W1A1 4BWLA 3GYEA 4PE8A 4QTGA 3W7PA 3PC0A 1J11A 4XWUA 5EMJA 2IW0A 1JDFA 1QNQA 3P5YA 3QMSA 4ZOBA 1BG9A 5IBXA 1TWSA 6CGTA 4FR1A 1B30A 2C71A 3A13A 2VC5A 3S42A 1PTAA 4GLEA 3PZMA 1NH6A 5EKYA 3S5NA 3VKKA 3VIMA 5AHLA 3SCVA 3NVTA 2C3ZA 3FAXA 3STCA 1TPH1 3B05A 3APYA 2GDQA 3GK0A 3VIHA 3VGBA 3KOZA 3TTQA 4O0QA 5AYYA 3DENA 4LY4A 4F79A 3EXSA 4YHEA 3UXLA 3BJFA 3OR1B 1UR1A 1E40A 1PYMA 3RPTA 4UMAA 3PZOA 4N4QA 1ZCOA 3RLVA 1HP4A 5I6SA 1JZ7A 4UFMA 5CG0A 8GEPA 3R7MA 2QAPA 4L4PA 2H6RA 4TR9A 4I9AA 4KEUA 4QX4A 5C2XA 2AMGA 2YXXA 4HQVA 4AX6A 1OGGA 2Z25A 1WA3A 3K1GA 1VBRA 4P8WA 4A8IA 1W3HA 5JXQA 4EKJA 1Y8BA 3NWRA 4AHPA 3CMJA 3TX9A 3OZYA 4XKYB 1EJWC 3TTSA 2XN0A 1XIGA 1BEUA 1OVDA 4GACA 5FSDC 4EWND 2F84A 5FF2A 4GX9A 3TTOA 4YTQA 4IP5A 1EPXA 3LDVA 1JCYA 3V75A 3W73A 3BGJA 4HB7A 4L9YA 3T0DA 2OWXA 3TNOA 1JCLA 3S6DA 1RPKA 2VVNA 1Z48A 5D8WA 4GY1A 5HWJA 3W02A 4D6JA 2P8CA 3A4JA 3LHZA 1V03A 4TQTA 5ABHA 2BOEX 3WKZA 5J8LA 1GKPA 1QWKA 3RCMA 2Z29A 4BF5A 3URNA 1UMYA 2NSOA 2PWFA 2VDGA 4JIIX 4OUIA 2YKKA 3I6RA 2QMJA 1UUMA 1M3UA 4S3JA 4HOZA 1T8XA 4GO9A 1LRQA 5JUVA 2WWCA 4FK9A 3EOLA 2HPMA 2E8YA 3HG3A 3OBEA 5XINA 4FAMA 4QE4A 4LU0A 4DZIA 1ZBCA 4IJBA 2NLYA 1JDDA 5LIXX 2ZRVA 4Z2LA 3VNMA 1RZMA 2XINA 2J66A 3AO0A 4HPHA 3ARTA 3S1GA 5CG7A 4MZ1A 5DFAA 4C6FA 3EWCA 1Q6DA 2V81A 4L4MA 1ZFJA 4OHQA 3HPFA 5FF4A 1ENUA 1MNSA 3WJZA 3GXNA 1G1YA 2X1IA 1OT2A 2Y2WA 3AXKA 2X0YA 4MDOA 4W93A 1MEIA 5HQLA 2QUNA 3WD0A 1K70A 1CXHA 1YDYA 1DJYA 3VMOA 1ICSA 4H9ZA 1VGAA 1ZRQA 3AYVA 3SUUA 4XVEA 3DEQA 3M5ZA 1A53A 5IXEA 4UTJA 4YCOA 5GNYA 5FJTA 3A47A 3S2MA 2GJLA 5I3DA 4FIQA 3LY0A 1M6JA 2UWFA 3P7YA 1M5WA 1GCYA 2GJNA 3QGAC 1TMLA 2EHHA 4AVFA 2BVYA 2OO0A 4WDUA 3WD1A 3GTIA 4GUJA 1BYAA 4IXHA 1WDRA 1YXDA 3GS6A 4MZYA 3GVQA 1QUMA 4DUVA 4L80A 1IGWA 4DM2A 1TG7A 4URIA 4HPJA 3WLSA 4HSNA 1FH8A 4REQA 4XD3A 3BV7A 5DN1A 4DWSA 1KRMA 4C6BA 1KQZA 3H4GA 3W2UA 1GG0A 3BLDA 3VD9A 2AKZA 2QVHA 1ZAHA 3ZVHA 1ZJHA 3M7SA 1I45A 5DRCA 4DPPA 4DJDA 1SO3A 2VFHA 1A3HA 1L6YA 2NQZA 3VMPA 3VDHA 3E12A 4TX8A 1JVNA 4G9PA 2NX3A 4PTMA 1J0KA 3VGDA 2ZZ2A 1Z69A 2R91A 4PTXA 3ITXA 2NV1A 1US3A 4GBUA 3ABRA 1EGVA 1E43A 3WDPP 4UTMA 4A21A 4LS1A 1E6RA 4IM4A 4EPDC 1SMDA 4X0NA 4FMVA 1G7VA 5E5CA 2VDHA 4KCUA 1NDWA 1QT1A 2C91A 3UA4A 2XJ7A 2E68A 2VXNA 3VOCA 1DTNA 2Y5EA 8A3HA 3W22A 1XUZA 1TMHA 2O4MA 4KRTA 2NW0A 3W7JA 4J35A 1PDYA 3STGA 3EX2A 1JUEA 2DQXA 4L4OA 4GIYA 1CLVA 1JI2A 3NUKA 1CT5A 4UOZA 2Q01A 1TX0A 4KEMA 1V6WA 2WHLA 2DT2A 2QEZA 1EZWA 3VNLA 1BTCA 3G1RA 2FPVA 2CIPA 3W1AA 1SSDA 2DJXA 3WLIA 3AQUA 3LHTA 3W81A 1EBGA 1LWHA 3G0UA 5J5DA 2B7NA 4WOQA 1W5QA 3VGGA 3WNKA 2C18A 1LWJA 2V8ZA 1KM5A 1KM6A 4PRWA 1TE1A 3MMDA 2H3DA 3I10A 4ZB5A 4WY0A 3NQFA 3ZJ6A 4IX2A 3QHMA 4CQAA 2PDYA 3GHRA 1E9IA 4WSKA 1WAUA 7REQA 5IFTA 3W88A 3CWHA 1A3WA 1QCWA 4JR5A 3TQ0A 2HV5A 4TVDA 1TTJA 3VKCA 4MADA 4B9ZA 5AY7A 3ITYA 2PCQA 6REQA 3DIPA 3WIJA 4JXCA 3SY1A 3BV4A 2O4QA 4IJRA 4B16A 4I9MA 1S38A 4MB3A 1XRFA 3CHVA 3IACA 5F2GA 2ISDA 1DJIA 1V3KA 4JTJA 3BW2A 4CGTA 3RO8A 1AW5A 3G3MA 1KXVA 4TIMA 1X1ZA 2QV5A 4Q7IA 1FVPA 4GVFA 4O1EA 1UC5A 1NWSA 4IJCA 4PUEA 4W7VA 4POCA 3GTHA 3FAWA 4DBWA 5F2MA 4AOPA 3CJPA 4J40A 1TV5A 4BWLC 3SCRA 4NG3A 3VKJA 3KS5A 4BQ5A 1JD7A 2E6AA 2NX9A 4LW7A 1WDWA 4A35A 3AIEA 3DBPA 1DWHM 1I2RA 1WV2A 3EA1A 4K39A 1DQUA 2DGAA 4RV8A 3BJSA 4MY1A 3QHNA 1E5NA 3EEZA 2BASA 4R34A 2OGJA 4DI8A 5AVNA 1A5AA 4X60A 5HA7A 2E3ZA 3ALGA 2A3HA 3W87A 4IISA 4ZZ9A 3R11A 3F4WA 4H04A 2XZ9A 3HF3A 2G95A 1EB3A 4GJ1A 3FYOA 1TX2A 2YA1A 1D3CA 3S6TA 5LNUA 4Q6JA 5CSUA 3OBAA 1MUCA 3IUIA 1TJRA 4HA1A 3NDZA 4IMCA 3VE9A 4GI4A 3IJ9A 3EX4A 3OZOA 1RBOB 2W4XA 2GVYA 1W54A 2BMBA 2GVGA 2PDUA 3H2EA 6TIMA 2VKZG 1SJAA 2Q3RA 2F9RA 4NXSA 7TIMA 2O55A 4QCEA 2PDGA 2ZXAA 3N12A 4WDTA 1ITCA 5DO8A 3QYSA 4DY1A 2D0HA 4HD5A 4ERGA 1XYZA 3TK7A 2VP8A 3CQJA 1DIEA 1HG3A 4IQEA 3DYOA 4PSPA 5CPLA 3NFUA 3SN0A 1KC7A 2ZX8A 2AAAA 2IQTA 2XFYA 3TZFA 4JFTA 4K1WA 4DYKA 1QNVA 1MRAA 1CBGA 4MOZA 3TFXA 4FNPA 4C91A 4L1GA 1F6YA 4R27A 2CLEA 2EG6A 1LL6A 4IMFA 2CESA 3PTDA 2JGQA 4LCQA 3THAA 5AOUA 3L4VA 3PSVA 2X7WA 3SCUA 2PWDA 4LJ3A 5HDRA 1DXIA 3N25A 4J3TA 4MKVA 2GOUA 4UMBA 1JYXA 2PGFA 3WLMA 1PL9A 1S46A 3C2RA 4DI9A 3PZUA 2PAJA 1X1OA 1KFWA 1M1BA 1QI2A 3VK5A 5KSWA 3CXOA 2ZX5A 5HULA 1UR8A 4G1NA 2CEQA 4IPLA 4XUGA 4P7LA 1HKWA 1J01A 3DKLA 1UASA 4M5PA 4UQ9A 5LZLA 1R47A 1L8NA 4N9CA 2EPLX 3ELFA 4B4FA 1IIHA 4KRZA 1XLHA 5AC4A 2GEPA 2W27A 4GKLA 1QVBA 1PX4A 2WKJA 4A3HA 3CO4A 4C7FA 4LB4A 3KTSA 4IPIA 3K8KA 2PRLA 4WD0A 3W6LA 3QLLA 1YKWA 3GIQA 3R94A 4IMGA 5C70A 5HPCA 3TOYA 4XBJA 2ACQA 1JUBA 3WNLA 4F0LA 3ECQA 4D1IA 1Q6RA 3G1SA 5HNRA 1SZRA 4DX3A 1GOWA 1PKYA 2DDXA 2GQ3A 1CDGA 5BW6A 1NOFA 3H4XA 2QCDB 1AJ0A 4KETA 2PA6A 2ZRYA 3G0SA 4DXKA 5H91A 4NAEA 2PE4A 4LVDA 4X2RA 2Y62A 2PBOA 3MMCB 3LU2A 1DIKA 3SQMA 1HKKA 4G38A 4ZSUA 4ZA0A 1MI3A 3ITCA 1P4CA 3L67A 1XC6A 4NAFB 4BA0A 2G3FA 3CK5A 1MW2A 3EXRA 3S5OA 3G18A 2J7BA 2AMXA 3L4ZA 3NR0A 4O52A 5ENLA 3SCSA 1UZ1A 4ORIA 3BAYA 4PMQA 3WDHA 3B0GA 1FWBC 4E8CA 4RJEA 4Q4SA 4PB5A 4UTIA 1US0A 2OTDA 2EEXA 1QBBA 2X41A 1IR2A 3BG3A 2NQLA 3MI2A 3G1XA 2PURA 4QROA 2YA2A 4RLIA 5I07A 1O5QA 2J9ZA 4O1BA 1HGYA 4NF7A 1PB0A 2G97A 2TYSA 5M03A 4ZENA 3GVVA 2VMFA 1R9ZA 4RL3A 3QGKC 3P0WA 4MIMA 4CQ8A 4M1BA 2ASHA 3S1VA 2XTKA 4IMDA 4QG8A 1TUXA 4Z2JA 4WCJA 1AL7A 1PE1A 4B5UA 3GEOA 1SPQA 3AC0A 3TN5A 3RX2A 1B5TA 3FIGA 5ABEA 1CW2A 4XZLX 3G22A 1B57A 2V82A 4C6DA 4MY8A 3N6JA 2C15A 2J6XA 1W3NA 5HNNA 2HE5A 3UPMA 1O95A 3ISIX 4KMQA 2YXOA 4FP1A 3VM1A 3UZXA 1LJYA 3QSTA 1CB7B 2PC4A 1O4UA 4LUTB 4AY1A 3PZTA 7ODCA 4CLMA 2ZZ5A 2O9PA 2RDUA 4H8HA 5I02A 1W9UA 4JTLA 3MM5A 4K7YA 1W8SA 4H7ZA 4UQAA 5TQLA 3I6EA 4PMZA 4QG6A 1S39A 3BG9A 3W28A 1CX9A 5LIUX 1E0VA 4ILSA 1X38A 3BOXA 3NXLA 3G1HA 4WK9A 2WVUA 2DSZA 1YE4A 4IT1A 3VUPA 3TLQA 1S5VA 3DFPA 4DF2A 3CUIA 3WQ4A 4I6KA 1C92A 2PDHA 2IKHA 3R25A 1QW8A 1AZ2A 1O5KA 3MVIA 1JR1A 1JDEA 3SEPA 4XBSA 3VC5A 4AMAA 3BW4A 1NF0A 2D73A 3MV11 3H8AA 1WZAA 3L4WA 2F2HA 4JEQA 3WJYA 3ARWA 3RR1A 5C9UA 1UYQA 1P6BA 1YDVA 3EWYA 1OFQA 5A5WA 2HK0A 2XIJA 4JBRA 2PFHA 3TOPA 1UROA 1ZU8A 3D0CA 3MCOA 3BLPX 1JUKA 1BRLB 1PKLA 1KR0A 3C56A 4UZSA 4O8RA 3VLXA 3CH9A 5FOOA 1VENA 2OLAA 3GBEA 1MDLA 3FOKA 1A0DA 4P8XA 1IEVA 4Q32A 2V5CA 2YDSA 4BZYA 4S3KA 2GGGA 4ZOAA 3E49A 3RU6A 1LM1A 3W00A 4C5ZA 2Y1HA 2DZWA 1Y5WA 4UFKA 1RCXB 4IHCA 4YTRA 4H7CA 2WNNA 4LRTA 4UNLA 3U0HA 2HEJA 2WHMA 2YBTA 3VDGA 3QQWA 2B0MA 3L4UA 2QCFA 3R10A 2PDLA 1HTIA 3AICA 4CQBA 4DWSC 1OEPA 4WJXA 4US5A 4CEXC 4HN8A 3UQNA 3W7DA 1UBPC 4S2CA 2E9MA 3COTA 4R5EA 1K3UA 1KTCA 3LTPA 2YXGA 4F0RA 1C8YA 4D8LA 4H9XA 1B3XA 1I1XA 3TE9A 3QR0A 4XD5A 4AD5A 2QCGA 1SZNA 4UXDA 3B0LA 3OPSA 3ABXA 3GNDA 2XG9A 3ANYA 5DT7A 2CLFA 1NFGA 2IXUA 1R3YA 1WYIA 1W5NA 1GOKA 1A3XA 3KDNA 4DBSA 1SO5A 4AD1A 1W1B1 2IKIA 1LF1A 3F5KA 3OTRA 3VE7A 1Q66A 1H11A 3MT1A 1EP2A 5K3VA 2PCEA 3GKAA 3OU8A 1ME8A 1BFNA 2JBMA 2PODA 3PY2A 1IEWA 4V15A 3A6OA 4ERIA 5E9XA 4O1DA 1XYCA 2OQLA 4NASA 1P48A 2BY2A 3W26A 3HFTA 4LUTA 3RNDA 4F3HA 2YCLA 1U5JA 4GIRA 3R8GA 1JF6A 3MDUA 4DZHA 3SCPA 4UR9A 3ITGA 3W83A 4QDPA 2WK2A 4V2XA 3U2ZA 4P61A 2CHRA 2PTZA 3AXHA 1JRCA 5A8NA 2QJIA 1K9FA 1VJSA 3A3XA 4Q8QA 1JAEA 2FKPA 3OQEA 3ZQ9A 4EXAA 1V5XA 1TWDA 3M0YA 4RDZA 1P0NA 2PP1A 1AMKA 1US2A 1B3ZA 5DT5A 4E3VA 3VTRA 3TA6A 3IIOA 3UR5A 4RZBA 1XIIA 1OM0A 1UD5A 3SR7A 3CS2A 1Y65A 2YB1A 4YYCA 2XM1A 4XG1A 1TR1A 1U1JA 2IPWA 5I5RA 4L1WA 3OGSA 2W79A 4LS2A 2YDQA 2PDNA 4M56A 4GCXA 4MY9A 1FDZA 1J5SA 3OHMB 4S3BA 5G1MA 3CH0A 4EPKA 3HGOA 1RLDA 1FCVA 3KLLA 3DFNA 1CLXA 5I23A 4CU7A 2WCSA 5C9XA 4IH3A 3W7OA 4FOJA 2J79A 3KTCA 2BVWA 3N73A 4CU8A 2QV4A 1E6QM 1Q63A 1JNEA 1DJXA 3FLUA 4J28A 1W0MA 3C8NA 4ONVA 3OBKA 4R3UA 1HT6A 3H2AA 3BCDA 2Y5JA 1XSKA 1EWEA 4H8UA 1A5SA 1TFVA 2V3FA 1XLEA 3UEQA 4QE1A 3M0JA 1XC4A 2YDAA 3F4DA 3BLKA 5GNXA 1PHQA 4FA3A 4N42A 7ENLA 3P93A 3FJ6A 1TV8A 4D6HA 3M6YA 1O12A 1UKTA 3BW3A 2NXHA 2JKAA 5CZSA 3CUZA 7TAAA 2VFFA 4M80A 1AOPA 3N1AA 4DBDA 3W7NA 2HVMA 2VGFA 2ISVA 4GK8A 3WH7A 1XISA 1YTKA 4L4LA 3MKKA 4GUIA 3NSNA 3BOFA 2G4JA 2YCKX 2DZPA 4OBSA 3M46A 3OG2A 4DQWA 1PZ1A 3AIUA 4ZB0A 2CLKA 4XK2A 5IHRA 1C9DA 1YXYA 1H49A 3UYCA 3S1WA 5MKGB 4FS9A 4WKHA 1UZDA 3UG4A 4NX0A 1REQA 1LZOA 1LRNA 2RKXA 3VIJA 1E15A 3NCOA 3LBOA 5FEWA 1RVGA 1XGDA 3CNYA 5FJJA 3VC6A 3KWXA 1UPMB 2Z00A 2CLPA 2YCLB 4KWWA 1SJDA 2VC9A 3C0JA 1LQ0A 2YL6A 2G3JA 5DLCA 1OC7A 3EKGA 1S5WA 2GWNA 3T2QA 4P8UA 4C6KA 1VPXA 1W5PA 3QKZA 2JQXA 4P7QA 2WCAA 5I24A 3IEBA 4JAWA 2BVDA 3TCEA 5EMUA 3SY5A 2ACRA 1DVJA 4NJJA 3I3BA 4F0SA 3HA1A 3SCOA 1OQFA 3M0KA 3RGTA 3USBA 4AC7C 5D9NA 1MNZA 1XM3A 2BY0A 5LSMA 2TMDA 4JQ3A 4JN8A 4ZO9A 3GHTA 1KBIA 2P8BA 1XD1A 4OKDA 1OYCA 3AWNA 3CPRA 4M51A 1QPRA 2BY1A 1IXNA 3NYDA 1FKXA 3U4FA 3O7UA 4M3PA 2A7NA 3L65A 3FGCB 1H4PA 5GNZA 1PCWA 1M04A 3TKFA 4HT3A 3WF4A 4CNTA 1OF8A 1YDNA 2GGHA 3O6CA 2ZQ0A 1DQXA 4GXMA 4CD8A 1DWAM 3G5EA 9CGTA 5DMYA 2WQDA 1IXOA 4K36A 1FBAA 4PMRA 3NSXA 1NOWA 2QNEA 3FHQA 1P0KA 1HNYA 3UERA 3FEQA 1YDOA 4L1XA 2NXIA 5CC3A 3SIMA 1TQXA 1I2NA 2A0NA 6ALDA 1YPXA 1QI5A 2VVSA 1R86A 3GH5A 5FAGA 5D38A 4AIUA 2FDSA 2XIMA 4GC4A 3CAVA 3QMTA 3WMSA 1CNVA 3CGTA 1O5XA 3SCTA 2VT0A 5DQPA 1F2JA 3EB4A 3DG7A 1ODZA 3I7SA 2PSNA 3TW7A 3UP8A 4L6OA 3EWDA 4AZCB 4MWAB 2XIQA 3A3HA 4LOCA 4D2JA 2VX7A 4ENLA 2A3LA 2YW3A 4FNQA 3E2VA 3SURA 2W91A 5DBTA 3DGRA 4XZHA 3W07A 3OYZA 4UNKA 2NUYA 2OCZA 2EPOA 4Z17A 5CQ1A 2QXWA 3AIBA 3VFCA 4JTKA 4RDVA 4AB4A 1V3JA 4HK6A 4H7VA 1QU4A 3W2NA 2ODOA 2QCHA 4L56A 1F61A 4LALA 3QHOA 5A6JA 4LV9A 4ZTYA 1AVAA 1PIIA 3F7JA 1NWTA 4M6VA 3ENLA 4Y90A 4ZODA 1HW6A 4HZ8A 1LCOA 1KFCA 4F2BA 1M7PA 4KWOA 5A8GA 2HTMA 5ABFB 3I7RA 2D20A 4FLQA 1ECQA 4JTEA 2EPKX 3W71A 3CLWA 5E0FA 2FVLA 1R3VA 3G1AA 1UR3M 2VUNA 1TVNA 1AQHA 2VR2A 3SCNA 3V36A 1A5NC 1S2CA 2NQJA 1UD2A 1LT8A 1UHVA 4AWUA 3ARUA 4GINA 5EMMA 4PN2A 3W53A 4PMOA 1XLBA 3N04A 1ZBWA 4CVWA 3MANA 3LA4A 3WUEA 4AZHA 3WY1A 1E0WA 3RM9A 1KLYA 1OADA 2HVNA 3WH6A 1V02A 3N34A 1Z7AA 1JZ4A 2ZX6A 3C52A 3EX6A 3MBDA 2PGEA 2YCJA 1C8VA 5D9MA 4AYGA 2PLJA 3XIMA 1HKMA 1PUDA 3VM5A 2QKFA 3ATZA 4ZO8A 4ZXOA 2CKRA 4DBUA 1L2QA 4DYEA 4RCXA 2Z1KA 4NVTA 3MJMA 1OSEA 2ZA1A 4JTSA 4IFKA 2MANA 1E6PA 1BQGA 4NZ1A 4MB4A 4DBEA 4JTGA 5EBUA 4LVAA 5KMYA 3ABSA 2DH3A 4V1XA 3UG5A 4IIBA 4LF1A 1JJKA 4LH8A 2RAGA 4JHMA 4DM1A 4FXJA 2WMJA 3PNZA 3GHUA 4O17A 2YR1A 3W25A 2L5HA 1PSCA 1T5AA 2B7QA 1YE6A 4PH6A 2J4GA 3H4WA 4WHBA 1E73M 3UPBA 3SUVA 2ICSA 3STFA 2OZ0A 1TREA 3V0UA 4B3KA 4I8YA 2VZTA 1EC7A 1K1DA 1AA1B 1XI3A 2J7FA 5A2BA 3S6OA 3CZEA 1QAPA 3DYPA 3VPLA 3UGRA 4L7ZA 1KV5A 4PUMA 5D9OA 7REQB 3S46A 4XD4A 4RE0A 2W63A 3JVAA 3MM9A 3NOYA 4W5ZA 1HO4A 1H0GA 2YFOA 2A21A 1E3XA 2WNZA 4QXIA 1JYNA 1VB9A 5FJUA 2IKJA 2ZUTA 1D3GA 1CPUA 4LAOA 3UJEA 1M65A 1TPC1 2HJPA 1K7EA 3BAJA 1JG9A 3O15A 4HMDA 4ZQNA 3VOGA 4JIEA 3BMXA 1P7TA 5U4NA 1F74A 4Q8UA 3IUDA 1K6WA 4GQ0A 1DJWA 4HZMA 1RA5A 3R4IA 1MMFA 3GVGA 3NQ2A 2WJZA 3KVLA 3C2VA 4DELA 1X8FA 4MKNA 3SAZA 2PDKA 3NO5A 5DANA 2E6FA 2X05A 4XB3A 1Z89A 3PM6A 4E6MA 3L7RA 3WDJA 2BV9A 3P2VA 1XYFA 1JDAA 2XM2A 2CU0A 4GY7A 3HPSA 3PZGA 1UD3A 2DZVA 4B5XA 1HJXA 1K7FA 1H50A 1ZUAX 2DEPA 4BS0A 1O94A 3LCIA 2CXEA 2YJQA 1W56A 1E1FA 3GFYA 3KL0A 1C9WA 4GQQA 3CZJA 3O05A 2XGBA 3H12A 4JCMA 4K8HA 1Q7MA 3O16A 1EX1A 4JQ4A 4QSHA 1RAKA 1I60A 4ZTXA 3I68A 2BLEA 4MTVA 1KFEA 1HF6A 5KZMA 2O9OA 4EX4A 4Z2IA 2ALRA 3NSMA 1UB3A 2AQOA 4JD4A 4Q4QA 4H9YA 1VZWA 3AUJA 5LNSA 5FJRA 4EOUA 4L64A 3BQ6A 1A5KC 1DIDA 3TYZA 3MHGA 2PDFA 5ABTA 2GGIA 1X6UA 3BE7A 1H7NA 2WB5A 5FCZA 5G4EA 3CL8A 1XDLA 4H19A 3AWOA 3OLDA 4U28A 5BCAA 4ZL1A 4HN4A 1H2JA 1C8XA 2J7DA 3LSBA 3PPFA 1ML1A 2Z1XA 2JF7A 7XIMA 2DVXA 1O66A 4A3QA 1ZQ5A 3FYYA 3BSHA 3DFHA 1OZQA 5HMDA 2GJXA 4IX0A 1G0CA 4V27A 1TUFA 3ID7A 1EJXC 3PZVA 4G56A 3PN8A 3W7RA 3NJ3A 3LPFA 4Q4MA 4C90A 1THFD 1ZZMA 1T6MA 3CEPA 1P43A 5HWNA 4JTRA 1UWQA 3L68A 5IBXC 4M24A 4AEOA 5H6HA 3T0AA 3SRFA 3V18A 3TIMA 1TQJA 1EUAA 3MSDA 3NZ1A 1ZGDA 5BMWA 4ATDA 1J96A 2X16A 1Z6KA 3KS6A 2ZDSA 1BGAA 1TSIA 3GUGA 3A4XA 5KZEA 4FNUA 1QW7A 4ZO7A 3DECA 4IPNB 2ZXBA 4C7GA 3IRDA 4LFYA 5I3FA 3IJDA 3MZ2A 3BMWA 1TV3A 3S5ZA 3HZ3A 1AW1A 2HZGA 4ERAA 3T07A 3MCMA 4W88A 3N19B 4V28A 2VEMA 4AIOA 3LZ5A 1WXJA 5D2VA 1B9BA 1WQ5A 4Q4OA 2DORA 1GG1A 4J3WA 2FMNA 3KOFA 2QDDA 5D03A 2R1KA 1ECEA 2F61A 4DO4A 3VO0A 3DHFA 4IIGA 5E09A 3ZM8A 1HVQA 1QPQA 3W37A 3UGVA 3H2MA 3GD6A 2WMIA 4JL1A 1CZ1A 1JQXA 3EPOA 3U3HA 2ISWA 4N7QA 5TBOA 2X1SA 1UD4A 4H9VA 1FCBA 1LTDA 2D3LA 2QLYA 4AHQA 3AMDA 1WDPA 1YTEA 1E1CA 2NUXA 5DMMA 3KRUA 1RVKA 3MWAA 4AAJA 2G96A 4QFUA 3NZRA 3GYCA 1SGJA 3DERA 2C19A 4UWMA 3W9ZA 2O0TA 5A6LA 2ATSA 5A6AA 1U5HA 1LL7A 4DYJA 3IJQA 3V16A 1K03A 3GFZA 3FX4A 3AU2A 3S2LA 1LBLA 4ACZB 3LX9A 2VENA 1TKKA 2POTA 2X1RA 3MP5A 3C4UA 1FHDA 1QK2A 3LCXA 1P6CA 3L0GA 3VAVA 4NZ5A 3BL3A 1Q85A 3ARZA 1QHZA 2DH2A 3C2OA 3NL2A 4UFIA 1VC4A 2P1FA 3MYOA 2E09A 4WDXA 1XL9A 2DV0A 3B4UA 1A0EA 3UWVA 1R2TA 3HIJA 3IK4A 3E5PA 1GHSA 1UH3A 5L6UA 3HTWA 4MPQA 1CWYA 1YBQA 2C13A 2I1OA 4W8BA 1J0YA 3GIPA 1RJQA 4B90A 3WO8A 3WYZA 4BCEA 1N82A 3KL3A 1O1ZA 3PZ9A 3GNPA 5H2ZA 3EX1A 1J0HA 5D30A 2P88A 3OZPA 1OINA 2Y0FA 2J75A 1XINA 1RBAA 3T05A 2E1WA 1GOXA 3LPGA 2C1IA 2FYMA 3WLJA 3IIVA 4MB1A 1VKFA 4XAPA 3HFYA 5AB3A 2OWCA 4FNRA 2EPMX 4WGHA 1T40A 2CZEA 3G77A 2DT3A 2BB0A 1TPDA 3CWOX 1FP9A 2C7FA 3C6CA 4M29A 4DO6A 1UKOA 3A24A 1SR0A 1IIGA 2QF7A 4UQCA 3WLLA 2XFFA 2VQUA 3N6HA 3WNMA 4JTIA 2ZE3A 2PDWA 4RDWA 3C0LA 5BU9A 4AEEA 1AUSL 1ISWA 1VFMA 3TTEA 4GWEA 4O57A 4Y6GA 3VIIA 3VNDA 1H1NA 2F38A 1M41A 3WDQA 4XAZA 2ZCGA 4EAYA 2W3ZA 3WEOA 2FDMA 2FHCA 4JX5A 2O56A 1FWWA 5F2LA 3WK1A 3ZVIA 4LNYA 5ABFA 1HJWA 3V5OA 1OC6A 5T26A 4GZJA 3DHDA 1FTXA 3AS0A 1GGOA 4GZEA 1J12A 3LM7A 1RCOB 3W1PA 3BXWA 1Q8JA 4LUYA 1RUSA 1ISZA 1EC8A 3E74A 2W6RA 2WVSA 1W3JA 1XBVA 1TPWA 1UP0A 3BGGA 4LCSA 4P8VA 1RK6A 1ZS2A 4TO8A 5LNWA 3QTPA 3ZR6A 3AXXA 4IPPA 5I09A 4EPBC 4CQDA 4A8LA 3CM4A 1NEYA 4WSHA 4Z2HA 1MRQA 5T9CE 1RJPA 3GXFA 4HHPA 3UJSA 2YA0A 3JZEA 2VD8A 5B80A 5I77A 1K9DA 3A5VA 1M03A 2VUYA 3GFXA 4AUBA 1H7WA 2RDXA 1Q6GA 4W5UA 2CZDA 3NXFA 1KCKA 1PXGA 2PPGA 3HMCA 3HG2A 1BVNP 2ACSA 2GGEA 3HJZA 2ZYFA 5IDIA 2OX1A 4UTWC 1VBGA 3M44A 3E2RA 4GUFA 4ZCWA 2HQAA 2FGLA 4B5VA 3H7RA 3UA3A 1J0JA 3B3DA 1F3EA 5HBFA 3RDKA 2GPTA 1L9WA 1MQPA 3B0HA 4GE8A 2CNCA 4DJEA 1H7RA 1WNOA 2VELA 1Q6QA 1KCXA 1VPQA 5C7HA 3LGGA 5K9XA 3W2JA 5CGMA 3R5EA 4QM1A 3OVQA 3UU0A 3AHZA 3LHVA 3QJAA 4GZ7A 4QLKA 2F7FA 1XS2A 1OFAA 2QAFA 1KBBA 1OFEA 3A22A 2WSQA 3GVWA 4JPGA 1EJVC 4N0RA 4CNPA 4AD4A 3FK4A 4AW7A 2WOQA 4DO5A 3ZJ7A 3GRIA 4J3ZA 3UY8A 4PTNA 1BVWA 3QR1A 3WQ8A 5CBJA 4Z1DA 3NO3A 1J2WA 3HOJA 3CPUA 5FL1A 3DN5A 3P8IA 1KM2A 2AL2B 4EF9A 3CT7A 1W3KA 4KF1A 5LGZA 2UY2A 1AJ2A 1GT8A 1KFKA 1EIXA 1W31A 3L4YA 2QJGA 3PJTA 1W3IA 1Z41A 5F4WA 1JCTA 1Q2SA 4KIRA 2RHGA 3MP3A 3EOOA 3DHUA 3DX5A 3DKJA 4RK8A 1EF2A 1HXJA 3BOLA 1XSJA 3U48A 1JPMA 1TTIA 2F2KA 2I16A 4HSHA 4DXVA 1W32A 2BXVA 1EPVA 4C6OA 5A6BA 3QY8A 3U2EA 4YNGA 5I3GA 1J5TA 3QZAA 4C6IA 4LUIA 4Q4KA 3LLDA 2BWGA 3N17A 4E2OA 2KZHA 4C1NB 5A2AA 4F0HA 4LT9A 4OT7A 5HINA 1KM0A 2BODX 3PAJA 1BTMA 3O6DA 2WZHA 2VZVA 2F6KA 1EJ7L 3NGJA 3VGHA 2D0GA 4GKTA 4H3DA 3WQ5A 1XLLA 5CZTA 3W2KA 5HWMA 2RFGA 2EBNA 4K68A 2BNJA 4F48A 1VHNA 4MYXA 3C61A 2BG5A 1LWIA 3WQPA 2HBVA 1H5VA 1OY0A 3A64A 4WXZA 3LV6A 3UWUA 1UKQA 2BOGX 5LYRA 3ZSTA 4E4FA 5AC7A 3CQKA 4WUIA 1WAWA 4JN7A 4Q8PA 3WQVA 5BU6A 4JNMA 3RK8A 4AY8A 4D8AA 3W01A 4GPNA 4E3TA 3EDDA 2IQDA 3IK2A 5HR7A 2FGBA 3BVJA 5JU6A 4WRHA 1HKJA 5GJMA 1DJHA 4JY8A 5JMUA 4PFHA 4X61A 3LXBA 1TJ1A 3R79A 3HGRA 7PTDA 1IZKA 3B8WA 1UMLA 3GB6A 3R8HA 3B04A 4GYPC 1H41A 3LN3A 3EWUA 3UW6A 1PKNA 1KBKA 4PCSA 2VZSA 4BK9A 2WZIA 5IOBA 1QO5A 1I8JA 3HPXA 3LPOA 3T55A 2G0WA 4PC8A 3B0UX 3FA5A 2VM8A 3MJYA 3AXIA 3NQDA 1G7UA 4U2ZA 5HQEA 1VH7A 2YCIX 5K4XA 5BROA 4JTTA 4LWWA 4XKMA 4HNVA 1JPDX 3L2LA 3SSZA 3IJ8A 4OJYA 1FWDC 4Z2KA 2GLKA 2R1NA 4DWSD 1OGBA 2F6XA 2GQAA 1EGZA 2O92A 4Z42C 1VFUA 2PDMA 1RD5A 1ZHAA 4HA4A 3GHSA 4K8EA 4Q8NA 1M7OA 1PCKA 3DFSA 3T8QA 5AYBA 1W2PA 1KV8A 3BSGA 3B0JA 4Q8WA 3OZMA 3O63A 1E55A 1RPXA 3TYBA 4GY0A 4OZOA 2PDPA 5EL1A 1IEQA 1V51A 1DP0A 4O28A 5BOEA 4IWWA 4KPLA 1IWBA 1RBLA 3TW9A 3S3GA 4FNTA 3RLUA 1FWNA 1D9EA 2OKTA 1OFDA 3HQ1A 1FXPA 3HJEA 2VYOA 1DJZA 3NEVA 4J3VA 2JK2A 9XIAA 3UG8A 1XLAA 1EGMA 2XIBA 3SCWA 3N29A 5JH2A 2ZXDA 2OOGA 2Z0IA 1S2AA 2FZ9A 1E4NA 3I3EA 3MM6B 1J18A 3TFCA 3MMTA 1GWJA 3UWQA 1X7FA 4PMVA 3S5SA 3FHAA 3OR1A 6A3HA 1UJPA 2ZDRA 2CLOA 3AROA 4N9EA 1QI3A 1PZ3A 1D2KA 1BYDA 1V0MA 1GVEA 2V69A 4AC1X 1ZBKA 2VWSA 3CZ8A 4J2MA 2VZOA 5DXYA 1JF5A 4AD0A 4C1KA 1R3RA 1NQKA 3T7VA 3CQIA 1JD9A 1GVIA 3HQNA 1V0KA 3H70A 1X96A 3NPWA 6XIAA 3MPGA 3UCQA 3K30A 4J4KA 5GJNA 2PC8A 4JYDA 4UMCA 2PU1A 1XBYA 4I5RA 5G2HA 2VEGA 4C1NA 5CC7A 4S3EA 5HK4A 3KZSA 3TYUA 5D37A 3AISA 1R3TA 1V6YA 3W24A 1LDCA 3CHEA 4JIHA 3HMJG 4GC3A 3ZSSA 3VDAA 3VIGA 1FH7A 4NT0A 3R12A 2J74A 4PEKA 1HUVA 4JNYA 2E7FA 1VR6A 3DZ1A 3OA3A 2IMRA 1XLKA 4NJGA 3SJNA 4D6FA 1IXPA 1B9ZA 5F2IA 1G5AA 4LBSA 4FXRA 1KR1A 1EDGA 2X0HA 3TYDA 5KTLA 1LROA 3S83A 3O6YX 4NI3A 4Y96A 2B7OA 1N7KA 1SYTA 5I3HA 4FX7A 3VDCA 2VOTA 5I0DA 3UXDA 1CGYA 1P0DA 3CLMA 5B7YA 1QRQA 1UH4A 2VQTA 3M1ZA 1J0IA 5TNVA 3L2MA 4H01A 1VAHA 3S9ZA 3CUGA 1UA3A 3H2OA 4AFYA 3IPWA 3MUAA 1VP5A 3ARRA 1VFSA 3PTMA 4IMEA 3WH8A 1BF2A 3MKCA 4J5NA 3UYIA 1S2TA 1O5RA 3DBNA 5E6ZA 4KQNA 1R30A 4LB3A 1ALDA 3PB2A 4YU1A 3AUOA 1QTWA 1B4EA 3XINA 4E0CA 1UJQA 4Q6XA 3CASA 1PTGA 3UNDA 1TYGA 1D8CA 4OGZA 3CIWA 2QDGA 3VKPA 4NL1A 2E8ZA 1ONXA 4Q33A 3V5CA 4O1AA 3RN6A 4NU7A 1FX6A 1PEZA 1E5JA 3VXGA 1OK4A 1G69A 3LHWA 2XWEA 1UA7A 4PR4A 3KRSA 3W7IA 3OLIA 5LKYA 1NM9A 1E4MM 4JICA 3A23A 3N15A 1OD0A 4E2VA 1PHWA 4FNSA 3UR2A 3ZO9A 2WM1A 4AX7A 1R9XA 4KGLA 4G6CA 5BWAA 1XIMA 1HX0A 2FZBA 2CPUA 2PP3A 3B8TA 1W37A 4DXXA 3SJ3A 1A5BA 1KTBA 3QV6A 1QMLA 2UZ9A 4HYWA 4MFDA 1K6AA 4PRRA 2ZA3A 4QP0A 4ICNA 1GEQA 4IICA 6REQB 1FHVA 1WDDA 2E1DA 3A3WA 3QXBA 3PUEA 1AH3A 4DLMA 3GDLA 3F03K 1C90A 1TTPA 4H9UA 2CERA 2ZX7A 3NURA 1FH9A 3AJ7A 3R2GA 1Y7VA 1QK0A 2J24A 3APGA 5DMNA 1TR9A 4AWTA 4B4HA 2Y89A 3PBVA 2Y5SA 3GG0A 4GISA 4ZMGA 4KWUA 4Z1CA 5K2ZA 1NOUA 1RHCA 4PUDA 3IV3A 4DIAA 1HJQA 1LLWA 2GJPA 5FKYA 3PFRA 4DJDD 3W7HA 5F7UA 2OT0A 1EO5A 1AFSA 1SR9A 2VI0A 1IXQA 4C65A 1QOQA 2DP3A 4LAMA 3CPGA 3CAQA 1CEOA 4H6QA 3SFWA 3W86A 4CNOA 4XSMA 3LRKA 2TPSA 3Q37A 2V68A 4GYKA 1C8QA 2J7CA 2ZUNA 1M53A 1OCJA 4GYFA 4HHMA 1MEHA 3BO9A 2Z1BA 3AMCA 2E67A 2EKGA 3U9IA 4O1FA 4UR7A 4PBFA 4IUOA 4AWEA 4BY3A 3C2FA 2QUVA 4LUSA 3QVQA 2Q02A 4PTVA 3M64A 4NP7A 3NZGA 4MNJA 1R3SA 2E6YA 5CJMA 4XIMA 5JBEA 3K2GA 5M1TA 3IGHX 4L6HA 3GNNA 1R7AA 3LTYA 3WLHA 5A6SA 2DW6A 2A5HA 5BRPA 3NO1A 4GEPA 1DJGA 4D9PA 2IKGA 4IQLA 2IPFA 3RMEA 4TTUA 1LG1A 2C14A 2IXVA 4L65A 4LQ1A 1QW9A 5HPOA 3DHPA 4H6RA 2Y4SA 2XVKA 3N2BA 5D32A 4Q8TA 1XF0A 2A79A 3VKTA 2H8ZA 3K4DA 2RDWA 4IIEA 4XBKA 1JFHA 4S3FA 3GO2A 1JZ8A 2E5CA 1EP1A 2DIEA 1VF8A 4BEQA 1FDJA 4RV3A 3I6TA 1GQKA 4UTTA 1GKRA 4K1GA 2OEMA 1A5CA 2POZA 2R14A 1YLVA 3QZEA 3VNYA 3LXCA 1FWIC 1I4NA 1K8XA 2A3BA 5LGXA 3BCFA 1UR2A 3ERPA 1HIZA 4UFLA 1W1VA 4DAFA 2VFEA 4WVXA 3B06A 5H8UA 1TO3A 2QPUA 3IJ6A 3BMVA 1OX5A 1MEWA 1FRBA 3UJRA 4LCRA 1W1YA 2E40A 2EPHA 4HTBA 3AHVA 4NNBA 4TUFA 4GFIA 3RXZA 4O54A 2IS7A 1UW9A 3KCLA 3MSGA 3TLLA 1F4HA 2QHAA 4UFJA 4GQGA 1TV2A 4IQDA 3QGVA 4Y2WA 1XX1A 4WDWA 2ZTKA 2GUUA 3RAOA 5A69A 1UCWA 1YBQB 5T9BG 3M41A 4GVIA 5GJPA 4P7NA 2OX4A 3W75A 3N9KA 4XX6A 3HGSA 3POCA 1LQAA 2XSJB 3WMLA 2UY5A 2W5FA 4KW2A 2Q09A 4PFMA 1PDZA 1V08A 3JR2A 3DI1A 3MA8A 3A9IA 3PBYA 5A94A 3BPWA 1DQWA 4HNOA 2YGYA 4O0KA 2Z27A 1FWEC 1AMYA 3CV7A 3L2IA 3B9OA 2J13A 1XFBA 4KFPA 2AKMA 1WO2A 3P0XA 2AKJA 3OR2B 1TWIA 1K8YA 2ZUWA 2C16A 4BJHA 3LYEA 3LOTA 2VCBA 4J2PA 4PODA 4DPQA 3F2CA 1GVYA 4CNSA 3MUZ1 4UBPC 4GO8A 1EEXA 2HISA 1WKEA 4FB7A 3AS2A 3DCPA 2QCEA 1NFBA 3O9NA 3VINA 3B0MA 4FO4A 4HJFA 1HL9A 5CPOA 3VGEA 1DYSA 3I7QA 3QY7A 3KBWA 3MMBB 2XGZA 3T40A 3R58A 1WOAA 3AI0A 4JTFA 4KWVA 3M7WA 4IL2A 4AZ5A 3HQPA 4C6CA 3PNUA 4N4PA 3TONA 3E0WA 4IIDA 1M9HA 4OE7A 1OX6A 1OFRA 4QITA 1GOQA 4HIBA 1CGVA 2R8WA 3JRKA 4LUSB 4RZ5A 1IYXA 4X2PA 1BKHA 2Y7GA 1MQRA 1TV7A 2V67A 4HMCA 3SUTA 1H1ZA 5I3JA 3MMCA 3BAWA 3G1VA 2BXZA 2PGRA 2ZBTA 4J7RA 2WAGA 5MKGA 1JI1A 4JX4A 4NRRA 2FHBA 5A95A 2VRQA 2DZTA 2O9TA 3LERA 1K7XA 1KRCC 3PR2A 3H23A 3C2YA 5A8QA 3GVRA 3RHGA 1IEIA 3QR3A 5D09A 4IP7A 4TX9A 2H9AA 4HK7A 2H3BA 2A3AA 3ZWSA 3OOQA 2EG7A 2PDJA 3CTLA 3H54A 3QYQA 3K8MA 4REQB 3W7QA 1H5YA 5HMEA 4K6AA 1VRDA 3AAMA 3OJGA 3ZXWA 3ZZ1A 3TC7A 1CI1A 2DZBA 2E6DA 2GSEA 1AD4A 3ZR5A 2W61A 3SUSA 5I06A 3R0KA 2G37A 3VNIA 3LD5A 3UJFA 3S5YA 4PA8A 4ZQRA 1M68A 3K13A 1U22A 2C1HA 1G94A 1DE5A 1JXKA 1J79A 4EANA 5JH1A 3VKRA 3EDKA 4I5XA 1SFLA 4DF1A 1UG6A 1XPGA 1E56A 2ZVRA 4HHLA 1BPLB 2HVOA 3ANVA 2PZ0A 5EMKA 4HU3A 2JFEX 7CGTA 3LHUA 1LOLA 4ADSA 2PB1A 3JU2A 3EYPA 3ZWTA 4NJHA 1JFXA 1RK5A 4JOMA 1X98A 4RNHA 2Y7FA 1KO0A 2YBVA 1EBHA 2PI6A 3UR8A 2PTYA 3ZFHA 2C1GA 3KE0A 3AZSA 2WZEA 3NM3A 3UY7A 1FWTA 4XKYA 4O15A 3LBMA 1UWTA 1PPIA 4GCAA 2HBXA 1KCZA 4UUIA 2VNCA 4MWAC 7GEPA 4MWAA 4R7OA 2NQ5A 4F40A 1A5UA 3L5MA 1WE5A 4I5UA 3HPZA 3MTWA 5FIPA 3LM3A 3VX1A 3SN4A 3VGFA 4UR8A 2A6LA 1PX3A 3MMBA 4AF0A 2R6OA 3CHCA 5DCDA 5MHBA 4KFNA 4ROPA 3G1YA 2MUCA 4CD4A 2R1LA 2J78A 3V7PA 2QUUA 3U4AA 2PLCA 3W2LA 3MC5A 3QEZA 2G3NA 2OMAA 3FDKA 3AIQA 3W1XA 4GA8A 2VC6A 3D47A 3L5AA 1A0CA 2VL4A 4WR3A 1TA3B 3P60A 2GZXA 4EXQA 3H6OA 2WNQA 2AQVA 1YPFA 2GL5A 4JFVA 4XTDA 4DUOA 2VWTA 1HJSA 3KEHA 2ZIDA 3R0DA 2WBGA 4OFCA 5AC5A 3TJLA 1UZ4A 4OIFA 4Y9PA 4Z1YA 3QPEA 5GEPA 5CC6A 3M4HA 3APTA 3LNMA 4OECA 4DAIA 3MW7A 3BAXA 2QGHA 1XBXA 4QJ5B 3REQB 1FFRA 1TZ7A 1JCNA 1H1YA 3IARA 3V35A 4HNUA 4Q8VA 1OHLA 1XP3A 2QDEA 1NY1A 3UZWA 2Z6JA 3R6IA 3HU7A 2BDQA 4PB3A 3DFTA 1QDSA 2F8QA 4TV5A 1UH2A 4QEEA 5F1VA 1GPFA 2X2GA 1TMQA 1PO9A 7A3HA 5A6BD 4LVBA 4DWDA 2PEVA 1E1CB 3MMUA 1OF6A 1UUQA