4S3FA

Ispg in complex with inhibitor 8 (compound 1077)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 136
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3fA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3fA02
3MM6B 1TWWA 3MMBB 1AJ2A 3TYZA 4DJDA 4S3FA 2VEFA 3H2FA 3OR1B 4G39A 4S38A 3VLXA 1EYEA 3H22A 4NIRA 3B0HA 3MM8B 4G38A 2VP8A 1Q7ZA 4DB7A 3VLZA 3H2AA 1Q8AA 3H26A 3BOFA 1AOPA 1TWZA 3VKQA 4MWAC 1AJZA 3MM9A 3MCOA 3H23A 1TWSA 5JQ9A 4D8ZA 4S23A 4PZVA 4HB7A 4O1EA 2AOPA 4S3AA 3MMCA 4DJEC 4DAFA 5AOPA 2YCKX 4MWAA 4DJFA 3TYCA 4S3BA 4HTRA 3NOYA 4S39A 3H2OA 2V4JB 2XSJA 3TYDA 3MMCB 2E7FA 4DJEA 3H2NA 3BOLA 4O0QA 3B0MA 4S3DA 3VM0A 2Y0FA 4MWAB 1Q7QA 3B0NA 4MWAD 4S3CA 2YCLA 2VEGA 3OR2B 3B0LA 4AOPA 1Q7MA 2OGYA 4S3EA 1Q85A 5GEPA 7GEPA 4MWAE 3TYUA 2H9AB 3MM7A 3VKTA 4DJDD 3MCMA 3MM8A 3TYAA 1AD4A 4NL1A 3V5OA 4C1NB 3TZNA 3TYBA 1AJ0A 1TX2A 3B0JA 3MCNA 4G9PA 4DJFC 4DJFD 2YCJA 3MMBA 4D8AA 3VKRA 3MM6A 3H2CA 4DJDC 3MM5A 2V4JA 1ZJ9A 4CCZA 1ZJ8A 4C1NA 2YCIX 2AKJA 4O1FA 3VLYA 2H9AA 3MM7B 1AD1A 3TZFA 2Y5JA 3H2MA 4NILA 2BMBA 1TX0A 3K13A 3TR9A 4GEPA 2Y5SA 1Q8JA 2XSJB 3MMAA 3MM9B 3OR2A 3H21A 2YCLB 3H24A 3MM5B 3MMAB 3VM1A 3VKSA 3VKPA 8GEPA 2DZAA 6GEPA 1F6YA 4DJED 4NHVA 3TYEA 2DQWA 3B0GA 2DZBA 3AOPA 4D9PA 2GEPA 4DAIA 3GEOA 3H2EA 3OR1A
chains in the Genus database with same CATH superfamily
3TTYA 4JQ1A 4GGBA 3JVAA 4GIAA 1EC7A 1NQKA 4AAJA 1J01A 2G3IA 4UCGA 5TNVA 4C6KA 3P80A 1X96A 1OF6A 4WX2A 2VT0A 1IXOA 3K2GA 1WX0A 3ISIX 1E51A 1FBAA 1DBTA 3EXRA 1RQHA 1SUXA 3HIJA 1QASA 1UYQA 2WV8A 1HKVA 2MUCA 2JE8A 1DJIA 2D0FA 4A05A 2ALDA 2WHMA 2HBXA 3BMXA 1M7PA 1F4HA 4D6JA 2CKSA 2QMKA 5C7VA 2P3EA 2GJLA 4M1BA 1IT0A 1YDOA 2DIEA 2OU4A 4MHBA 2WVUA 3TP4A 3EWWA 3QEZA 2XIJA 2HEJA 1XUZA 2G3JA 2IPJA 3LRKA 2ZUUA 3BZJA 4QISA 3TW7A 3VLYA 4E6MA 3QTGA 2DUAA 1HL2A 1UD2A 3TN4A 2OOGA 2GJPA 3L4TA 3MHFA 1YYAA 3SQLA 3AIVA 4LRSA 1YQ2A 2F8QA 3VUPA 2YXXA 4ORMA 3S1UA 1PAMA 4P7OA 1QWKA 3NURA 3PANA 2VNCA 3HQNA 3SSJA 3P0WA 4YS1A 4DN1A 1UR1A 3A3HA 4MLRA 4ICCX 1DL3A 1Q45A 2VEFA 4PCNA 2NWRA 1WDRA 3A3WA 3WLPA 4GVFA 3VE9A 3MM8B 4IZGA 4XG1A 4Q8MA 5K9XA 4NRRA 1EBGA 1B1YA 4MFEA 3LM7A 4NI8A 3RM9A 1K7XA 4DQWA 2Z0IA 1EHNA 4V1YA 4L5ZA 1LWJA 3LSBA 4HB7A 5AOPA 3AWNA 2OWWA 1M01A 2X8RA 3KLLA 3QY6A 5AYIA 1UWTA 3DHFA 2Y0FA 4G6CA 1ZJIA 1POJA 2NUXA 2E1WA 4Y8EA 4XQ6A 3S1GA 3T09A 4HVXA 4GACA 2Y8UA 4X61A 1EJVC 3EWYA 1A5NC 2O7SA 5B7YA 2BY0A 2O9RA 2ZXBA 2Y1HA 2WANA 3GDKA 4ZB2A 2DVTA 5FF2A 3UETA 4ZOCA 4XUGA 2QZRA 3NQ8A 4M6PA 3ZR6A 1MW1A 1Q6CA 1VCVA 3WJSA 5I06A 1JGMA 3PJXA 1DKWA 3UPMA 2P76A 4Z1BA 1TPWA 2Q71A 1QO2A 1REQA 2BMBA 4PB5A 1Y0EA 4JFVA 4QG6A 3GXIA 3L5AA 1WKEA 4H7CA 4GLEA 1ZSXA 2RDTA 2YJQA 3AUOA 1TA3B 2QEZA 3F03K 3E5PA 1GKRA 1QOXA 2QKFA 3J7HA 1VKFA 3G1RA 3S5YA 1S46A 4D2JA 2EPKX 3DZ1A 2WAGA 4GE8A 5ABTA 1N82A 3W7JA 5E70A 2HPIA 5A6LA 2EEXA 4RX0A 5SWUA 5LIYX 4GJIA 4JX5A 1DWHM 1M53A 3UR2A 1AODA 1EJWC 3ONBA 3BQ5A 2OLHA 1R86A 5JVLA 2YOCA 5FF0A 1WZLA 1S2UA 4EP8C 1KWKA 4UNLA 5HWNA 4QDMA 3ARRA 1EDQA 4RE4A 3OEXA 3KP0A 4N6EA 3NQCA 3NZ1A 3MM7A 4GH3A 2BV9A 5F4XA 2XIBA 5ABHA 2C19A 3GKFA 4HZ8A 4WF7A 4LF1A 4A3UA 5BNKA 3R6IA 1V7YA 3BGGA 3O63A 2Q8ZA 2HVNA 4RZBA 3PZTA 3VD7A 4AEOA 3DHUA 2E25A 3A23A 1JDAA 3JUGA 5CGQA 4JQ2A 2ZRZA 2JEPA 4G56A 3MI3A 5EA9A 2WNQA 4LV4A 4ROPA 5DF0A 5A6TC 3WENA 4NNBA 2ACUA 4DELA 4L9XA 8GEPA 5A6SA 3VD5A 4UTTA 4HU3A 2QUVA 2J88A 4BQ4A 1EDTA 2V82A 2A79A 2WC4A 3CQKA 5DBTA 4JS3A 1Q2SA 2P3ZA 1CB7B 3K4WA 2R1MA 3VLXA 2R1KA 2A2IA 1NOUA 4Q7NA 4W7VA 4S3GA 3SY5A 3GDTA 1GOQA 5D9MA 2F6KA 1E6RA 1B3ZA 3BC9A 3FFSA 5C9RA 1VQTA 2BGSA 1QW8A 1VFHA 4JTSA 1JCMP 3CK5A 3TONA 2AOPA 1UROA 3CLMA 3N18A 2VGBA 4J7RA 2DZVA 2OZ0A 5D8WA 4UTTC 1XYBA 2E40A 3KL3A 1O7AA 3FKRA 3KOFA 4DJEA 1EUNA 2ZE0A 4GYJA 1QW9A 1BXCA 2INFA 4LC8A 3TOPA 3SI9A 4ATDA 2FTWA 5LZLA 2CC0A 2XINA 3U0HA 2TSYA 1UZHA 1J9YA 1GONA 2X1IA 5IHSA 5D2TA 2R94A 1CXKA 3PP7A 3DYOA 4C1NB 4ZODA 2RFGA 5JU6A 3QGKC 4KBXA 2FJKA 4JZ5A 4FX6M 1F8IA 4FNSA 4QQ3A 3LV6A 4LPCA 3QJAA 3W83A 3WFLA 2PGWA 4D8LA 5A8GA 4GYKA 1TB3A 1V0LA 4RE0A 3A24A 3MTWA 3E2SA 2Z7GA 2YKKA 4J2MA 5IFTA 4O50A 5KZEA 2DZBA 4H9MA 1OINA 3GVRA 2B7OA 5E6YA 4IQDA 5IXEA 4X0VA 2PEVA 3C2VA 5TD4A 3SCQA 1G1YA 4KQNA 1Q6RA 1XW8A 2WPGA 3S5ZA 1OYCA 1BKSA 2ZYFA 1XIMA 5HPOA 3ZS4A 3QSRA 1W0MA 2G3FA 4P2VA 5I3GA 4LALA 3JS3A 1XGZA 4GUIA 2CBVA 3E02A 4BEUA 5C70A 1WUEA 4UTHA 4ZL1A 2W3ZA 1F3EA 5GNYA 1DQWA 3CPRA 1EP3A 2ZE3A 3G1VA 4S3CA 3MBFA 2VJXA 4LVGA 4C6QA 4FIRA 4AX7A 4MWAE 3KBNA 4K7VA 5LIXX 2Y6ZA 2RDXA 3QVQA 4W85A 1R2SA 5FF4A 4U28A 3TW9A 1KFEA 1MVYA 3M5ZA 1TPFA 1QOPA 3OZPA 3M43A 1OFEA 5EFFA 5M17A 1T5AA 4DF0A 2BOEX 1E6QM 5D05A 1WBJA 2QUUA 1P4CA 2YB1A 4KWSA 5FJTA 4INFA 1VBHA 1TMQA 5DCBA 5D2YA 4F0HA 3VD3A 4AMAA 4DXVA 1SW3A 3W2NA 3SN0A 1VFSA 1FHDA 1CXHA 4LUSB 3U2ZA 1D8WA 4PMJA 3HO8A 1F6KA 3ARUA 2PF8A 5XIMA 3CJPA 1LCOA 4AU0A 1BTCA 1GYMA 1MXGA 3IANA 1WV2A 1CYGA 2XUCA 1GOMA 1XL9A 1WP6A 3KEHA 4US5A 1G5AA 3PM6A 3RUBL 3G8RA 3W7MA 3MU7A 4AHPA 3MCOA 1UMYA 5LNRA 4Q4SA 5CXPA 4BF9A 4ZQCA 3KTSA 2BHUA 3ZXWA 4CEXC 3DFHA 3HGSA 3B9DA 4LTSA 3W1RA 2HMCA 2E09A 3SW6A 1TPUA 3GKAA 3OZYA 2QXWA 3PZMA 2ZVRA 1QI5A 1V3IA 3QKEA 4JTFA 1GOIA 4JTCA 4UFMA 2Q8LA 3FCPA 3B0XA 2JIEA 4H83A 1V02E 4X9SA 1HKMA 5HANA 2WJDA 1XS2A 4UQBA 3VKAA 2XVLA 1FWDC 3OW1A 3S2JA 1E9YB 2J66A 3IVSA 3RLUA 3B8DA 4H4IA 4XX6A 2VVSA 2TYSA 2XN2A 1TPH1 2XM2A 2XN0A 3P62A 4GI6A 4AXNA 4ZE4A 5G5IA 2XM1A 1HKIA 3UJFA 2XFFA 3WNOA 1FHLA 3R25A 4LOCA 4WOQA 4JQ4A 3RDKA 4JL1A 3V5CA 2VEIA 3B8UA 5E0KA 3W74A 1B0IA 2XWEA 3GU2A 4IPLA 4DWSB 2V69A 1QHPA 4BEQA 2DORA 3G1HA 1W5MA 3TWAA 4N0RA 4EWND 3THQA 2KX9A 2BXZA 3R2GA 2SFPA 4R53A 5LNWA 3W2UA 2HTMA 1ML1A 4CLMA 1ICPA 3FGCB 4Y8FA 4JHZA 4R7OA 4FALA 3V0UA 4S3BA 2CPUA 3BLLA 1EWEA 3U5YA 1VCGA 1V3KA 4JDBA 1JR1A 4C6NA 4H19A 4H9YA 3W53A 5CJNA 1LWIA 3MWCA 6TIMA 4MKVA 2YCEA 1K3UA 4DF2A 2ZICA 3BCDA 4NRSA 1Z44A 3SCSA 2XISA 2CWXA 3T2PA 4ZOEA 3B40A 4I8DA 4K2SA 4MM1A 4A2SA 4IIBA 3P61A 3L9CA 1R9XA 2I5GA 1YPIA 3A4AA 2A85A 4O4WA 3DI1A 3MUIA 3T2OA 2WJZA 3GFYA 3W1QA 1I0DA 2VZSA 2DPEA 1OD0A 1GNXA 4MOZA 3ZT6A 2Y7GA 2HROA 3M0XA 1J18A 3KAOA 1EJTC 1E1CB 3W75A 4K36A 1UA7A 1WBHA 2G4JA 1AW1A 4E4PA 3WKZA 3MA8A 4PL1A 3RM4A 2HNEA 4TQTA 4W84A 1KR0A 3IJ8A 3BW4A 3ALGA 5EMLA 1UJPA 1YPFA 1XYLA 4RKAA 2ZWZA 2FVLA 1W9DM 5A5WA 4EIVA 3QXBA 1PCWA 5TF0A 5AHFA 3RJYA 4J3SA 4ZSTA 5HAOA 4CNPA 4W5UA 2BZNA 3N6JA 3G1AA 3QPEA 3IUDA 3CH0A 1FWAC 2ZZ3A 4UOZA 3GYEA 1BYDA 3LHVA 1JEZA 3GH5A 4HA4A 4KESA 2X0YA 1HT6A 4REQB 1HJVA 2QYGA 2G8ZA 3VM0A 4IIDA 3M47A 4PMZA 3VX1A 5LA1A 1VRDA 3TIMA 3PR2A 4R33A 4B3KA 2WKGA 1RZMA 4UQDA 1GYLA 5HNTA 1OFDA 1XBYA 3ONCA 3HMCA 4JY8A 4PTMA 3SRHA 3U8GA 3L21A 3NQFA 4K8GA 1V6YA 3H2CA 4GJJA 2YLLA 2E77A 4MB4A 3UR7A 3G3DA 3EOEA 2A7NA 6REQB 3V36A 5A8OA 2FB2A 1JD7A 3VABA 2D24A 4ROQA 1FFQA 4H1ZA 3B06A 5EMMA 2IQDA 1CZ1A 3W1XA 2OT1A 4JTQA 3WLHA 4I7UA 2WBGA 1HO4A 1HF6A 3WH5A 5CBIA 2ZRWA 4S3JA 2NXHA 3KRBA 4YWIA 4MJZA 3ITXA 4X9YA 1H62A 4O52A 1AJ2A 3LQGA 3A3XA 4GUGA 2Z1BA 4IGHA 4AFYA 2DIJA 2OX4A 2QQ6A 4S2BA 2GQ3A 3R0UA 4ZXOA 4O1AA 3ME3A 5HMDA 1JZ4A 3RITA 2GUYA 3DKJA 1G6CA 3MVTA 2CWNA 1VPQA 3CV6A 4JX6A 4QJ1A 3M0LA 4F0RA 1X8CA 3RM8A 3WIJA 1R85A 5AHEA 4IMDA 4QG8A 4GD0A 3UY7A 5C0QA 1MNZA 2A4AA 4AY1A 1ZTVA 3LEPA 1UQYA 1XKYA 1W8GA 1L0PA 3GU1A 4E2BA 5FJJA 3UZZA 1B3WA 1BQCA 2OSXA 3CTLA 4GOAA 2NX1A 3IIVA 3VKDA 4D6CA 2PLCA 3ZVHA 2ZX9A 4J28A 2YCJA 3HPZA 4AIBA 1WKDA 1BYAA 3KWSA 4ZO6A 4YVVA 4E38A 1VEOA 2FFCA 4O1FA 5KETA 4EANA 3F2BA 3ATZA 1PKYA 2YPIA 3IJ6A 4GNVA 3NPXA 4FHAA 4JCLA 4B2DD 2B81A 3N2TA 1ALDA 1J5SA 2ACQA 2FHBA 1W1A1 3RILA 2OLSA 3VPLA 2AOSA 4YTSA 2GL5A 1TRDA 2A3HA 3VGGA 1BXBA 3FEMA 1ICQA 1ZALA 1VEMA 5DLCA 1CLXA 3S9IA 5CJ5A 1TSIA 2KZHA 2IXUA 1KQYA 1PZ3A 1LT8A 2C18A 4HHLA 1U30A 3U5UA 1KFCA 3BOXA 4L56A 4UTFA 3LNPA 4HU8A 4C6EA 1VZWA 4PEKA 3THCA 2ZUNA 1XLEA 2R14A 3L4VA 4CCDA 2BOGX 4Q4RA 4C7DA 1JL8A 3C2FA 4S39A 3LK6A 2PDBA 1ZFJA 2XSJA 1ITXA 5IDZA 3T2QA 1QCWA 1B3OA 3TYUA 2PP1A 5G2IA 1TREA 4HGXA 1R3RA 3S4TA 3CHFA 4JYFA 5HXMA 1EFZA 1VPXA 1IWBA 4CQDA 4HKPA 3A64A 2PWEA 1JZ5A 3POCA 2HV5A 3IK2A 4OUEA 4NXSA 4LXFA 5L6UA 2YXOA 3MUCA 1YW1A 3DFYA 2EO7A 3O1NA 4CCZA 2PDPA 1U1HA 1J2BA 3MSRA 4ML4A 2OZTA 3LLXA 3QBUA 1QU4A 2A6NA 2AL1A 2BASA 1IEWA 3TLQA 3S2NA 3R13A 4K1WA 5D8ZA 3PUDA 4LEQA 3BZGA 4CD7A 4NIRA 1J6OA 4GI4A 3S1WA 3C3UA 4IQLA 1FHUA 3W2JA 2WC7A 3UT0A 3FA3A 3VU2A 2DZSA 3ARTA 1OZMA 4AZGA 3DFNA 2YL9A 1ZENA 1V51A 4WKHA 5MF5A 4OIFA 1A5LC 1GJWA 5AVHA 1XDLA 1O5RA 3RR1A 4E3VA 1QI4A 3AZTA 3B4UA 1XJBA 2D2GA 3PPGA 2UY5A 2YZ5A 3HGRA 1XWYA 1AQFA 4HMNA 3E1F1 3EA3A 4W9TA 3RFAA 3GZ3A 2C1IA 1S3TC 1NU5A 3MM8A 1LM1A 1YDNA 2VELA 3U7VA 4GA8A 4S2CA 1ISWA 4Z1AA 3TFCA 3NSMA 3ELFA 3IJ9A 3LLFA 3BG5A 4Q4MA 4RLIA 5JUVA 4NT0A 1UC4A 4I5UA 4HYVA 4FXJA 4XAZA 2PLKA 3OIXA 1NQ6A 3FJ4A 2ZFAA 3CL8A 3M7WA 1VFTA 1WOBA 3VFCA 1TA3A 5AFDA 1SZGA 3C52A 1DIKA 1A5AA 2AQVA 3WF4A 4O4VA 3NNTA 1SMDA 1W32A 1TYGA 3MUXA 5IRPA 1M9HA 2VCCA 4IIFA 4R7JA 2QIIA 2ZUVA 3LA4A 1X6LA 3PUOA 1UZ4A 4GQ0A 3TYZA 3QY8A 2NVCA 8RUCA 1KCLA 2CLFA 2OTDA 3NXLA 3OHIA 3KOYA 2O9OA 3AFBA 4HHHA 3TJLA 4IL0A 5J5RA 3AROA 3W87A 1LT7A 2Z1XA 4FXFA 1KLZA 3UP8A 2R1PA 4A8LA 1W2VA 2WJFA 4E8DA 1H7PA 4BI7A 3VE7A 2X1TA 2YGYA 2AQWA 4KRUA 5HULA 3TYDA 1H7OA 1FP9A 1G7VA 3VIPA 1K02A 1K6WA 3NPUA 3TQVA 2YBVA 5CH9A 1L6YA 3UWUA 3KOZA 5HPCA 5HNRA 3IGXA 3GB6A 3NQ7A 1RXOB 4QNWA 4I6VA 3DESA 5E6ZA 3RF9A 2VL4A 1K77A 1E43A 2GQAA 4MB5A 3SSZA 5A3HA 3G1DA 2D0HA 2QJMA 3TLLA 2BVDA 4D1JA 4NYUA 3W00A 4C6PA 2PODA 1CDGA 4L61A 5JH1A 1G67A 3DC0A 4Q8QA 1XBVA 3N1AA 5H2ZA 4CVUA 3K1GA 3N2BA 4KS0A 4JQ3A 4UC5A 1A47A 2J25A 2OR2A 4RZ5A 3LHZA 4GYPA 4ICMA 1R3WA 4U10A 4KEVA 4F2BA 5HK4A 4QEEA 1GOWA 1OX4A 1PKMA 4S38A 1V8EA 3H7RA 4NYYA 3SUUA 1XIEA 3H22A 3KBJA 3VMPA 2X16A 1LBMA 1DJNA 1EB3A 1RJQA 3SCVA 2JGYA 5HINA 4ZO9A 2Z1KA 3B3DA 4HNOA 4UTWA 1V03A 1W91A 4S3AA 4WQ6A 1MUMA 3ANYA 3W84A 4HNTA 1ZAIA 3SBFA 4NY2A 4Q7IA 1EO7A 2J13A 3FX4A 2J7CA 4OV4A 1O5QA 1H61A 4ZA0A 4TU1A 2V5CA 4O17A 4MAZA 2ZA1A 4J3ZA 2W4XA 4UXDA 4F48A 1EP1A 1X8FA 2XYLA 1RVKA 3VIHA 3TC3A 4MY9A 1J12A 1I75A 3IK4A 2V5DA 3GNPA 1VPYA 3N3MA 3PNZA 3EWZA 3P14A 1F73A 1LP6A 3G1SA 4NX5A 1FCVA 4BR1A 2OZ3A 4CKQA 1IEIA 2XFYA 3UU0A 1WO2A 2F2HA 1FWWA 1DP0A 3N11A 4M6UA 3AAMA 2GSHA 2QCDB 5T91A 2G95A 3DAQA 3ZWSA 3FA4A 3WEOA 3C0SA 1Z3NA 1TX0A 1CGUA 4OECA 1ZJAA 2D0GA 1XQKA 4XUYA 3S9ZA 2GVYA 4PCTA 4X2RA 3SUWA 1BRLB 2VGFA 2HNHA 2PWGA 1W31A 2NQZA 2ZRUA 5J04A 4CNOA 1OFPA 2VC5A 1EJ7L 3KW3A 4MF4A 2G50A 3R0KA 1YX1A 4X2PA 3LSCA 1GYNA 2TODA 2HPMA 4FLQA 3KL0A 2WVVA 1IR2A 2ZC8A 4I5RA 2XGBA 1A4LA 4R27A 4AZ5A 4UTJA 1E0XA 1R5YA 4XIMA 4ZOAA 1BVWA 1RJRA 3RXZA 3F4VA 3LI0A 2F38A 2CLPA 1UWQA 1SO4A 4WIWA 3VZXA 4BK9A 1GZGA 2NZLA 1AVAA 5BWFA 4O0QA 5AKQA 1HXJA 2HVOA 3RLGA 3VOIA 4MZYA 3CUJA 5IDIA 3VIJA 2VC9A 3PBUA 2Z1SA 5H6HA 2QHAA 3ZIZA 5HR6A 2YA0A 2PC8A 3UVIA 4E2VA 2P5NA 2OB3A 3GAKA 5KSWA 4G9PA 7A3HA 4F79A 1FKWA 1FX6A 3AS0A 3I65A 4IPPA 3IEBA 1WQ5A 2HS8A 1J10A 4QR6A 2H9AA 1M7OA 3E74A 1IT8A 1DV7A 1OC7A 2QAFA 3PNUA 1KTCA 2E67A 1SR9A 3IS4A 4Z2HA 3ANVA 2W67A 5D9NA 3VM1A 2GUUA 2XDFA 4ACYA 2CHNA 1PYFA 4UQAA 4MUZA 1E70M 3CWNA 3OBEA 3W38A 3GDMA 3V0SA 2HK0A 4JDYA 1R7OA 2R91A 1XBZA 2UV8G 1ZBKA 3L66A 2RH9A 4XD5A 4LUJA 2AAAA 3LHUA 1P0NA 3VTRA 4KCTA 4QJ4B 3E2RA 2DSWA 3VLZA 4UTIA 3QSTA 3ARZA 5MKGB 1A5SA 4F4RA 4XVDA 1FQ0A 4NJHA 2J7BA 4HCLA 3P0XA 8XIAA 2VRJA 1FUYA 1MUWA 3PTQA 3OP2A 1WCGA 2YXGA 2ZRXA 3QQ1A 2V38A 4N9BA 6REQA 1EH9A 3A13A 3WDRA 3UZXA 3NIYA 3NJ3A 4ASTA 1C3FA 4BQ3A 3VKTA 3AHVA 4H8HA 4M29A 1XSJA 3CM4A 3GNDA 3B9AA 2B0MA 1B2YA 4PN2A 3VI2A 3WLIA 3AIBA 1AA1B 6TAAA 3QY7A 3LXBA 1G4PA 5G1MA 2PTXA 1TTQA 2BTMA 3MSGA 3I7QA 3DG6A 4NASA 2VQUA 3ZT7A 2UY3A 3LZ3A 1XLHA 4L9YA 4RDYA 2OWCA 2YDQA 3R43A 3WLRA 2WKJA 1KFWA 3WNKA 4AEEA 1A5BA 5E9XA 2INEA 3CUGA 4GISA 1M7XA 4FOUA 4LNCA 1XP3A 1XLLA 1ISXA 3Q45A 4NVTA 4ADUA 4AIEA 5CZJA 2PWUA 4GI8A 2WNZA 1IZJA 4IGSA 1GQJA 5G2WA 4UTLA 4AZ6A 5ECVA 4JEQA 4XZ9A 2CLKA 3OJGA 1JD9A 1W56A 1SGJA 4B9ZA 1BTMA 1CENA 3FHAA 1M1BA 4QS6A 4IX2A 3L65A 4IUGA 5CG7A 4WXYA 4D6DA 1WZKA 2NWSA 3L4UA 3NO5A 1GQLA 1W1TA 1KKRA 3EOSA 3FLUA 1Z32X 3CMJA 3PK7A 3MHUA 2V5JA 3H2NA 5K7JA 3HTWA 2NT0A 3ARQA 4PBGA 2RDWA 3KE0A 4M81A 4MNJA 1I2OA 3AIQA 4QLKA 4EPEC 3VNKA 2CLHA 1YIXA 3PWGA 3UYIA 5REQA 2F7FA 4MB1A 2YLAA 2J9YA 4AZIA 2OCZA 3I4EA 4J3WA 1HVQA 1P0DA 1VBUA 2A3EA 3AMGA 4A3YA 3FVMA 1XFBA 1GGOA 1DJQA 2IPWA 4ZZ9A 3INPA 1KA9F 1YXYA 3CB8A 3MUY1 2XWDA 3PB0A 4RXFA 2VENA 1EKOA 4XKYA 2H3BA 2YL6A 5RUBA 3ZOAA 1FWEC 3AJ7A 3UEQA 1M5WA 2XVNA 4HCDA 3EX1A 2OODA 1L6SA 3GEOA 4N2YA 1K4HA 4YU1A 1B3YA 5D4YA 1HX0A 1K7EA 3RIKA 3N13A 4NI3A 3KL5A 1Z69A 3L7RA 4NQ1A 1E1FA 3SO7A 3W9ZA 1JFXA 4W93A 3W7IA 4PSPA 1IZCA 2RGLA 1E0UA 2Q3OA 4KFOA 4F3HA 4J27A 2ZA2A 3M9YA 3TFXA 2PGFA 1F05A 4H2HA 3R4IA 1DTUA 2XTKA 4B5UA 1LRTA 2FPYA 2V8ZA 4BI6A 1FDZA 3EX6A 3S5OA 1CGVA 1TFVA 1C92A 4MYXA 3ZM8A 3VO0A 3AIWA 1UASA 3AZRA 1F3WA 3S6DA 4V1XA 2YL5A 5I3JA 3LHYA 3CT2A 3HB9A 2D69A 2QCCA 1DIOA 1XLMA 2ZZ4A 3A21A 2WOQA 3WQFA 3W7QA 1AH0A 2A1YA 3P6LA 2PDWA 3EXSA 1XHGA 3GHUA 1UBSA 3WNNA 3Q67A 1SJAA 2VOMA 3LX9A 3HPAA 4K38A 1GVEA 2YDAA 2ZXAA 1JCJA 3VGBA 4PSRA 1V79A 4HA0A 3QLLA 4ORIA 5D9PA 3BXWA 1J0IA 3FYYA 1UOZA 4ECLA 2NT1A 4DX3A 5BMWA 4FXSA 2OELA 2FVKA 2IPFA 5KZDA 1H7WA 3FIGA 1TV8A 3OYXA 1L2UA 3TWBA 1FWBC 3SUVA 2IW0A 3W1TA 4WCJA 1KFBA 3PAOA 1NSJA 4MY1A 3NG3A 2VR5A 4UZSA 1OK4A 1A50A 5AECA 1QWGA 2VMFA 1U2YA 3RMJA 4GX8A 4AHOA 2OG9A 3VOHA 2CHRA 3EX4A 3GH7A 2PDFA 3S46A 5EY5A 4AD2A 3SQMA 1ODZA 2PP0A 4ADTA 1G01A 2OEKA 5AY7A 3LU2A 4H8UA 2QJGA 4B91A 4L4LA 3IIPA 3NEVA 1R38A 3E9AA 2WMIA 3R1ZA 2CXEA 4XZHA 4BS0A 5PTDA 4HZMA 1FWNA 4RNIA 4PUWA 1OG0A 2NQHA 1DOSA 1QXLA 4K39A 1KD0A 3CIXA 4XAPA 1TJRA 1HVXA 3LPPA 3WH8A 2R1NA 5A69A 3VKRA 1SJBA 2IKIA 4EKJA 2WMFA 2R6OA 4YLWA 2CETA 5AC6A 3BMVA 4JHMA 3GIYA 5I3DA 3TJ4A 5CGMA 1OQFA 1TELA 3UWVA 1N8IA 3OB8A 1UC5A 3MKKA 1X1ZA 3NM1A 1NVMA 1UP0A 1CT5A 4RK8A 3BLPX 3W26A 1O60A 2QR6A 2Z27A 3EGJA 2INZA 2HE8A 1C93A 3U9IA 4ICNA 4N9DA 2XH0A 1MYRA 2HK1A 3WUEA 5EKYA 5HWJA 2D2OA 1T0OA 1PTGA 4D1IA 3CQ0A 1O1ZA 1LL6A 1QAPA 2YBUA 3AJXA 3CZLA 3WJXA 4N6FA 3E0IA 4MG4A 2RUSA 4C5YA 4K6AA 5D2XA 1NH6A 2YR1A 4MWAA 2AGTA 3SCPA 1I4NA 5IM51 1E0WA 1RK6A 3TTSA 2NX3A 3BMWA 2BHYA 4LGXA 5A95A 3PHAA 4BCEA 2Y61A 4Z1CA 3LOTA 1ADSA 4O12A 1I2PA 2VEGA 1TV4A 3NSXA 2FH6A 1LORA 1GVIA 2UBPC 3NQAA 2GVGA 2H8XA 4B90A 3L2IA 1JDDA 1PXGA 2JK2A 1T99A 1I0BA 4WJXA 5F2MA 3F5KA 1UW9A 3ITTA 1EQPA 2XZ9A 4GUJA 4W7WA 1JG9A 3T0TA 2AAMA 4HMDA 1H5VA 2ZZ7A 3WDIA 4JNMA 1OB0A 1JAKA 5E5CA 1HZYA 3SJ3A 1VFLA 4QROA 3MW7A 5EYWA 4AB4A 5GJNA 4OOZA 5K2ZA 2ZDSA 2FTPA 3FYOA 3RR4A 4GQGA 1VC4A 3DUGA 3G0SA 2NUWA 3OLIA 1MFUA 3T44A 3BE7A 1US0A 1H50A 1SZEA 3K5XA 3QV8A 3FOKA 4MKSA 3TKFA 3LHWA 8XIMA 1KM2A 3BGAA 4AVNA 3L0KA 4AZCB 2J9ZA 1IGWA 1SO6A 1TPVA 4IJRA 1Z9AA 2Q01A 3QLDA 3G2GA 2WZIA 4A4AA 5H8MA 1L9WA 4DO7A 4ACZB 5HUOA 5KMYA 2AGKA 1T40A 5H91A 2W92A 3II1A 4DJFA 3URQA 4XAGA 4MY8A 1POKA 3LN3A 4PFMA 3W7HA 2CKRA 3WMCA 2FVMA 2E7FA 4ZOBA 5DANA 1W1B1 1W54A 4JIPA 1RHCA 2ZZ5A 4DBSA 3NL3A 2G37A 1O4UA 1IYXA 1TJ0A 2FGBA 3GTHA 4C6DA 4S1FA 1VFUA 2B4GA 2PWFA 3TYBA 2BFGA 1O66A 4KF1A 6ALDA 4TR9A 2DEPA 4Y9AA 1AZ1A 2I56A 4MSSA 1PKLA 4D8AA 4XISA 4Q8OA 1I2RA 4UUIA 2GVJA 1DIEA 4IPIA 1CB2A 1LOQA 2A6LA 4NJIA 5CG0A 4C1NA 4H01A 3EWDA 4OTKA 4NSBA 3STGA 1O68A 3R5EA 2XSXA 3IJ7A 3H2MA 4AVFA 4HIBA 1ZY9A 2ISSA 3A5VA 4D71A 3T55A 3I3EA 3WLJA 1RY8A 1KW1A 3VKPA 2PDHA 3LUTA 2O56A 2DQWA 1ITQA 1XC4A 3XINA 4Z2GA 1NY1A 3AI0A 4YHEA 5CEWA 1O12A 3ITGA 1M68A 2O4QA 1THFD 4HK7A 2ICSA 1Q7ZA 4C60A 3C2EA 3PUGA 2XU2A 4JIQA 2OT0A 4W8BA 1P7TB 1V6TA 3A22A 4OUIA 3WLQA 1NFBA 1XXXA 3PBWA 4Q6XA 1H7XA 3JZUA 3WQPA 4YTRA 3TN3A 4Y9OA 5AC7A 3KVKA 3WSUA 4NZ4A 1VENA 3NCOA 3CUIA 4PCPA 5FEXA 1ISZA 2EG7A 4HK6A 5FJOA 1GVRA 2D1ZA 3W1NA 9CGTA 1X1NA 3MCMA 4LS0A 1LL7A 4L1GA 5DQPA 2QCHA 3RG6A 5K3VA 1GWJA 1JYXA 1JULA 3RCMA 4B3LA 1QI3A 2FYMA 3PBGA 5DBUA 2XPKA 2WZHA 2XZ7A 4RZ4A 4WDXA 3SN4A 3U57A 1ZJ8A 5CPLA 6A3HA 3MMTA 3GG1A 3EWCA 4GMEA 4HYWA 4NILA 2NX9A 3VOGA 1C29A 4ZQNA 2HZGA 4J2PA 1Y5VA 1MEWA 1KGWA 3L5MA 5BROA 4YIWA 1NP0A 3O15A 3ICJA 4QAIA 1JNDA 2AL2A 1GQIA 1GTEA 4UQCA 4MMWA 5LHFA 3FDKA 1SPQA 1VJSA 5XINA 4I7WA 4JTLA 1TWIA 4G38A 1ZJHA 3LTPA 1GEHA 3ZFHA 3R8RA 3LMYA 4IWWA 2ZRVA 2Y89A 1VFFA 1G4SA 3G18A 4C6FA 1BYCA 4GWEA 3WQ6A 4XZBA 2A3LA 2XIQA 5KTLA 5JH2A 2BX7A 3GSMA 1UZ1A 4F8XA 3DC8A 4LVAA 3B0VC 4FZIA 1YKWA 3G5EA 3TMQA 1ZB5A 2R8WA 2V5BA 4JIRA 1GVSA 4DZAA 4BF5A 3VIIA 4IG2B 2E28A 1PX8A 2PS2A 4YNGA 2XVGA 2VXNA 2F2KA 4DYKA 4AC1X 2F6XA 3QGVA 1OFRA 3ENLA 3HFTA 4QAWA 3GNNA 1MW2A 4JEJA 3APYA 3QR0A 1XRTA 1AZ2A 3T6CA 4MJ2A 3TH6A 2QDGA 3UZWA 1PVNA 2QPUA 1LBFA 3NQ6A 1FWCC 3BW2A 2CCRA 2CLMA 4PMVA 1KBKA 2Y5SA 2YYTA 3P5YA 2OO6A 1JZ3A 4DY1A 4LY8A 3S2MA 2QW5A 3R89A 2I16A 4AZ7A 3W7DA 1G4TA 5EB8A 4JTIA 2ZKMX 2ZDRA 5L9FA 3WUGA 2WB5A 4LNYA 3HG3A 2CLIA 1IXNA 3FS2A 3C4UA 2WHLA 1BVZA 4M82A 2E9BA 1XYMA 2FGLA 4WK9A 5TBOA 3SFKA 3LY0A 3CHVA 4YTTA 2OOFA 3TNBA 2QNEA 2CHOA 3ANUA 3N9KA 2BS9A 3QQWA 3I7RA 4EK7A 3R12A 4LVFA 4OFCA 1R3QA 5CPNA 1V6UA 1XCXA 3AZSA 1H4PA 3TTQA 1PKNA 5FOOA 2QUNA 1EA0A 2PBOA 1KM1A 2VOTA 4M6QA 4KEZA 3REQB 1Z6KA 3WLNA 4Q8TA 2BDQA 4DXKA 3TZNA 5CBJA 1JFHA 1SO5A 3H4XA 3ZLFA 3T0DA 1UD6A 4RE3A 2V5KA 2ACSA 3DECA 2ZA3A 3TOYA 3OVQA 4AZCA 3SZ8A 3MKCA 1QPQA 4KCWA 1L2QA 4D6FA 4AIOA 3OQ8A 1DJGA 4Z08A 3EPNA 3IGUA 3SRFA 5CC3A 1MNSA 3T0BA 2BG5A 4WUIA 1BF6A 8CGTA 1ME7A 2QV4A 4O13A 4WDTA 3UWWA 1LDCA 4QG9A 2POTA 3VZYA 3M0IA 3MMBB 4QS5A 5DMMA 5FSEC 3T0AA 4FNUA 3T78A 4GZ7A 5BOFA 1N8FA 3GZAA 1LTDA 4MPKA 4AUBA 3EX2A 1LRQA 1XRFA 3HPXA 4F0LA 4GFIA 1AMKA 2PD9A 3QPYA 3WH6A 4O1EA 1IZKA 3DG7A 1Q6LA 2W27A 3O8AA 4FB7A 2GUBA 2WZTA 3EZ4A 3KWXA 3I6EA 2QCMA 1XLJA 1EO5A 4HOXA 2D73A 4CQBA 3PB2A 3E0WA 3S3GA 2VD8A 4PTDA 3HJEA 1XYAA 3OBKA 3VM5A 4O28A 4URIA 3NA8A 4JTTA 2VTFA 3W29A 4I9TA 3B0UX 4JL2A 1UD5A 4Q4OA 1HO1A 3MWAA 1OFBA 2ZVIA 1TZ9A 2J7DA 1ONEA 4TV6A 4L80A 4IL2A 2PBGA 4JOMA 4WHBA 1JQVA 2C0HA 4W8LA 1W9VA 3M5YA 4WGHA 5DXYA 4MUPA 1HL8A 4REQA 3OVGA 1B3VA 4MIMA 4LYPA 1MQRA 5HQEA 5DCDA 1KFJA 2ANUA 3K4DA 4JD4A 4V27A 5LKYA 1I45A 1HG3A 4PULA 1ONXA 1XBXA 4ATLA 4GINA 5AC8A 2DSKA 3CC1A 3N14A 1RA0A 5K4XA 3APGA 3FXGA 1ZPTA 3W71A 4NAEA 5C6MA 3MBDA 3N34A 3EKGA 1JF5A 2NUYA 3LD5A 4D6IA 1ZL1A 3CQJA 3FSTA 3W76A 1ITUA 3OVPA 3GR8A 4HSHA 3WFZA 1E1CA 4GGHA 2HQAA 1DJHA 4AF0B 3SQSA 4EXBA 1W3TA 1EYWA 4OGZA 1GKQA 4JTGA 4DUVA 2DFAA 4D6GA 1WXZA 5D30A 3GXTA 4W88A 5C7HA 3PJWA 3PZ9A 4LQ1A 3BTNA 3T0CA 1IWAA 4UTUA 3HG2A 4QSHA 3UCQA 1T8XA 2PRMA 1JYVA 2FHCA 3TVAA 3LCXA 4M19A 1J2WA 3GW0A 1GVFA 3H55A 4LS2A 1VAHA 4N42A 2DSZA 1Q2RA 2FZDA 1UMLA 4W87A 2DY3A 3VX0A 3IIZA 3THUA 4CCEA 3F4NA 3DFTA 2Y2WA 3BV7A 2V30A 2CZEA 3F5LA 3W24A 4YWSA 4PRTA 1XIJA 1J0JA 3G77A 2A7RA 4AWEA 1RQEA 1YRRA 2PDXA 1F61A 3S1VA 3KOXA 2QVHA 1GKPA 1R9ZA 4TIMA 2GGJA 2PDKA 1AL7A 2Q6ZA 1B5TA 3W73A 1KRCC 2V81A 4JFSA 3WQ4A 1KQZA 3GVQA 4AX6A 1I1XA 4MWAD 5HATA 3DERA 1VLWA 3SJNA 3TSMA 3SUSA 4A3RA 4GO9A 5D2VA 1UR8A 2QS8A 3RX4A 2OQHA 1GHRA 3G6MA 4UR7A 1N8WA 3ZSTA 4FNTA 1U1UA 4KWOA 4PUNA 5CPQA 4AZHA 1QPRA 1AL8A 1HJUA 3S2LA 3UCCA 2X42A 2RJGA 1M3UA 4NZ1A 2GDUA 4W89A 4PCFA 3RPTA 5A6BD 1MDLA 4UB9A 3QQ0A 1AD1A 2PD5A 3QGAC 4W5ZA 2HRWA 1R6WA 2QCEA 1EZ2A 4B5NA 3F4WA 3AMCA 3AU2A 2IUZA 1T41A 4AD0A 5CC7A 5BWAA 1TJ2A 1VFOA 1FWTA 3NEHA 4F0SA 1UH2A 3ID7A 4O8RA 1RUSA 2X7VA 4AC7C 5TQLA 1DJXA 5CAKA 3ALFA 1SM9A 3TAOA 1A0DA 3F2CA 5CKSA 1O5KA 1TMHA 4YMZA 2EHHA 2FDSA 1MEIA 4HK5A 1LQAA 4XAFA 1CGTA 3EA1A 2PFHA 4O14A 2NV2A 3IUIA 1H1NA 4PMRA 4QFUA 4UTWC 4DM1A 1AOPA 3W1MA 4ENLA 1WDDA 1WAWA 2X2GA 4ZQRA 1FWGC 3WQGA 1I2QA 3UXIA 4J40A 2A3AA 4LUSA 3A47A 1DJYA 3R0DA 5E09A 4HCHA 4F40A 1FVPA 3M16A 2VCBA 4I6KA 2OKOA 4RPQA 1Q7QA 5LNUA 1NEYA 3VDCA 3ZSSA 4ADSA 3DDMA 4EF9A 1FOBA 1S2VA 5A8QA 4PODA 1PJ9A 1RLCL 3DH7A 3G6LA 3K4AA 1RLDA 3EB3A 3FSUA 3HF3A 3WD4A 2HVMA 3CEUA 1ELSA 3B8WA 5IHRA 3TV8A 1ZAJA 4P5UA 1ADOA 5LIWX 2YA2A 3W7OA 3AMKA 4P7NA 1HW6A 4LCRA 3C2OA 2D23A 1OEPA 2NQ5A 4S3KA 1EQCA 1WDWA 4IFKB 3U4AA 3GTIA 1CCWB 4MJMA 3EMQA 1H2JA 3ORWA 4U31A 1HP4A 1KLYA 3V1PA 3MZ2A 2Z4GA 3HBLA 2CZDA 4FNPA 2XIOA 4V33A 3N19B 4IM4A 1AG1O 1CWYA 3FK4A 3N9RA 3ZMRA 1XCWA 4P61A 1UBPC 5G4HC 2VDHA 1OX5A 1DQXA 2O4MA 3G3MA 3LLDA 4GCXA 1KM6A 3NDYA 4JKMA 4ONVA 1JDCA 1RA5A 1JPIA 4WD0A 2PDYA 1FH9A 4ZTYA 4CUCA 5E9AA 3MC5A 1EGVA 1JPKA 1JUKA 4JYEA 4RDZA 4XZNX 2Y63A 3KZSA 5HJLA 3DOPA 4AY7A 1IHIA 4FNRA 5AHNA 1JUBA 4JIHA 3SM0A 5CSYA 3F4DA 2BB0A 5KZ6A 7TAAA 3M5VA 5FKYA 3UG3A 5C8BB 2ZXQA 2GDVA 3LCLA 3BAWA 4LUYA 2G0WA 4RNJA 3O6AA 4Z2KA 1EL3A 3FJ6A 1NDZA 3VDBA 3ABQA 1IIGA 4N02A 3DBPA 4UFJA 1R47A 2IKHA 3IACA 2OXNA 5FEZA 2PLJA 2YDRA 2HXUA 5AC5A 3WL1A 3I3DA 3GXPA 3DX5A 2ALRA 1FDYA 1UIPA 1M04A 3BVJA 3CQHA 1QNQA 4JTJA 1T7LA 1UR0A 3HV8A 3RRAA 2GOUA 4IP7A 1DEDA 3BSMA 1DHPA 1GG1A 1BD0A 2GWGA 1A4MA 4QTGA 4Z2LA 2VEKA 1HKWA 2DW7A 2DQXA 4ES4A 4AEFA 4XBJA 2WMGA 5I7GA 5D37A 1TJPA 4IF2A 2E0PA 1S1PA 1JCTA 2Z6JA 3LM3A 3V0TA 3CS2A 4AD3A 4CQCA 5GNZA 3DGBA 5CSUA 4M24A 2VRQA 3A9BA 3GXDA 4O53A 3QV6A 2AKJA 3L4YA 4TX8A 2E68A 4XV0A 2PDGA 4XBSA 1F76A 2CERA 2QF8A 3CQIA 1RAKA 4OU1A 1GOKA 3CAKA 1BYBA 3W86A 1UR9A 1HNYA 4JN8A 3W7GA 4RCXA 1H7RA 3ABOA 2X09A 1Q65A 8A3HA 1ECEA 4HPJA 1K9EA 1OBAA 4N9EA 4PB4A 3NPWA 3W85A 1CW2A 3TNOA 2OGJA 1JZ6A 1XCFA 1EEXA 3KVLA 1BLIA 1HKKA 1KTBA 4MZ1A 4R9XA 1IQ8A 2W79A 4X60A 4JX4A 4Q3MA 4G1NA 1OCBA 3WEMA 4CNNA 4Y7EA 1UB3A 1PEZA 3QFWA 2ZWYA 4CNSA 1M65A 2PRHA 4JN7A 5A8NA 1DIDA 1W9UA 3PG9A 1YLVA 4LS1A 1XH2A 1XF0A 5DRIA 4O18A 4MLJA 2EJAA 2FQIA 3EOOA 1NWRA 1XR2A 1UWSA 3AXMA 5J5DA 3GBDA 1P7TA 2CLEA 1DE5A 4H8NA 4A2RA 4M6VA 1YXCA 4CN4A 4O11A 4YL2A 3PN8A 3CV1A 3OLDA 2VZOA 4RPPA 4DJFD 1UOKA 4Y9NA 3ATYA 3S5NA 1H5YA 2BVYA 3ARXA 3AQUA 3P2VA 3NZRA 1T8QA 1GJPA 3IAPA 3CUZA 4ZB5A 3K30A 3IVUA 1XDMA 1SZNA 2YCLB 4B3ZA 1JXJA 2C79A 1V3LA 3VGEA 5BXRA 2HDJA 3RHGA 4RW5A 3QRHA 4H9ZA 1P48A 1QTWA 1XPYA 1B90A 2CLLA 2YSWA 3ZVHB 4PMUA 1XISA 3C5QA 4GYPC 2YX0A 4RR4A 1V5XA 3ES7A 5KINA 1C7SA 3AXKA 3AXHA 3LENA 1TUXA 4WY0F 2NVDA 5FSDC 1ZP4A 3T42A 3EKLA 5CLTA 2GDQA 3TYCA 1KO0A 1GEQA 4Q32A 3TUUA 4OOUA 4CCCA 2BHZA 3W70A 2EPMX 1EGZA 1J0YA 3KHDA 5A6AA 3B0LA 2WQPA 3NO1A 1LL4A 2WZEA 1KV5A 1SJCA 1D3CA 3HGOA 5DO8A 1JI2A 3CUHA 1DHKA 1LYXA 3D46A 1CIUA 1U22A 2IS7A 4ZBCA 2X30A 3OGRA 3EB2A 2OSWA 1HUVA 4XO7A 4AD5A 3HQ1A 1JGIA 2OPJA 3ARVA 2WSRA 1LROA 4HU0A 4Q6JA 1BVNP 2F61A 2ZC1A 2G3MA 3K8LA 1MXSA 3U4FA 4TVUA 4HZ6A 4KFPA 4ZR8A 3PZOA 3W6MA 2I9EA 2OX1A 2OLAA 2C8NA 2CZVA 2J7EA 1FRBA 1W37A 3POHA 3B0GA 2QAPA 4HPNA 3S5SA 2V9DA 1EX1A 2YW3A 1I9CB 3W4RA 3H2FA 1C9DA 4P8WA 4DWSC 2QULA 4IFOA 2I5QA 1XX1A 3URNA 3PTMA 2I17A 5M2FX 1OG6A 4FK9A 4XIAA 4DZIA 3CEPA 1GCYA 3PZUA 5AOUA 5JQ9A 2JFEX 3RX2A 4IICA 3WJZA 4C90A 5I0DA 3VMOA 1XD1A 3GYCA 3DBNA 4AG0A 1EPXA 1LOLA 3EDKA 2CZ5A 4QHRA 3DHDA 1YDYA 1PL9A 5ABGA 3CZ8A 3G0UA 3AMLA 3LRLA 2VDIA 3MHGA 5CPMA 1HGYA 1JRBA 1FCQA 1RCQA 3KVJA 4TVDA 3SY8A 5JIWA 2B31A 4ILSA 3TQKA 2VURA 5KITA 3AS3A 2DT3A 3C8NA 1AJ0A 1Y65A 2VFGA 3AOFA 1KBIA 2BWGA 1XG3A 2H6RA 3QW3A 3CXOA 1FY6A 1G9HA 1IEVA 3WLOA 4N7QA 3UVAA 4UMBA 3VCRA 5CLWA 3ECQA 4F0KA 3PY2A 4NJGA 4FAMA 1X38A 3NOEA 2OWXA 1Q6DA 1XGDA 4OVXA 5AYXA 3AYRA 3MP5A 1ONWA 3THAA 4HBKA 3LGGA 4QGCA 3VNYA 2HCVA 3KBMA 4Y90A 3VKSA 1UUMA 4XAYA 3M4HA 3WK1A 3GXFA 1KFKA 1NDYA 3TA6A 4HNUA 3H2EA 4BWLC 5FJIA 1DJZA 1UWUA 2Z1VA 4DJDA 3WCZA 4LBRA 1K70A 3R94A 4C6JA 1UJQA 2V67A 3L12A 5EMYA 2D3NA 1XIDA 3TSDA 5LXXA 3VNZA 3CPGA 4H8VA 4MWAC 2WMIB 1CBGA 3HPSA 3Q94A 4EX4A 1JUEA 3W2MA 3I3BA 2E6YA 2PGEA 3RO8A 1HJSA 3KBVA 3WEZA 2YYUA 3W1LA 3M0ZA 2QCLA 4C65A 2GLKA 4JBRA 1E6PA 2I9UA 3N12A 3R7MA 2UZ9A 3BOLA 2KAUC 7CGTA 3C0QA 1QI2A 2CEQA 3TJIA 3VVGA 4JTDA 1P1XA 2NXIA 2P0OA 4GJ1A 2WNWA 3UWEA 2CIPA 4XZMX 3CV7A 4JTUA 3DKLA 3XISA 4CN6A 5BXSA 1U83A 1PX4A 4B4FA 2XFWA 5D2WA 2VFHA 3QTPA 5DY2A 4XZLX 2W61A 3TK7A 3M07A 3LTYA 3ZQ9A 4N9CA 2QT3A 3LG3A 1YXDA 1KXQA 4GQBA 4AHQA 3WLTA 2TMDA 1CXEA 3BAJA 5C2CA 3AXIA 4LU0A 1JI1A 4JHOA 4LAUA 3EWUA 5DX7A 3ZJKA 3GC4A 5FAJA 2OMAA 5CJMA 3N2CA 4GNJA 2G97A 1W5NA 5F7UA 1QJWA 2O7QA 4IMFA 1CXFA 2BSLA 4MYAA 2OYKA 3EPMA 2E6AA 4DBUA 3U2CA 3B8SA 4B2DA 3PJUA 4LAZA 3D5HA 1C90A 1H1ZA 2O92A 3THDA 3TC7A 2D3LA 1TWSA 1DQUA 2E6FA 1K8ZA 1T6MA 3GC5A 3WBXA 2E4TA 3NDZA 4DJEC 4M8UA 1UUOA 1OY0A 1CGWA 1TG7A 4WDWA 1FHVA 1MUCA 1W3HA 1TVLA 3QR1A 3OR2B 1LLWA 3ZR5A 2Z2UA 3I68A 2VKZG 1XIGA 1H60A 4PUUA 3R58A 2BNJA 2Z25A 3W88A 1R3VA 4CEUC 1GUVA 1YDVA 4GCAA 2Y7DA 3KTXA 4FMVA 1IGSA 3UBPC 2VRKA 3MI2A 1H7NA 3URAA 3WQWA 2PGRA 1CNVA 3QM3A 4O0ZA 4P8XA 3NVTA 5A2CA 3WL0A 2XIMA 3UY8A 3CU2A 3SRKA 5BW6A 4H00A 3BLEA 3B9OA 4DRSA 3QC0A 1H41A 1PHQA 1PIIA 1UIOA 3EKZA 3UZYA 1DPMA 2PP3A 3B4YA 4PC8A 3M0JA 5CPSA 5JBEA 3R8HA 3SURA 4RV8A 4O19A 3N4EA 1F6PA 4Q4KA 1NDWA 4IUOA 2CFFA 2XFRA 1S1RA 3PBMA 3P93A 4H04A 2XH7A 1EF3A 1WB0A 1R30A 4DB7A 4CD5A 3CWHA 3MV11 4HMEA 3VKQA 1I2NA 3VDGA 3TDFA 2DSUA 3TXZA 4ZQOA 1WAUA 4KFNA 1VS1A 3A6OA 1OWQA 1XDJA 3W1UA 1NJJA 3WK2A 1QHOA 3UWZA 2H8ZA 4Q8WA 2A3CA 1TV5A 3UJ2A 3BJSA 7ENLA 4FX7A 4IMCA 1UPPA 3MYOA 1LF1A 3LGDA 4W8AA 2Z29A 2BGNE 2VVNA 4DO5A 3EDFA 4KWUA 4KGJA 4KW2A 2OFJA 4LBUA 3O6DA 2FZ9A 1HJQA 3NVDA 3SCOA 3STEA 3DFPA 4OBTA 1IXQA 2AQOA 1W1VA 2E9LA 2V2CA 5B80A 1PYMA 2LLEA 1TV2A 3CNYA 3N4FA 3ZLGA 4YCOA 4AIUA 1IEQA 1R87A 1MRQA 1RVGA 3PPCA 3LI1A 4M7TA 1RJPA 2QIWA 3BLKA 1A49A 3L0GA 1S5TA 4XZIA 3WMBA 1Q8JA 3F7JA 1KTNA 4L6HA 2Q02A 4EAMA 1ECQA 1D2KA 4NJKA 1XIFA 3MM6B 2BLEA 5DMLA 3GIPA 2A0NA 1J0KA 3QZAA 1YE4A 2GFTA 4POCA 1J4EA 3BDKA 5FL0A 2QCNA 6PTDA 1R3YA 3FA5A 1RSCA 2WCSA 4ZFMA 4A35A 1US2A 1KV8A 1FWSA 4LWWA 3GHRA 4CVWA 3Q65A 4XWUA 3VM7A 4L4PA 3NQMA 2L5HA 2VD9A 1AQMA 4JICA 4JIEA 4FSAA 3HM7A 1E73M 4EWJA 3NXFA 1P6WA 3B0MA 3K1DA 4IMAA 4GZEA 1GW9A 1I6NA 3GVWA 3BUVA 2OGYA 4DZHA 3SADA 3AO0A 4WSHA 1HN1A 3BLFA 3MPGA 1UCWA 4JTRA 4MDOA 4NX0A 3VKKA 3EX3A 3W7PA 2BOFX 3BARA 3RK8A 4CD6A 2V63A 5TAOA 1KBJA 4WSJA 4A8NA 5EBUA 3QN3A 3NL2A 4DJDC 4UMAA 2J8GA 4LBSA 4HYRA 2GGEA 4LVDA 3M0KA 4FLOA 3VKBA 2GYIA 3OLEA 4DBWA 2NSXA 5DN1A 4AF0A 3LXAA 3HGJA 4U33A 2DH3A 4PA8A 2F6UA 1H0GA 3BG9A 3I6TA 2DZAA 1GPFA 1RCOB 5E0CA 5E93A 1TRIA 4IP5A 4PE8A 1VFMA 3OG2A 2E5DA 3N2XA 3DENA 4O16A 1XKJA 4C6MA 4ZB0A 3T8QA 4QDPA 3DXIA 4HSOA 2DZUA 3H26A 5D33A 3GQYA 3P3BA 1W5OA 4S23A 1K4GA 4PUJA 1YMYA 1XSKA 1V08A 4X22A 1GOOA 1XI3A 5BYWA 3M0MA 1B57A 1W3NA 3W2LA 5MHBA 4LVBA 1UR3M 1UWIA 4AISA 3WQEA 1E4MM 4LFYA 2J7GA 3EEZA 4AYGA 3GRIA 5HDRA 3REQA 4U5KA 3EB4A 4DZ5A 1XUUA 4JY9A 5IBXA 3OYZA 2VI0A 1CGYA 1AD4A 3F2DA 3SY1A 2GK1A 3EWXA 3GR7A 4KMQA 2CBJA 4FF7A 1A3XA 4HTYA 1Q5MA 1YTKA 3QR3A 3VIKA 4IIEA 4GYFA 1ZP3A 4M5PA 2J8TA 1WXJA 3S0CA 3KDOA 5F2LA 1NIUA 4PUDA 4AD4A 2VR4A 4BHYA 1AK5A 1NAL1 1KM0A 2CU0A 4GVIA 3WK0A 3WBYA 2VX6A 1WA3A 4NZFA 3KBWA 4C91A 2GGGA 2JIWA 1FCBA 2QCDA 2YA1A 2RJHA 4L7ZA 4JTEA 3R8GA 4DJED 2WCAA 2FZBA 1Z8AA 4TTGA 1UUQA 3UD6A 4TXEA 3MB9A 1CEOA 1YE6A 1B9ZA 4JCMA 4E8CA 1US3A 1U5HA 3TN5A 3JW7A 4KKXA 3UGRA 2C14A 1W3KA 2EQDA 2J7FA 1QR7A 1OF8A 1E4NA 3P67A 2IQTA 3SIZA 3KFTA 2WVSA 1RR2A 3PG8A 1GG0A 3FW6A 5LYRA 3B04A 4OWGA 3S2CA 2VFFA 1R0MA 1Q6GA 1R9YA 1S2CA 4FI4A 5CZSA 2ZOXA 4RNFA 5G1YA 2ZUSA 4CU7A 1FA2A 1KR1A 3NGFA 2GOKA 3GM8A 4YHGA 3N6HA 1JZ7A 4YVXA 5DELA 3HZ3A 4YPJA 1JCLA 4GY0A 1TPC1 5LIUX 1KC7A 1RP8A 4CQAA 4LCQA 1GPWA 4Z1DA 4MNMA 3MCNA 4QCFA 6XIMA 1PX3A 1P0KA 4H3DA 1WDSA 2YDSA 3WQ8A 4AH7A 1EOKA 2YCIX 1UKOA 2ZZ2A 1GOXA 3EDEA 1XLAA 3WG6A 3CIVA 1QO5A 4HJFA 4FR6A 1IE7C 5IFPA 4GQQA 3EMZA 1FDJA 1OCJA 3O05A 2PZNA 3WD1A 3QYQA 4EAYA 1XINA 4GABA 3TTEA 4NHVA 1H1YA 4J9JA 1UWAA 5I6SA 3VOJA 2CZFA 4BY3A 5D09A 2VP8A 4WKAA 4GG9A 2AL2B 4LJ3A 1Q4WA 2RHGA 3EDDA 3W72A 2CLOA 3H70A 4ZVJA 2ZUWA 3V4BA 4MB3A 4U3AA 1GJUA 4UR8A 1V02A 4JFWA 4H7ZA 1QPOA 3QHOA 1C8QA 9XIMA 4QXIA 2QV5A 1LRNA 4DLFA 5I78A 3CYJA 2QMJA 1QRQA 1NM9A 2EG8A 2BY1A 1UD4A 1GVQA 2WHKA 3IRDA 3RRXA 3CIWA 1YTEA 3C3NA 3W1AA 4FF5A 4EXAA 3EDJA 2PDIA 2QPSA 3TCEA 2IXVA 1XIBA 1JPMA 2GZXA 3W1PA 3SB0A 5CPOA 3AISA 5I23A 1B30A 4GC4A 4XSMA 4C6IA 3WBWA 3GS6A 1S5WA 2Y5EA 4XO6A 5AN7A 4AMCA 2PSNA 4GEPA 3VGFA 1QPNA 4AYSA 2J74A 3STCA 1FKXA 4E3TA 3T4WA 3ZZ1A 2GEPA 4DAIA 4GY1A 1EDGA 2QVNA 4V2XA 3NM3A 1E0VA 3C86A 3SCWA 4AVOA 2FKPA 1B54A 3D3FA 4ZXLA 4IPJA 1LOSA 3KS5A 4K8HA 1EX5A 2JKEA 2VC7A 3SRDA 3CZKA 4O0KA 1OZQA 4QBXA 1OT1A 2CYGA 3GW3A 3WK3A 2ESCA 3DYPA 4DAFA 3MO7A 1P1MA 5LHEA 2X41A 3WN6A 5AB3A 1U1JA 5I24A 4YTQA 1BWVA 3GBEA 2P53A 1BQGA 2NV9A 4NNAA 1BHGA 3GG0A 4L64A 1UD3A 4UBPC 1L6FA 3GHSA 4DI9A 4V28A 5FD0A 3IGSA 3WH9A 3ZT5A 1E4LA 3T1GA 3BURA 2C13A 2JBMA 4UFHA 1JYNA 3PSVA 2JALA 3V5OA 3TX9A 4E2DA 4L4OA 2ON3A 4P7QA 4FXRA 2OEMA 3C6CA 4QCEA 3P81A 1Z42A 4B5SA 4N4QA 2J7HA 3UNDA 2P8BA 1WNOA 5FI8A 1LQ0A 4YYFA 1A5MC 1ZHAA 2FPTA 1TPDA 3ZWTA 4UR9A 4HZ7A 1XLDA 4DUWA 3IIXA 2JGQA 3LDVA 1C91A 1Q13A 2J79A 3T05A 4D9PA 4K8EA 1TR1A 1WUFA 1WXYA 1J0ZA 3LERA 1DWJM 1JPDX 2X0HA 1ME9A 3BJTA 3BWWA 1O5XA 2PURA 3VGDA 3N3TA 1JXKA 4EOUA 4Z17A 3GK0A 3UXKA 1ZZMA 1FWFC 2R1LA 1OIMA 1L6WA 3GX9A 5F2GA 4D8ZA 4V15A 4PZVA 3VUSA 3RCNA 1ZBCA 4DYJA 1FTXA 2X05A 3TAKA 2PWVA 5FJPA 1R8LA 1ZRQA 4GRSA 2V4JB 3GO2A 5CZ0A 2Z28A 4C6CA 7XIMA 2E1DA 1SR0A 2IPGA 1GVYA 1TV3A 1QPKA 2IMRA 3H53A 1J79A 2DZXA 4IXHA 3WNLA 4GKLA 3QMTA 4DPQA 4L6DA 1MEHA 2V2DA 3Q58A 1D3GA 4PTXA 1A80A 3QOKA 4R85A 1DWIM 3DGRA 5DRCA 3R11A 4W4QA 4JNZA 2AMGA 4IMGA 4GXPA 3CASA 3NQVA 3LTSA 1ISVA 5BOEA 4Z42C 3ZJ7A 3PC0A 3LPOA 3W7KA 4O8AA 4NNCA 1ZJ9A 4KIEA 4B92A 2ASHA 5CBBA 1V7AA 2UWFA 5K9DA 1ZLPA 2PU0A 5LA0A 1KNWA 3H54A 2H90A 3PFRA 2WVTA 5ENLA 1JF6A 2TAAA 2Z7KA 2VZVA 5GQBA 1K8CA 1LQ2A 3FNDA 1HKJA 4QJ3B 3KCJA 1DXIA 4RUBA 3KLKA 2DVUA 4JQAA 2FPVA 1WZMA 4Y9PA 1EJUC 5HWMA 1FWJC 1V3HA 2DUXA 1IWPA 1KM4A 4GPNA 2PRLA 1YEYA 3COTA 3USZA 3OGSA 1X6NA 1XLBA 3DFSA 2DUZA 1MDRA 3WDHA 3QW4B 5K9CA 2DVXA 3U6WA 2ACRA 2GQ8A 2XN1A 1ZBWA 3A4WA 1PWMA 4XK2A 4M0XA 4JFTA 2ATMA 2ISDA 1A5UA 3DHPA 3PVFA 4GIYA 5I2UA 1W1PA 3W25A 1TQJA 5F4SA 3BK0A 3DU0A 2VR2A 4L1WA 2WWDA 1NOFA 2DU2A 4C5ZA 1GQNA 2X1RA 1QNSA 3VDAA 1YBQB 2YB4A 4BQ2A 2PCEA 3TJXA 2GPTA 4BZYA 1DYSA 2IQ0A 4A3QA 9RUBA 5U4NA 5G4WA 4GQRA 3URBA 1DWAM 2OYLA 1RK5A 4WY0A 3QV9A 3MMAB 4C7FA 3CAWA 1L8PA 1F8MA 1BF2A 2GJXA 3MUZ1 2CW6A 3E2QA 4QE4A 3A4JA 1V6WA 1WYIA 4GUHA 2BY3A 3T4CA 4AXKA 5H8UA 3VMNA 3A4XA 3K46A 1OC5A 1NFGA 1TVNA 1EJSC 3CUFA 3VNJA 3WLSA 1MFVA 2YCKX 1FH8A 3BAYA 3KZPA 4I9AA 3G1YA 3WF3A 4DUXA 5I02A 4QJ5B 1TCDA 4R9OA 2FJUB 3IV8A 1LBLA 2XJ7A 1UQZA 2TRSA 4GFSA 3W7CA 3VD9A 5AZ0A 3BL3A 4QE5A 4GBUA 5FA5A 3CYVA 3AYSA 4XSLA 4E0CA 3VGHA 3WBEA 3OODA 2Z6IA 3P5ZA 1MW3A 3UXLA 3PUEA 2GWNA 2HS6A 5EMUA 1PPIA 2QJNA 4WVXA 3S1XA 1LJYA 4LUTA 3B8VA 3B9NA 4J3VA 5IOBA 5I3HA 2DP3A 3CMFA 2J27A 4EE9A 2WKLA 1ZBVA 1VGAA 4FOJA 1KBBA 5REQB 1TZZA 4I8YA 4Y96A 5I77A 2XVKA 4CD8A 3UW6A 2QLYA 3B0PA 4LSBA 1QHZA 3MZNA 1F4AA 3USBA 3ABXA 4WLCA 1TWWA 1BXNA 3AXXA 3L5LA 1YHTA 4G39A 1Y5WA 3E49A 4J4KA 2JKAA 2WC3A 1EXBA 1VIWA 3AS1A 3BAXA 3NQGA 4QLLA 5EGRA 2Z26A 1PCKA 3GE7A 1F3XA 3BPWA 2ZZ1A 3MM9A 3V16A 1X1OA 3MANA 4ZTXA 4LAMA 2XHYA 3W81A 1RBAA 1TQXA 4DM2A 4HP5A 3D6NA 4IISA 1LUCA 3EXTA 1OK6A 3SCUA 3LV5A 5A2BA 2PTZA 3R10A 2ZTKA 1IR1A 3MMDA 2PDUA 4CU8A 1OVDA 2YZRA 4HA1A 4S3DA 3S8HA 4CGTA 4DVOA 1VRXA 4F66A 1SVDA 5EMKA 4HN4A 3N4AA 1TUFA 3DYMA 1RH9A 5LNSA 3VDHA 3CO4A 4NAEB 5JMUA 4OKDA 3VAVA 3PZGA 4AD1A 2BBFA 4U2YA 2EKGA 5C54A 4M7SA 5ABFA 3VKCA 3U2OA 1LG2A 3MM6A 3RAOA 1V3JA 4UWMA 3MDWA 1JQXA 2J62A 3BSHA 1K7FA 4ZE5A 1EC9A 1OGGA 3HFYA 1RP9A 2ZCGA 4PBEA 1NTHA 4RXGA 3TSBA 1S5MA 2WMHA 4B5VA 3GNRA 5FEPA 2BODX 4I9JA 5FJRA 1ENUA 3BW3A 4H41A 3JZEA 2XSAA 5DEZA 3T7VA 1XC6A 2VGIA 5C71A 2OSYA 3UPWA 3IPWA 2H3DA 1DXFA 5H8PA 2Y85A 2DIKA 1SFTA 4LAKA 4B4HA 1W9BM 5I5RA 4IIHA 5D03A 3OVRA 1MO0A 3TC6A 4ZENA 4JNYA 1AJZA 5HMFA 2GGIA 1V4YA 3H23A 1KXTA 2WW5A 4R5EA 1QI0A 1GZ1A 5C9UA 3W07A 1J6PA 1LZOA 2ZX8A 4JIIX 3FAWA 4K68A 1RD5A 2XH2A 2WQDA 4OBRA 1GZJA 4ZMGA 1N2VA 1EZWA 3VOFA 4LY4A 2WSYA 1RQBA 4DF1A 1V93A 1UHVA 2PLMA 1Q7MA 3MY9A 1VEPA 4G8TA 1KWGA 4FLSA 3W0KA 4PMDA 1JZ8A 3KM8A 4EPKA 1PV8A 2C91A 3LBCA 3S6TA 1Y7VA 2VFEA 4AWSA 2G4FA 2XVPA 1ZS2A 4RDVA 1NF7A 3PFMA 4G2DA 4DO4A 2P1FA 3GUWA 5EBAA 3FDGA 3WUBA 4FLRA 6CGTA 3O6CA 3PZVA 4O10A 1J93A 1VH7A 4P7RA 3SGUA 3OU8A 3V3WA 1GQKA 3I4KA 2PTYA 2EG6A 4Z2JA 4IH3A 3M0VA 1NOWA 4AWTA 1F6YA 1VBJA 3AHYA 1TIWA 4TMCA 1R7AA 2FIQA 3EEGA 3TQ0A 4TVCA 1TTIA 4LT9A 4KEMA 3WF0A 5DXXA 4J3TA 4Q8NA 3ZLHA 2I14A 1O94A 4IMEA 1VIZA 1MWOA 5CZKA 4NJJA 5BRBA 1B31A 4L4MA 4ZSUA 3M0HA 4DPPA 4LV9A 3WLMA 2PWHA 4C1KA 1S39A 4IT1A 4DYEA 1G94A 3SCTA 2CXGA 4B16A 4KETA 1W2PA 2PDNA 2WLZA 3KS6A 2D22A 2B7NA 1ITCA 2PC4A 1KGUA 2QJHA 1XFCA 3MJMA 4E5TA 4E4FA 4X3ZA 3V7PA 2Q3RA 1CLKA 4UOJA 2BY2A 3KRZA 3WF1A 4NL1A 1M41A 4LB4A 1SMAA 1JCNA 4MVAA 3BLIA 1Y8BA 1FWIC 3LCFA 4QEHA 4Q7BA 1YBQA 3W2KA 2REQB 3UXAA 3OBAA 5M3WA 1OIFA 2X1UA 2FTYA 1E6XM 3LB0A 5I03A 3EOUA 3ERPA 4HSNA 4I3GA 2XGIA 3LXCA 1WKYA 3VD4A 3WD3A 1H49A 2WVVB 2ZX5A 1KKOA 2G96A 2ISWA 2VX5A 3JU2A 3WNMA 2PDLA 5FAGA 2BVWA 3SCNA 2NSOA 4DEFA 4MNLA 3UQNA 1F3TA 1AUSL 5KEZA 4WXZA 3OR1B 1XICA 2W6RA 1S2TA 1EP2A 1A5CA 5MKGA 3GD6A 4QIUA 2OEJA 3WUFA 3M6YA 3WZ0E 3B05A 2QJIA 3A12A 1W9PA 4L9ZA 2DZPA 2QPXA 2XSBA 4H9TA 1PTDA 1FXPA 4WSKA 3T08A 3R79A 3PBVA 3NR0A 3ARSA 4FNQA 4PBFA 3W02A 3UF9A 1VP5A 3UR8A 1KCKA 4OBSA 1XLGA 1WE5A 2O0TA 4CNUA 4PH6A 3ARWA 4GX9A 1JRCA 1Q85A 2H9AB 3YPIA 1JJKA 3HQPA 4AY8A 3H7VA 1NP2A 1OGBA 3GTXA 3N15A 4F2UA 1NELA 2WYSA 5D38A 1XLCA 1P6CA 3MVIA 1H63A 1SU5A 8TIMA 3VNDA 3O7UA 4HA3A 2PCQA 4H6RA 2YW4A 4QNEA 4B15A 2VC6A 3U2EA 2Y5JA 2EKCA 2OJPA 2J24A 2PDJA 4HOZA 3QMRA 3WLKX 1XPGA 4UFLA 2FZ8A 2DT2A 2IKJA 3H21A 2VM8A 2EGZA 5AHLA 2V3DA 5C5YA 1V0MA 3A9IA 5D02A 1HIZA 4BQ5A 3LCWA 1YNQA 3KVMA 1JCYA 5HQMA 3VINA 4N4PA 3MT1A 3GXMA 1J5TA 1P0BA 4CD4A 3U3HA 1MQQA 4GO8A 3T81A 5FIPA 4AWUA 3M44A 2Y24A 3N04A 3JR2A 3W27A 1XYCA 1H11A 2EXOA 2Y88A 4BI5A 3UA3A 2I1OA 4QITA 3LGEA 3EAUA 5BU9A 1XH1A 1HFBA 3W37A 4G1KA 1GW1A 3KRSA 3C61A 3H6OA 4R34A 3UESA 3B03A 1U33A 3NQ2A 1E3XA 3EYPA 3PZQA 4J3XA 3MS8A 2TPSA 4MZ8A 1C9WA 1JYWA 4O54A 2WSPA 2PF0A 3G24A 3NPVA 5A6JA 3E0LA 4DJFC 1BPLB 4BWLA 4RV3A 5CC5A 1XM3A 6XIAA 4PCSA 3I6RA 2PE4A 4HOWA 4FPSA 3QF0A 3CAVA 4DI8A 3AC0A 1X98A 1ZNNA 4ERGA 3WJWA 5M1TA 1RCXB 2PWDA 1Q63A 4B5WA 1MMFA 3AS2A 4PGLA 3DEQA 3MM5B 2YL8A 3UZ5A 2VHLA 5BU6A 1AFSA 1TVPA 2E8ZA 3OR1A 4UNKA 4EPBC 5CCZA 2G41A 4QSFA 3B0HA 4KGLA 2P8CA 3RNDA 4HPXA 2VEPA 3QZEA 4NF7A 3LZ5A 1OX4B 4RL3A 3P8IA 3M5XA 4GKTA 4A3HA 1KM3A 3N2OA 1HP5A 1EXPA 5FJUA 3GDRA 5ECUA 4MJ4A 1SO3A 4XVEA 2O55A 3SEPA 3S42A 1S5VA 2PTWA 3DIPA 3W6YA 3VXGA 3GXNA 4RNHA 3DFOA 4ACZA 2GGHA 5G4EA 1QT1A 1EF2A 2A3BA 3HA1A 2WK2A 3VIFA 4KERA 3PTKA 3GVGA 4G7EB 4OHQA 2EPHA 1J11A 3VC6A 3W6LA 1PBGA 2J75A 1J0HA 4ZO7A 3RLHA 3H7UA 3NYDA 3B9EA 5GPRA 3QKZA 4A6GA 2ABBA 2EJ1A 1XLIA 3M6DA 2EPLX 2WM1A 1NWTA 1GVOA 3MI6A 1Z7AA 3GG7A 1OM0A 3JRKA 3T8LA 3CHCA 3TR2A 1JCXA 1FCUA 3TROA 1C7TA 5A8MA 4UQ9A 4M3PA 3UG8A 1UKQA 3VKJA 5AHMA 3OA5A 2VUNA 1O95A 4O57A 3W7RA 2VX4A 3ARYA 3FJNA 1EYEA 3TN6A 4QQUA 2BP1A 1WKFA 2C16A 1C8XA 2X2YA 2ZZ6A 1BWLA 4ZQMA 2P88A 1W5PA 3OG3A 4EF8A 1ZU8A 1DORA 3BG3A 3EWBX 5F2IA 1H09A 3GDLA 4MPQA 3MSYA 3WY1A 3B8IA 2ZRYA 3BLOA 3GFZA 3MSDA 3O0FA 2POZA 1CXIA 3NSNA 3QH2A 4RE2A 3HJZA 4DXXA 1W3IA 2V5LA 4C1LA 2D2JA 3RPMA 1TO3A 5GEPA 3BO9A 1EJXC 2YFNA 1JDFA 3I10A 4HNLA 1SZFA 2REQA 1B4KA 4MDPA 4Z0JA 4A29A 1R3SA 3ZR4A 3HPFA 4P8UA 3G0XA 3BANA 5HOSA 2ATSA 1DE6A 4IQEA 5E1QA 4I7VA 2Z2AA 4PTNA 1QFEA 5I3KA 3MV01 2VDGA 3W7NA 3IARA 2EF9A 1ISYA 4WZHA 2RKXA 4AZBA 5AVNA 3LPFA 2PPGA 7ODCA 2WHJA 4X0NA 2R24A 3C0JA 3RX3A 3IAQA 2F84A 2NQ9A 3NZPA 1A0CA 2D2HA 3E0FA 5LSMA 3OIHA 1WPCA 1P43A 5B7ZA 3LQLA 1EHAA 2I5IA 2WSQA 2V3EA 3F5JA 1V6VA 1BG9A 2PB1A 4GZIA 4Q4PA 1IV8A 1RBLA 1E55A 3NYZA 4CQ8A 1TWZA 4JPGA 4DBEA 4HNCA 1X97A 3PPFA 3V18A 4WDUA 3WMSA 3AHXA 3MMCA 1DJWA 3BJFA 2QUTA 3H4GA 4FEZA 3TEVA 3GC2A 1SFLA 5G1TA 4P7LA 4CN1A 1SJDA 5A6BA 2WSKA 2DSVA 5C2GA 7GEPA 4H9UA 2C71A 3NQDA 2ISFA 2RDUA 3QHMA 3TYAA 3ITLA 3MUAA 3FAXA 5J8LA 4PUEA 1XV8A 1K9DA 3CLWA 1VBRA 1OFQA 3VILA 2X7WA 3TE9A 2PA6A 1KGXA 2J4GA 4E4UA 2GK1B 3P84A 3RN6A 1DVJA 1RPXA 1E9LA 1EBHA 1E72M 5M5DA 1P5BA 1W17A 4B5XA 3NL6A 4J5NA 2Y70A 3K13A 5EFDA 1FXQA 3OZMA 2ZX7A 3M46A 1M6JA 2JEQA 2XSJB 3MM9B 3IUHA 3FGCA 3OGVA 3PZIA 2VYOA 4GIEA 3TYEA 1H3GA 5DMYA 3PPHA 1TWDA 2WO5A 1D7FA 1F2JA 3VCCA 1E15A 1MQPA 1G69A 1V0NA 3WELA 4EPDC 3BICA 2EBNA 5HUPA 2FB3A 1NDVA 1Q8AA 3E3HA 3VFLA 3E96A 3NDOA 3U7BA 4YTUA 1E5NA 3VNIA 1UR2A 3TW6A 2J9XA 4JKLA 5CZTA 2DH2A 1EGMA 5I79A 4JYDA 5DY3A 3GLCA 3AWOA 3TA9A 1D3HA 1ICSA 3IIOA 4NZCA 3DCPA 1WZAA 1I60A 1W6TA 4XKMA 4UCFA 2X40A 1D8CA 2HE5A 1S2WA 2V2HA 5LNVA 3KDNA 3OLGA 4KRZA 3EBVA 1PZ2A 3M64A 2XIIA 4IFKA 4R7WA 4CQ9A 4JAWA 1X6UA 2Y8VA 2G3NA 3WF2A 5C2XA 3FVDA 4OJYA 2J78A 1GORA 5BOOA 4O1DA 1YADA 5GVJA 1OT2A 3RO6A 2HBVA 3E5BA 4FO4A 3LRMA 2GJNA 1LUCB 1A5KC 4PTVA 3SGZA 2P50A 3AIRA 5BRPA 4HPGA 2E5CA 2GJXB 3BAIA 3PF3A 1A53A 2VEMA 4FOKA 3AUJA 1T96A 2VFIA 2YFOA 5A94A 3O9NA 4MADA 1UZDA 3K8MA 4WY0B 3O2LA 4ERIA 3S9YA 5AYBA 3RU6A 1KRMA 3UWYA 4DWSA 2YIHA 2QDHA 1VB9A 3SIMA 3MJYA 4Z1YA 3BCJA 4HTRA 4UIOA 1K03A 1VLIA 2ZTJA 4Q8PA 4OT7A 5BXTA 4FA3A 1BFNA 3PBYA 2WBKA 3WLLA 3CZEA 3CL7A 4J35A 1OC6A 1SFSA 1KCXA 2WXDM 4JTKA 1VJIA 1AW5A 4MFDA 2OYMA 1TX2A 4HN8A 4PRWA 1JPHA 2AKZA 2QGYA 1AMYA 1QK2A 3AU6A 1XLKA 3TU9A 1EWDA 4K3ZA 2C1GA 1B3XA 5A1AA 1TZ7A 4D6EA 4D6HA 4EVZA 3MYPA 3WQDA 5C9XA 3EPOA 3M7SA 4ERAA 1ZCOA 1XRSA 2BXYA 4TX9A 3W7EA 1BG4A 4H6KA 4GHRA 2VFDA 3LCIA 2A21A 2FDMA 1NWUA 2CBUA 4U5IA 2E3ZA 4G7FA 4TMBA 3P7YA 3STFA 2WNNA 4F2TA 3G1FA 1KRBC 3IRSA 3UWQA 3GNXA 3OPSA 2QUMA 2Y8KA 3KOWA 3LMZA 3VC5A 4GNKB 1UD8A 4IGMA 2RAGA 3M41A 3AIEA 3XIMA 2GVLA 3S83A 5T9CE 1I8JA 4WGXA 1ZGDA 3NO3A 4EACA 1CXLA 1FFRA 3ZJ8A 4FIQA 2FMNA 2V6AA 4F9DA 1EEPA 1FWHC 2GJRA 1TTPA 3VNMA 2PMQA 1UP2A 3GTFA 2DJLA 4P8VA 5M03A 2Z00A 3WQ5A 4XD6A 3AYTA 3HMJG 1SFJA 4I90A 1U5VA 2V4JA 4A22A 3UNTA 1TIMA 1KFLA 3TZFA 1QBAA 3AHZA 1QNVA 2Y7EA 2PDQA 1UKSA 3KP1A 4C6LA 3NGJA 3PJTA 3OR2A 4WJEA 3NAVA 3H24A 3CV2A 5HNUA 1TR9A 4KWVA 2F9RA 2C7FA 2HISA 3U48A 1PZ1A 3CH9A 3RMEA 5FESA 1F9CA 1CLVA 3NQEA 1NF0A 3LBOA 1LLZA 2PAJA 4H2CA 1RY0A 4A21A 3BV4A 3OQEA 1FWRA 1W5QA 5CAHA 4BFAA 2W63A 2CNCA 3EA2A 2E5BA 5E0FA 5DT5A 1E6ZA 1GTHA 3HV9A 2FZNA 1LWHA 1X7IA 3VA8A 2V3FA 1A5OC 4AQLA 5I3FA 5FL1A 3MMCB 2C1HA 1DWGM 4HD5A 1Q6OA 2D20A 5GJPA 1E6SM 4PL2A 1QK0A 3CMGA 1QNOA 3IV3A 3WD2A 3ABZA 1QVBA 5I00A 4UQEA 3RYSA 1NFPA 4KT2A 1ZCCA 1QMLA 1Y5XA 3VK5A 4YN5A 4DNMA 3WQVA 3FHQA 1YNPA 1ZJBA 2OZ8A 3TTOA 2O9PA 2DDXA 4LW7A 1AH3A 1OJXA 4O15A 4GBDA 4Q8UA 2X0SA 3AHTA 3Q2DA 1E9ZB 1TMLA 4DWDA 4LAOA 3B97A 1BRLA 2AKMA 1A3WA 4NAFA 3ZVIA 3KX6A 5A6MA 3O16A 5AC4A 4QRNA 4LH8A 2OVLA 4XB3A 3G22A 1HQTA 3RGTA 2NQLA 4ZO8A 1XSIA 1A3HA 1P6BA 3GG8A 4QE1A 5HR7A 1OD8A 2NQJA 1V6XA 2FLIA 3CZJA 2WWCA 7PTDA 4ALDA 2ABAA 3BOFA 1BWKA 2WJEA 3LBMA 5T26A 1EOMA 1UG6A 3ABRA 1ZAHA 4C7GA 1WOAA 3L4ZA 1WDQA 4IG2A 3IWPA 3NOYA 1DWFM 3P74A 1REQB 3WYZA 4WEVX 4E2OA 1JDEA 1VYRA 1QUMA 2CBIA 5F1VA 1K6AA 3OA3A 5HJYA 1SW7A 5CSSA 3GR4A 2V3GA 2R82A 3OZOA 3CWOX 4BKNA 1R2RA 2UY2A 1W3LA 2MNRA 4KRTA 1RV8A 3OOQA 3B8TA 5GJMA 4WR3A 1PHWA 3MMBA 5DT7A 3N25A 5A2AA 4GC3A 2HWGA 1ADDA 1E40A 2YBTA 4FR1A 1XYZA 3E38A 3WFAA 4LYQA 3L23A 4A8RA 3H4WA 1RPKA 3FJLA 1OFOA 3APTA 4F0MA 1XG4A 6GEPA 1XRVA 2V68A 2JF7A 1N55A 4G7EA 1MW0A 3UCDA 3QV7A 2GSJA 4GUFA 1QATA 3RPDA 4OE7A 7REQA 1RD6A 3P82A 3VZZA 1VYPX 2PTDA 3L67A 2PUZA 2ZIDA 4PRRA 2X1SA 3CT7A 1CTNA 1NWSA 3KXQA 4QP0A 4U3CA 4NXKA 3DFQA 3OHMB 3SECA 1SQ7A 4OZOA 3GVVA 5I3IA 5EMJA 1JIBA 3UYCA 3ZJ6A 1XGEA 4L6OA 4M1RA 2GVEA 3STPA 4NZ5A 4RDWA 3N29A 5A8PA 4K1GA 1K1DA 4PB3A 4J1OA 2ZX6A 4MGGA 5FF7A 7TIMA 3MO4A 1E5JA 4Z2IA 3C0LA 5TIMA 3VNLA 3W7LA 3MM5A 4UNIA 1M03A 1E71M 1GHSA 3WX7A 1JNEA 1EPVA 4C6OA 2FZMA 4JTHA 1MZHA 3N2MA 2I7GA 3L0NA 4LEFA 1DXEA 2C6QA 1FH7A 5CPTA 5EU9A 3RCYA 1IEXA 5FACA 6ENLA 9XIAA 3L4WA 1R3TA 3AMDA 4GY7A 3PZNA 1KRAC 3TXVA 2BXVA 1W3JA 4PMYA 3WO8A 2G5WA 1OADA 3MMWA 2DJXA 2BGQA 4LB3A 3DG3A 3WJYA 3GY1A 4IFRA 4MNKA 4ZGYA 1EIXA 3SR7A 1Q6QA 4UFKA 3BCFA 2NLIA 1MZRA 4UOQA 3GH4A 5CSRA 1PE1A 1R46A 1TCMA 4HT3A 4IIGA 4LCSA 2WLYA 1EC8A 1EJRC 3IVTA 5T8GA 3T40A 1I1WA 2DT1A 1RBOB 1Q66A 4US6A 5ABEA 1O1HA 2J47A 1BKHA 2DGAA 2YCLA 4W86A 4AOPA 2W5FA 1TTJA 2DW6A 3WMLA 7REQB 3VCNA 1YPXA 3O07A 3M1ZA 3QYSA 3BSGA 3SDOA 1E0TA 3UZJA 1TKKA 4RJEA 1Q6FA 3RU8X 4DBDA 1OFAA 1S5NA 5IBXC 4K37A 1VBGA 1B9BA 2GSEA 3KBSA 3ITVA 2JQXA 2WMKA 4HNNA 3MM7B 3ARPA 3MQTA 2NXGA 1P0EA 4M56A 3ABSA 4Q22A 4NP7A 1J96A 3MMUA 1ZQ5A 3WQCA 4HHMA 1PDYA 4H6EA 3TR9A 2CITA 2E6DA 3G8EA 4QM1A 1OCNA 2C15A 2Q09A 3QHNA 1EIBA 3KTCA