4S3NA

Crystal structure of human oas3 domain i in complex with dsrna
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
359
structure length
343
Chain Sequence
MDLYSTPAAALDRFVARKLQPRKEFVEKARRALGALAAALRERPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of sensing long dsRNA via a noncatalytic domain in human oligoadenylate synthetase 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords 2'-5'-oligoadenylate synthase 3
total genus 116
structure length 343
sequence length 359
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10421 OAS1_C 2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4s3nA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4s3nA01
4RPZA 1JN3A 1TFYA 4X4UA 4X4QA 1ZQGA 2ISOA 2ZH2A 4O5EA 8ICJA 4RQ6A 3AUOA 5HRGA 3JPQA 2ZH7A 4R63A 2M2TA 3PMLA 8ICVA 1R8AA 8ICMA 4X4NA 1MIYA 4UAWA 4KLEA 3C18A 3RH4A 3MGIA 3JPOA 4FHWA 7ICRA 1R8BA 4PGXA 5CJ7A 4X5VA 4Z6DA 3OVSA 4KLJA 2VANA 5BOLA 3ISBA 4GXIA 9ICEA 1JMSA 5HHHA 1TVAA 8ICQA 4R66A 3AU6A 1PX5A 3AQMA 4K4GA 9ICIA 4K4HA 2ZH4A 4MFAA 4XRHA 2DRAA 2ZH5A 1BPEA 4Z6CA 4M47A 2P66A 1ZQXA 4NXZA 3B0YA 4RWQA 3WFQE 4EBKA 9ICBA 3V7JA 3OVAA 4P4PA 5HRKA 3LQCB 5J29A 4AT7A 2ZH6A 4RPXA 4RQ4A 1XSNA 4TUSA 2BCVA 1ZQEA 2HHPA 1BPBA 3K75D 4QZHA 4KLOA 4RQ1A 4I2JA 9ICUA 2M2WA 4M2YA 1ZQMA 4AT9B 5HRFA 3OUYB 7ICVA 2ZH3A 4FH3A 1MQ2A 8ICUA 3AQLA 8ICGA 3RJJA 4GXKA 5J2GA 1ZQBA 1V4AA 4IQWA 4WBZA 2RFFA 1RZTA 4ATBA 5CWRA 3V72A 3MDCA 4KLGA 4I2CA 4I28A 4WC2A 3TFSA 1UETA 1ZQRA 1ZQZA 1ZQIA 5IIJA 5EOZA 7ICPA 7ICLA 3RJFA 5J2EA 4M9JA 3OUYA 9ICNA 2O5AA 3AQKA 9ICMA 9ICCA 4PGQA 5J0YA 1ZQVA 5J0QA 5D46A 1WOTA 4PPXA 2PBEA 3JZ0A 4LZGA 4NKUA 5J0TA 3MDAA 4RWNA 4YCXA 8ICPA 4I2IA 3C2MA 1RPLA 3UPQA 5J2KA 5J2BA 2ZH8A 4WC7A 3H37A 2DRBA 5HC9A 4F5RA 2IHMA 1JAJA 4P4MA 5F2VO 4QZAA 1MIWA 3HJ4A 1BPZA 2M2UA 4MF8A 3JPRA 3MBYA 4P4OA 4UAZA 4K4IA 4JWNA 4IQUA 7ICGA 4RWOA 4RQ7A 1BPYA 1ZQUA 4RT3A 1ZQKA 3ISCA 1ZQSA 5HRLA 4M9LA 3RJIA 8ICNA 3UQ0A 5J2DA 4F5NA 3C66A 4I29A 4NKTA 4QZCA 7ICJA 5J2HA 9ICXA 5DB6A 4WC1A 5DB9A 4LVSA 3HIYA 2M2VA 9ICWA 9ICJA 5J2JA 4AT8A 4UBBA 4MFCA 4UB4A 3MGHA 5J0UA 4KLMA 4F5OA 2PFPA 5DB7A 3RJEA 5HRHA 1XSLA 2FMSA 4MFFA 4M9HA 4DOBA 2DVIA 7ICMA 5DBAA 3V7KA 2DR7A 2GWSA 2DR5A 3LK9A 4S3NA 2O1PA 2ZH1A 2DR8A 5DBCA 5J2CA 5CHGA 4XUSA 4TURA 5DECA 1BPDA 5CP2A 7ICTA 1XSPA 4XA5A 8ICLA 1VJ7A 3H39A 4RPYA 2BCRA 4X4VA 5J2FA 7ICNA 4KLLA 3AU2A 7ICEA 3ISDA 3PMNA 4I2FA 4PH5A 4P2HA 4AT9A 4O5KA 4QZBA 2BCSA 1ZQJA 4I2GA 3WFPA 5IILA 4RQ3A 4TUPA 4RWPA 4O5CA 4X4SA 4QZGA 4WCWA 1TFWA 8ICTA 3JYYA 4X0AA 4Z6FA 5DKWA 5DDYA 5J0OA 1KDHA 3JPPA 4AT7B 4NM2A 2BCUA 4M0AA 5HRIA 4WC3A 1R8CA 8ICEA 1VFGA 3RJGA 4WC5A 4I2BA 3JPTA 2Q66A 5DEDA 4YMOA 5IIMA 1HUZA 4TUQA 1Q78A 4GXJA 2PFOA 1ZQOA 8ICIA 4NLZA 4XQ7A 4WBYA 5HHIA 1Q79A 4YN4A 4WC4A 2FMQA 5D4BA 4UD4A 4KLTA 2ISPA 2BCQA 3UXOA 8ICFA 2W9MA 5J2IA 4FO6A 4DOCA 4YMNA 4R64A 8ICZA 3PNCA 4NY8A 3H3AA 4JWMA 4M5DA 3UXNA 5HRDA 5DBBA 4NLKA 1NO5A 2ZH9A 1ZQDA 3L9DA 5CA7A 2BPGA 4I2AA 5CB1A 9ICGA 1UEUA 7ICQA 4WC0A 7ICSA 5HRBA 5IIIA 4I27A 4MF2A 8ICKA 3HJ1A 3C2LA 7ICUA 5IIOA 8ICWA 3NYBA 5D49A 4QZFA 3C5FA 3RH6A 1F5AA 8ICBA 4RT2A 4RQ8A 4EP7A 1ZJNA 3GDXA 3RJHA 8ICXA 4AT8B 5TZVA 4DO9A 9ICVA 4IG8A 1NOMA 4KLIA 2PXIA 1ZQTA 5BOMA 4I2EA 7ICKA 4KLUA 5J0PA 4R65A 3HWTA 3WFRE 2FMPA 3C5GA 1ZQLA 1ZQWA 4QZDA 1ZQAA 4UB3A 4PHPA 1MIVA 3TFRA 4I2DA 8ICRA 4KLFA 2ZHBA 1JQRA 4UB1A 5J2AA 1ZQNA 3JPNA 4YD2A 7ICFA 3V7LA 1BPXA 3HX0A 4M9NA 4NM1A 4YD1A 4QZEA 4RQ5A 4PGYA 3HW8A 3RH5A 8ICAA 5HREA 1KNYA 4X0BA 4IQVA 1UEVA 4PHDA 1ZQFA 9ICQA 4FH5A 4LZDA 2DR9A 4KLQA 9ICKA 4E8FA 5BPCA 1ZQPA 4QZIA 1ZQQA 2PFNA 4RQ2A 4X4TA 5J0WA 3OVBA 4XQ8A 2BPCA 1YLQA 4UD5A 1TV9A 5DDMA 4KLHA 4QZ9A 5J0XA 3JPSA 8ICHA 2NRKA 4I2HA 4YMMA 7ICHA 1MQ3A 8ICCA 1ZJMA 4M04A 4E80A 4KLDA 1ZQHA 9ICTA 5CR0A 4UBCA 1OU5A 1HUOA 1FA0A 3OGUA 3C2KA 9ICFA 8ICSA 4NLNA 3OV7A 1R89A 2I9GA 4O9MA 3WFSC 3UXPA 3H38A 4IQTA 1ZQYA 8ICOA 3RJKA 7ICIA 4LT6A 2ZHAA 5J0RA 1KEJA 4RQ0A 4FHPA 4E7XA 4X4RA 4DOAA 4PHAA 2BPFA 8ICYA 4M9GA 5IIKA 9ICAA 4KLSA 3WFOA 4Z6EA 3UPSA 5J0SA 7ICOA 3UQ2A 4UB5A 5IINA 4WC6A 4X4PA 4FHVA 4ATBB 3AQNA 5DB8A 9ICPA 4UAYA 9ICLA 4QZ8A 2PFQA 2BE3A 4F5PA 4EBJA 5HR9A 4F5QA 4UB2A 9ICOA 9ICRA 4X4OA 1ZQCA 4PHEA 9ICHA 3B0XA 4FHXA 9ICSA 2ID1A 4FHYA
chains in the Genus database with same CATH superfamily
4RPZA 1JN3A 1TFYA 4X4UA 4OAFA 4X4QA 1ZQGA 2ISOA 2ZH2A 4O5EA 8ICJA 4RQ6A 3AUOA 5HRGA 3JPQA 3NKUA 2ZH7A 4R63A 2M2TA 3PMLA 8ICVA 1R8AA 8ICMA 4X4NA 1MIYA 4UAWA 4KLEA 5CHEA 3C18A 3RH4A 3MGIA 3JPOA 4FHWA 7ICRA 1R8BA 4PGXA 5CJ7A 4X5VA 4Z6DA 3OVSA 4KLJA 5CFUA 2VANA 4XJEA 5BOLA 3ISBA 4GXIA 9ICEA 1JMSA 5HHHA 1TVAA 8ICQA 4R66A 3AU6A 2FCLA 5JTGA 1PX5A 3AQMA 4K4GA 9ICIA 4K4HA 2ZH4A 4MFAA 4XRHA 2DRAA 2ZH5A 1BPEA 4Z6CA 4M47A 4K99A 2P66A 1ZQXA 4NXZA 3B0YA 4RWQA 3WFQE 4NXWA 4EBKA 3ER8C 9ICBA 3V7JA 3OVAA 4P4PA 5HRKA 5CFSA 3LQCB 2GAFD 5J29A 4AT7A 2ZH6A 3CK6A 4RPXA 4RQ4A 1XSNA 4TUSA 2BCVA 1ZQEA 2HHPA 3PHZA 3NVOA 1BPBA 3K75D 4QZHA 4KLOA 4RQ1A 4I2JA 9ICUA 2M2WA 4M2YA 1ZQMA 4AT9B 5HRFA 3OUYB 7ICVA 2ZH3A 4FH3A 1MQ2A 3ERCC 4EEBA 8ICUA 3AQLA 8ICGA 3RJJA 4GXKA 5J2GA 1ZQBA 1V4AA 4IQWA 2BBHA 4LEYA 4WBZA 2RFFA 2B51A 1RZTA 4ATBA 5CWRA 3V72A 3MDCA 4KLGA 4I2CA 4I28A 4WC2A 3TFSA 1UETA 1ZQRA 1ZQZA 1ZQIA 5IIJA 5EOZA 7ICPA 7ICLA 3RJFA 5J2EA 4M9JA 3OUYA 9ICNA 2O5AA 3AQKA 9ICMA 9ICCA 4PGQA 5J0YA 1ZQVA 5J0QA 5D63A 5D46A 1WOTA 4PPXA 2PBEA 3JZ0A 4LZGA 4NKUA 5J0TA 3MDAA 4RWNA 4YCXA 8ICPA 4I2IA 3C2MA 1RPLA 2ZH8A 5D62A 5J2KA 5J2BA 3UPQA 4WC7A 3H37A 2DRBA 5HC9A 4F5RA 2IHMA 1JAJA 4P4MA 4OAHA 5F2VO 4QZAA 1MIWA 3HJ4A 1BPZA 2M2UA 4HX0A 4MF8A 4NXVA 4WH5A 3JPRA 3MBYA 4P4OA 4UAZA 4WOYA 4O6AA 4K4IA 4JWNA 4IQUA 7ICGA 4RWOA 4RQ7A 1BPYA 1ZQUA 4RT3A 1ZQKA 3ISCA 1ZQSA 5HRLA 4NXTA 4M9LA 3RJIA 8ICNA 5CFTA 5J2DA 3UQ0A 4F5NA 3C66A 4I29A 4NKTA 4QZCA 7ICJA 5J2HA 9ICXA 5DB6A 4WC1A 5DB9A 4LVSA 3HIYA 2M2VA 9ICWA 9ICJA 5J2JA 4AT8A 4UBBA 4MFCA 2B4VA 4UB4A 3MGHA 5J0UA 4KLMA 4F5OA 2PFPA 5DB7A 3RJEA 4NXUA 5HRHA 1XSLA 2FMSA 4MFFA 4M9HA 4DOBA 2DVIA 4K97A 7ICMA 5DBAA 3V7KA 2DR7A 2GWSA 2DR5A 3LK9A 4S3NA 2O1PA 2ZH1A 2DR8A 4OAIZ 5DBCA 5J2CA 5CHGA 4XUSA 4TURA 5DECA 1BPDA 5CP2A 7ICTA 3NWIA 4LEZA 2BBJA 4EGWA 1XSPA 4XA5A 8ICLA 1VJ7A 3H39A 4RPYA 3JCFA 2BCRA 4X4VA 5J2FA 7ICNA 4KLLA 3AU2A 7ICEA 3ISDA 3PMNA 4I2FA 4PH5A 4JLXA 4AT9A 4O5KA 4P2HA 4QZBA 2BCSA 1ZQJA 4I2GA 3WFPA 5IILA 4RQ3A 4TUPA 4RWPA 4O5CA 4X4SA 4QZGA 4WCWA 1TFWA 8ICTA 4K9BA 3JYYA 2GA9D 5B3QA 4X0AA 4Z6FA 5DKWA 5DDYA 5J0OA 1KDHA 3JPPA 4AT7B 4NM2A 2BCUA 4M0AA 5HRIA 4WC3A 4I0UA 1R8CA 8ICEA 3OWGA 1VFGA 3K7DA 2IHOA 4WC5A 3JPTA 3RJGA 4I2BA 2Q66A 5D61A 5DEDA 4YMOA 5IIMA 1HUZA 4TUQA 1Q78A 4GXJA 2PFOA 1ZQOA 8ICIA 4NLZA 4XQ7A 4JLZA 4WBYA 5HHIA 1Q79A 4YN4A 4WC4A 2FMQA 2B56A 5D4BA 4UD4A 4KLTA 2ISPA 2BCQA 4WQLA 3UXOA 8ICFA 2W9MA 5J2IA 4FO6A 4K9AA 4DOCA 4YMNA 4R64A 8ICZA 3PNCA 4NY8A 3H3AA 4JWMA 4M5DA 3UXNA 5HRDA 5DBBA 4NLKA 1NO5A 2ZH9A 1ZQDA 3L9DA 5CA7A 2BPGA 4I2AA 5CB1A 9ICGA 4WQKA 1UEUA 7ICQA 4WC0A 7ICSA 5HRBA 5IIIA 4I27A 4MF2A 8ICKA 3HJ1A 3ER9B 3C2LA 7ICUA 4KM5A 5IIOA 8ICWA 3NYBA 5D49A 4QZFA 3C5FA 3RH6A 1F5AA 8ICBA 4RT2A 4RQ8A 4EP7A 1ZJNA 3GDXA 3RJHA 8ICXA 5TZVA 4AT8B 4DO9A 9ICVA 4EEDA 4IG8A 1NOMA 4KLIA 2PXIA 1ZQTA 5BOMA 4I2EA 7ICKA 4KLUA 5J0PA 4R65A 3HWTA 3WFRE 2FMPA 3C5GA 1ZQLA 1ZQWA 4QZDA 1ZQAA 4UB3A 4PHPA 1MIVA 3TFRA 2HN2A 4I2DA 4K98A 8ICRA 4KLFA 2ZHBA 1JQRA 4UB1A 5J2AA 1ZQNA 3JPNA 4YD2A 4K96A 7ICFA 3V7LA 1BPXA 3HX0A 4M9NA 4NM1A 4YD1A 4LEVA 4QZEA 4RQ5A 4PGYA 4EV6A 3HW8A 3RH5A 8ICAA 5HREA 1KNYA 1GPJA 4X0BA 4IQVA 1UEVA 4PHDA 1ZQFA 9ICQA 4FH5A 4LZDA 2DR9A 4KLQA 4O67A 9ICKA 4E8FA 5BPCA 1ZQPA 4QZIA 1ZQQA 2PFNA 4RQ2A 4X4TA 5J0WA 3OVBA 4XQ8A 2BPCA 1YLQA 4UD5A 1TV9A 5DDMA 4KLHA 4QZ9A 5J0XA 3JPSA 8ICHA 2NRKA 4I2HA 4YMMA 5B3PA 7ICHA 1MQ3A 8ICCA 2IUBA 4KB6A 1ZJMA 4M04A 2HN1A 4E80A 4KLDA 4O69A 1ZQHA 9ICTA 4OAGA 5CR0A 4UBCA 1OU5A 1HUOA 1FA0A 3OGUA 3C2KA 9ICFA 8ICSA 4NLNA 3OV7A 1R89A 2I9GA 4O9MA 3WFSC 3UXPA 3H38A 4IQTA 1ZQYA 8ICOA 4NXXA 3RJKA 7ICIA 4LT6A 2ZHAA 3EF2A 5J0RA 1KEJA 4RQ0A 4FHPA 4E7XA 4X4RA 4DOAA 4PHAA 2BPFA 8ICYA 4N7RA 4M9GA 5IIKA 9ICAA 4KLSA 3WFOA 3UPSA 5J0SA 4Z6EA 7ICOA 3MCRA 4UB5A 3UQ2A 5IINA 4WC6A 4LEWA 4X4PA 4MKPA 4FHVA 4ATBB 3AQNA 5DB8A 9ICPA 4UAYA 9ICLA 4QZ8A 2PFQA 4K8VA 2BE3A 4F5PA 4EBJA 2EWRA 4FO1A 5HR9A 4F5QA 4UB2A 9ICOA 4O68A 9ICRA 4X4OA 1ZQCA 4PHEA 9ICHA 3B0XA 4FHXA 9ICSA 2ID1A 4FHYA
chains in the Genus database with same CATH topology
4RPZA 1JN3A 1TFYA 4X4UA 4X4QA 1ZQGA 2ISOA 2ZH2A 4O5EA 8ICJA 4RQ6A 3AUOA 5HRGA 3JPQA 2ZH7A 4R63A 2M2TA 3PMLA 8ICVA 1R8AA 8ICMA 4X4NA 1MIYA 4UAWA 4KLEA 3C18A 3RH4A 3MGIA 3JPOA 4FHWA 7ICRA 1R8BA 4PGXA 5CJ7A 4X5VA 4Z6DA 3OVSA 4KLJA 2VANA 5BOLA 3ISBA 4GXIA 9ICEA 1JMSA 5HHHA 1TVAA 8ICQA 4R66A 3AU6A 1PX5A 3AQMA 4K4GA 9ICIA 4K4HA 2ZH4A 4MFAA 4XRHA 2DRAA 2ZH5A 1BPEA 4Z6CA 4M47A 2P66A 1ZQXA 4NXZA 3B0YA 4RWQA 3WFQE 4EBKA 9ICBA 3V7JA 3OVAA 4P4PA 5HRKA 3LQCB 5J29A 4AT7A 2ZH6A 4RPXA 4RQ4A 1XSNA 4TUSA 2BCVA 1ZQEA 2HHPA 1BPBA 3K75D 4QZHA 4KLOA 4RQ1A 4I2JA 9ICUA 2M2WA 4M2YA 1ZQMA 4AT9B 5HRFA 3OUYB 7ICVA 2ZH3A 4FH3A 1MQ2A 8ICUA 3AQLA 8ICGA 3RJJA 4GXKA 5J2GA 1ZQBA 1V4AA 4IQWA 4WBZA 2RFFA 1RZTA 4ATBA 5CWRA 3V72A 3MDCA 4KLGA 4I2CA 4I28A 4WC2A 3TFSA 1UETA 1ZQRA 1ZQZA 1ZQIA 5IIJA 5EOZA 7ICPA 7ICLA 3RJFA 5J2EA 4M9JA 3OUYA 9ICNA 2O5AA 3AQKA 9ICMA 9ICCA 4PGQA 5J0YA 1ZQVA 5J0QA 5D46A 1WOTA 4PPXA 2PBEA 3JZ0A 4LZGA 4NKUA 5J0TA 3MDAA 4RWNA 4YCXA 8ICPA 4I2IA 3C2MA 1RPLA 3UPQA 5J2KA 5J2BA 2ZH8A 4WC7A 3H37A 2DRBA 5HC9A 4F5RA 2IHMA 1JAJA 4P4MA 5F2VO 4QZAA 1MIWA 3HJ4A 1BPZA 2M2UA 4MF8A 3JPRA 3MBYA 4P4OA 4UAZA 4K4IA 4JWNA 4IQUA 7ICGA 4RWOA 4RQ7A 1BPYA 1ZQUA 4RT3A 1ZQKA 3ISCA 1ZQSA 5HRLA 4M9LA 3RJIA 8ICNA 3UQ0A 5J2DA 4F5NA 3C66A 4I29A 4NKTA 4QZCA 7ICJA 5J2HA 9ICXA 5DB6A 4WC1A 5DB9A 4LVSA 3HIYA 2M2VA 9ICWA 9ICJA 5J2JA 4AT8A 4UBBA 4MFCA 4UB4A 3MGHA 5J0UA 4KLMA 4F5OA 2PFPA 5DB7A 3RJEA 5HRHA 1XSLA 2FMSA 4MFFA 4M9HA 4DOBA 2DVIA 7ICMA 5DBAA 3V7KA 2DR7A 2GWSA 2DR5A 3LK9A 4S3NA 2O1PA 2ZH1A 2DR8A 5DBCA 5J2CA 5CHGA 4XUSA 4TURA 5DECA 1BPDA 5CP2A 7ICTA 1XSPA 4XA5A 8ICLA 1VJ7A 3H39A 4RPYA 2BCRA 4X4VA 5J2FA 7ICNA 4KLLA 3AU2A 7ICEA 3ISDA 3PMNA 4I2FA 4PH5A 4P2HA 4AT9A 4O5KA 4QZBA 2BCSA 1ZQJA 4I2GA 3WFPA 5IILA 4RQ3A 4TUPA 4RWPA 4O5CA 4X4SA 4QZGA 4WCWA 1TFWA 8ICTA 3JYYA 4X0AA 4Z6FA 5DKWA 5DDYA 5J0OA 1KDHA 3JPPA 4AT7B 4NM2A 2BCUA 4M0AA 5HRIA 4WC3A 1R8CA 8ICEA 1VFGA 3RJGA 4WC5A 4I2BA 3JPTA 2Q66A 5DEDA 4YMOA 5IIMA 1HUZA 4TUQA 1Q78A 4GXJA 2PFOA 1ZQOA 8ICIA 4NLZA 4XQ7A 4WBYA 5HHIA 1Q79A 4YN4A 4WC4A 2FMQA 5D4BA 4UD4A 4KLTA 2ISPA 2BCQA 3UXOA 8ICFA 2W9MA 5J2IA 4FO6A 4DOCA 4YMNA 4R64A 8ICZA 3PNCA 4NY8A 3H3AA 4JWMA 4M5DA 3UXNA 5HRDA 5DBBA 4NLKA 1NO5A 2ZH9A 1ZQDA 3L9DA 5CA7A 2BPGA 4I2AA 5CB1A 9ICGA 1UEUA 7ICQA 4WC0A 7ICSA 5HRBA 5IIIA 4I27A 4MF2A 8ICKA 3HJ1A 3C2LA 7ICUA 5IIOA 8ICWA 3NYBA 5D49A 4QZFA 3C5FA 3RH6A 1F5AA 8ICBA 4RT2A 4RQ8A 4EP7A 1ZJNA 3GDXA 3RJHA 8ICXA 4AT8B 5TZVA 4DO9A 9ICVA 4IG8A 1NOMA 4KLIA 2PXIA 1ZQTA 5BOMA 4I2EA 7ICKA 4KLUA 5J0PA 4R65A 3HWTA 3WFRE 2FMPA 3C5GA 1ZQLA 1ZQWA 4QZDA 1ZQAA 4UB3A 4PHPA 1MIVA 3TFRA 4I2DA 8ICRA 4KLFA 2ZHBA 1JQRA 4UB1A 5J2AA 1ZQNA 3JPNA 4YD2A 7ICFA 3V7LA 1BPXA 3HX0A 4M9NA 4NM1A 4YD1A 4QZEA 4RQ5A 4PGYA 3HW8A 3RH5A 8ICAA 5HREA 1KNYA 4X0BA 4IQVA 1UEVA 4PHDA 1ZQFA 9ICQA 4FH5A 4LZDA 2DR9A 4KLQA 9ICKA 4E8FA 5BPCA 1ZQPA 4QZIA 1ZQQA 2PFNA 4RQ2A 4X4TA 5J0WA 3OVBA 4XQ8A 2BPCA 1YLQA 4UD5A 1TV9A 5DDMA 4KLHA 4QZ9A 5J0XA 3JPSA 8ICHA 2NRKA 4I2HA 4YMMA 7ICHA 1MQ3A 8ICCA 1ZJMA 4M04A 4E80A 4KLDA 1ZQHA 9ICTA 5CR0A 4UBCA 1OU5A 1HUOA 1FA0A 3OGUA 3C2KA 9ICFA 8ICSA 4NLNA 3OV7A 1R89A 2I9GA 4O9MA 3WFSC 3UXPA 3H38A 4IQTA 1ZQYA 8ICOA 3RJKA 7ICIA 4LT6A 2ZHAA 5J0RA 1KEJA 4RQ0A 4FHPA 4E7XA 4X4RA 4DOAA 4PHAA 2BPFA 8ICYA 4M9GA 5IIKA 9ICAA 4KLSA 3WFOA 4Z6EA 3UPSA 5J0SA 7ICOA 3UQ2A 4UB5A 5IINA 4WC6A 4X4PA 4FHVA 4ATBB 3AQNA 5DB8A 9ICPA 4UAYA 9ICLA 4QZ8A 2PFQA 2BE3A 4F5PA 4EBJA 5HR9A 4F5QA 4UB2A 9ICOA 9ICRA 4X4OA 1ZQCA 4PHEA 9ICHA 3B0XA 4FHXA 9ICSA 2ID1A 4FHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPZ A;  1JN3 A;  1TFY A;  4X4U A;  4X4Q A;  1ZQG A;  2ISO A;  2ZH2 A;  4O5E A;  8ICJ A;  4RQ6 A;  3AUO A;  5HRG A;  3JPQ A;  2ZH7 A;  4R63 A;  2M2T A;  3PML A;  8ICV A;  1R8A A;  8ICM A;  4X4N A;  1MIY A;  4UAW A;  4KLE A;  3C18 A;  3RH4 A;  3MGI A;  3JPO A;  4FHW A;  7ICR A;  1R8B A;  4PGX A;  5CJ7 A;  4X5V A;  4Z6D A;  3OVS A;  4KLJ A;  2VAN A;  5BOL A;  3ISB A;  4GXI A;  9ICE A;  1JMS A;  5HHH A;  1TVA A;  8ICQ A;  4R66 A;  3AU6 A;  1PX5 A;  3AQM A;  4K4G A;  9ICI A;  4K4H A;  2ZH4 A;  4MFA A;  4XRH A;  2DRA A;  2ZH5 A;  1BPE A;  4Z6C A;  4M47 A;  2P66 A;  1ZQX A;  4NXZ A;  3B0Y A;  4RWQ A;  3WFQ E;  4EBK A;  9ICB A;  3V7J A;  3OVA A;  4P4P A;  5HRK A;  3LQC B;  5J29 A;  4AT7 A;  2ZH6 A;  4RPX A;  4RQ4 A;  1XSN A;  4TUS A;  2BCV A;  1ZQE A;  2HHP A;  1BPB A;  3K75 D;  4QZH A;  4KLO A;  4RQ1 A;  4I2J A;  9ICU A;  2M2W A;  4M2Y A;  1ZQM A;  4AT9 B;  5HRF A;  3OUY B;  7ICV A;  2ZH3 A;  4FH3 A;  1MQ2 A;  8ICU A;  3AQL A;  8ICG A;  3RJJ A;  4GXK A;  5J2G A;  1ZQB A;  1V4A A;  4IQW A;  4WBZ A;  2RFF A;  1RZT A;  4ATB A;  5CWR A;  3V72 A;  3MDC A;  4KLG A;  4I2C A;  4I28 A;  4WC2 A;  3TFS A;  1UET A;  1ZQR A;  1ZQZ A;  1ZQI A;  5IIJ A;  5EOZ A;  7ICP A;  7ICL A;  3RJF A;  5J2E A;  4M9J A;  3OUY A;  9ICN A;  2O5A A;  3AQK A;  9ICM A;  9ICC A;  4PGQ A;  5J0Y A;  1ZQV A;  5J0Q A;  5D46 A;  1WOT A;  4PPX A;  2PBE A;  3JZ0 A;  4LZG A;  4NKU A;  5J0T A;  3MDA A;  4RWN A;  4YCX A;  8ICP A;  4I2I A;  3C2M A;  1RPL A;  3UPQ A;  5J2K A;  5J2B A;  2ZH8 A;  4WC7 A;  3H37 A;  2DRB A;  5HC9 A;  4F5R A;  2IHM A;  1JAJ A;  4P4M A;  5F2V O;  4QZA A;  1MIW A;  3HJ4 A;  1BPZ A;  2M2U A;  4MF8 A;  3JPR A;  3MBY A;  4P4O A;  4UAZ A;  4K4I A;  4JWN A;  4IQU A;  7ICG A;  4RWO A;  4RQ7 A;  1BPY A;  1ZQU A;  4RT3 A;  1ZQK A;  3ISC A;  1ZQS A;  5HRL A;  4M9L A;  3RJI A;  8ICN A;  3UQ0 A;  5J2D A;  4F5N A;  3C66 A;  4I29 A;  4NKT A;  4QZC A;  7ICJ A;  5J2H A;  9ICX A;  5DB6 A;  4WC1 A;  5DB9 A;  4LVS A;  3HIY A;  2M2V A;  9ICW A;  9ICJ A;  5J2J A;  4AT8 A;  4UBB A;  4MFC A;  4UB4 A;  3MGH A;  5J0U A;  4KLM A;  4F5O A;  2PFP A;  5DB7 A;  3RJE A;  5HRH A;  1XSL A;  2FMS A;  4MFF A;  4M9H A;  4DOB A;  2DVI A;  7ICM A;  5DBA A;  3V7K A;  2DR7 A;  2GWS A;  2DR5 A;  3LK9 A;  4S3N A;  2O1P A;  2ZH1 A;  2DR8 A;  5DBC A;  5J2C A;  5CHG A;  4XUS A;  4TUR A;  5DEC A;  1BPD A;  5CP2 A;  7ICT A;  1XSP A;  4XA5 A;  8ICL A;  1VJ7 A;  3H39 A;  4RPY A;  2BCR A;  4X4V A;  5J2F A;  7ICN A;  4KLL A;  3AU2 A;  7ICE A;  3ISD A;  3PMN A;  4I2F A;  4PH5 A;  4P2H A;  4AT9 A;  4O5K A;  4QZB A;  2BCS A;  1ZQJ A;  4I2G A;  3WFP A;  5IIL A;  4RQ3 A;  4TUP A;  4RWP A;  4O5C A;  4X4S A;  4QZG A;  4WCW A;  1TFW A;  8ICT A;  3JYY A;  4X0A A;  4Z6F A;  5DKW A;  5DDY A;  5J0O A;  1KDH A;  3JPP A;  4AT7 B;  4NM2 A;  2BCU A;  4M0A A;  5HRI A;  4WC3 A;  1R8C A;  8ICE A;  1VFG A;  3RJG A;  4WC5 A;  4I2B A;  3JPT A;  2Q66 A;  5DED A;  4YMO A;  5IIM A;  1HUZ A;  4TUQ A;  1Q78 A;  4GXJ A;  2PFO A;  1ZQO A;  8ICI A;  4NLZ A;  4XQ7 A;  4WBY A;  5HHI A;  1Q79 A;  4YN4 A;  4WC4 A;  2FMQ A;  5D4B A;  4UD4 A;  4KLT A;  2ISP A;  2BCQ A;  3UXO A;  8ICF A;  2W9M A;  5J2I A;  4FO6 A;  4DOC A;  4YMN A;  4R64 A;  8ICZ A;  3PNC A;  4NY8 A;  3H3A A;  4JWM A;  4M5D A;  3UXN A;  5HRD A;  5DBB A;  4NLK A;  1NO5 A;  2ZH9 A;  1ZQD A;  3L9D A;  5CA7 A;  2BPG A;  4I2A A;  5CB1 A;  9ICG A;  1UEU A;  7ICQ A;  4WC0 A;  7ICS A;  5HRB A;  5III A;  4I27 A;  4MF2 A;  8ICK A;  3HJ1 A;  3C2L A;  7ICU A;  5IIO A;  8ICW A;  3NYB A;  5D49 A;  4QZF A;  3C5F A;  3RH6 A;  1F5A A;  8ICB A;  4RT2 A;  4RQ8 A;  4EP7 A;  1ZJN A;  3GDX A;  3RJH A;  8ICX A;  4AT8 B;  5TZV A;  4DO9 A;  9ICV A;  4IG8 A;  1NOM A;  4KLI A;  2PXI A;  1ZQT A;  5BOM A;  4I2E A;  7ICK A;  4KLU A;  5J0P A;  4R65 A;  3HWT A;  3WFR E;  2FMP A;  3C5G A;  1ZQL A;  1ZQW A;  4QZD A;  1ZQA A;  4UB3 A;  4PHP A;  1MIV A;  3TFR A;  4I2D A;  8ICR A;  4KLF A;  2ZHB A;  1JQR A;  4UB1 A;  5J2A A;  1ZQN A;  3JPN A;  4YD2 A;  7ICF A;  3V7L A;  1BPX A;  3HX0 A;  4M9N A;  4NM1 A;  4YD1 A;  4QZE A;  4RQ5 A;  4PGY A;  3HW8 A;  3RH5 A;  8ICA A;  5HRE A;  1KNY A;  4X0B A;  4IQV A;  1UEV A;  4PHD A;  1ZQF A;  9ICQ A;  4FH5 A;  4LZD A;  2DR9 A;  4KLQ A;  9ICK A;  4E8F A;  5BPC A;  1ZQP A;  4QZI A;  1ZQQ A;  2PFN A;  4RQ2 A;  4X4T A;  5J0W A;  3OVB A;  4XQ8 A;  2BPC A;  1YLQ A;  4UD5 A;  1TV9 A;  5DDM A;  4KLH A;  4QZ9 A;  5J0X A;  3JPS A;  8ICH A;  2NRK A;  4I2H A;  4YMM A;  7ICH A;  1MQ3 A;  8ICC A;  1ZJM A;  4M04 A;  4E80 A;  4KLD A;  1ZQH A;  9ICT A;  5CR0 A;  4UBC A;  1OU5 A;  1HUO A;  1FA0 A;  3OGU A;  3C2K A;  9ICF A;  8ICS A;  4NLN A;  3OV7 A;  1R89 A;  2I9G A;  4O9M A;  3WFS C;  3UXP A;  3H38 A;  4IQT A;  1ZQY A;  8ICO A;  3RJK A;  7ICI A;  4LT6 A;  2ZHA A;  5J0R A;  1KEJ A;  4RQ0 A;  4FHP A;  4E7X A;  4X4R A;  4DOA A;  4PHA A;  2BPF A;  8ICY A;  4M9G A;  5IIK A;  9ICA A;  4KLS A;  3WFO A;  4Z6E A;  3UPS A;  5J0S A;  7ICO A;  3UQ2 A;  4UB5 A;  5IIN A;  4WC6 A;  4X4P A;  4FHV A;  4ATB B;  3AQN A;  5DB8 A;  9ICP A;  4UAY A;  9ICL A;  4QZ8 A;  2PFQ A;  2BE3 A;  4F5P A;  4EBJ A;  5HR9 A;  4F5Q A;  4UB2 A;  9ICO A;  9ICR A;  4X4O A;  1ZQC A;  4PHE A;  9ICH A;  3B0X A;  4FHX A;  9ICS A;  2ID1 A;  4FHY A; 
#chains in the Genus database with same CATH topology
 4RPZ A;  1JN3 A;  1TFY A;  4X4U A;  4OAF A;  4X4Q A;  1ZQG A;  2ISO A;  2ZH2 A;  4O5E A;  8ICJ A;  4RQ6 A;  3AUO A;  5HRG A;  3JPQ A;  3NKU A;  2ZH7 A;  4R63 A;  2M2T A;  3PML A;  8ICV A;  1R8A A;  8ICM A;  4X4N A;  1MIY A;  4UAW A;  4KLE A;  5CHE A;  3C18 A;  3RH4 A;  3MGI A;  3JPO A;  4FHW A;  7ICR A;  1R8B A;  4PGX A;  5CJ7 A;  4X5V A;  4Z6D A;  3OVS A;  4KLJ A;  5CFU A;  2VAN A;  4XJE A;  5BOL A;  3ISB A;  4GXI A;  9ICE A;  1JMS A;  5HHH A;  1TVA A;  8ICQ A;  4R66 A;  3AU6 A;  2FCL A;  5JTG A;  1PX5 A;  3AQM A;  4K4G A;  9ICI A;  4K4H A;  2ZH4 A;  4MFA A;  4XRH A;  2DRA A;  2ZH5 A;  1BPE A;  4Z6C A;  4M47 A;  4K99 A;  2P66 A;  1ZQX A;  4NXZ A;  3B0Y A;  4RWQ A;  3WFQ E;  4NXW A;  4EBK A;  3ER8 C;  9ICB A;  3V7J A;  3OVA A;  4P4P A;  5HRK A;  5CFS A;  3LQC B;  2GAF D;  5J29 A;  4AT7 A;  2ZH6 A;  3CK6 A;  4RPX A;  4RQ4 A;  1XSN A;  4TUS A;  2BCV A;  1ZQE A;  2HHP A;  3PHZ A;  3NVO A;  1BPB A;  3K75 D;  4QZH A;  4KLO A;  4RQ1 A;  4I2J A;  9ICU A;  2M2W A;  4M2Y A;  1ZQM A;  4AT9 B;  5HRF A;  3OUY B;  7ICV A;  2ZH3 A;  4FH3 A;  1MQ2 A;  3ERC C;  4EEB A;  8ICU A;  3AQL A;  8ICG A;  3RJJ A;  4GXK A;  5J2G A;  1ZQB A;  1V4A A;  4IQW A;  2BBH A;  4LEY A;  4WBZ A;  2RFF A;  2B51 A;  1RZT A;  4ATB A;  5CWR A;  3V72 A;  3MDC A;  4KLG A;  4I2C A;  4I28 A;  4WC2 A;  3TFS A;  1UET A;  1ZQR A;  1ZQZ A;  1ZQI A;  5IIJ A;  5EOZ A;  7ICP A;  7ICL A;  3RJF A;  5J2E A;  4M9J A;  3OUY A;  9ICN A;  2O5A A;  3AQK A;  9ICM A;  9ICC A;  4PGQ A;  5J0Y A;  1ZQV A;  5J0Q A;  5D63 A;  5D46 A;  1WOT A;  4PPX A;  2PBE A;  3JZ0 A;  4LZG A;  4NKU A;  5J0T A;  3MDA A;  4RWN A;  4YCX A;  8ICP A;  4I2I A;  3C2M A;  1RPL A;  2ZH8 A;  5D62 A;  5J2K A;  5J2B A;  3UPQ A;  4WC7 A;  3H37 A;  2DRB A;  5HC9 A;  4F5R A;  2IHM A;  1JAJ A;  4P4M A;  4OAH A;  5F2V O;  4QZA A;  1MIW A;  3HJ4 A;  1BPZ A;  2M2U A;  4HX0 A;  4MF8 A;  4NXV A;  4WH5 A;  3JPR A;  3MBY A;  4P4O A;  4UAZ A;  4WOY A;  4O6A A;  4K4I A;  4JWN A;  4IQU A;  7ICG A;  4RWO A;  4RQ7 A;  1BPY A;  1ZQU A;  4RT3 A;  1ZQK A;  3ISC A;  1ZQS A;  5HRL A;  4NXT A;  4M9L A;  3RJI A;  8ICN A;  5CFT A;  5J2D A;  3UQ0 A;  4F5N A;  3C66 A;  4I29 A;  4NKT A;  4QZC A;  7ICJ A;  5J2H A;  9ICX A;  5DB6 A;  4WC1 A;  5DB9 A;  4LVS A;  3HIY A;  2M2V A;  9ICW A;  9ICJ A;  5J2J A;  4AT8 A;  4UBB A;  4MFC A;  2B4V A;  4UB4 A;  3MGH A;  5J0U A;  4KLM A;  4F5O A;  2PFP A;  5DB7 A;  3RJE A;  4NXU A;  5HRH A;  1XSL A;  2FMS A;  4MFF A;  4M9H A;  4DOB A;  2DVI A;  4K97 A;  7ICM A;  5DBA A;  3V7K A;  2DR7 A;  2GWS A;  2DR5 A;  3LK9 A;  4S3N A;  2O1P A;  2ZH1 A;  2DR8 A;  4OAI Z;  5DBC A;  5J2C A;  5CHG A;  4XUS A;  4TUR A;  5DEC A;  1BPD A;  5CP2 A;  7ICT A;  3NWI A;  4LEZ A;  2BBJ A;  4EGW A;  1XSP A;  4XA5 A;  8ICL A;  1VJ7 A;  3H39 A;  4RPY A;  3JCF A;  2BCR A;  4X4V A;  5J2F A;  7ICN A;  4KLL A;  3AU2 A;  7ICE A;  3ISD A;  3PMN A;  4I2F A;  4PH5 A;  4JLX A;  4AT9 A;  4O5K A;  4P2H A;  4QZB A;  2BCS A;  1ZQJ A;  4I2G A;  3WFP A;  5IIL A;  4RQ3 A;  4TUP A;  4RWP A;  4O5C A;  4X4S A;  4QZG A;  4WCW A;  1TFW A;  8ICT A;  4K9B A;  3JYY A;  2GA9 D;  5B3Q A;  4X0A A;  4Z6F A;  5DKW A;  5DDY A;  5J0O A;  1KDH A;  3JPP A;  4AT7 B;  4NM2 A;  2BCU A;  4M0A A;  5HRI A;  4WC3 A;  4I0U A;  1R8C A;  8ICE A;  3OWG A;  1VFG A;  3K7D A;  2IHO A;  4WC5 A;  3JPT A;  3RJG A;  4I2B A;  2Q66 A;  5D61 A;  5DED A;  4YMO A;  5IIM A;  1HUZ A;  4TUQ A;  1Q78 A;  4GXJ A;  2PFO A;  1ZQO A;  8ICI A;  4NLZ A;  4XQ7 A;  4JLZ A;  4WBY A;  5HHI A;  1Q79 A;  4YN4 A;  4WC4 A;  2FMQ A;  2B56 A;  5D4B A;  4UD4 A;  4KLT A;  2ISP A;  2BCQ A;  4WQL A;  3UXO A;  8ICF A;  2W9M A;  5J2I A;  4FO6 A;  4K9A A;  4DOC A;  4YMN A;  4R64 A;  8ICZ A;  3PNC A;  4NY8 A;  3H3A A;  4JWM A;  4M5D A;  3UXN A;  5HRD A;  5DBB A;  4NLK A;  1NO5 A;  2ZH9 A;  1ZQD A;  3L9D A;  5CA7 A;  2BPG A;  4I2A A;  5CB1 A;  9ICG A;  4WQK A;  1UEU A;  7ICQ A;  4WC0 A;  7ICS A;  5HRB A;  5III A;  4I27 A;  4MF2 A;  8ICK A;  3HJ1 A;  3ER9 B;  3C2L A;  7ICU A;  4KM5 A;  5IIO A;  8ICW A;  3NYB A;  5D49 A;  4QZF A;  3C5F A;  3RH6 A;  1F5A A;  8ICB A;  4RT2 A;  4RQ8 A;  4EP7 A;  1ZJN A;  3GDX A;  3RJH A;  8ICX A;  5TZV A;  4AT8 B;  4DO9 A;  9ICV A;  4EED A;  4IG8 A;  1NOM A;  4KLI A;  2PXI A;  1ZQT A;  5BOM A;  4I2E A;  7ICK A;  4KLU A;  5J0P A;  4R65 A;  3HWT A;  3WFR E;  2FMP A;  3C5G A;  1ZQL A;  1ZQW A;  4QZD A;  1ZQA A;  4UB3 A;  4PHP A;  1MIV A;  3TFR A;  2HN2 A;  4I2D A;  4K98 A;  8ICR A;  4KLF A;  2ZHB A;  1JQR A;  4UB1 A;  5J2A A;  1ZQN A;  3JPN A;  4YD2 A;  4K96 A;  7ICF A;  3V7L A;  1BPX A;  3HX0 A;  4M9N A;  4NM1 A;  4YD1 A;  4LEV A;  4QZE A;  4RQ5 A;  4PGY A;  4EV6 A;  3HW8 A;  3RH5 A;  8ICA A;  5HRE A;  1KNY A;  1GPJ A;  4X0B A;  4IQV A;  1UEV A;  4PHD A;  1ZQF A;  9ICQ A;  4FH5 A;  4LZD A;  2DR9 A;  4KLQ A;  4O67 A;  9ICK A;  4E8F A;  5BPC A;  1ZQP A;  4QZI A;  1ZQQ A;  2PFN A;  4RQ2 A;  4X4T A;  5J0W A;  3OVB A;  4XQ8 A;  2BPC A;  1YLQ A;  4UD5 A;  1TV9 A;  5DDM A;  4KLH A;  4QZ9 A;  5J0X A;  3JPS A;  8ICH A;  2NRK A;  4I2H A;  4YMM A;  5B3P A;  7ICH A;  1MQ3 A;  8ICC A;  2IUB A;  4KB6 A;  1ZJM A;  4M04 A;  2HN1 A;  4E80 A;  4KLD A;  4O69 A;  1ZQH A;  9ICT A;  4OAG A;  5CR0 A;  4UBC A;  1OU5 A;  1HUO A;  1FA0 A;  3OGU A;  3C2K A;  9ICF A;  8ICS A;  4NLN A;  3OV7 A;  1R89 A;  2I9G A;  4O9M A;  3WFS C;  3UXP A;  3H38 A;  4IQT A;  1ZQY A;  8ICO A;  4NXX A;  3RJK A;  7ICI A;  4LT6 A;  2ZHA A;  3EF2 A;  5J0R A;  1KEJ A;  4RQ0 A;  4FHP A;  4E7X A;  4X4R A;  4DOA A;  4PHA A;  2BPF A;  8ICY A;  4N7R A;  4M9G A;  5IIK A;  9ICA A;  4KLS A;  3WFO A;  3UPS A;  5J0S A;  4Z6E A;  7ICO A;  3MCR A;  4UB5 A;  3UQ2 A;  5IIN A;  4WC6 A;  4LEW A;  4X4P A;  4MKP A;  4FHV A;  4ATB B;  3AQN A;  5DB8 A;  9ICP A;  4UAY A;  9ICL A;  4QZ8 A;  2PFQ A;  4K8V A;  2BE3 A;  4F5P A;  4EBJ A;  2EWR A;  4FO1 A;  5HR9 A;  4F5Q A;  4UB2 A;  9ICO A;  4O68 A;  9ICR A;  4X4O A;  1ZQC A;  4PHE A;  9ICH A;  3B0X A;  4FHX A;  9ICS A;  2ID1 A;  4FHY A; 
#chains in the Genus database with same CATH homology
 4RPZ A;  1JN3 A;  1TFY A;  4X4U A;  4X4Q A;  1ZQG A;  2ISO A;  2ZH2 A;  4O5E A;  8ICJ A;  4RQ6 A;  3AUO A;  5HRG A;  3JPQ A;  2ZH7 A;  4R63 A;  2M2T A;  3PML A;  8ICV A;  1R8A A;  8ICM A;  4X4N A;  1MIY A;  4UAW A;  4KLE A;  3C18 A;  3RH4 A;  3MGI A;  3JPO A;  4FHW A;  7ICR A;  1R8B A;  4PGX A;  5CJ7 A;  4X5V A;  4Z6D A;  3OVS A;  4KLJ A;  2VAN A;  5BOL A;  3ISB A;  4GXI A;  9ICE A;  1JMS A;  5HHH A;  1TVA A;  8ICQ A;  4R66 A;  3AU6 A;  1PX5 A;  3AQM A;  4K4G A;  9ICI A;  4K4H A;  2ZH4 A;  4MFA A;  4XRH A;  2DRA A;  2ZH5 A;  1BPE A;  4Z6C A;  4M47 A;  2P66 A;  1ZQX A;  4NXZ A;  3B0Y A;  4RWQ A;  3WFQ E;  4EBK A;  9ICB A;  3V7J A;  3OVA A;  4P4P A;  5HRK A;  3LQC B;  5J29 A;  4AT7 A;  2ZH6 A;  4RPX A;  4RQ4 A;  1XSN A;  4TUS A;  2BCV A;  1ZQE A;  2HHP A;  1BPB A;  3K75 D;  4QZH A;  4KLO A;  4RQ1 A;  4I2J A;  9ICU A;  2M2W A;  4M2Y A;  1ZQM A;  4AT9 B;  5HRF A;  3OUY B;  7ICV A;  2ZH3 A;  4FH3 A;  1MQ2 A;  8ICU A;  3AQL A;  8ICG A;  3RJJ A;  4GXK A;  5J2G A;  1ZQB A;  1V4A A;  4IQW A;  4WBZ A;  2RFF A;  1RZT A;  4ATB A;  5CWR A;  3V72 A;  3MDC A;  4KLG A;  4I2C A;  4I28 A;  4WC2 A;  3TFS A;  1UET A;  1ZQR A;  1ZQZ A;  1ZQI A;  5IIJ A;  5EOZ A;  7ICP A;  7ICL A;  3RJF A;  5J2E A;  4M9J A;  3OUY A;  9ICN A;  2O5A A;  3AQK A;  9ICM A;  9ICC A;  4PGQ A;  5J0Y A;  1ZQV A;  5J0Q A;  5D46 A;  1WOT A;  4PPX A;  2PBE A;  3JZ0 A;  4LZG A;  4NKU A;  5J0T A;  3MDA A;  4RWN A;  4YCX A;  8ICP A;  4I2I A;  3C2M A;  1RPL A;  3UPQ A;  5J2K A;  5J2B A;  2ZH8 A;  4WC7 A;  3H37 A;  2DRB A;  5HC9 A;  4F5R A;  2IHM A;  1JAJ A;  4P4M A;  5F2V O;  4QZA A;  1MIW A;  3HJ4 A;  1BPZ A;  2M2U A;  4MF8 A;  3JPR A;  3MBY A;  4P4O A;  4UAZ A;  4K4I A;  4JWN A;  4IQU A;  7ICG A;  4RWO A;  4RQ7 A;  1BPY A;  1ZQU A;  4RT3 A;  1ZQK A;  3ISC A;  1ZQS A;  5HRL A;  4M9L A;  3RJI A;  8ICN A;  3UQ0 A;  5J2D A;  4F5N A;  3C66 A;  4I29 A;  4NKT A;  4QZC A;  7ICJ A;  5J2H A;  9ICX A;  5DB6 A;  4WC1 A;  5DB9 A;  4LVS A;  3HIY A;  2M2V A;  9ICW A;  9ICJ A;  5J2J A;  4AT8 A;  4UBB A;  4MFC A;  4UB4 A;  3MGH A;  5J0U A;  4KLM A;  4F5O A;  2PFP A;  5DB7 A;  3RJE A;  5HRH A;  1XSL A;  2FMS A;  4MFF A;  4M9H A;  4DOB A;  2DVI A;  7ICM A;  5DBA A;  3V7K A;  2DR7 A;  2GWS A;  2DR5 A;  3LK9 A;  4S3N A;  2O1P A;  2ZH1 A;  2DR8 A;  5DBC A;  5J2C A;  5CHG A;  4XUS A;  4TUR A;  5DEC A;  1BPD A;  5CP2 A;  7ICT A;  1XSP A;  4XA5 A;  8ICL A;  1VJ7 A;  3H39 A;  4RPY A;  2BCR A;  4X4V A;  5J2F A;  7ICN A;  4KLL A;  3AU2 A;  7ICE A;  3ISD A;  3PMN A;  4I2F A;  4PH5 A;  4P2H A;  4AT9 A;  4O5K A;  4QZB A;  2BCS A;  1ZQJ A;  4I2G A;  3WFP A;  5IIL A;  4RQ3 A;  4TUP A;  4RWP A;  4O5C A;  4X4S A;  4QZG A;  4WCW A;  1TFW A;  8ICT A;  3JYY A;  4X0A A;  4Z6F A;  5DKW A;  5DDY A;  5J0O A;  1KDH A;  3JPP A;  4AT7 B;  4NM2 A;  2BCU A;  4M0A A;  5HRI A;  4WC3 A;  1R8C A;  8ICE A;  1VFG A;  3RJG A;  4WC5 A;  4I2B A;  3JPT A;  2Q66 A;  5DED A;  4YMO A;  5IIM A;  1HUZ A;  4TUQ A;  1Q78 A;  4GXJ A;  2PFO A;  1ZQO A;  8ICI A;  4NLZ A;  4XQ7 A;  4WBY A;  5HHI A;  1Q79 A;  4YN4 A;  4WC4 A;  2FMQ A;  5D4B A;  4UD4 A;  4KLT A;  2ISP A;  2BCQ A;  3UXO A;  8ICF A;  2W9M A;  5J2I A;  4FO6 A;  4DOC A;  4YMN A;  4R64 A;  8ICZ A;  3PNC A;  4NY8 A;  3H3A A;  4JWM A;  4M5D A;  3UXN A;  5HRD A;  5DBB A;  4NLK A;  1NO5 A;  2ZH9 A;  1ZQD A;  3L9D A;  5CA7 A;  2BPG A;  4I2A A;  5CB1 A;  9ICG A;  1UEU A;  7ICQ A;  4WC0 A;  7ICS A;  5HRB A;  5III A;  4I27 A;  4MF2 A;  8ICK A;  3HJ1 A;  3C2L A;  7ICU A;  5IIO A;  8ICW A;  3NYB A;  5D49 A;  4QZF A;  3C5F A;  3RH6 A;  1F5A A;  8ICB A;  4RT2 A;  4RQ8 A;  4EP7 A;  1ZJN A;  3GDX A;  3RJH A;  8ICX A;  4AT8 B;  5TZV A;  4DO9 A;  9ICV A;  4IG8 A;  1NOM A;  4KLI A;  2PXI A;  1ZQT A;  5BOM A;  4I2E A;  7ICK A;  4KLU A;  5J0P A;  4R65 A;  3HWT A;  3WFR E;  2FMP A;  3C5G A;  1ZQL A;  1ZQW A;  4QZD A;  1ZQA A;  4UB3 A;  4PHP A;  1MIV A;  3TFR A;  4I2D A;  8ICR A;  4KLF A;  2ZHB A;  1JQR A;  4UB1 A;  5J2A A;  1ZQN A;  3JPN A;  4YD2 A;  7ICF A;  3V7L A;  1BPX A;  3HX0 A;  4M9N A;  4NM1 A;  4YD1 A;  4QZE A;  4RQ5 A;  4PGY A;  3HW8 A;  3RH5 A;  8ICA A;  5HRE A;  1KNY A;  4X0B A;  4IQV A;  1UEV A;  4PHD A;  1ZQF A;  9ICQ A;  4FH5 A;  4LZD A;  2DR9 A;  4KLQ A;  9ICK A;  4E8F A;  5BPC A;  1ZQP A;  4QZI A;  1ZQQ A;  2PFN A;  4RQ2 A;  4X4T A;  5J0W A;  3OVB A;  4XQ8 A;  2BPC A;  1YLQ A;  4UD5 A;  1TV9 A;  5DDM A;  4KLH A;  4QZ9 A;  5J0X A;  3JPS A;  8ICH A;  2NRK A;  4I2H A;  4YMM A;  7ICH A;  1MQ3 A;  8ICC A;  1ZJM A;  4M04 A;  4E80 A;  4KLD A;  1ZQH A;  9ICT A;  5CR0 A;  4UBC A;  1OU5 A;  1HUO A;  1FA0 A;  3OGU A;  3C2K A;  9ICF A;  8ICS A;  4NLN A;  3OV7 A;  1R89 A;  2I9G A;  4O9M A;  3WFS C;  3UXP A;  3H38 A;  4IQT A;  1ZQY A;  8ICO A;  3RJK A;  7ICI A;  4LT6 A;  2ZHA A;  5J0R A;  1KEJ A;  4RQ0 A;  4FHP A;  4E7X A;  4X4R A;  4DOA A;  4PHA A;  2BPF A;  8ICY A;  4M9G A;  5IIK A;  9ICA A;  4KLS A;  3WFO A;  4Z6E A;  3UPS A;  5J0S A;  7ICO A;  3UQ2 A;  4UB5 A;  5IIN A;  4WC6 A;  4X4P A;  4FHV A;  4ATB B;  3AQN A;  5DB8 A;  9ICP A;  4UAY A;  9ICL A;  4QZ8 A;  2PFQ A;  2BE3 A;  4F5P A;  4EBJ A;  5HR9 A;  4F5Q A;  4UB2 A;  9ICO A;  9ICR A;  4X4O A;  1ZQC A;  4PHE A;  9ICH A;  3B0X A;  4FHX A;  9ICS A;  2ID1 A;  4FHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...