4S3NA

Crystal structure of human oas3 domain i in complex with dsrna
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
359
structure length
343
Chain Sequence
MDLYSTPAAALDRFVARKLQPRKEFVEKARRALGALAAALRERPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of sensing long dsRNA via a noncatalytic domain in human oligoadenylate synthetase 3.
pubmed doi rcsb
molecule keywords 2'-5'-oligoadenylate synthase 3
source organism Homo sapiens
molecule tags Transferase/rna
total genus 116
structure length 343
sequence length 359
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10421 OAS1_C 2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4s3nA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4s3nA01
5CA7A 4FHXA 3H38A 5DDMA 2O5AA 3UXOA 3UQ2A 4KLFA 4F5NA 4MFFA 4QZFA 3NYBA 1KEJA 4UBCA 5J2AA 4UB3A 1BPYA 1FA0A 1ZQTA 2ZH4A 4I2FA 4KLDA 4FH5A 7ICSA 4Z6EA 4M9HA 4YMNA 4I29A 1ZJMA 5J2JA 2O1PA 4I2DA 4UAYA 4UAZA 2NRKA 5IILA 5CJ7A 2BCRA 2DR7A 8ICTA 3HX0A 4I2CA 9ICEA 5J0YA 4YMOA 4FO6A 2DRAA 4NKUA 1NO5A 4I2JA 5CB1A 3JPPA 3MDAA 1TFWA 4YN4A 5BPCA 2DVIA 1WOTA 5HC9A 1XSLA 4S3NA 4M9GA 7ICIA 7ICFA 3AU6A 5IIOA 1ZQIA 4QZIA 7ICGA 4YD2A 4TUQA 3UQ0A 3AQMA 2DRBA 1Q79A 4P4OA 1ZQZA 1RZTA 1OU5A 3RJFA 3H3AA 2BCSA 1XSNA 4O9MA 4I2EA 4I28A 7ICEA 4E7XA 4EBKA 1R8AA 3B0YA 4DOAA 3MGHA 9ICFA 5DDYA 2BCVA 4X4UA 4AT9A 1R8BA 9ICAA 9ICVA 4DOCA 5J0PA 4KLHA 8ICAA 2FMSA 5D49A 3RH5A 2BPGA 5J0TA 3OVBA 5HRKA 3L9DA 1ZQHA 5J2HA 4F5OA 3AUOA 4RQ6A 3C2LA 2FMPA 3OGUA 5DB7A 5HHHA 1RPLA 2M2UA 4YD1A 4QZAA 4RT3A 5J2EA 5J0OA 9ICMA 5J2FA 7ICOA 4TURA 8ICWA 4RWNA 9ICQA 3JPSA 4WC2A 1Q78A 7ICVA 1NOMA 4M47A 5J2CA 3AQLA 3C5FA 4UB2A 1ZQAA 1ZQUA 2HHPA 4WC3A 3OUYB 4RQ7A 4RQ4A 2ZH5A 5J29A 2PFPA 4PPXA 7ICNA 2VANA 8ICHA 2W9MA 3V7JA 2GWSA 2PBEA 4X5VA 9ICBA 1ZQGA 4M04A 9ICRA 8ICZA 4DOBA 4KLOA 3AQKA 4QZHA 1JN3A 4E8FA 4WBZA 8ICGA 1MIVA 1ZQBA 5HRDA 4LVSA 8ICXA 4X4RA 4R64A 4TUPA 4WC4A 3V7KA 1R8CA 4XRHA 1MIYA 4RT2A 4EP7A 3UPQA 1ZQNA 4I27A 4KLGA 4X4SA 4M9LA 4X4QA 1MQ2A 4NXZA 2ZH2A 4LZDA 9ICPA 5J2DA 3RJJA 3RJKA 3LQCB 2ZH6A 9ICGA 4FHYA 4RWPA 1KDHA 9ICNA 1ZQKA 2ISOA 1UEVA 4K4HA 4F5RA 2RFFA 3PMLA 3UXNA 4LT6A 2ID1A 4GXKA 5EOZA 3MGIA 3UXPA 9ICJA 3HW8A 4ATBA 4QZDA 4IQWA 3HJ4A 4IQVA 3LK9A 4PH5A 3TFSA 5D4BA 4RQ5A 4M2YA 4AT7A 1ZQWA 4UBBA 8ICEA 4WC0A 2P66A 8ICIA 3JPNA 3JPRA 2DR8A 5J0WA 4UAWA 4EBJA 4QZ9A 4UD5A 3WFPA 8ICOA 5DBCA 4NLKA 3C66A 8ICCA 2ZHBA 4R66A 1ZQOA 1ZQYA 5J2GA 5HRBA 1V4AA 4FHVA 4QZ8A 4M5DA 3RH6A 5J2KA 4RQ8A 3PNCA 1ZQQA 4NLNA 2PFNA 4X4TA 4XQ7A 4QZBA 4YCXA 8ICNA 4UB4A 2PXIA 5HRFA 5BOMA 4PHAA 3HJ1A 4XUSA 5J2BA 1ZJNA 5F2VO 4X0BA 4O5KA 8ICVA 9ICTA 2ISPA 5IINA 4XQ8A 3GDXA 1ZQJA 5CHGA 7ICUA 1JMSA 1MIWA 2DR9A 5IIKA 3ISCA 1ZQVA 5IIIA 4WC5A 4XA5A 2ZH7A 5HRGA 4AT9B 8ICYA 4X4OA 9ICWA 4PGQA 7ICMA 4KLUA 1VFGA 4FHPA 4R65A 1TFYA 3MBYA 2PFQA 4KLQA 4NLZA 4PHEA 3MDCA 1ZQPA 4KLSA 5HRIA 5DBBA 4I2BA 3B0XA 3RH4A 9ICSA 4NM2A 4K4GA 4RPYA 1ZQCA 2FMQA 2BPCA 5HR9A 4JWNA 3WFSC 2BCUA 1JAJA 1BPEA 3HIYA 1PX5A 5DB9A 1HUZA 4Z6CA 3OV7A 1YLQA 5HHIA 4I2GA 4AT8A 4M9NA 5CR0A 3JPTA 2BCQA 4Z6DA 4K4IA 4MFCA 5J0UA 5CWRA 4PHDA 8ICKA 4I2IA 9ICXA 4RQ2A 3WFOA 3WFQE 9ICIA 9ICOA 4E80A 4NY8A 4QZCA 4GXJA 4JWMA 1MQ3A 4RQ3A 4RQ0A 1BPDA 4RPXA 3HWTA 7ICQA 9ICHA 1BPXA 4KLEA 3AU2A 3H39A 5DB6A 9ICCA 4FHWA 7ICLA 1UETA 4O5EA 2M2VA 4RQ1A 3C5GA 5DECA 4NKTA 4UD4A 7ICHA 7ICPA 4WC1A 8ICJA 2ZH3A 4MF2A 4X4VA 4M9JA 4WCWA 5J2IA 4IG8A 8ICFA 4GXIA 1JQRA 4IQTA 7ICTA 4FH3A 1HUOA 9ICKA 4ATBB 3OVSA 5IIJA 4RWOA 4PHPA 4MF8A 4P4PA 3RJIA 4WC7A 3AQNA 2PFOA 5DKWA 4AT7B 4PGYA 3C18A 9ICUA 5DBAA 1ZQEA 4YMMA 3JPQA 4IQUA 4WBYA 5J0QA 2ZH9A 1BPBA 4RWQA 4DO9A 5J0XA 1TV9A 5HREA 3ISDA 3C2KA 5D46A 8ICSA 2BPFA 4TUSA 4UB1A 3V72A 2IHMA 9ICLA 7ICJA 3V7LA 1ZQMA 3ISBA 4WC6A 2M2WA 5IIMA 3TFRA 5J0SA 5HRLA 8ICLA 1ZQFA 8ICQA 3RJHA 4X4PA 4I2HA 2M2TA 4MFAA 8ICMA 4QZGA 3JPOA 4Z6FA 5CP2A 7ICKA 4R63A 1ZQSA 4P2HA 2ZH8A 3WFRE 4O5CA 1ZQLA 8ICRA 3RJEA 3OUYA 3UPSA 1ZQRA 8ICUA 4KLIA 5J0RA 3K75D 4KLJA 1R89A 1XSPA 3PMNA 4X4NA 1VJ7A 3C2MA 2ZHAA 2ZH1A 4I2AA 3H37A 5DB8A 4NM1A 4F5QA 4P4MA 2I9GA 1UEUA 4M0AA 2Q66A 8ICBA 5TZVA 5DEDA 1F5AA 5BOLA 4LZGA 2DR5A 3RJGA 3OVAA 2BE3A 4PGXA 4RPZA 7ICRA 1ZQXA 4QZEA 4KLLA 5HRHA 4X0AA 3JZ0A 4UB5A 1BPZA 1TVAA 8ICPA 1ZQDA 1KNYA 4F5PA 3JYYA 4AT8B 4KLMA 4KLTA
chains in the Genus database with same CATH superfamily
2IHOA 5CA7A 4FHXA 3H38A 5DDMA 2O5AA 3UXOA 3UQ2A 4KLFA 4F5NA 4LEYA 4MFFA 4OAGA 4QZFA 3NYBA 1KEJA 4UBCA 5J2AA 4UB3A 1BPYA 1FA0A 1ZQTA 2ZH4A 4I2FA 4KLDA 4FH5A 7ICSA 4Z6EA 4M9HA 4YMNA 4I29A 3NWIA 1ZJMA 5J2JA 2O1PA 4I2DA 4UAYA 4UAZA 2NRKA 5IILA 5CJ7A 2BCRA 2DR7A 8ICTA 3HX0A 4I2CA 9ICEA 4OAIZ 5J0YA 4YMOA 4FO6A 2DRAA 4NKUA 1NO5A 4I2JA 5CB1A 4NXVA 3JPPA 3MDAA 1TFWA 4YN4A 5BPCA 2DVIA 1WOTA 5HC9A 1XSLA 4S3NA 3NKUA 4M9GA 7ICIA 7ICFA 5B3PA 3AU6A 5IIOA 1ZQIA 4NXUA 4QZIA 7ICGA 4YD2A 4TUQA 3UQ0A 2DRBA 3AQMA 1Q79A 4P4OA 1ZQZA 1RZTA 1OU5A 4HX0A 3RJFA 3H3AA 2BCSA 1XSNA 4O9MA 4I2EA 2HN2A 4I28A 3K7DA 7ICEA 4E7XA 4EBKA 1R8AA 3B0YA 4DOAA 3MGHA 9ICFA 5DDYA 2BCVA 4X4UA 4AT9A 1R8BA 9ICAA 9ICVA 4DOCA 5J0PA 4KLHA 8ICAA 2FMSA 5D49A 3OWGA 3RH5A 2BPGA 5J0TA 3OVBA 5HRKA 3L9DA 1ZQHA 5J2HA 4F5OA 3AUOA 4RQ6A 3C2LA 2FMPA 3OGUA 5B3QA 5DB7A 5HHHA 1RPLA 2M2UA 5CFUA 4YD1A 4QZAA 2BBJA 4RT3A 4WQLA 4K9AA 5J2EA 5J0OA 9ICMA 4K8VA 5J2FA 4WOYA 7ICOA 4TURA 8ICWA 4RWNA 9ICQA 3JPSA 4WC2A 1Q78A 4K9BA 4EV6A 7ICVA 1NOMA 4M47A 5J2CA 3AQLA 3C5FA 4UB2A 1ZQAA 1ZQUA 4O67A 2HHPA 3OUYB 4WC3A 2ZH5A 4RQ7A 4RQ4A 5J29A 2PFPA 4PPXA 7ICNA 2VANA 8ICHA 4NXTA 2W9MA 3V7JA 2GWSA 2FCLA 2PBEA 4X5VA 9ICBA 4EEDA 1ZQGA 4M04A 9ICRA 8ICZA 4DOBA 4KLOA 3AQKA 4QZHA 4E8FA 1JN3A 4WBZA 8ICGA 1MIVA 1ZQBA 5HRDA 4LVSA 8ICXA 4X4RA 4R64A 4TUPA 4I0UA 4WC4A 3V7KA 1R8CA 4XRHA 1MIYA 4RT2A 4EP7A 3UPQA 1ZQNA 4I27A 4KLGA 4X4SA 4M9LA 4X4QA 5JTGA 4NXZA 1MQ2A 2ZH2A 4LZDA 9ICPA 5J2DA 3RJJA 4LEWA 3CK6A 3RJKA 4NXWA 2ZH6A 3LQCB 9ICGA 4FHYA 4RWPA 1KDHA 9ICNA 1ZQKA 2ISOA 4JLZA 1UEVA 4K4HA 4F5RA 2RFFA 3PMLA 3UXNA 2IUBA 4LT6A 2ID1A 4GXKA 4EGWA 5EOZA 3MGIA 3UXPA 9ICJA 3HW8A 4ATBA 4QZDA 4IQWA 3HJ4A 4IQVA 4EEBA 4OAFA 3LK9A 4PH5A 3TFSA 5D4BA 4RQ5A 4M2YA 4AT7A 4XJEA 1ZQWA 4UBBA 8ICEA 4WC0A 2B56A 2P66A 4K96A 8ICIA 3JPNA 3JPRA 2DR8A 5J0WA 4UAWA 4EBJA 4QZ9A 4UD5A 3WFPA 8ICOA 5DBCA 4NLKA 3C66A 8ICCA 2ZHBA 4R66A 1ZQOA 1ZQYA 5J2GA 5HRBA 1V4AA 4FHVA 4QZ8A 4M5DA 3RH6A 5J2KA 3ERCC 4RQ8A 3PNCA 1ZQQA 4NLNA 2PFNA 4X4TA 4XQ7A 3MCRA 5D62A 4QZBA 4YCXA 8ICNA 4UB4A 2PXIA 5HRFA 5BOMA 4PHAA 3HJ1A 4XUSA 3EF2A 5J2BA 1ZJNA 5F2VO 4X0BA 4O5KA 8ICVA 9ICTA 2ISPA 5IINA 4XQ8A 3GDXA 5CFTA 1ZQJA 5CHGA 7ICUA 1JMSA 1MIWA 2DR9A 5IIKA 3ISCA 1ZQVA 5IIIA 4WC5A 2ZH7A 4XA5A 5HRGA 4AT9B 8ICYA 4X4OA 5CHEA 9ICWA 4PGQA 7ICMA 4KLUA 1VFGA 4FHPA 4R65A 1TFYA 3MBYA 2PFQA 4KLQA 4NLZA 4PHEA 3MDCA 1ZQPA 4KLSA 5HRIA 5DBBA 4I2BA 3B0XA 3RH4A 9ICSA 4NM2A 4K4GA 4RPYA 1ZQCA 2FMQA 2BPCA 2B4VA 5HR9A 4JWNA 2BCUA 3WFSC 1BPEA 1JAJA 3HIYA 1PX5A 5DB9A 1HUZA 3OV7A 4Z6CA 1YLQA 5HHIA 4N7RA 4I2GA 4AT8A 4M9NA 5CR0A 3JPTA 2BCQA 4Z6DA 4JLXA 4K4IA 4MFCA 3JCFA 5J0UA 5CWRA 4PHDA 8ICKA 4I2IA 9ICXA 4RQ2A 3WFOA 3WFQE 9ICIA 9ICOA 4E80A 4NY8A 4QZCA 4GXJA 4JWMA 1MQ3A 4RQ3A 4RQ0A 1BPDA 4RPXA 2B51A 4LEVA 4WH5A 3HWTA 7ICQA 9ICHA 1BPXA 4WQKA 4KLEA 3AU2A 3H39A 5DB6A 9ICCA 2BBHA 4FHWA 7ICLA 1UETA 4O5EA 2M2VA 4RQ1A 3C5GA 2GAFD 5DECA 2GA9D 1GPJA 4NKTA 4UD4A 2HN1A 7ICHA 4K97A 7ICPA 4WC1A 8ICJA 2ZH3A 4MF2A 4X4VA 3ER9B 4M9JA 4WCWA 5J2IA 4IG8A 8ICFA 4GXIA 1JQRA 4KB6A 4IQTA 7ICTA 4FH3A 4KM5A 1HUOA 9ICKA 4ATBB 3OVSA 5IIJA 4RWOA 4PHPA 4MF8A 4NXXA 4P4PA 3RJIA 4WC7A 3AQNA 2PFOA 5DKWA 4AT7B 4PGYA 5D63A 3C18A 9ICUA 5DBAA 1ZQEA 4YMMA 3JPQA 4IQUA 4WBYA 4O69A 2ZH9A 5J0QA 1BPBA 4RWQA 4DO9A 5J0XA 5CFSA 4LEZA 1TV9A 5HREA 3ISDA 3C2KA 5D46A 5D61A 2BPFA 8ICSA 4TUSA 4UB1A 3V72A 2IHMA 4O68A 9ICLA 4FO1A 7ICJA 3V7LA 3PHZA 1ZQMA 3ISBA 4WC6A 2EWRA 2M2WA 5IIMA 3TFRA 5J0SA 5HRLA 8ICLA 4K99A 1ZQFA 8ICQA 3RJHA 4X4PA 4I2HA 2M2TA 4MFAA 8ICMA 4QZGA 3JPOA 4Z6FA 5CP2A 7ICKA 4R63A 1ZQSA 4P2HA 2ZH8A 3WFRE 4O5CA 1ZQLA 8ICRA 3RJEA 3OUYA 3UPSA 1ZQRA 8ICUA 4KLIA 5J0RA 3K75D 4KLJA 1R89A 1XSPA 3PMNA 4X4NA 1VJ7A 3C2MA 4K98A 2ZHAA 2ZH1A 4I2AA 3H37A 5DB8A 3NVOA 4NM1A 4F5QA 4P4MA 2I9GA 1UEUA 4M0AA 2Q66A 4MKPA 8ICBA 5TZVA 5DEDA 1F5AA 5BOLA 4LZGA 2DR5A 4O6AA 3RJGA 3OVAA 2BE3A 4PGXA 4OAHA 4RPZA 7ICRA 4QZEA 1ZQXA 4KLLA 5HRHA 3JZ0A 4X0AA 4UB5A 1BPZA 1TVAA 8ICPA 1ZQDA 1KNYA 4F5PA 4AT8B 3JYYA 4KLMA 4KLTA 3ER8C
chains in the Genus database with same CATH topology
5CA7A 4FHXA 3H38A 5DDMA 2O5AA 3UXOA 3UQ2A 4KLFA 4F5NA 4MFFA 4QZFA 3NYBA 1KEJA 4UBCA 5J2AA 4UB3A 1BPYA 1FA0A 1ZQTA 2ZH4A 4I2FA 4KLDA 4FH5A 7ICSA 4Z6EA 4M9HA 4YMNA 4I29A 1ZJMA 5J2JA 2O1PA 4I2DA 4UAYA 4UAZA 2NRKA 5IILA 5CJ7A 2BCRA 2DR7A 8ICTA 3HX0A 4I2CA 9ICEA 5J0YA 4YMOA 4FO6A 2DRAA 4NKUA 1NO5A 4I2JA 5CB1A 3JPPA 3MDAA 1TFWA 4YN4A 5BPCA 2DVIA 1WOTA 5HC9A 1XSLA 4S3NA 4M9GA 7ICIA 7ICFA 3AU6A 5IIOA 1ZQIA 4QZIA 7ICGA 4YD2A 4TUQA 3UQ0A 3AQMA 2DRBA 1Q79A 4P4OA 1ZQZA 1RZTA 1OU5A 3RJFA 3H3AA 2BCSA 1XSNA 4O9MA 4I2EA 4I28A 7ICEA 4E7XA 4EBKA 1R8AA 3B0YA 4DOAA 3MGHA 9ICFA 5DDYA 2BCVA 4X4UA 4AT9A 1R8BA 9ICAA 9ICVA 4DOCA 5J0PA 4KLHA 8ICAA 2FMSA 5D49A 3RH5A 2BPGA 5J0TA 3OVBA 5HRKA 3L9DA 1ZQHA 5J2HA 4F5OA 3AUOA 4RQ6A 3C2LA 2FMPA 3OGUA 5DB7A 5HHHA 1RPLA 2M2UA 4YD1A 4QZAA 4RT3A 5J2EA 5J0OA 9ICMA 5J2FA 7ICOA 4TURA 8ICWA 4RWNA 9ICQA 3JPSA 4WC2A 1Q78A 7ICVA 1NOMA 4M47A 5J2CA 3AQLA 3C5FA 4UB2A 1ZQAA 1ZQUA 2HHPA 4WC3A 3OUYB 4RQ7A 4RQ4A 2ZH5A 5J29A 2PFPA 4PPXA 7ICNA 2VANA 8ICHA 2W9MA 3V7JA 2GWSA 2PBEA 4X5VA 9ICBA 1ZQGA 4M04A 9ICRA 8ICZA 4DOBA 4KLOA 3AQKA 4QZHA 1JN3A 4E8FA 4WBZA 8ICGA 1MIVA 1ZQBA 5HRDA 4LVSA 8ICXA 4X4RA 4R64A 4TUPA 4WC4A 3V7KA 1R8CA 4XRHA 1MIYA 4RT2A 4EP7A 3UPQA 1ZQNA 4I27A 4KLGA 4X4SA 4M9LA 4X4QA 1MQ2A 4NXZA 2ZH2A 4LZDA 9ICPA 5J2DA 3RJJA 3RJKA 3LQCB 2ZH6A 9ICGA 4FHYA 4RWPA 1KDHA 9ICNA 1ZQKA 2ISOA 1UEVA 4K4HA 4F5RA 2RFFA 3PMLA 3UXNA 4LT6A 2ID1A 4GXKA 5EOZA 3MGIA 3UXPA 9ICJA 3HW8A 4ATBA 4QZDA 4IQWA 3HJ4A 4IQVA 3LK9A 4PH5A 3TFSA 5D4BA 4RQ5A 4M2YA 4AT7A 1ZQWA 4UBBA 8ICEA 4WC0A 2P66A 8ICIA 3JPNA 3JPRA 2DR8A 5J0WA 4UAWA 4EBJA 4QZ9A 4UD5A 3WFPA 8ICOA 5DBCA 4NLKA 3C66A 8ICCA 2ZHBA 4R66A 1ZQOA 1ZQYA 5J2GA 5HRBA 1V4AA 4FHVA 4QZ8A 4M5DA 3RH6A 5J2KA 4RQ8A 3PNCA 1ZQQA 4NLNA 2PFNA 4X4TA 4XQ7A 4QZBA 4YCXA 8ICNA 4UB4A 2PXIA 5HRFA 5BOMA 4PHAA 3HJ1A 4XUSA 5J2BA 1ZJNA 5F2VO 4X0BA 4O5KA 8ICVA 9ICTA 2ISPA 5IINA 4XQ8A 3GDXA 1ZQJA 5CHGA 7ICUA 1JMSA 1MIWA 2DR9A 5IIKA 3ISCA 1ZQVA 5IIIA 4WC5A 4XA5A 2ZH7A 5HRGA 4AT9B 8ICYA 4X4OA 9ICWA 4PGQA 7ICMA 4KLUA 1VFGA 4FHPA 4R65A 1TFYA 3MBYA 2PFQA 4KLQA 4NLZA 4PHEA 3MDCA 1ZQPA 4KLSA 5HRIA 5DBBA 4I2BA 3B0XA 3RH4A 9ICSA 4NM2A 4K4GA 4RPYA 1ZQCA 2FMQA 2BPCA 5HR9A 4JWNA 3WFSC 2BCUA 1JAJA 1BPEA 3HIYA 1PX5A 5DB9A 1HUZA 4Z6CA 3OV7A 1YLQA 5HHIA 4I2GA 4AT8A 4M9NA 5CR0A 3JPTA 2BCQA 4Z6DA 4K4IA 4MFCA 5J0UA 5CWRA 4PHDA 8ICKA 4I2IA 9ICXA 4RQ2A 3WFOA 3WFQE 9ICIA 9ICOA 4E80A 4NY8A 4QZCA 4GXJA 4JWMA 1MQ3A 4RQ3A 4RQ0A 1BPDA 4RPXA 3HWTA 7ICQA 9ICHA 1BPXA 4KLEA 3AU2A 3H39A 5DB6A 9ICCA 4FHWA 7ICLA 1UETA 4O5EA 2M2VA 4RQ1A 3C5GA 5DECA 4NKTA 4UD4A 7ICHA 7ICPA 4WC1A 8ICJA 2ZH3A 4MF2A 4X4VA 4M9JA 4WCWA 5J2IA 4IG8A 8ICFA 4GXIA 1JQRA 4IQTA 7ICTA 4FH3A 1HUOA 9ICKA 4ATBB 3OVSA 5IIJA 4RWOA 4PHPA 4MF8A 4P4PA 3RJIA 4WC7A 3AQNA 2PFOA 5DKWA 4AT7B 4PGYA 3C18A 9ICUA 5DBAA 1ZQEA 4YMMA 3JPQA 4IQUA 4WBYA 5J0QA 2ZH9A 1BPBA 4RWQA 4DO9A 5J0XA 1TV9A 5HREA 3ISDA 3C2KA 5D46A 8ICSA 2BPFA 4TUSA 4UB1A 3V72A 2IHMA 9ICLA 7ICJA 3V7LA 1ZQMA 3ISBA 4WC6A 2M2WA 5IIMA 3TFRA 5J0SA 5HRLA 8ICLA 1ZQFA 8ICQA 3RJHA 4X4PA 4I2HA 2M2TA 4MFAA 8ICMA 4QZGA 3JPOA 4Z6FA 5CP2A 7ICKA 4R63A 1ZQSA 4P2HA 2ZH8A 3WFRE 4O5CA 1ZQLA 8ICRA 3RJEA 3OUYA 3UPSA 1ZQRA 8ICUA 4KLIA 5J0RA 3K75D 4KLJA 1R89A 1XSPA 3PMNA 4X4NA 1VJ7A 3C2MA 2ZHAA 2ZH1A 4I2AA 3H37A 5DB8A 4NM1A 4F5QA 4P4MA 2I9GA 1UEUA 4M0AA 2Q66A 8ICBA 5TZVA 5DEDA 1F5AA 5BOLA 4LZGA 2DR5A 3RJGA 3OVAA 2BE3A 4PGXA 4RPZA 7ICRA 1ZQXA 4QZEA 4KLLA 5HRHA 4X0AA 3JZ0A 4UB5A 1BPZA 1TVAA 8ICPA 1ZQDA 1KNYA 4F5PA 3JYYA 4AT8B 4KLMA 4KLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CA7 A;  4FHX A;  3H38 A;  5DDM A;  2O5A A;  3UXO A;  3UQ2 A;  4KLF A;  4F5N A;  4MFF A;  4QZF A;  3NYB A;  1KEJ A;  4UBC A;  5J2A A;  4UB3 A;  1BPY A;  1FA0 A;  1ZQT A;  2ZH4 A;  4I2F A;  4KLD A;  4FH5 A;  7ICS A;  4Z6E A;  4M9H A;  4YMN A;  4I29 A;  1ZJM A;  5J2J A;  2O1P A;  4I2D A;  4UAY A;  4UAZ A;  2NRK A;  5IIL A;  5CJ7 A;  2BCR A;  2DR7 A;  8ICT A;  3HX0 A;  4I2C A;  9ICE A;  5J0Y A;  4YMO A;  4FO6 A;  2DRA A;  4NKU A;  1NO5 A;  4I2J A;  5CB1 A;  3JPP A;  3MDA A;  1TFW A;  4YN4 A;  5BPC A;  2DVI A;  1WOT A;  5HC9 A;  1XSL A;  4S3N A;  4M9G A;  7ICI A;  7ICF A;  3AU6 A;  5IIO A;  1ZQI A;  4QZI A;  7ICG A;  4YD2 A;  4TUQ A;  3UQ0 A;  3AQM A;  2DRB A;  1Q79 A;  4P4O A;  1ZQZ A;  1RZT A;  1OU5 A;  3RJF A;  3H3A A;  2BCS A;  1XSN A;  4O9M A;  4I2E A;  4I28 A;  7ICE A;  4E7X A;  4EBK A;  1R8A A;  3B0Y A;  4DOA A;  3MGH A;  9ICF A;  5DDY A;  2BCV A;  4X4U A;  4AT9 A;  1R8B A;  9ICA A;  9ICV A;  4DOC A;  5J0P A;  4KLH A;  8ICA A;  2FMS A;  5D49 A;  3RH5 A;  2BPG A;  5J0T A;  3OVB A;  5HRK A;  3L9D A;  1ZQH A;  5J2H A;  4F5O A;  3AUO A;  4RQ6 A;  3C2L A;  2FMP A;  3OGU A;  5DB7 A;  5HHH A;  1RPL A;  2M2U A;  4YD1 A;  4QZA A;  4RT3 A;  5J2E A;  5J0O A;  9ICM A;  5J2F A;  7ICO A;  4TUR A;  8ICW A;  4RWN A;  9ICQ A;  3JPS A;  4WC2 A;  1Q78 A;  7ICV A;  1NOM A;  4M47 A;  5J2C A;  3AQL A;  3C5F A;  4UB2 A;  1ZQA A;  1ZQU A;  2HHP A;  4WC3 A;  3OUY B;  4RQ7 A;  4RQ4 A;  2ZH5 A;  5J29 A;  2PFP A;  4PPX A;  7ICN A;  2VAN A;  8ICH A;  2W9M A;  3V7J A;  2GWS A;  2PBE A;  4X5V A;  9ICB A;  1ZQG A;  4M04 A;  9ICR A;  8ICZ A;  4DOB A;  4KLO A;  3AQK A;  4QZH A;  1JN3 A;  4E8F A;  4WBZ A;  8ICG A;  1MIV A;  1ZQB A;  5HRD A;  4LVS A;  8ICX A;  4X4R A;  4R64 A;  4TUP A;  4WC4 A;  3V7K A;  1R8C A;  4XRH A;  1MIY A;  4RT2 A;  4EP7 A;  3UPQ A;  1ZQN A;  4I27 A;  4KLG A;  4X4S A;  4M9L A;  4X4Q A;  1MQ2 A;  4NXZ A;  2ZH2 A;  4LZD A;  9ICP A;  5J2D A;  3RJJ A;  3RJK A;  3LQC B;  2ZH6 A;  9ICG A;  4FHY A;  4RWP A;  1KDH A;  9ICN A;  1ZQK A;  2ISO A;  1UEV A;  4K4H A;  4F5R A;  2RFF A;  3PML A;  3UXN A;  4LT6 A;  2ID1 A;  4GXK A;  5EOZ A;  3MGI A;  3UXP A;  9ICJ A;  3HW8 A;  4ATB A;  4QZD A;  4IQW A;  3HJ4 A;  4IQV A;  3LK9 A;  4PH5 A;  3TFS A;  5D4B A;  4RQ5 A;  4M2Y A;  4AT7 A;  1ZQW A;  4UBB A;  8ICE A;  4WC0 A;  2P66 A;  8ICI A;  3JPN A;  3JPR A;  2DR8 A;  5J0W A;  4UAW A;  4EBJ A;  4QZ9 A;  4UD5 A;  3WFP A;  8ICO A;  5DBC A;  4NLK A;  3C66 A;  8ICC A;  2ZHB A;  4R66 A;  1ZQO A;  1ZQY A;  5J2G A;  5HRB A;  1V4A A;  4FHV A;  4QZ8 A;  4M5D A;  3RH6 A;  5J2K A;  4RQ8 A;  3PNC A;  1ZQQ A;  4NLN A;  2PFN A;  4X4T A;  4XQ7 A;  4QZB A;  4YCX A;  8ICN A;  4UB4 A;  2PXI A;  5HRF A;  5BOM A;  4PHA A;  3HJ1 A;  4XUS A;  5J2B A;  1ZJN A;  5F2V O;  4X0B A;  4O5K A;  8ICV A;  9ICT A;  2ISP A;  5IIN A;  4XQ8 A;  3GDX A;  1ZQJ A;  5CHG A;  7ICU A;  1JMS A;  1MIW A;  2DR9 A;  5IIK A;  3ISC A;  1ZQV A;  5III A;  4WC5 A;  4XA5 A;  2ZH7 A;  5HRG A;  4AT9 B;  8ICY A;  4X4O A;  9ICW A;  4PGQ A;  7ICM A;  4KLU A;  1VFG A;  4FHP A;  4R65 A;  1TFY A;  3MBY A;  2PFQ A;  4KLQ A;  4NLZ A;  4PHE A;  3MDC A;  1ZQP A;  4KLS A;  5HRI A;  5DBB A;  4I2B A;  3B0X A;  3RH4 A;  9ICS A;  4NM2 A;  4K4G A;  4RPY A;  1ZQC A;  2FMQ A;  2BPC A;  5HR9 A;  4JWN A;  3WFS C;  2BCU A;  1JAJ A;  1BPE A;  3HIY A;  1PX5 A;  5DB9 A;  1HUZ A;  4Z6C A;  3OV7 A;  1YLQ A;  5HHI A;  4I2G A;  4AT8 A;  4M9N A;  5CR0 A;  3JPT A;  2BCQ A;  4Z6D A;  4K4I A;  4MFC A;  5J0U A;  5CWR A;  4PHD A;  8ICK A;  4I2I A;  9ICX A;  4RQ2 A;  3WFO A;  3WFQ E;  9ICI A;  9ICO A;  4E80 A;  4NY8 A;  4QZC A;  4GXJ A;  4JWM A;  1MQ3 A;  4RQ3 A;  4RQ0 A;  1BPD A;  4RPX A;  3HWT A;  7ICQ A;  9ICH A;  1BPX A;  4KLE A;  3AU2 A;  3H39 A;  5DB6 A;  9ICC A;  4FHW A;  7ICL A;  1UET A;  4O5E A;  2M2V A;  4RQ1 A;  3C5G A;  5DEC A;  4NKT A;  4UD4 A;  7ICH A;  7ICP A;  4WC1 A;  8ICJ A;  2ZH3 A;  4MF2 A;  4X4V A;  4M9J A;  4WCW A;  5J2I A;  4IG8 A;  8ICF A;  4GXI A;  1JQR A;  4IQT A;  7ICT A;  4FH3 A;  1HUO A;  9ICK A;  4ATB B;  3OVS A;  5IIJ A;  4RWO A;  4PHP A;  4MF8 A;  4P4P A;  3RJI A;  4WC7 A;  3AQN A;  2PFO A;  5DKW A;  4AT7 B;  4PGY A;  3C18 A;  9ICU A;  5DBA A;  1ZQE A;  4YMM A;  3JPQ A;  4IQU A;  4WBY A;  5J0Q A;  2ZH9 A;  1BPB A;  4RWQ A;  4DO9 A;  5J0X A;  1TV9 A;  5HRE A;  3ISD A;  3C2K A;  5D46 A;  8ICS A;  2BPF A;  4TUS A;  4UB1 A;  3V72 A;  2IHM A;  9ICL A;  7ICJ A;  3V7L A;  1ZQM A;  3ISB A;  4WC6 A;  2M2W A;  5IIM A;  3TFR A;  5J0S A;  5HRL A;  8ICL A;  1ZQF A;  8ICQ A;  3RJH A;  4X4P A;  4I2H A;  2M2T A;  4MFA A;  8ICM A;  4QZG A;  3JPO A;  4Z6F A;  5CP2 A;  7ICK A;  4R63 A;  1ZQS A;  4P2H A;  2ZH8 A;  3WFR E;  4O5C A;  1ZQL A;  8ICR A;  3RJE A;  3OUY A;  3UPS A;  1ZQR A;  8ICU A;  4KLI A;  5J0R A;  3K75 D;  4KLJ A;  1R89 A;  1XSP A;  3PMN A;  4X4N A;  1VJ7 A;  3C2M A;  2ZHA A;  2ZH1 A;  4I2A A;  3H37 A;  5DB8 A;  4NM1 A;  4F5Q A;  4P4M A;  2I9G A;  1UEU A;  4M0A A;  2Q66 A;  8ICB A;  5TZV A;  5DED A;  1F5A A;  5BOL A;  4LZG A;  2DR5 A;  3RJG A;  3OVA A;  2BE3 A;  4PGX A;  4RPZ A;  7ICR A;  1ZQX A;  4QZE A;  4KLL A;  5HRH A;  4X0A A;  3JZ0 A;  4UB5 A;  1BPZ A;  1TVA A;  8ICP A;  1ZQD A;  1KNY A;  4F5P A;  3JYY A;  4AT8 B;  4KLM A;  4KLT A; 
#chains in the Genus database with same CATH topology
 2IHO A;  5CA7 A;  4FHX A;  3H38 A;  5DDM A;  2O5A A;  3UXO A;  3UQ2 A;  4KLF A;  4F5N A;  4LEY A;  4MFF A;  4OAG A;  4QZF A;  3NYB A;  1KEJ A;  4UBC A;  5J2A A;  4UB3 A;  1BPY A;  1FA0 A;  1ZQT A;  2ZH4 A;  4I2F A;  4KLD A;  4FH5 A;  7ICS A;  4Z6E A;  4M9H A;  4YMN A;  4I29 A;  3NWI A;  1ZJM A;  5J2J A;  2O1P A;  4I2D A;  4UAY A;  4UAZ A;  2NRK A;  5IIL A;  5CJ7 A;  2BCR A;  2DR7 A;  8ICT A;  3HX0 A;  4I2C A;  9ICE A;  4OAI Z;  5J0Y A;  4YMO A;  4FO6 A;  2DRA A;  4NKU A;  1NO5 A;  4I2J A;  5CB1 A;  4NXV A;  3JPP A;  3MDA A;  1TFW A;  4YN4 A;  5BPC A;  2DVI A;  1WOT A;  5HC9 A;  1XSL A;  4S3N A;  3NKU A;  4M9G A;  7ICI A;  7ICF A;  5B3P A;  3AU6 A;  5IIO A;  1ZQI A;  4NXU A;  4QZI A;  7ICG A;  4YD2 A;  4TUQ A;  3UQ0 A;  2DRB A;  3AQM A;  1Q79 A;  4P4O A;  1ZQZ A;  1RZT A;  1OU5 A;  4HX0 A;  3RJF A;  3H3A A;  2BCS A;  1XSN A;  4O9M A;  4I2E A;  2HN2 A;  4I28 A;  3K7D A;  7ICE A;  4E7X A;  4EBK A;  1R8A A;  3B0Y A;  4DOA A;  3MGH A;  9ICF A;  5DDY A;  2BCV A;  4X4U A;  4AT9 A;  1R8B A;  9ICA A;  9ICV A;  4DOC A;  5J0P A;  4KLH A;  8ICA A;  2FMS A;  5D49 A;  3OWG A;  3RH5 A;  2BPG A;  5J0T A;  3OVB A;  5HRK A;  3L9D A;  1ZQH A;  5J2H A;  4F5O A;  3AUO A;  4RQ6 A;  3C2L A;  2FMP A;  3OGU A;  5B3Q A;  5DB7 A;  5HHH A;  1RPL A;  2M2U A;  5CFU A;  4YD1 A;  4QZA A;  2BBJ A;  4RT3 A;  4WQL A;  4K9A A;  5J2E A;  5J0O A;  9ICM A;  4K8V A;  5J2F A;  4WOY A;  7ICO A;  4TUR A;  8ICW A;  4RWN A;  9ICQ A;  3JPS A;  4WC2 A;  1Q78 A;  4K9B A;  4EV6 A;  7ICV A;  1NOM A;  4M47 A;  5J2C A;  3AQL A;  3C5F A;  4UB2 A;  1ZQA A;  1ZQU A;  4O67 A;  2HHP A;  3OUY B;  4WC3 A;  2ZH5 A;  4RQ7 A;  4RQ4 A;  5J29 A;  2PFP A;  4PPX A;  7ICN A;  2VAN A;  8ICH A;  4NXT A;  2W9M A;  3V7J A;  2GWS A;  2FCL A;  2PBE A;  4X5V A;  9ICB A;  4EED A;  1ZQG A;  4M04 A;  9ICR A;  8ICZ A;  4DOB A;  4KLO A;  3AQK A;  4QZH A;  4E8F A;  1JN3 A;  4WBZ A;  8ICG A;  1MIV A;  1ZQB A;  5HRD A;  4LVS A;  8ICX A;  4X4R A;  4R64 A;  4TUP A;  4I0U A;  4WC4 A;  3V7K A;  1R8C A;  4XRH A;  1MIY A;  4RT2 A;  4EP7 A;  3UPQ A;  1ZQN A;  4I27 A;  4KLG A;  4X4S A;  4M9L A;  4X4Q A;  5JTG A;  4NXZ A;  1MQ2 A;  2ZH2 A;  4LZD A;  9ICP A;  5J2D A;  3RJJ A;  4LEW A;  3CK6 A;  3RJK A;  4NXW A;  2ZH6 A;  3LQC B;  9ICG A;  4FHY A;  4RWP A;  1KDH A;  9ICN A;  1ZQK A;  2ISO A;  4JLZ A;  1UEV A;  4K4H A;  4F5R A;  2RFF A;  3PML A;  3UXN A;  2IUB A;  4LT6 A;  2ID1 A;  4GXK A;  4EGW A;  5EOZ A;  3MGI A;  3UXP A;  9ICJ A;  3HW8 A;  4ATB A;  4QZD A;  4IQW A;  3HJ4 A;  4IQV A;  4EEB A;  4OAF A;  3LK9 A;  4PH5 A;  3TFS A;  5D4B A;  4RQ5 A;  4M2Y A;  4AT7 A;  4XJE A;  1ZQW A;  4UBB A;  8ICE A;  4WC0 A;  2B56 A;  2P66 A;  4K96 A;  8ICI A;  3JPN A;  3JPR A;  2DR8 A;  5J0W A;  4UAW A;  4EBJ A;  4QZ9 A;  4UD5 A;  3WFP A;  8ICO A;  5DBC A;  4NLK A;  3C66 A;  8ICC A;  2ZHB A;  4R66 A;  1ZQO A;  1ZQY A;  5J2G A;  5HRB A;  1V4A A;  4FHV A;  4QZ8 A;  4M5D A;  3RH6 A;  5J2K A;  3ERC C;  4RQ8 A;  3PNC A;  1ZQQ A;  4NLN A;  2PFN A;  4X4T A;  4XQ7 A;  3MCR A;  5D62 A;  4QZB A;  4YCX A;  8ICN A;  4UB4 A;  2PXI A;  5HRF A;  5BOM A;  4PHA A;  3HJ1 A;  4XUS A;  3EF2 A;  5J2B A;  1ZJN A;  5F2V O;  4X0B A;  4O5K A;  8ICV A;  9ICT A;  2ISP A;  5IIN A;  4XQ8 A;  3GDX A;  5CFT A;  1ZQJ A;  5CHG A;  7ICU A;  1JMS A;  1MIW A;  2DR9 A;  5IIK A;  3ISC A;  1ZQV A;  5III A;  4WC5 A;  2ZH7 A;  4XA5 A;  5HRG A;  4AT9 B;  8ICY A;  4X4O A;  5CHE A;  9ICW A;  4PGQ A;  7ICM A;  4KLU A;  1VFG A;  4FHP A;  4R65 A;  1TFY A;  3MBY A;  2PFQ A;  4KLQ A;  4NLZ A;  4PHE A;  3MDC A;  1ZQP A;  4KLS A;  5HRI A;  5DBB A;  4I2B A;  3B0X A;  3RH4 A;  9ICS A;  4NM2 A;  4K4G A;  4RPY A;  1ZQC A;  2FMQ A;  2BPC A;  2B4V A;  5HR9 A;  4JWN A;  2BCU A;  3WFS C;  1BPE A;  1JAJ A;  3HIY A;  1PX5 A;  5DB9 A;  1HUZ A;  3OV7 A;  4Z6C A;  1YLQ A;  5HHI A;  4N7R A;  4I2G A;  4AT8 A;  4M9N A;  5CR0 A;  3JPT A;  2BCQ A;  4Z6D A;  4JLX A;  4K4I A;  4MFC A;  3JCF A;  5J0U A;  5CWR A;  4PHD A;  8ICK A;  4I2I A;  9ICX A;  4RQ2 A;  3WFO A;  3WFQ E;  9ICI A;  9ICO A;  4E80 A;  4NY8 A;  4QZC A;  4GXJ A;  4JWM A;  1MQ3 A;  4RQ3 A;  4RQ0 A;  1BPD A;  4RPX A;  2B51 A;  4LEV A;  4WH5 A;  3HWT A;  7ICQ A;  9ICH A;  1BPX A;  4WQK A;  4KLE A;  3AU2 A;  3H39 A;  5DB6 A;  9ICC A;  2BBH A;  4FHW A;  7ICL A;  1UET A;  4O5E A;  2M2V A;  4RQ1 A;  3C5G A;  2GAF D;  5DEC A;  2GA9 D;  1GPJ A;  4NKT A;  4UD4 A;  2HN1 A;  7ICH A;  4K97 A;  7ICP A;  4WC1 A;  8ICJ A;  2ZH3 A;  4MF2 A;  4X4V A;  3ER9 B;  4M9J A;  4WCW A;  5J2I A;  4IG8 A;  8ICF A;  4GXI A;  1JQR A;  4KB6 A;  4IQT A;  7ICT A;  4FH3 A;  4KM5 A;  1HUO A;  9ICK A;  4ATB B;  3OVS A;  5IIJ A;  4RWO A;  4PHP A;  4MF8 A;  4NXX A;  4P4P A;  3RJI A;  4WC7 A;  3AQN A;  2PFO A;  5DKW A;  4AT7 B;  4PGY A;  5D63 A;  3C18 A;  9ICU A;  5DBA A;  1ZQE A;  4YMM A;  3JPQ A;  4IQU A;  4WBY A;  4O69 A;  2ZH9 A;  5J0Q A;  1BPB A;  4RWQ A;  4DO9 A;  5J0X A;  5CFS A;  4LEZ A;  1TV9 A;  5HRE A;  3ISD A;  3C2K A;  5D46 A;  5D61 A;  2BPF A;  8ICS A;  4TUS A;  4UB1 A;  3V72 A;  2IHM A;  4O68 A;  9ICL A;  4FO1 A;  7ICJ A;  3V7L A;  3PHZ A;  1ZQM A;  3ISB A;  4WC6 A;  2EWR A;  2M2W A;  5IIM A;  3TFR A;  5J0S A;  5HRL A;  8ICL A;  4K99 A;  1ZQF A;  8ICQ A;  3RJH A;  4X4P A;  4I2H A;  2M2T A;  4MFA A;  8ICM A;  4QZG A;  3JPO A;  4Z6F A;  5CP2 A;  7ICK A;  4R63 A;  1ZQS A;  4P2H A;  2ZH8 A;  3WFR E;  4O5C A;  1ZQL A;  8ICR A;  3RJE A;  3OUY A;  3UPS A;  1ZQR A;  8ICU A;  4KLI A;  5J0R A;  3K75 D;  4KLJ A;  1R89 A;  1XSP A;  3PMN A;  4X4N A;  1VJ7 A;  3C2M A;  4K98 A;  2ZHA A;  2ZH1 A;  4I2A A;  3H37 A;  5DB8 A;  3NVO A;  4NM1 A;  4F5Q A;  4P4M A;  2I9G A;  1UEU A;  4M0A A;  2Q66 A;  4MKP A;  8ICB A;  5TZV A;  5DED A;  1F5A A;  5BOL A;  4LZG A;  2DR5 A;  4O6A A;  3RJG A;  3OVA A;  2BE3 A;  4PGX A;  4OAH A;  4RPZ A;  7ICR A;  4QZE A;  1ZQX A;  4KLL A;  5HRH A;  3JZ0 A;  4X0A A;  4UB5 A;  1BPZ A;  1TVA A;  8ICP A;  1ZQD A;  1KNY A;  4F5P A;  4AT8 B;  3JYY A;  4KLM A;  4KLT A;  3ER8 C; 
#chains in the Genus database with same CATH homology
 5CA7 A;  4FHX A;  3H38 A;  5DDM A;  2O5A A;  3UXO A;  3UQ2 A;  4KLF A;  4F5N A;  4MFF A;  4QZF A;  3NYB A;  1KEJ A;  4UBC A;  5J2A A;  4UB3 A;  1BPY A;  1FA0 A;  1ZQT A;  2ZH4 A;  4I2F A;  4KLD A;  4FH5 A;  7ICS A;  4Z6E A;  4M9H A;  4YMN A;  4I29 A;  1ZJM A;  5J2J A;  2O1P A;  4I2D A;  4UAY A;  4UAZ A;  2NRK A;  5IIL A;  5CJ7 A;  2BCR A;  2DR7 A;  8ICT A;  3HX0 A;  4I2C A;  9ICE A;  5J0Y A;  4YMO A;  4FO6 A;  2DRA A;  4NKU A;  1NO5 A;  4I2J A;  5CB1 A;  3JPP A;  3MDA A;  1TFW A;  4YN4 A;  5BPC A;  2DVI A;  1WOT A;  5HC9 A;  1XSL A;  4S3N A;  4M9G A;  7ICI A;  7ICF A;  3AU6 A;  5IIO A;  1ZQI A;  4QZI A;  7ICG A;  4YD2 A;  4TUQ A;  3UQ0 A;  3AQM A;  2DRB A;  1Q79 A;  4P4O A;  1ZQZ A;  1RZT A;  1OU5 A;  3RJF A;  3H3A A;  2BCS A;  1XSN A;  4O9M A;  4I2E A;  4I28 A;  7ICE A;  4E7X A;  4EBK A;  1R8A A;  3B0Y A;  4DOA A;  3MGH A;  9ICF A;  5DDY A;  2BCV A;  4X4U A;  4AT9 A;  1R8B A;  9ICA A;  9ICV A;  4DOC A;  5J0P A;  4KLH A;  8ICA A;  2FMS A;  5D49 A;  3RH5 A;  2BPG A;  5J0T A;  3OVB A;  5HRK A;  3L9D A;  1ZQH A;  5J2H A;  4F5O A;  3AUO A;  4RQ6 A;  3C2L A;  2FMP A;  3OGU A;  5DB7 A;  5HHH A;  1RPL A;  2M2U A;  4YD1 A;  4QZA A;  4RT3 A;  5J2E A;  5J0O A;  9ICM A;  5J2F A;  7ICO A;  4TUR A;  8ICW A;  4RWN A;  9ICQ A;  3JPS A;  4WC2 A;  1Q78 A;  7ICV A;  1NOM A;  4M47 A;  5J2C A;  3AQL A;  3C5F A;  4UB2 A;  1ZQA A;  1ZQU A;  2HHP A;  4WC3 A;  3OUY B;  4RQ7 A;  4RQ4 A;  2ZH5 A;  5J29 A;  2PFP A;  4PPX A;  7ICN A;  2VAN A;  8ICH A;  2W9M A;  3V7J A;  2GWS A;  2PBE A;  4X5V A;  9ICB A;  1ZQG A;  4M04 A;  9ICR A;  8ICZ A;  4DOB A;  4KLO A;  3AQK A;  4QZH A;  1JN3 A;  4E8F A;  4WBZ A;  8ICG A;  1MIV A;  1ZQB A;  5HRD A;  4LVS A;  8ICX A;  4X4R A;  4R64 A;  4TUP A;  4WC4 A;  3V7K A;  1R8C A;  4XRH A;  1MIY A;  4RT2 A;  4EP7 A;  3UPQ A;  1ZQN A;  4I27 A;  4KLG A;  4X4S A;  4M9L A;  4X4Q A;  1MQ2 A;  4NXZ A;  2ZH2 A;  4LZD A;  9ICP A;  5J2D A;  3RJJ A;  3RJK A;  3LQC B;  2ZH6 A;  9ICG A;  4FHY A;  4RWP A;  1KDH A;  9ICN A;  1ZQK A;  2ISO A;  1UEV A;  4K4H A;  4F5R A;  2RFF A;  3PML A;  3UXN A;  4LT6 A;  2ID1 A;  4GXK A;  5EOZ A;  3MGI A;  3UXP A;  9ICJ A;  3HW8 A;  4ATB A;  4QZD A;  4IQW A;  3HJ4 A;  4IQV A;  3LK9 A;  4PH5 A;  3TFS A;  5D4B A;  4RQ5 A;  4M2Y A;  4AT7 A;  1ZQW A;  4UBB A;  8ICE A;  4WC0 A;  2P66 A;  8ICI A;  3JPN A;  3JPR A;  2DR8 A;  5J0W A;  4UAW A;  4EBJ A;  4QZ9 A;  4UD5 A;  3WFP A;  8ICO A;  5DBC A;  4NLK A;  3C66 A;  8ICC A;  2ZHB A;  4R66 A;  1ZQO A;  1ZQY A;  5J2G A;  5HRB A;  1V4A A;  4FHV A;  4QZ8 A;  4M5D A;  3RH6 A;  5J2K A;  4RQ8 A;  3PNC A;  1ZQQ A;  4NLN A;  2PFN A;  4X4T A;  4XQ7 A;  4QZB A;  4YCX A;  8ICN A;  4UB4 A;  2PXI A;  5HRF A;  5BOM A;  4PHA A;  3HJ1 A;  4XUS A;  5J2B A;  1ZJN A;  5F2V O;  4X0B A;  4O5K A;  8ICV A;  9ICT A;  2ISP A;  5IIN A;  4XQ8 A;  3GDX A;  1ZQJ A;  5CHG A;  7ICU A;  1JMS A;  1MIW A;  2DR9 A;  5IIK A;  3ISC A;  1ZQV A;  5III A;  4WC5 A;  4XA5 A;  2ZH7 A;  5HRG A;  4AT9 B;  8ICY A;  4X4O A;  9ICW A;  4PGQ A;  7ICM A;  4KLU A;  1VFG A;  4FHP A;  4R65 A;  1TFY A;  3MBY A;  2PFQ A;  4KLQ A;  4NLZ A;  4PHE A;  3MDC A;  1ZQP A;  4KLS A;  5HRI A;  5DBB A;  4I2B A;  3B0X A;  3RH4 A;  9ICS A;  4NM2 A;  4K4G A;  4RPY A;  1ZQC A;  2FMQ A;  2BPC A;  5HR9 A;  4JWN A;  3WFS C;  2BCU A;  1JAJ A;  1BPE A;  3HIY A;  1PX5 A;  5DB9 A;  1HUZ A;  4Z6C A;  3OV7 A;  1YLQ A;  5HHI A;  4I2G A;  4AT8 A;  4M9N A;  5CR0 A;  3JPT A;  2BCQ A;  4Z6D A;  4K4I A;  4MFC A;  5J0U A;  5CWR A;  4PHD A;  8ICK A;  4I2I A;  9ICX A;  4RQ2 A;  3WFO A;  3WFQ E;  9ICI A;  9ICO A;  4E80 A;  4NY8 A;  4QZC A;  4GXJ A;  4JWM A;  1MQ3 A;  4RQ3 A;  4RQ0 A;  1BPD A;  4RPX A;  3HWT A;  7ICQ A;  9ICH A;  1BPX A;  4KLE A;  3AU2 A;  3H39 A;  5DB6 A;  9ICC A;  4FHW A;  7ICL A;  1UET A;  4O5E A;  2M2V A;  4RQ1 A;  3C5G A;  5DEC A;  4NKT A;  4UD4 A;  7ICH A;  7ICP A;  4WC1 A;  8ICJ A;  2ZH3 A;  4MF2 A;  4X4V A;  4M9J A;  4WCW A;  5J2I A;  4IG8 A;  8ICF A;  4GXI A;  1JQR A;  4IQT A;  7ICT A;  4FH3 A;  1HUO A;  9ICK A;  4ATB B;  3OVS A;  5IIJ A;  4RWO A;  4PHP A;  4MF8 A;  4P4P A;  3RJI A;  4WC7 A;  3AQN A;  2PFO A;  5DKW A;  4AT7 B;  4PGY A;  3C18 A;  9ICU A;  5DBA A;  1ZQE A;  4YMM A;  3JPQ A;  4IQU A;  4WBY A;  5J0Q A;  2ZH9 A;  1BPB A;  4RWQ A;  4DO9 A;  5J0X A;  1TV9 A;  5HRE A;  3ISD A;  3C2K A;  5D46 A;  8ICS A;  2BPF A;  4TUS A;  4UB1 A;  3V72 A;  2IHM A;  9ICL A;  7ICJ A;  3V7L A;  1ZQM A;  3ISB A;  4WC6 A;  2M2W A;  5IIM A;  3TFR A;  5J0S A;  5HRL A;  8ICL A;  1ZQF A;  8ICQ A;  3RJH A;  4X4P A;  4I2H A;  2M2T A;  4MFA A;  8ICM A;  4QZG A;  3JPO A;  4Z6F A;  5CP2 A;  7ICK A;  4R63 A;  1ZQS A;  4P2H A;  2ZH8 A;  3WFR E;  4O5C A;  1ZQL A;  8ICR A;  3RJE A;  3OUY A;  3UPS A;  1ZQR A;  8ICU A;  4KLI A;  5J0R A;  3K75 D;  4KLJ A;  1R89 A;  1XSP A;  3PMN A;  4X4N A;  1VJ7 A;  3C2M A;  2ZHA A;  2ZH1 A;  4I2A A;  3H37 A;  5DB8 A;  4NM1 A;  4F5Q A;  4P4M A;  2I9G A;  1UEU A;  4M0A A;  2Q66 A;  8ICB A;  5TZV A;  5DED A;  1F5A A;  5BOL A;  4LZG A;  2DR5 A;  3RJG A;  3OVA A;  2BE3 A;  4PGX A;  4RPZ A;  7ICR A;  1ZQX A;  4QZE A;  4KLL A;  5HRH A;  4X0A A;  3JZ0 A;  4UB5 A;  1BPZ A;  1TVA A;  8ICP A;  1ZQD A;  1KNY A;  4F5P A;  3JYY A;  4AT8 B;  4KLM A;  4KLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...