4S3NA

Crystal structure of human oas3 domain i in complex with dsrna
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
359
structure length
343
Chain Sequence
MDLYSTPAAALDRFVARKLQPRKEFVEKARRALGALAAALRERPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of sensing long dsRNA via a noncatalytic domain in human oligoadenylate synthetase 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords 2'-5'-oligoadenylate synthase 3
total genus 116
structure length 343
sequence length 359
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10421 OAS1_C 2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4s3nA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4s3nA01
1JQRA 1YLQA 4AT9A 4F5NA 4I27A 3WFSC 9ICQA 4UD5A 4XRHA 3MGIA 5J0WA 8ICBA 9ICPA 7ICEA 5J0OA 5J0YA 4M2YA 4RPXA 5J29A 4K4IA 4RQ4A 9ICUA 9ICKA 1ZQUA 4IQTA 3OVSA 3UPQA 4S3NA 1PX5A 1ZQSA 4Z6CA 3B0XA 8ICLA 8ICXA 3AQKA 2ZH4A 9ICXA 4FO6A 1BPYA 1BPXA 4K4HA 3V7LA 4X4UA 3UPSA 4X4SA 2O1PA 9ICBA 2ZHAA 3PNCA 1UEUA 1ZJNA 7ICIA 5J2HA 4TUSA 2ZH7A 4WC6A 4P4PA 2M2VA 1R8AA 8ICYA 4LZDA 2PFQA 4PHEA 4UBBA 4WCWA 5DECA 1ZQAA 2ISOA 4I2DA 2BCRA 4RPYA 3AQNA 1R8CA 5HRDA 1VJ7A 4RQ6A 8ICZA 4IG8A 4YD1A 5EOZA 4RQ0A 2ZH5A 1ZQLA 4M47A 7ICNA 7ICHA 9ICTA 4MFAA 7ICOA 4AT7B 4UB1A 5DDYA 1ZQIA 2FMSA 8ICMA 9ICWA 3HIYA 3OVBA 4PGXA 7ICMA 1ZQZA 4QZDA 9ICOA 4UB4A 3JPTA 4JWMA 1ZQJA 3C18A 5F2VO 3OVAA 4KLGA 2HHPA 5J0SA 1ZQYA 3MDCA 4QZ9A 4O5KA 7ICRA 4NM1A 4R65A 3ISBA 4I2HA 3ISDA 8ICOA 2M2TA 4FHVA 8ICHA 5HC9A 4JWNA 1BPBA 2ZH9A 4EBJA 3WFOA 2RFFA 5IILA 1ZQPA 3JPPA 1TVAA 2PBEA 4NXZA 4P4MA 4PHDA 1JMSA 2BCSA 1ZJMA 4IQWA 4RWQA 2VANA 5CR0A 2ZH8A 2IHMA 5HRLA 4PGYA 4GXJA 3UXNA 5IIKA 4X4RA 4AT9B 4R66A 8ICWA 2M2UA 4TUPA 3V72A 3H39A 4KLJA 5DEDA 1R8BA 4MF8A 9ICLA 7ICJA 4QZCA 9ICHA 4X0BA 5J2FA 4QZIA 8ICNA 4I2GA 1ZQXA 3JYYA 4I2EA 5HHHA 4R64A 1ZQBA 4LZGA 5HHIA 1WOTA 4AT7A 1ZQNA 1V4AA 4AT8B 1TV9A 3HX0A 4NLKA 3RJGA 4UB2A 9ICMA 7ICUA 4QZFA 1XSPA 3WFQE 3UQ0A 8ICRA 3WFRE 4PHPA 7ICGA 7ICLA 5IIMA 5IIOA 4KLIA 5HRHA 3ISCA 4K4GA 3V7KA 9ICNA 3C5FA 5J2GA 5HREA 4EBKA 4KLLA 1JN3A 4F5RA 2Q66A 5HRBA 7ICPA 1MQ3A 3AU2A 7ICSA 2M2WA 4QZHA 1ZQEA 9ICAA 5TZVA 3C2LA 2BPFA 2DR9A 4LVSA 3PMLA 3RJEA 5J0RA 1MIWA 5CA7A 1BPDA 4RWNA 4P2HA 8ICTA 9ICCA 1MIYA 4UB5A 4QZBA 2FMQA 4I28A 4X4OA 1NOMA 2ISPA 1BPEA 2ZH2A 4FHYA 4M04A 3HJ4A 5DBBA 1ZQDA 4RPZA 5DB6A 3C2KA 4XUSA 2P66A 2BE3A 4I2CA 1KNYA 1TFWA 4Z6DA 4M9LA 2PFPA 3RJJA 1UEVA 4MF2A 4FHWA 2BCUA 4WBZA 5J2EA 9ICGA 1JAJA 2FMPA 3V7JA 4FH3A 4I2AA 5J0UA 4MFFA 4Z6EA 3JPRA 4NKTA 4EP7A 2BPGA 3K75D 4LT6A 2ZHBA 2ID1A 3WFPA 1RZTA 3RH4A 2ZH1A 4M9HA 3AU6A 8ICQA 2ZH3A 2PXIA 3TFSA 4M0AA 3RJIA 1XSLA 9ICJA 3JZ0A 4KLUA 5J2DA 7ICVA 3MDAA 4DO9A 4I29A 4M5DA 4FH5A 4MFCA 3H38A 4YMOA 4RWOA 5CJ7A 1RPLA 3OGUA 3C66A 4RQ2A 1XSNA 8ICFA 2DRBA 4GXKA 3RJKA 5D49A 4X4NA 4F5PA 8ICIA 4UAWA 1F5AA 4QZAA 5BPCA 3RH6A 1HUOA 4Z6FA 4WC5A 4IQUA 5DKWA 8ICCA 4O5CA 9ICIA 4KLFA 3B0YA 4UD4A 5BOMA 1ZQFA 3H3AA 3OUYB 4DOBA 4PPXA 4ATBA 5HRIA 4UAYA 7ICKA 8ICKA 4X4QA 5DBCA 4I2BA 1ZQRA 3UXOA 2DR8A 4AT8A 5DB8A 3MGHA 5BOLA 4UAZA 4WC3A 8ICJA 5HRKA 4KLOA 4O5EA 4FHPA 4RQ7A 9ICVA 5J2IA 4WBYA 3TFRA 4M9NA 4QZGA 2GWSA 5HR9A 3MBYA 8ICGA 2PFOA 2PFNA 2W9MA 3LK9A 4KLQA 1ZQHA 4QZ8A 5CHGA 4RQ5A 1MQ2A 3H37A 5DDMA 4TUQA 4RT3A 4NLZA 4IQVA 5J0XA 4RQ8A 4RQ1A 4RWPA 8ICEA 4XQ7A 1OU5A 5DB7A 1ZQWA 7ICFA 4YN4A 1ZQTA 3L9DA 4PH5A 9ICEA 4X0AA 5IIJA 3JPQA 1NO5A 4YCXA 4YMMA 5J0QA 3RJFA 2BCQA 4KLEA 5J2JA 4M9JA 1Q78A 5HRFA 2BPCA 3LQCB 3NYBA 8ICUA 4I2IA 4R63A 5D4BA 2I9GA 4I2FA 1ZQOA 2DRAA 3JPSA 3UQ2A 4KLDA 9ICFA 4NKUA 3JPNA 4WC7A 8ICPA 5DB9A 1MIVA 1R89A 1VFGA 4X4VA 2NRKA 4PGQA 4UBCA 3HJ1A 5CP2A 5CB1A 1TFYA 4X4PA 4QZEA 1BPZA 4WC2A 2ZH6A 1UETA 5IIIA 3HW8A 3HWTA 2DR7A 4FHXA 5CWRA 1ZQQA 3C5GA 9ICRA 3AQMA 3JPOA 2O5AA 4F5OA 4O9MA 5DBAA 4ATBB 4I2JA 5J2AA 4KLMA 4TURA 1HUZA 5J0PA 3GDXA 4YD2A 2BCVA 5J2KA 3AUOA 4KLSA 1ZQVA 2DVIA 5J0TA 4E80A 4XA5A 4M9GA 5HRGA 4XQ8A 4E7XA 8ICSA 9ICSA 3C2MA 4DOAA 5IINA 1FA0A 1ZQMA 1ZQGA 4KLTA 4DOCA 4PHAA 5J2BA 3RH5A 4UB3A 4YMNA 4NLNA 4F5QA 3PMNA 3AQLA 3OV7A 4X5VA 1Q79A 1KDHA 4WC1A 5D46A 4WC4A 8ICVA 1KEJA 4NM2A 4RT2A 4X4TA 8ICAA 2DR5A 4E8FA 4GXIA 4KLHA 3UXPA 1ZQKA 4RQ3A 4NY8A 1ZQCA 7ICTA 7ICQA 4WC0A 4P4OA 3RJHA 3OUYA 5J2CA
chains in the Genus database with same CATH superfamily
1JQRA 1YLQA 4AT9A 4WH5A 4F5NA 4I27A 3WFSC 9ICQA 4UD5A 4HX0A 4XRHA 3MGIA 5J0WA 8ICBA 9ICPA 7ICEA 5J0OA 4O69A 5J0YA 4M2YA 4RPXA 5J29A 4K4IA 3OUYA 4K8VA 4RQ4A 9ICUA 9ICKA 3OVSA 1ZQUA 4IQTA 3UPQA 2GAFD 4S3NA 4KB6A 1PX5A 1ZQSA 4Z6CA 3B0XA 8ICLA 8ICXA 3AQKA 2ZH4A 9ICXA 4FO6A 1BPYA 1BPXA 4K99A 4K4HA 4K98A 3ERCC 3V7LA 4X4UA 5CFSA 3UPSA 4X4SA 2O1PA 9ICBA 2ZHAA 3PNCA 1UEUA 1ZJNA 7ICIA 5J2HA 4TUSA 2ZH7A 4WC6A 4P4PA 2EWRA 2M2VA 1R8AA 8ICYA 4LZDA 2PFQA 4PHEA 4UBBA 3K7DA 4OAHA 4WCWA 2B56A 5DECA 1ZQAA 2ISOA 4I2DA 2BCRA 4EEDA 4RPYA 3AQNA 4LEWA 1R8CA 5HRDA 1VJ7A 4RQ6A 8ICZA 5CHEA 3ER9B 4IG8A 4YD1A 4JLXA 2ZH5A 5EOZA 4RQ0A 1ZQLA 4M47A 7ICNA 7ICHA 9ICTA 4MFAA 4N7RA 7ICOA 4AT7B 4UB1A 5DDYA 1ZQIA 2FMSA 8ICMA 9ICWA 3HIYA 3OVBA 4PGXA 3NVOA 2IUBA 4MKPA 7ICMA 1ZQZA 4QZDA 9ICOA 4LEZA 4UB4A 3JPTA 4JWMA 1ZQJA 3OVAA 3C18A 5F2VO 4KLGA 2HHPA 5J0SA 1ZQYA 3MDCA 4QZ9A 4O5KA 7ICRA 4NM1A 4R65A 3ISBA 4I2HA 3ISDA 8ICOA 4FHVA 2M2TA 8ICHA 5HC9A 4K96A 4JWNA 1BPBA 2ZH9A 4EBJA 3WFOA 2RFFA 5IILA 1ZQPA 4O68A 2IHOA 3JPPA 1TVAA 4OAGA 2PBEA 5D63A 4NXZA 4P4MA 2HN1A 4PHDA 1JMSA 2BCSA 1ZJMA 4IQWA 4RWQA 2ZH8A 2VANA 5CR0A 2IHMA 5HRLA 4LEYA 4PGYA 4GXJA 3UXNA 5IIKA 4X4RA 4AT9B 4R66A 8ICWA 4FO1A 2M2UA 4TUPA 3V72A 2B4VA 3H39A 4KLJA 5DEDA 1R8BA 4NXTA 4MF8A 9ICLA 7ICJA 4QZCA 9ICHA 4X0BA 5J2FA 4QZIA 8ICNA 4I2GA 4WOYA 1ZQXA 4OAIZ 3JYYA 4I2EA 5HHHA 4R64A 1ZQBA 4LZGA 5HHIA 1WOTA 4AT7A 1ZQNA 1V4AA 4AT8B 1TV9A 3HX0A 4NLKA 3RJGA 3MCRA 4UB2A 7ICUA 4QZFA 9ICMA 1XSPA 3WFQE 3UQ0A 8ICRA 3WFRE 4PHPA 7ICGA 7ICLA 5IIMA 5IIOA 4EV6A 4KLIA 5HRHA 3CK6A 4WQLA 3ISCA 4K4GA 3V7KA 9ICNA 3C5FA 5J2GA 5HREA 4EBKA 4KLLA 1JN3A 2Q66A 4F5RA 5HRBA 7ICPA 1MQ3A 3AU2A 7ICSA 2M2WA 4NXXA 4QZHA 1ZQEA 9ICAA 5TZVA 3C2LA 2BPFA 2DR9A 2FCLA 3PMLA 4LVSA 3RJEA 4WQKA 5J0RA 1MIWA 4I0UA 5CA7A 1BPDA 4RWNA 4P2HA 8ICTA 9ICCA 1MIYA 4UB5A 4QZBA 2FMQA 4I28A 4X4OA 1NOMA 2ISPA 1BPEA 2ZH2A 4FHYA 4EGWA 4M04A 5D61A 3HJ4A 5DBBA 1ZQDA 4RPZA 5DB6A 3C2KA 4XUSA 2P66A 2BE3A 4I2CA 1TFWA 1KNYA 4Z6DA 4M9LA 5D62A 2PFPA 3RJJA 1UEVA 4MF2A 4FHWA 2BCUA 4WBZA 5J2EA 9ICGA 1JAJA 2FMPA 3V7JA 4FH3A 4I2AA 5J0UA 3ER8C 4MFFA 4Z6EA 3JPRA 4NKTA 4EP7A 2BPGA 3K75D 4LT6A 2ZHBA 4K9AA 2B51A 2ID1A 4K9BA 3WFPA 1RZTA 3RH4A 2BBHA 2ZH1A 4M9HA 3AU6A 8ICQA 2ZH3A 2PXIA 3TFSA 4M0AA 3RJIA 4XJEA 1XSLA 9ICJA 3JZ0A 4KLUA 5B3QA 5CFTA 5J2DA 5CFUA 7ICVA 3MDAA 4DO9A 4I29A 4M5DA 4FH5A 4MFCA 3H38A 4YMOA 4RWOA 5CJ7A 1RPLA 3OGUA 3C66A 4RQ2A 1XSNA 8ICFA 2DRBA 4GXKA 3RJKA 5D49A 4X4NA 4F5PA 5B3PA 8ICIA 4UAWA 4NXVA 1F5AA 4QZAA 5BPCA 3RH6A 1HUOA 4Z6FA 4WC5A 4IQUA 5DKWA 8ICCA 4O5CA 9ICIA 4KLFA 4UD4A 3B0YA 5BOMA 1ZQFA 3H3AA 3OUYB 4DOBA 4PPXA 4ATBA 5HRIA 3OWGA 4UAYA 7ICKA 8ICKA 4X4QA 5DBCA 4I2BA 1ZQRA 3UXOA 2DR8A 4AT8A 5DB8A 3MGHA 5BOLA 4UAZA 3PHZA 4WC3A 8ICJA 5HRKA 4NXUA 4KLOA 4O67A 4O5EA 4FHPA 4EEBA 4RQ7A 9ICVA 5J2IA 4WBYA 3TFRA 4M9NA 4QZGA 2GWSA 5HR9A 3MBYA 8ICGA 2PFOA 2PFNA 2W9MA 4O6AA 3LK9A 4KLQA 1ZQHA 4QZ8A 5CHGA 3NKUA 4RQ5A 2BBJA 1MQ2A 3H37A 5DDMA 4TUQA 4RT3A 4NLZA 4IQVA 5J0XA 4RQ8A 4RQ1A 8ICEA 4XQ7A 1OU5A 5DB7A 1ZQWA 7ICFA 4YN4A 1ZQTA 3L9DA 4PH5A 4KM5A 4X0AA 5IIJA 9ICEA 3JPQA 1NO5A 4YCXA 4YMMA 5J0QA 3RJFA 2BCQA 4KLEA 5J2JA 4M9JA 1Q78A 5HRFA 2BPCA 3LQCB 3NYBA 8ICUA 4I2IA 4R63A 5D4BA 2I9GA 4I2FA 2DRAA 3JCFA 1ZQOA 3JPSA 3UQ2A 2GA9D 4KLDA 9ICFA 4NKUA 3JPNA 4WC7A 8ICPA 5DB9A 1MIVA 1R89A 1VFGA 4X4VA 2NRKA 4PGQA 4UBCA 3HJ1A 5CP2A 5CB1A 1TFYA 4X4PA 4QZEA 1BPZA 4WC2A 2ZH6A 1UETA 5IIIA 3HW8A 3HWTA 2DR7A 4FHXA 5CWRA 1ZQQA 3C5GA 9ICRA 3AQMA 3JPOA 2O5AA 4F5OA 4O9MA 5DBAA 4ATBB 4I2JA 5J2AA 4KLMA 4TURA 1HUZA 5J0PA 3GDXA 4YD2A 2BCVA 5J2KA 3AUOA 4OAFA 1ZQVA 2DVIA 5J0TA 4E80A 4XA5A 4M9GA 4KLSA 5HRGA 4XQ8A 4E7XA 8ICSA 9ICSA 4LEVA 3C2MA 4DOAA 5IINA 1FA0A 1ZQMA 1ZQGA 4KLTA 4DOCA 4PHAA 5J2BA 4K97A 3RH5A 4UB3A 4YMNA 4NLNA 4NXWA 4F5QA 2HN2A 3PMNA 3AQLA 3OV7A 1GPJA 4X5VA 1Q79A 1KDHA 4WC1A 5D46A 4WC4A 8ICVA 1KEJA 4NM2A 4RT2A 4X4TA 3EF2A 8ICAA 2DR5A 4E8FA 4JLZA 4GXIA 4KLHA 3UXPA 1ZQKA 3NWIA 4RQ3A 4NY8A 1ZQCA 7ICTA 7ICQA 4WC0A 4P4OA 3RJHA 4RWPA 5JTGA 5J2CA
chains in the Genus database with same CATH topology
1JQRA 1YLQA 4AT9A 4F5NA 4I27A 3WFSC 9ICQA 4UD5A 4XRHA 3MGIA 5J0WA 8ICBA 9ICPA 7ICEA 5J0OA 5J0YA 4M2YA 4RPXA 5J29A 4K4IA 4RQ4A 9ICUA 9ICKA 1ZQUA 4IQTA 3OVSA 3UPQA 4S3NA 1PX5A 1ZQSA 4Z6CA 3B0XA 8ICLA 8ICXA 3AQKA 2ZH4A 9ICXA 4FO6A 1BPYA 1BPXA 4K4HA 3V7LA 4X4UA 3UPSA 4X4SA 2O1PA 9ICBA 2ZHAA 3PNCA 1UEUA 1ZJNA 7ICIA 5J2HA 4TUSA 2ZH7A 4WC6A 4P4PA 2M2VA 1R8AA 8ICYA 4LZDA 2PFQA 4PHEA 4UBBA 4WCWA 5DECA 1ZQAA 2ISOA 4I2DA 2BCRA 4RPYA 3AQNA 1R8CA 5HRDA 1VJ7A 4RQ6A 8ICZA 4IG8A 4YD1A 5EOZA 4RQ0A 2ZH5A 1ZQLA 4M47A 7ICNA 7ICHA 9ICTA 4MFAA 7ICOA 4AT7B 4UB1A 5DDYA 1ZQIA 2FMSA 8ICMA 9ICWA 3HIYA 3OVBA 4PGXA 7ICMA 1ZQZA 4QZDA 9ICOA 4UB4A 3JPTA 4JWMA 1ZQJA 3C18A 5F2VO 3OVAA 4KLGA 2HHPA 5J0SA 1ZQYA 3MDCA 4QZ9A 4O5KA 7ICRA 4NM1A 4R65A 3ISBA 4I2HA 3ISDA 8ICOA 2M2TA 4FHVA 8ICHA 5HC9A 4JWNA 1BPBA 2ZH9A 4EBJA 3WFOA 2RFFA 5IILA 1ZQPA 3JPPA 1TVAA 2PBEA 4NXZA 4P4MA 4PHDA 1JMSA 2BCSA 1ZJMA 4IQWA 4RWQA 2VANA 5CR0A 2ZH8A 2IHMA 5HRLA 4PGYA 4GXJA 3UXNA 5IIKA 4X4RA 4AT9B 4R66A 8ICWA 2M2UA 4TUPA 3V72A 3H39A 4KLJA 5DEDA 1R8BA 4MF8A 9ICLA 7ICJA 4QZCA 9ICHA 4X0BA 5J2FA 4QZIA 8ICNA 4I2GA 1ZQXA 3JYYA 4I2EA 5HHHA 4R64A 1ZQBA 4LZGA 5HHIA 1WOTA 4AT7A 1ZQNA 1V4AA 4AT8B 1TV9A 3HX0A 4NLKA 3RJGA 4UB2A 9ICMA 7ICUA 4QZFA 1XSPA 3WFQE 3UQ0A 8ICRA 3WFRE 4PHPA 7ICGA 7ICLA 5IIMA 5IIOA 4KLIA 5HRHA 3ISCA 4K4GA 3V7KA 9ICNA 3C5FA 5J2GA 5HREA 4EBKA 4KLLA 1JN3A 4F5RA 2Q66A 5HRBA 7ICPA 1MQ3A 3AU2A 7ICSA 2M2WA 4QZHA 1ZQEA 9ICAA 5TZVA 3C2LA 2BPFA 2DR9A 4LVSA 3PMLA 3RJEA 5J0RA 1MIWA 5CA7A 1BPDA 4RWNA 4P2HA 8ICTA 9ICCA 1MIYA 4UB5A 4QZBA 2FMQA 4I28A 4X4OA 1NOMA 2ISPA 1BPEA 2ZH2A 4FHYA 4M04A 3HJ4A 5DBBA 1ZQDA 4RPZA 5DB6A 3C2KA 4XUSA 2P66A 2BE3A 4I2CA 1KNYA 1TFWA 4Z6DA 4M9LA 2PFPA 3RJJA 1UEVA 4MF2A 4FHWA 2BCUA 4WBZA 5J2EA 9ICGA 1JAJA 2FMPA 3V7JA 4FH3A 4I2AA 5J0UA 4MFFA 4Z6EA 3JPRA 4NKTA 4EP7A 2BPGA 3K75D 4LT6A 2ZHBA 2ID1A 3WFPA 1RZTA 3RH4A 2ZH1A 4M9HA 3AU6A 8ICQA 2ZH3A 2PXIA 3TFSA 4M0AA 3RJIA 1XSLA 9ICJA 3JZ0A 4KLUA 5J2DA 7ICVA 3MDAA 4DO9A 4I29A 4M5DA 4FH5A 4MFCA 3H38A 4YMOA 4RWOA 5CJ7A 1RPLA 3OGUA 3C66A 4RQ2A 1XSNA 8ICFA 2DRBA 4GXKA 3RJKA 5D49A 4X4NA 4F5PA 8ICIA 4UAWA 1F5AA 4QZAA 5BPCA 3RH6A 1HUOA 4Z6FA 4WC5A 4IQUA 5DKWA 8ICCA 4O5CA 9ICIA 4KLFA 3B0YA 4UD4A 5BOMA 1ZQFA 3H3AA 3OUYB 4DOBA 4PPXA 4ATBA 5HRIA 4UAYA 7ICKA 8ICKA 4X4QA 5DBCA 4I2BA 1ZQRA 3UXOA 2DR8A 4AT8A 5DB8A 3MGHA 5BOLA 4UAZA 4WC3A 8ICJA 5HRKA 4KLOA 4O5EA 4FHPA 4RQ7A 9ICVA 5J2IA 4WBYA 3TFRA 4M9NA 4QZGA 2GWSA 5HR9A 3MBYA 8ICGA 2PFOA 2PFNA 2W9MA 3LK9A 4KLQA 1ZQHA 4QZ8A 5CHGA 4RQ5A 1MQ2A 3H37A 5DDMA 4TUQA 4RT3A 4NLZA 4IQVA 5J0XA 4RQ8A 4RQ1A 4RWPA 8ICEA 4XQ7A 1OU5A 5DB7A 1ZQWA 7ICFA 4YN4A 1ZQTA 3L9DA 4PH5A 9ICEA 4X0AA 5IIJA 3JPQA 1NO5A 4YCXA 4YMMA 5J0QA 3RJFA 2BCQA 4KLEA 5J2JA 4M9JA 1Q78A 5HRFA 2BPCA 3LQCB 3NYBA 8ICUA 4I2IA 4R63A 5D4BA 2I9GA 4I2FA 1ZQOA 2DRAA 3JPSA 3UQ2A 4KLDA 9ICFA 4NKUA 3JPNA 4WC7A 8ICPA 5DB9A 1MIVA 1R89A 1VFGA 4X4VA 2NRKA 4PGQA 4UBCA 3HJ1A 5CP2A 5CB1A 1TFYA 4X4PA 4QZEA 1BPZA 4WC2A 2ZH6A 1UETA 5IIIA 3HW8A 3HWTA 2DR7A 4FHXA 5CWRA 1ZQQA 3C5GA 9ICRA 3AQMA 3JPOA 2O5AA 4F5OA 4O9MA 5DBAA 4ATBB 4I2JA 5J2AA 4KLMA 4TURA 1HUZA 5J0PA 3GDXA 4YD2A 2BCVA 5J2KA 3AUOA 4KLSA 1ZQVA 2DVIA 5J0TA 4E80A 4XA5A 4M9GA 5HRGA 4XQ8A 4E7XA 8ICSA 9ICSA 3C2MA 4DOAA 5IINA 1FA0A 1ZQMA 1ZQGA 4KLTA 4DOCA 4PHAA 5J2BA 3RH5A 4UB3A 4YMNA 4NLNA 4F5QA 3PMNA 3AQLA 3OV7A 4X5VA 1Q79A 1KDHA 4WC1A 5D46A 4WC4A 8ICVA 1KEJA 4NM2A 4RT2A 4X4TA 8ICAA 2DR5A 4E8FA 4GXIA 4KLHA 3UXPA 1ZQKA 4RQ3A 4NY8A 1ZQCA 7ICTA 7ICQA 4WC0A 4P4OA 3RJHA 3OUYA 5J2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQR A;  1YLQ A;  4AT9 A;  4F5N A;  4I27 A;  3WFS C;  9ICQ A;  4UD5 A;  4XRH A;  3MGI A;  5J0W A;  8ICB A;  9ICP A;  7ICE A;  5J0O A;  5J0Y A;  4M2Y A;  4RPX A;  5J29 A;  4K4I A;  4RQ4 A;  9ICU A;  9ICK A;  1ZQU A;  4IQT A;  3OVS A;  3UPQ A;  4S3N A;  1PX5 A;  1ZQS A;  4Z6C A;  3B0X A;  8ICL A;  8ICX A;  3AQK A;  2ZH4 A;  9ICX A;  4FO6 A;  1BPY A;  1BPX A;  4K4H A;  3V7L A;  4X4U A;  3UPS A;  4X4S A;  2O1P A;  9ICB A;  2ZHA A;  3PNC A;  1UEU A;  1ZJN A;  7ICI A;  5J2H A;  4TUS A;  2ZH7 A;  4WC6 A;  4P4P A;  2M2V A;  1R8A A;  8ICY A;  4LZD A;  2PFQ A;  4PHE A;  4UBB A;  4WCW A;  5DEC A;  1ZQA A;  2ISO A;  4I2D A;  2BCR A;  4RPY A;  3AQN A;  1R8C A;  5HRD A;  1VJ7 A;  4RQ6 A;  8ICZ A;  4IG8 A;  4YD1 A;  5EOZ A;  4RQ0 A;  2ZH5 A;  1ZQL A;  4M47 A;  7ICN A;  7ICH A;  9ICT A;  4MFA A;  7ICO A;  4AT7 B;  4UB1 A;  5DDY A;  1ZQI A;  2FMS A;  8ICM A;  9ICW A;  3HIY A;  3OVB A;  4PGX A;  7ICM A;  1ZQZ A;  4QZD A;  9ICO A;  4UB4 A;  3JPT A;  4JWM A;  1ZQJ A;  3C18 A;  5F2V O;  3OVA A;  4KLG A;  2HHP A;  5J0S A;  1ZQY A;  3MDC A;  4QZ9 A;  4O5K A;  7ICR A;  4NM1 A;  4R65 A;  3ISB A;  4I2H A;  3ISD A;  8ICO A;  2M2T A;  4FHV A;  8ICH A;  5HC9 A;  4JWN A;  1BPB A;  2ZH9 A;  4EBJ A;  3WFO A;  2RFF A;  5IIL A;  1ZQP A;  3JPP A;  1TVA A;  2PBE A;  4NXZ A;  4P4M A;  4PHD A;  1JMS A;  2BCS A;  1ZJM A;  4IQW A;  4RWQ A;  2VAN A;  5CR0 A;  2ZH8 A;  2IHM A;  5HRL A;  4PGY A;  4GXJ A;  3UXN A;  5IIK A;  4X4R A;  4AT9 B;  4R66 A;  8ICW A;  2M2U A;  4TUP A;  3V72 A;  3H39 A;  4KLJ A;  5DED A;  1R8B A;  4MF8 A;  9ICL A;  7ICJ A;  4QZC A;  9ICH A;  4X0B A;  5J2F A;  4QZI A;  8ICN A;  4I2G A;  1ZQX A;  3JYY A;  4I2E A;  5HHH A;  4R64 A;  1ZQB A;  4LZG A;  5HHI A;  1WOT A;  4AT7 A;  1ZQN A;  1V4A A;  4AT8 B;  1TV9 A;  3HX0 A;  4NLK A;  3RJG A;  4UB2 A;  9ICM A;  7ICU A;  4QZF A;  1XSP A;  3WFQ E;  3UQ0 A;  8ICR A;  3WFR E;  4PHP A;  7ICG A;  7ICL A;  5IIM A;  5IIO A;  4KLI A;  5HRH A;  3ISC A;  4K4G A;  3V7K A;  9ICN A;  3C5F A;  5J2G A;  5HRE A;  4EBK A;  4KLL A;  1JN3 A;  4F5R A;  2Q66 A;  5HRB A;  7ICP A;  1MQ3 A;  3AU2 A;  7ICS A;  2M2W A;  4QZH A;  1ZQE A;  9ICA A;  5TZV A;  3C2L A;  2BPF A;  2DR9 A;  4LVS A;  3PML A;  3RJE A;  5J0R A;  1MIW A;  5CA7 A;  1BPD A;  4RWN A;  4P2H A;  8ICT A;  9ICC A;  1MIY A;  4UB5 A;  4QZB A;  2FMQ A;  4I28 A;  4X4O A;  1NOM A;  2ISP A;  1BPE A;  2ZH2 A;  4FHY A;  4M04 A;  3HJ4 A;  5DBB A;  1ZQD A;  4RPZ A;  5DB6 A;  3C2K A;  4XUS A;  2P66 A;  2BE3 A;  4I2C A;  1KNY A;  1TFW A;  4Z6D A;  4M9L A;  2PFP A;  3RJJ A;  1UEV A;  4MF2 A;  4FHW A;  2BCU A;  4WBZ A;  5J2E A;  9ICG A;  1JAJ A;  2FMP A;  3V7J A;  4FH3 A;  4I2A A;  5J0U A;  4MFF A;  4Z6E A;  3JPR A;  4NKT A;  4EP7 A;  2BPG A;  3K75 D;  4LT6 A;  2ZHB A;  2ID1 A;  3WFP A;  1RZT A;  3RH4 A;  2ZH1 A;  4M9H A;  3AU6 A;  8ICQ A;  2ZH3 A;  2PXI A;  3TFS A;  4M0A A;  3RJI A;  1XSL A;  9ICJ A;  3JZ0 A;  4KLU A;  5J2D A;  7ICV A;  3MDA A;  4DO9 A;  4I29 A;  4M5D A;  4FH5 A;  4MFC A;  3H38 A;  4YMO A;  4RWO A;  5CJ7 A;  1RPL A;  3OGU A;  3C66 A;  4RQ2 A;  1XSN A;  8ICF A;  2DRB A;  4GXK A;  3RJK A;  5D49 A;  4X4N A;  4F5P A;  8ICI A;  4UAW A;  1F5A A;  4QZA A;  5BPC A;  3RH6 A;  1HUO A;  4Z6F A;  4WC5 A;  4IQU A;  5DKW A;  8ICC A;  4O5C A;  9ICI A;  4KLF A;  3B0Y A;  4UD4 A;  5BOM A;  1ZQF A;  3H3A A;  3OUY B;  4DOB A;  4PPX A;  4ATB A;  5HRI A;  4UAY A;  7ICK A;  8ICK A;  4X4Q A;  5DBC A;  4I2B A;  1ZQR A;  3UXO A;  2DR8 A;  4AT8 A;  5DB8 A;  3MGH A;  5BOL A;  4UAZ A;  4WC3 A;  8ICJ A;  5HRK A;  4KLO A;  4O5E A;  4FHP A;  4RQ7 A;  9ICV A;  5J2I A;  4WBY A;  3TFR A;  4M9N A;  4QZG A;  2GWS A;  5HR9 A;  3MBY A;  8ICG A;  2PFO A;  2PFN A;  2W9M A;  3LK9 A;  4KLQ A;  1ZQH A;  4QZ8 A;  5CHG A;  4RQ5 A;  1MQ2 A;  3H37 A;  5DDM A;  4TUQ A;  4RT3 A;  4NLZ A;  4IQV A;  5J0X A;  4RQ8 A;  4RQ1 A;  4RWP A;  8ICE A;  4XQ7 A;  1OU5 A;  5DB7 A;  1ZQW A;  7ICF A;  4YN4 A;  1ZQT A;  3L9D A;  4PH5 A;  9ICE A;  4X0A A;  5IIJ A;  3JPQ A;  1NO5 A;  4YCX A;  4YMM A;  5J0Q A;  3RJF A;  2BCQ A;  4KLE A;  5J2J A;  4M9J A;  1Q78 A;  5HRF A;  2BPC A;  3LQC B;  3NYB A;  8ICU A;  4I2I A;  4R63 A;  5D4B A;  2I9G A;  4I2F A;  1ZQO A;  2DRA A;  3JPS A;  3UQ2 A;  4KLD A;  9ICF A;  4NKU A;  3JPN A;  4WC7 A;  8ICP A;  5DB9 A;  1MIV A;  1R89 A;  1VFG A;  4X4V A;  2NRK A;  4PGQ A;  4UBC A;  3HJ1 A;  5CP2 A;  5CB1 A;  1TFY A;  4X4P A;  4QZE A;  1BPZ A;  4WC2 A;  2ZH6 A;  1UET A;  5III A;  3HW8 A;  3HWT A;  2DR7 A;  4FHX A;  5CWR A;  1ZQQ A;  3C5G A;  9ICR A;  3AQM A;  3JPO A;  2O5A A;  4F5O A;  4O9M A;  5DBA A;  4ATB B;  4I2J A;  5J2A A;  4KLM A;  4TUR A;  1HUZ A;  5J0P A;  3GDX A;  4YD2 A;  2BCV A;  5J2K A;  3AUO A;  4KLS A;  1ZQV A;  2DVI A;  5J0T A;  4E80 A;  4XA5 A;  4M9G A;  5HRG A;  4XQ8 A;  4E7X A;  8ICS A;  9ICS A;  3C2M A;  4DOA A;  5IIN A;  1FA0 A;  1ZQM A;  1ZQG A;  4KLT A;  4DOC A;  4PHA A;  5J2B A;  3RH5 A;  4UB3 A;  4YMN A;  4NLN A;  4F5Q A;  3PMN A;  3AQL A;  3OV7 A;  4X5V A;  1Q79 A;  1KDH A;  4WC1 A;  5D46 A;  4WC4 A;  8ICV A;  1KEJ A;  4NM2 A;  4RT2 A;  4X4T A;  8ICA A;  2DR5 A;  4E8F A;  4GXI A;  4KLH A;  3UXP A;  1ZQK A;  4RQ3 A;  4NY8 A;  1ZQC A;  7ICT A;  7ICQ A;  4WC0 A;  4P4O A;  3RJH A;  3OUY A;  5J2C A; 
#chains in the Genus database with same CATH topology
 1JQR A;  1YLQ A;  4AT9 A;  4WH5 A;  4F5N A;  4I27 A;  3WFS C;  9ICQ A;  4UD5 A;  4HX0 A;  4XRH A;  3MGI A;  5J0W A;  8ICB A;  9ICP A;  7ICE A;  5J0O A;  4O69 A;  5J0Y A;  4M2Y A;  4RPX A;  5J29 A;  4K4I A;  3OUY A;  4K8V A;  4RQ4 A;  9ICU A;  9ICK A;  3OVS A;  1ZQU A;  4IQT A;  3UPQ A;  2GAF D;  4S3N A;  4KB6 A;  1PX5 A;  1ZQS A;  4Z6C A;  3B0X A;  8ICL A;  8ICX A;  3AQK A;  2ZH4 A;  9ICX A;  4FO6 A;  1BPY A;  1BPX A;  4K99 A;  4K4H A;  4K98 A;  3ERC C;  3V7L A;  4X4U A;  5CFS A;  3UPS A;  4X4S A;  2O1P A;  9ICB A;  2ZHA A;  3PNC A;  1UEU A;  1ZJN A;  7ICI A;  5J2H A;  4TUS A;  2ZH7 A;  4WC6 A;  4P4P A;  2EWR A;  2M2V A;  1R8A A;  8ICY A;  4LZD A;  2PFQ A;  4PHE A;  4UBB A;  3K7D A;  4OAH A;  4WCW A;  2B56 A;  5DEC A;  1ZQA A;  2ISO A;  4I2D A;  2BCR A;  4EED A;  4RPY A;  3AQN A;  4LEW A;  1R8C A;  5HRD A;  1VJ7 A;  4RQ6 A;  8ICZ A;  5CHE A;  3ER9 B;  4IG8 A;  4YD1 A;  4JLX A;  2ZH5 A;  5EOZ A;  4RQ0 A;  1ZQL A;  4M47 A;  7ICN A;  7ICH A;  9ICT A;  4MFA A;  4N7R A;  7ICO A;  4AT7 B;  4UB1 A;  5DDY A;  1ZQI A;  2FMS A;  8ICM A;  9ICW A;  3HIY A;  3OVB A;  4PGX A;  3NVO A;  2IUB A;  4MKP A;  7ICM A;  1ZQZ A;  4QZD A;  9ICO A;  4LEZ A;  4UB4 A;  3JPT A;  4JWM A;  1ZQJ A;  3OVA A;  3C18 A;  5F2V O;  4KLG A;  2HHP A;  5J0S A;  1ZQY A;  3MDC A;  4QZ9 A;  4O5K A;  7ICR A;  4NM1 A;  4R65 A;  3ISB A;  4I2H A;  3ISD A;  8ICO A;  4FHV A;  2M2T A;  8ICH A;  5HC9 A;  4K96 A;  4JWN A;  1BPB A;  2ZH9 A;  4EBJ A;  3WFO A;  2RFF A;  5IIL A;  1ZQP A;  4O68 A;  2IHO A;  3JPP A;  1TVA A;  4OAG A;  2PBE A;  5D63 A;  4NXZ A;  4P4M A;  2HN1 A;  4PHD A;  1JMS A;  2BCS A;  1ZJM A;  4IQW A;  4RWQ A;  2ZH8 A;  2VAN A;  5CR0 A;  2IHM A;  5HRL A;  4LEY A;  4PGY A;  4GXJ A;  3UXN A;  5IIK A;  4X4R A;  4AT9 B;  4R66 A;  8ICW A;  4FO1 A;  2M2U A;  4TUP A;  3V72 A;  2B4V A;  3H39 A;  4KLJ A;  5DED A;  1R8B A;  4NXT A;  4MF8 A;  9ICL A;  7ICJ A;  4QZC A;  9ICH A;  4X0B A;  5J2F A;  4QZI A;  8ICN A;  4I2G A;  4WOY A;  1ZQX A;  4OAI Z;  3JYY A;  4I2E A;  5HHH A;  4R64 A;  1ZQB A;  4LZG A;  5HHI A;  1WOT A;  4AT7 A;  1ZQN A;  1V4A A;  4AT8 B;  1TV9 A;  3HX0 A;  4NLK A;  3RJG A;  3MCR A;  4UB2 A;  7ICU A;  4QZF A;  9ICM A;  1XSP A;  3WFQ E;  3UQ0 A;  8ICR A;  3WFR E;  4PHP A;  7ICG A;  7ICL A;  5IIM A;  5IIO A;  4EV6 A;  4KLI A;  5HRH A;  3CK6 A;  4WQL A;  3ISC A;  4K4G A;  3V7K A;  9ICN A;  3C5F A;  5J2G A;  5HRE A;  4EBK A;  4KLL A;  1JN3 A;  2Q66 A;  4F5R A;  5HRB A;  7ICP A;  1MQ3 A;  3AU2 A;  7ICS A;  2M2W A;  4NXX A;  4QZH A;  1ZQE A;  9ICA A;  5TZV A;  3C2L A;  2BPF A;  2DR9 A;  2FCL A;  3PML A;  4LVS A;  3RJE A;  4WQK A;  5J0R A;  1MIW A;  4I0U A;  5CA7 A;  1BPD A;  4RWN A;  4P2H A;  8ICT A;  9ICC A;  1MIY A;  4UB5 A;  4QZB A;  2FMQ A;  4I28 A;  4X4O A;  1NOM A;  2ISP A;  1BPE A;  2ZH2 A;  4FHY A;  4EGW A;  4M04 A;  5D61 A;  3HJ4 A;  5DBB A;  1ZQD A;  4RPZ A;  5DB6 A;  3C2K A;  4XUS A;  2P66 A;  2BE3 A;  4I2C A;  1TFW A;  1KNY A;  4Z6D A;  4M9L A;  5D62 A;  2PFP A;  3RJJ A;  1UEV A;  4MF2 A;  4FHW A;  2BCU A;  4WBZ A;  5J2E A;  9ICG A;  1JAJ A;  2FMP A;  3V7J A;  4FH3 A;  4I2A A;  5J0U A;  3ER8 C;  4MFF A;  4Z6E A;  3JPR A;  4NKT A;  4EP7 A;  2BPG A;  3K75 D;  4LT6 A;  2ZHB A;  4K9A A;  2B51 A;  2ID1 A;  4K9B A;  3WFP A;  1RZT A;  3RH4 A;  2BBH A;  2ZH1 A;  4M9H A;  3AU6 A;  8ICQ A;  2ZH3 A;  2PXI A;  3TFS A;  4M0A A;  3RJI A;  4XJE A;  1XSL A;  9ICJ A;  3JZ0 A;  4KLU A;  5B3Q A;  5CFT A;  5J2D A;  5CFU A;  7ICV A;  3MDA A;  4DO9 A;  4I29 A;  4M5D A;  4FH5 A;  4MFC A;  3H38 A;  4YMO A;  4RWO A;  5CJ7 A;  1RPL A;  3OGU A;  3C66 A;  4RQ2 A;  1XSN A;  8ICF A;  2DRB A;  4GXK A;  3RJK A;  5D49 A;  4X4N A;  4F5P A;  5B3P A;  8ICI A;  4UAW A;  4NXV A;  1F5A A;  4QZA A;  5BPC A;  3RH6 A;  1HUO A;  4Z6F A;  4WC5 A;  4IQU A;  5DKW A;  8ICC A;  4O5C A;  9ICI A;  4KLF A;  4UD4 A;  3B0Y A;  5BOM A;  1ZQF A;  3H3A A;  3OUY B;  4DOB A;  4PPX A;  4ATB A;  5HRI A;  3OWG A;  4UAY A;  7ICK A;  8ICK A;  4X4Q A;  5DBC A;  4I2B A;  1ZQR A;  3UXO A;  2DR8 A;  4AT8 A;  5DB8 A;  3MGH A;  5BOL A;  4UAZ A;  3PHZ A;  4WC3 A;  8ICJ A;  5HRK A;  4NXU A;  4KLO A;  4O67 A;  4O5E A;  4FHP A;  4EEB A;  4RQ7 A;  9ICV A;  5J2I A;  4WBY A;  3TFR A;  4M9N A;  4QZG A;  2GWS A;  5HR9 A;  3MBY A;  8ICG A;  2PFO A;  2PFN A;  2W9M A;  4O6A A;  3LK9 A;  4KLQ A;  1ZQH A;  4QZ8 A;  5CHG A;  3NKU A;  4RQ5 A;  2BBJ A;  1MQ2 A;  3H37 A;  5DDM A;  4TUQ A;  4RT3 A;  4NLZ A;  4IQV A;  5J0X A;  4RQ8 A;  4RQ1 A;  8ICE A;  4XQ7 A;  1OU5 A;  5DB7 A;  1ZQW A;  7ICF A;  4YN4 A;  1ZQT A;  3L9D A;  4PH5 A;  4KM5 A;  4X0A A;  5IIJ A;  9ICE A;  3JPQ A;  1NO5 A;  4YCX A;  4YMM A;  5J0Q A;  3RJF A;  2BCQ A;  4KLE A;  5J2J A;  4M9J A;  1Q78 A;  5HRF A;  2BPC A;  3LQC B;  3NYB A;  8ICU A;  4I2I A;  4R63 A;  5D4B A;  2I9G A;  4I2F A;  2DRA A;  3JCF A;  1ZQO A;  3JPS A;  3UQ2 A;  2GA9 D;  4KLD A;  9ICF A;  4NKU A;  3JPN A;  4WC7 A;  8ICP A;  5DB9 A;  1MIV A;  1R89 A;  1VFG A;  4X4V A;  2NRK A;  4PGQ A;  4UBC A;  3HJ1 A;  5CP2 A;  5CB1 A;  1TFY A;  4X4P A;  4QZE A;  1BPZ A;  4WC2 A;  2ZH6 A;  1UET A;  5III A;  3HW8 A;  3HWT A;  2DR7 A;  4FHX A;  5CWR A;  1ZQQ A;  3C5G A;  9ICR A;  3AQM A;  3JPO A;  2O5A A;  4F5O A;  4O9M A;  5DBA A;  4ATB B;  4I2J A;  5J2A A;  4KLM A;  4TUR A;  1HUZ A;  5J0P A;  3GDX A;  4YD2 A;  2BCV A;  5J2K A;  3AUO A;  4OAF A;  1ZQV A;  2DVI A;  5J0T A;  4E80 A;  4XA5 A;  4M9G A;  4KLS A;  5HRG A;  4XQ8 A;  4E7X A;  8ICS A;  9ICS A;  4LEV A;  3C2M A;  4DOA A;  5IIN A;  1FA0 A;  1ZQM A;  1ZQG A;  4KLT A;  4DOC A;  4PHA A;  5J2B A;  4K97 A;  3RH5 A;  4UB3 A;  4YMN A;  4NLN A;  4NXW A;  4F5Q A;  2HN2 A;  3PMN A;  3AQL A;  3OV7 A;  1GPJ A;  4X5V A;  1Q79 A;  1KDH A;  4WC1 A;  5D46 A;  4WC4 A;  8ICV A;  1KEJ A;  4NM2 A;  4RT2 A;  4X4T A;  3EF2 A;  8ICA A;  2DR5 A;  4E8F A;  4JLZ A;  4GXI A;  4KLH A;  3UXP A;  1ZQK A;  3NWI A;  4RQ3 A;  4NY8 A;  1ZQC A;  7ICT A;  7ICQ A;  4WC0 A;  4P4O A;  3RJH A;  4RWP A;  5JTG A;  5J2C A; 
#chains in the Genus database with same CATH homology
 1JQR A;  1YLQ A;  4AT9 A;  4F5N A;  4I27 A;  3WFS C;  9ICQ A;  4UD5 A;  4XRH A;  3MGI A;  5J0W A;  8ICB A;  9ICP A;  7ICE A;  5J0O A;  5J0Y A;  4M2Y A;  4RPX A;  5J29 A;  4K4I A;  4RQ4 A;  9ICU A;  9ICK A;  1ZQU A;  4IQT A;  3OVS A;  3UPQ A;  4S3N A;  1PX5 A;  1ZQS A;  4Z6C A;  3B0X A;  8ICL A;  8ICX A;  3AQK A;  2ZH4 A;  9ICX A;  4FO6 A;  1BPY A;  1BPX A;  4K4H A;  3V7L A;  4X4U A;  3UPS A;  4X4S A;  2O1P A;  9ICB A;  2ZHA A;  3PNC A;  1UEU A;  1ZJN A;  7ICI A;  5J2H A;  4TUS A;  2ZH7 A;  4WC6 A;  4P4P A;  2M2V A;  1R8A A;  8ICY A;  4LZD A;  2PFQ A;  4PHE A;  4UBB A;  4WCW A;  5DEC A;  1ZQA A;  2ISO A;  4I2D A;  2BCR A;  4RPY A;  3AQN A;  1R8C A;  5HRD A;  1VJ7 A;  4RQ6 A;  8ICZ A;  4IG8 A;  4YD1 A;  5EOZ A;  4RQ0 A;  2ZH5 A;  1ZQL A;  4M47 A;  7ICN A;  7ICH A;  9ICT A;  4MFA A;  7ICO A;  4AT7 B;  4UB1 A;  5DDY A;  1ZQI A;  2FMS A;  8ICM A;  9ICW A;  3HIY A;  3OVB A;  4PGX A;  7ICM A;  1ZQZ A;  4QZD A;  9ICO A;  4UB4 A;  3JPT A;  4JWM A;  1ZQJ A;  3C18 A;  5F2V O;  3OVA A;  4KLG A;  2HHP A;  5J0S A;  1ZQY A;  3MDC A;  4QZ9 A;  4O5K A;  7ICR A;  4NM1 A;  4R65 A;  3ISB A;  4I2H A;  3ISD A;  8ICO A;  2M2T A;  4FHV A;  8ICH A;  5HC9 A;  4JWN A;  1BPB A;  2ZH9 A;  4EBJ A;  3WFO A;  2RFF A;  5IIL A;  1ZQP A;  3JPP A;  1TVA A;  2PBE A;  4NXZ A;  4P4M A;  4PHD A;  1JMS A;  2BCS A;  1ZJM A;  4IQW A;  4RWQ A;  2VAN A;  5CR0 A;  2ZH8 A;  2IHM A;  5HRL A;  4PGY A;  4GXJ A;  3UXN A;  5IIK A;  4X4R A;  4AT9 B;  4R66 A;  8ICW A;  2M2U A;  4TUP A;  3V72 A;  3H39 A;  4KLJ A;  5DED A;  1R8B A;  4MF8 A;  9ICL A;  7ICJ A;  4QZC A;  9ICH A;  4X0B A;  5J2F A;  4QZI A;  8ICN A;  4I2G A;  1ZQX A;  3JYY A;  4I2E A;  5HHH A;  4R64 A;  1ZQB A;  4LZG A;  5HHI A;  1WOT A;  4AT7 A;  1ZQN A;  1V4A A;  4AT8 B;  1TV9 A;  3HX0 A;  4NLK A;  3RJG A;  4UB2 A;  9ICM A;  7ICU A;  4QZF A;  1XSP A;  3WFQ E;  3UQ0 A;  8ICR A;  3WFR E;  4PHP A;  7ICG A;  7ICL A;  5IIM A;  5IIO A;  4KLI A;  5HRH A;  3ISC A;  4K4G A;  3V7K A;  9ICN A;  3C5F A;  5J2G A;  5HRE A;  4EBK A;  4KLL A;  1JN3 A;  4F5R A;  2Q66 A;  5HRB A;  7ICP A;  1MQ3 A;  3AU2 A;  7ICS A;  2M2W A;  4QZH A;  1ZQE A;  9ICA A;  5TZV A;  3C2L A;  2BPF A;  2DR9 A;  4LVS A;  3PML A;  3RJE A;  5J0R A;  1MIW A;  5CA7 A;  1BPD A;  4RWN A;  4P2H A;  8ICT A;  9ICC A;  1MIY A;  4UB5 A;  4QZB A;  2FMQ A;  4I28 A;  4X4O A;  1NOM A;  2ISP A;  1BPE A;  2ZH2 A;  4FHY A;  4M04 A;  3HJ4 A;  5DBB A;  1ZQD A;  4RPZ A;  5DB6 A;  3C2K A;  4XUS A;  2P66 A;  2BE3 A;  4I2C A;  1KNY A;  1TFW A;  4Z6D A;  4M9L A;  2PFP A;  3RJJ A;  1UEV A;  4MF2 A;  4FHW A;  2BCU A;  4WBZ A;  5J2E A;  9ICG A;  1JAJ A;  2FMP A;  3V7J A;  4FH3 A;  4I2A A;  5J0U A;  4MFF A;  4Z6E A;  3JPR A;  4NKT A;  4EP7 A;  2BPG A;  3K75 D;  4LT6 A;  2ZHB A;  2ID1 A;  3WFP A;  1RZT A;  3RH4 A;  2ZH1 A;  4M9H A;  3AU6 A;  8ICQ A;  2ZH3 A;  2PXI A;  3TFS A;  4M0A A;  3RJI A;  1XSL A;  9ICJ A;  3JZ0 A;  4KLU A;  5J2D A;  7ICV A;  3MDA A;  4DO9 A;  4I29 A;  4M5D A;  4FH5 A;  4MFC A;  3H38 A;  4YMO A;  4RWO A;  5CJ7 A;  1RPL A;  3OGU A;  3C66 A;  4RQ2 A;  1XSN A;  8ICF A;  2DRB A;  4GXK A;  3RJK A;  5D49 A;  4X4N A;  4F5P A;  8ICI A;  4UAW A;  1F5A A;  4QZA A;  5BPC A;  3RH6 A;  1HUO A;  4Z6F A;  4WC5 A;  4IQU A;  5DKW A;  8ICC A;  4O5C A;  9ICI A;  4KLF A;  3B0Y A;  4UD4 A;  5BOM A;  1ZQF A;  3H3A A;  3OUY B;  4DOB A;  4PPX A;  4ATB A;  5HRI A;  4UAY A;  7ICK A;  8ICK A;  4X4Q A;  5DBC A;  4I2B A;  1ZQR A;  3UXO A;  2DR8 A;  4AT8 A;  5DB8 A;  3MGH A;  5BOL A;  4UAZ A;  4WC3 A;  8ICJ A;  5HRK A;  4KLO A;  4O5E A;  4FHP A;  4RQ7 A;  9ICV A;  5J2I A;  4WBY A;  3TFR A;  4M9N A;  4QZG A;  2GWS A;  5HR9 A;  3MBY A;  8ICG A;  2PFO A;  2PFN A;  2W9M A;  3LK9 A;  4KLQ A;  1ZQH A;  4QZ8 A;  5CHG A;  4RQ5 A;  1MQ2 A;  3H37 A;  5DDM A;  4TUQ A;  4RT3 A;  4NLZ A;  4IQV A;  5J0X A;  4RQ8 A;  4RQ1 A;  4RWP A;  8ICE A;  4XQ7 A;  1OU5 A;  5DB7 A;  1ZQW A;  7ICF A;  4YN4 A;  1ZQT A;  3L9D A;  4PH5 A;  9ICE A;  4X0A A;  5IIJ A;  3JPQ A;  1NO5 A;  4YCX A;  4YMM A;  5J0Q A;  3RJF A;  2BCQ A;  4KLE A;  5J2J A;  4M9J A;  1Q78 A;  5HRF A;  2BPC A;  3LQC B;  3NYB A;  8ICU A;  4I2I A;  4R63 A;  5D4B A;  2I9G A;  4I2F A;  1ZQO A;  2DRA A;  3JPS A;  3UQ2 A;  4KLD A;  9ICF A;  4NKU A;  3JPN A;  4WC7 A;  8ICP A;  5DB9 A;  1MIV A;  1R89 A;  1VFG A;  4X4V A;  2NRK A;  4PGQ A;  4UBC A;  3HJ1 A;  5CP2 A;  5CB1 A;  1TFY A;  4X4P A;  4QZE A;  1BPZ A;  4WC2 A;  2ZH6 A;  1UET A;  5III A;  3HW8 A;  3HWT A;  2DR7 A;  4FHX A;  5CWR A;  1ZQQ A;  3C5G A;  9ICR A;  3AQM A;  3JPO A;  2O5A A;  4F5O A;  4O9M A;  5DBA A;  4ATB B;  4I2J A;  5J2A A;  4KLM A;  4TUR A;  1HUZ A;  5J0P A;  3GDX A;  4YD2 A;  2BCV A;  5J2K A;  3AUO A;  4KLS A;  1ZQV A;  2DVI A;  5J0T A;  4E80 A;  4XA5 A;  4M9G A;  5HRG A;  4XQ8 A;  4E7X A;  8ICS A;  9ICS A;  3C2M A;  4DOA A;  5IIN A;  1FA0 A;  1ZQM A;  1ZQG A;  4KLT A;  4DOC A;  4PHA A;  5J2B A;  3RH5 A;  4UB3 A;  4YMN A;  4NLN A;  4F5Q A;  3PMN A;  3AQL A;  3OV7 A;  4X5V A;  1Q79 A;  1KDH A;  4WC1 A;  5D46 A;  4WC4 A;  8ICV A;  1KEJ A;  4NM2 A;  4RT2 A;  4X4T A;  8ICA A;  2DR5 A;  4E8F A;  4GXI A;  4KLH A;  3UXP A;  1ZQK A;  4RQ3 A;  4NY8 A;  1ZQC A;  7ICT A;  7ICQ A;  4WC0 A;  4P4O A;  3RJH A;  3OUY A;  5J2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...