4S3NA

Crystal structure of human oas3 domain i in complex with dsrna
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
359
structure length
343
Chain Sequence
b'MDLYSTPAAALDRFVARKLQPRKEFVEKARRALGALAAALRERPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2'-5'-oligoadenylate synthase 3
publication title Structural mechanism of sensing long dsRNA via a noncatalytic domain in human oligoadenylate synthetase 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 116
structure length 343
sequence length 359
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10421 OAS1_C 2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4s3nA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4s3nA01
4X4VA 4UBCA 9ICVA 1XSNA 3UXNA 5CB1A 1BPBA 2PFPA 5J2IA 5IIOA 4F5RA 5HC9A 4X0BA 2DR9A 4KLSA 3WFSC 4UD5A 1UEVA 4LZDA 7ICHA 4P4MA 3H39A 1R89A 4WBZA 7ICTA 4I2CA 4M5DA 4RQ4A 9ICKA 1VFGA 3AQKA 2Q66A 5J2EA 7ICNA 2PFNA 5D46A 5J0SA 3HJ4A 4M9HA 4RWOA 5HRDA 4AT7A 5DDMA 4WC5A 8ICWA 5CP2A 3PMLA 3JPNA 1ZJMA 5HRKA 2DR5A 1ZQNA 9ICUA 1MIVA 5J2AA 4NKTA 4X4QA 1ZQKA 9ICMA 5DB6A 4PGQA 4QZGA 2PBEA 4I2FA 4F5QA 4AT9B 5J2GA 1HUOA 4KLOA 4RQ0A 5J2JA 3ISDA 9ICJA 1RZTA 4E80A 4F5PA 4QZDA 5CWRA 7ICPA 3C2LA 4X4PA 4UBBA 4UB3A 4NXZA 5D49A 4QZAA 4WC3A 3JPTA 4NLZA 1BPEA 3K75D 3GDXA 4Z6FA 1ZQOA 4RPXA 5BOLA 1ZQYA 8ICMA 3MGIA 1BPYA 4XQ7A 2DR8A 1ZQZA 3OUYA 1ZQJA 4WBYA 4PHEA 1ZQVA 2BPGA 8ICVA 5CJ7A 8ICRA 4EBKA 5J0OA 5IIKA 4TUSA 1TVAA 3MGHA 4JWMA 3RH5A 4GXJA 4M9NA 7ICVA 3C5GA 4FHPA 4O5CA 5DBAA 4NM2A 5J2FA 4MF2A 4KLUA 3WFPA 4O5EA 2ZH2A 4FH3A 2W9MA 4XUSA 4FO6A 4MFCA 1PX5A 7ICKA 4YMNA 4XA5A 4IQVA 4TUPA 5DB9A 5HRHA 4YN4A 5HRBA 2P66A 4LVSA 9ICRA 4PPXA 4ATBB 4I2GA 4KLDA 4IQWA 3MDAA 3LQCB 3OV7A 4AT8A 3V72A 4Z6DA 4E8FA 4R64A 3HX0A 2RFFA 8ICGA 2M2TA 1ZJNA 2IHMA 3UQ2A 4QZEA 4QZFA 8ICPA 1JQRA 1ZQBA 8ICLA 1JMSA 5HHHA 1MQ2A 4DO9A 2BCQA 4R63A 5J0WA 4RQ8A 1MQ3A 3WFRE 2BCVA 3RH4A 4P4OA 4XQ8A 4RQ3A 4RPYA 8ICEA 4UB2A 3PNCA 4EP7A 2ZH3A 3OVBA 4RQ5A 9ICXA 4IQUA 5J29A 5J2KA 4RPZA 3RJEA 2ISOA 4M9LA 4YD2A 4K4GA 4RQ6A 8ICBA 3PMNA 9ICGA 3L9DA 1ZQHA 2ZHAA 4RT3A 4MFAA 2PXIA 1R8AA 1KDHA 2DRBA 5IIJA 1Q78A 7ICIA 4P2HA 4AT7B 4K4IA 3NYBA 8ICCA 8ICAA 5J0RA 4NKUA 3TFRA 4M9GA 2M2VA 4UAYA 5CR0A 4FHWA 3RJIA 4KLQA 2ISPA 3HJ1A 7ICUA 4I29A 3RJGA 4IG8A 3JPSA 5J2CA 4WC1A 4YCXA 2VANA 1TFWA 4DOCA 3HW8A 9ICHA 4UD4A 5DKWA 4I27A 8ICOA 4X4UA 4FH5A 5IILA 1ZQPA 2DR7A 8ICZA 1MIYA 2ZH8A 3B0YA 5J0TA 4KLGA 4XRHA 1ZQUA 3C2KA 7ICJA 8ICQA 3HWTA 8ICXA 4PH5A 1ZQMA 1YLQA 1ZQSA 1JN3A 4PGYA 1ZQDA 4QZHA 4NM1A 7ICEA 4I2BA 2ZH9A 4I2DA 8ICYA 4O5KA 2DRAA 4RQ7A 9ICIA 4F5OA 8ICFA 1RPLA 3C18A 4TURA 3UPQA 2BCRA 1BPZA 4JWNA 2ZH6A 4QZCA 3OUYB 3LK9A 3AQMA 5J0PA 3WFQE 4UB4A 3V7JA 3AU6A 5HRGA 2FMSA 1NO5A 2NRKA 5J0UA 3OVSA 5J2DA 4I2JA 1MIWA 1V4AA 4K4HA 9ICNA 5DDYA 2DVIA 3B0XA 5DB7A 1HUZA 9ICTA 4WC0A 7ICSA 4DOAA 3UQ0A 4M04A 9ICQA 2BPFA 5HR9A 1ZQCA 2GWSA 3OGUA 3RH6A 4YD1A 5HRFA 9ICCA 4EBJA 9ICBA 3H37A 5J2HA 3RJKA 9ICAA 5J0XA 2ZH5A 4LZGA 4I2AA 2M2WA 4AT8B 5BPCA 4LT6A 3UXPA 4RWPA 2ZH4A 4WC7A 8ICSA 3RJFA 1OU5A 8ICIA 2ID1A 1ZQFA 4PHPA 7ICRA 5HRIA 3C5FA 2BCSA 3JPRA 5IIMA 4NLNA 8ICJA 4Z6EA 4KLEA 9ICPA 3C66A 4KLJA 4FHXA 4X4RA 1R8CA 4PHAA 1ZQTA 5DECA 9ICFA 4R66A 8ICTA 4RT2A 1ZQRA 5F2VO 4UAZA 1ZQAA 2I9GA 5BOMA 3V7KA 4PHDA 3OVAA 3AUOA 9ICEA 1BPDA 4KLLA 2M2UA 4IQTA 3AU2A 2HHPA 5HHIA 2PFQA 2ZH1A 4KLHA 4GXKA 4E7XA 4RQ2A 3JPOA 4X4SA 4KLIA 4F5NA 1R8BA 4FHYA 4RQ1A 4X5VA 4X4TA 3TFSA 1KEJA 4RWNA 1ZQLA 1TV9A 4S3NA 5EOZA 5J0YA 7ICLA 4QZIA 3JPQA 4WC2A 3AQLA 8ICNA 4NLKA 1NOMA 5DBBA 5CHGA 4I28A 2PFOA 4AT9A 2BCUA 1UETA 2BE3A 5IINA 2ZHBA 4KLMA 4PGXA 3JZ0A 4YMMA 5D4BA 4X4NA 4KLTA 1WOTA 5TZVA 3AQNA 3JYYA 2ZH7A 4UB1A 7ICGA 4RWQA 2BPCA 9ICWA 4O9MA 1KNYA 3ISBA 1XSPA 1TFYA 3H38A 4X4OA 3C2MA 7ICQA 4R65A 5DEDA 4TUQA 4DOBA 5IIIA 1ZQEA 3H3AA 4I2IA 4P4PA 4FHVA 3UXOA 4X0AA 4QZ8A 4UAWA 3HIYA 4M2YA 4M0AA 5DBCA 4QZ9A 4GXIA 1ZQQA 5CA7A 1FA0A 4Z6CA 1JAJA 1UEUA 2FMPA 5J2BA 8ICHA 7ICFA 9ICLA 1VJ7A 3JPPA 4WC4A 3RJHA 4QZBA 4MF8A 4UB5A 4I2HA 2O1PA 4ATBA 3MDCA 7ICMA 4NY8A 2FMQA 1XSLA 1Q79A 1BPXA 4M9JA 3ISCA 1ZQWA 3WFOA 9ICSA 1ZQGA 3RJJA 4WCWA 4I2EA 5DB8A 4M47A 4YMOA 4MFFA 5J0QA 8ICUA 3UPSA 3V7LA 4WC6A 9ICOA 1F5AA 8ICKA 5HRLA 7ICOA 5HREA 2O5AA 1ZQIA 4KLFA 3MBYA 1ZQXA
chains in the Genus database with same CATH superfamily
4X4VA 4UBCA 9ICVA 1XSNA 3NWIA 3UXNA 5CB1A 3K7DA 1BPBA 2PFPA 5J2IA 5IIOA 4NXUA 4F5RA 5HC9A 4X0BA 2DR9A 4KLSA 3WFSC 4OAGA 4UD5A 1UEVA 4LZDA 7ICHA 4P4MA 3H39A 1R89A 4WBZA 7ICTA 4I2CA 4M5DA 4RQ4A 9ICKA 1VFGA 3AQKA 2Q66A 5J2EA 7ICNA 2PFNA 5D46A 5J0SA 3HJ4A 4M9HA 4RWOA 5HRDA 4AT7A 5DDMA 4WC5A 8ICWA 5CP2A 3PMLA 3JPNA 2HN1A 1ZJMA 2HN2A 4WOYA 5HRKA 2DR5A 1ZQNA 9ICUA 1MIVA 5J2AA 4NKTA 4X4QA 1ZQKA 9ICMA 5DB6A 4PGQA 4QZGA 2PBEA 4I2FA 4F5QA 4AT9B 5J2GA 1HUOA 4KLOA 4RQ0A 5J2JA 3ISDA 9ICJA 1RZTA 4E80A 2B56A 4F5PA 4QZDA 5CWRA 7ICPA 3C2LA 4X4PA 4UBBA 5JTGA 4UB3A 4NXZA 5D49A 4QZAA 4K98A 4WC3A 3JPTA 4NLZA 1BPEA 3K75D 3GDXA 4K97A 4WQKA 4Z6FA 1ZQOA 4RPXA 5BOLA 1ZQYA 8ICMA 4O69A 3MGIA 4JLZA 1BPYA 4XQ7A 2DR8A 1ZQZA 3OUYA 3MCRA 1ZQJA 3ER8C 4KM5A 4WBYA 4PHEA 1ZQVA 2BPGA 8ICVA 5CJ7A 8ICRA 4EBKA 5J0OA 5IIKA 4TUSA 2GA9D 1TVAA 3MGHA 4JWMA 3RH5A 4GXJA 4M9NA 7ICVA 3C5GA 4NXTA 4FHPA 4O5CA 5DBAA 4K99A 4K96A 4NM2A 5J2FA 4MF2A 4KLUA 4MKPA 3WFPA 4O5EA 2ZH2A 2W9MA 4FH3A 4XUSA 4FO6A 4MFCA 1PX5A 4K9AA 2BBHA 7ICKA 4YMNA 4XA5A 3NVOA 4IQVA 5DB9A 4TUPA 5HRHA 4YN4A 5HRBA 2P66A 4O6AA 3CK6A 4LVSA 9ICRA 4PPXA 4ATBB 4I2GA 4KLDA 5B3PA 4IQWA 3MDAA 3LQCB 3OV7A 4AT8A 3V72A 4N7RA 4Z6DA 4E8FA 5D62A 4R64A 3HX0A 2RFFA 8ICGA 5CHEA 2M2TA 1ZJNA 2IHMA 3UQ2A 4QZEA 4O68A 4QZFA 8ICPA 1JQRA 1ZQBA 2EWRA 1JMSA 8ICLA 5HHHA 4HX0A 1MQ2A 4DO9A 2BCQA 4R63A 5J0WA 4RQ8A 1MQ3A 3WFRE 2BCVA 3RH4A 4P4OA 4XQ8A 4FO1A 4RQ3A 4RPYA 8ICEA 4UB2A 3OVBA 4EP7A 2ZH3A 3PNCA 4RQ5A 9ICXA 3PHZA 4IQUA 5J29A 4XJEA 5J2KA 4RPZA 3RJEA 5CFTA 2ISOA 4M9LA 4YD2A 4K4GA 4RQ6A 8ICBA 3PMNA 9ICGA 3L9DA 1ZQHA 2ZHAA 4RT3A 4MFAA 2PXIA 1R8AA 2IUBA 1KDHA 2DRBA 5IIJA 1Q78A 7ICIA 4P2HA 4AT7B 4K4IA 3NYBA 8ICCA 8ICAA 5J0RA 4NKUA 3TFRA 4M9GA 2GAFD 2M2VA 4UAYA 5CR0A 4FHWA 3RJIA 4KLQA 2ISPA 3HJ1A 7ICUA 4I29A 3RJGA 4IG8A 3JCFA 3JPSA 5J2CA 4WC1A 4YCXA 1TFWA 2VANA 4DOCA 3HW8A 9ICHA 4UD4A 5DKWA 4I27A 8ICOA 4X4UA 4FH5A 4EEDA 5IILA 1ZQPA 4WQLA 2DR7A 8ICZA 1MIYA 2ZH8A 3B0YA 5J0TA 4KLGA 4XRHA 1ZQUA 3C2KA 7ICJA 8ICQA 3HWTA 8ICXA 4PH5A 1ZQMA 1YLQA 1ZQSA 1JN3A 4PGYA 1ZQDA 4LEWA 4QZHA 4NM1A 7ICEA 4I2BA 2ZH9A 4I2DA 8ICYA 4O5KA 2DRAA 4RQ7A 9ICIA 4F5OA 8ICFA 1RPLA 3C18A 4TURA 3UPQA 2BCRA 1BPZA 4JWNA 2ZH6A 4QZCA 3OUYB 3LK9A 3AQMA 5J0PA 3WFQE 4I0UA 4UB4A 3EF2A 3V7JA 3AU6A 4WH5A 5HRGA 2FMSA 1NO5A 2NRKA 5J0UA 3OVSA 5J2DA 4I2JA 1MIWA 1V4AA 4K4HA 9ICNA 4OAIZ 5DDYA 2DVIA 3B0XA 5DB7A 1HUZA 9ICTA 4WC0A 7ICSA 4DOAA 3UQ0A 4M04A 9ICQA 4K9BA 2BPFA 5HR9A 1ZQCA 2GWSA 3OGUA 3RH6A 4YD1A 2BBJA 5HRFA 9ICCA 4EBJA 9ICBA 3H37A 5J2HA 3RJKA 9ICAA 5J0XA 3NKUA 2ZH5A 4LZGA 4I2AA 2M2WA 4AT8B 5BPCA 4LT6A 3UXPA 4RWPA 2ZH4A 4WC7A 8ICSA 2B51A 3RJFA 1OU5A 4EV6A 4KB6A 2FCLA 2ID1A 8ICIA 4EGWA 1ZQFA 4PHPA 7ICRA 5HRIA 3C5FA 2BCSA 3JPRA 5IIMA 4NLNA 8ICJA 4Z6EA 4KLEA 9ICPA 3C66A 4KLJA 4FHXA 4X4RA 1R8CA 4PHAA 1ZQTA 5DECA 9ICFA 4R66A 8ICTA 4RT2A 1ZQRA 5F2VO 4UAZA 1ZQAA 2I9GA 5BOMA 3V7KA 3OVAA 4PHDA 3AUOA 9ICEA 1BPDA 4LEZA 2M2UA 4KLLA 4IQTA 3AU2A 2HHPA 4OAHA 5HHIA 2PFQA 4OAFA 4NXWA 2ZH1A 4KLHA 4GXKA 4E7XA 4RQ2A 3JPOA 4X4SA 4KLIA 4F5NA 1R8BA 4FHYA 4RQ1A 4X5VA 4X4TA 3TFSA 1GPJA 1KEJA 4RWNA 1ZQLA 1TV9A 4S3NA 5EOZA 5J0YA 7ICLA 4K8VA 4QZIA 3JPQA 4WC2A 3AQLA 8ICNA 4NLKA 1NOMA 5DBBA 5CHGA 4I28A 2PFOA 4AT9A 2BCUA 1UETA 2BE3A 5IINA 2ZHBA 4KLMA 4PGXA 3JZ0A 4YMMA 4X4NA 5D4BA 4KLTA 1WOTA 5TZVA 3AQNA 4LEVA 3JYYA 2ZH7A 4UB1A 7ICGA 4RWQA 2BPCA 9ICWA 5D61A 4O9MA 1KNYA 5CFSA 3ISBA 1TFYA 5B3QA 1XSPA 3OWGA 4NXVA 3H38A 4X4OA 3C2MA 7ICQA 4R65A 5DEDA 4TUQA 4DOBA 5IIIA 1ZQEA 3H3AA 4I2IA 4P4PA 4FHVA 3UXOA 4X0AA 4QZ8A 2B4VA 4UAWA 3HIYA 3ER9B 4M2YA 4M0AA 5DBCA 4QZ9A 4GXIA 1ZQQA 5CA7A 1FA0A 4Z6CA 1JAJA 1UEUA 2FMPA 5J2BA 8ICHA 3ERCC 7ICFA 9ICLA 1VJ7A 3JPPA 4WC4A 3RJHA 4QZBA 5D63A 4MF8A 4UB5A 4I2HA 2O1PA 4ATBA 3MDCA 7ICMA 4NY8A 2FMQA 1XSLA 1Q79A 4NXXA 1BPXA 4M9JA 4EEBA 3ISCA 1ZQWA 3WFOA 9ICSA 2IHOA 1ZQGA 3RJJA 4JLXA 4WCWA 4I2EA 5CFUA 5DB8A 4M47A 4YMOA 4MFFA 5J0QA 8ICUA 4O67A 3UPSA 3V7LA 4WC6A 9ICOA 1F5AA 8ICKA 4LEYA 5HRLA 7ICOA 5HREA 2O5AA 1ZQIA 4KLFA 3MBYA 1ZQXA
chains in the Genus database with same CATH topology
4X4VA 4UBCA 9ICVA 1XSNA 3UXNA 5CB1A 1BPBA 2PFPA 5J2IA 5IIOA 4F5RA 5HC9A 4X0BA 2DR9A 4KLSA 3WFSC 4UD5A 1UEVA 4LZDA 7ICHA 4P4MA 3H39A 1R89A 4WBZA 7ICTA 4I2CA 4M5DA 4RQ4A 9ICKA 1VFGA 3AQKA 2Q66A 5J2EA 7ICNA 2PFNA 5D46A 5J0SA 3HJ4A 4M9HA 4RWOA 5HRDA 4AT7A 5DDMA 4WC5A 8ICWA 5CP2A 3PMLA 3JPNA 1ZJMA 5HRKA 2DR5A 1ZQNA 9ICUA 1MIVA 5J2AA 4NKTA 4X4QA 1ZQKA 9ICMA 5DB6A 4PGQA 4QZGA 2PBEA 4I2FA 4F5QA 4AT9B 5J2GA 1HUOA 4KLOA 4RQ0A 5J2JA 3ISDA 9ICJA 1RZTA 4E80A 4F5PA 4QZDA 5CWRA 7ICPA 3C2LA 4X4PA 4UBBA 4UB3A 4NXZA 5D49A 4QZAA 4WC3A 3JPTA 4NLZA 1BPEA 3K75D 3GDXA 4Z6FA 1ZQOA 4RPXA 5BOLA 1ZQYA 8ICMA 3MGIA 1BPYA 4XQ7A 2DR8A 1ZQZA 3OUYA 1ZQJA 4WBYA 4PHEA 1ZQVA 2BPGA 8ICVA 5CJ7A 8ICRA 4EBKA 5J0OA 5IIKA 4TUSA 1TVAA 3MGHA 4JWMA 3RH5A 4GXJA 4M9NA 7ICVA 3C5GA 4FHPA 4O5CA 5DBAA 4NM2A 5J2FA 4MF2A 4KLUA 3WFPA 4O5EA 2ZH2A 4FH3A 2W9MA 4XUSA 4FO6A 4MFCA 1PX5A 7ICKA 4YMNA 4XA5A 4IQVA 4TUPA 5DB9A 5HRHA 4YN4A 5HRBA 2P66A 4LVSA 9ICRA 4PPXA 4ATBB 4I2GA 4KLDA 4IQWA 3MDAA 3LQCB 3OV7A 4AT8A 3V72A 4Z6DA 4E8FA 4R64A 3HX0A 2RFFA 8ICGA 2M2TA 1ZJNA 2IHMA 3UQ2A 4QZEA 4QZFA 8ICPA 1JQRA 1ZQBA 8ICLA 1JMSA 5HHHA 1MQ2A 4DO9A 2BCQA 4R63A 5J0WA 4RQ8A 1MQ3A 3WFRE 2BCVA 3RH4A 4P4OA 4XQ8A 4RQ3A 4RPYA 8ICEA 4UB2A 3PNCA 4EP7A 2ZH3A 3OVBA 4RQ5A 9ICXA 4IQUA 5J29A 5J2KA 4RPZA 3RJEA 2ISOA 4M9LA 4YD2A 4K4GA 4RQ6A 8ICBA 3PMNA 9ICGA 3L9DA 1ZQHA 2ZHAA 4RT3A 4MFAA 2PXIA 1R8AA 1KDHA 2DRBA 5IIJA 1Q78A 7ICIA 4P2HA 4AT7B 4K4IA 3NYBA 8ICCA 8ICAA 5J0RA 4NKUA 3TFRA 4M9GA 2M2VA 4UAYA 5CR0A 4FHWA 3RJIA 4KLQA 2ISPA 3HJ1A 7ICUA 4I29A 3RJGA 4IG8A 3JPSA 5J2CA 4WC1A 4YCXA 2VANA 1TFWA 4DOCA 3HW8A 9ICHA 4UD4A 5DKWA 4I27A 8ICOA 4X4UA 4FH5A 5IILA 1ZQPA 2DR7A 8ICZA 1MIYA 2ZH8A 3B0YA 5J0TA 4KLGA 4XRHA 1ZQUA 3C2KA 7ICJA 8ICQA 3HWTA 8ICXA 4PH5A 1ZQMA 1YLQA 1ZQSA 1JN3A 4PGYA 1ZQDA 4QZHA 4NM1A 7ICEA 4I2BA 2ZH9A 4I2DA 8ICYA 4O5KA 2DRAA 4RQ7A 9ICIA 4F5OA 8ICFA 1RPLA 3C18A 4TURA 3UPQA 2BCRA 1BPZA 4JWNA 2ZH6A 4QZCA 3OUYB 3LK9A 3AQMA 5J0PA 3WFQE 4UB4A 3V7JA 3AU6A 5HRGA 2FMSA 1NO5A 2NRKA 5J0UA 3OVSA 5J2DA 4I2JA 1MIWA 1V4AA 4K4HA 9ICNA 5DDYA 2DVIA 3B0XA 5DB7A 1HUZA 9ICTA 4WC0A 7ICSA 4DOAA 3UQ0A 4M04A 9ICQA 2BPFA 5HR9A 1ZQCA 2GWSA 3OGUA 3RH6A 4YD1A 5HRFA 9ICCA 4EBJA 9ICBA 3H37A 5J2HA 3RJKA 9ICAA 5J0XA 2ZH5A 4LZGA 4I2AA 2M2WA 4AT8B 5BPCA 4LT6A 3UXPA 4RWPA 2ZH4A 4WC7A 8ICSA 3RJFA 1OU5A 8ICIA 2ID1A 1ZQFA 4PHPA 7ICRA 5HRIA 3C5FA 2BCSA 3JPRA 5IIMA 4NLNA 8ICJA 4Z6EA 4KLEA 9ICPA 3C66A 4KLJA 4FHXA 4X4RA 1R8CA 4PHAA 1ZQTA 5DECA 9ICFA 4R66A 8ICTA 4RT2A 1ZQRA 5F2VO 4UAZA 1ZQAA 2I9GA 5BOMA 3V7KA 4PHDA 3OVAA 3AUOA 9ICEA 1BPDA 4KLLA 2M2UA 4IQTA 3AU2A 2HHPA 5HHIA 2PFQA 2ZH1A 4KLHA 4GXKA 4E7XA 4RQ2A 3JPOA 4X4SA 4KLIA 4F5NA 1R8BA 4FHYA 4RQ1A 4X5VA 4X4TA 3TFSA 1KEJA 4RWNA 1ZQLA 1TV9A 4S3NA 5EOZA 5J0YA 7ICLA 4QZIA 3JPQA 4WC2A 3AQLA 8ICNA 4NLKA 1NOMA 5DBBA 5CHGA 4I28A 2PFOA 4AT9A 2BCUA 1UETA 2BE3A 5IINA 2ZHBA 4KLMA 4PGXA 3JZ0A 4YMMA 5D4BA 4X4NA 4KLTA 1WOTA 5TZVA 3AQNA 3JYYA 2ZH7A 4UB1A 7ICGA 4RWQA 2BPCA 9ICWA 4O9MA 1KNYA 3ISBA 1XSPA 1TFYA 3H38A 4X4OA 3C2MA 7ICQA 4R65A 5DEDA 4TUQA 4DOBA 5IIIA 1ZQEA 3H3AA 4I2IA 4P4PA 4FHVA 3UXOA 4X0AA 4QZ8A 4UAWA 3HIYA 4M2YA 4M0AA 5DBCA 4QZ9A 4GXIA 1ZQQA 5CA7A 1FA0A 4Z6CA 1JAJA 1UEUA 2FMPA 5J2BA 8ICHA 7ICFA 9ICLA 1VJ7A 3JPPA 4WC4A 3RJHA 4QZBA 4MF8A 4UB5A 4I2HA 2O1PA 4ATBA 3MDCA 7ICMA 4NY8A 2FMQA 1XSLA 1Q79A 1BPXA 4M9JA 3ISCA 1ZQWA 3WFOA 9ICSA 1ZQGA 3RJJA 4WCWA 4I2EA 5DB8A 4M47A 4YMOA 4MFFA 5J0QA 8ICUA 3UPSA 3V7LA 4WC6A 9ICOA 1F5AA 8ICKA 5HRLA 7ICOA 5HREA 2O5AA 1ZQIA 4KLFA 3MBYA 1ZQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4V A;  4UBC A;  9ICV A;  1XSN A;  3UXN A;  5CB1 A;  1BPB A;  2PFP A;  5J2I A;  5IIO A;  4F5R A;  5HC9 A;  4X0B A;  2DR9 A;  4KLS A;  3WFS C;  4UD5 A;  1UEV A;  4LZD A;  7ICH A;  4P4M A;  3H39 A;  1R89 A;  4WBZ A;  7ICT A;  4I2C A;  4M5D A;  4RQ4 A;  9ICK A;  1VFG A;  3AQK A;  2Q66 A;  5J2E A;  7ICN A;  2PFN A;  5D46 A;  5J0S A;  3HJ4 A;  4M9H A;  4RWO A;  5HRD A;  4AT7 A;  5DDM A;  4WC5 A;  8ICW A;  5CP2 A;  3PML A;  3JPN A;  1ZJM A;  5HRK A;  2DR5 A;  1ZQN A;  9ICU A;  1MIV A;  5J2A A;  4NKT A;  4X4Q A;  1ZQK A;  9ICM A;  5DB6 A;  4PGQ A;  4QZG A;  2PBE A;  4I2F A;  4F5Q A;  4AT9 B;  5J2G A;  1HUO A;  4KLO A;  4RQ0 A;  5J2J A;  3ISD A;  9ICJ A;  1RZT A;  4E80 A;  4F5P A;  4QZD A;  5CWR A;  7ICP A;  3C2L A;  4X4P A;  4UBB A;  4UB3 A;  4NXZ A;  5D49 A;  4QZA A;  4WC3 A;  3JPT A;  4NLZ A;  1BPE A;  3K75 D;  3GDX A;  4Z6F A;  1ZQO A;  4RPX A;  5BOL A;  1ZQY A;  8ICM A;  3MGI A;  1BPY A;  4XQ7 A;  2DR8 A;  1ZQZ A;  3OUY A;  1ZQJ A;  4WBY A;  4PHE A;  1ZQV A;  2BPG A;  8ICV A;  5CJ7 A;  8ICR A;  4EBK A;  5J0O A;  5IIK A;  4TUS A;  1TVA A;  3MGH A;  4JWM A;  3RH5 A;  4GXJ A;  4M9N A;  7ICV A;  3C5G A;  4FHP A;  4O5C A;  5DBA A;  4NM2 A;  5J2F A;  4MF2 A;  4KLU A;  3WFP A;  4O5E A;  2ZH2 A;  4FH3 A;  2W9M A;  4XUS A;  4FO6 A;  4MFC A;  1PX5 A;  7ICK A;  4YMN A;  4XA5 A;  4IQV A;  4TUP A;  5DB9 A;  5HRH A;  4YN4 A;  5HRB A;  2P66 A;  4LVS A;  9ICR A;  4PPX A;  4ATB B;  4I2G A;  4KLD A;  4IQW A;  3MDA A;  3LQC B;  3OV7 A;  4AT8 A;  3V72 A;  4Z6D A;  4E8F A;  4R64 A;  3HX0 A;  2RFF A;  8ICG A;  2M2T A;  1ZJN A;  2IHM A;  3UQ2 A;  4QZE A;  4QZF A;  8ICP A;  1JQR A;  1ZQB A;  8ICL A;  1JMS A;  5HHH A;  1MQ2 A;  4DO9 A;  2BCQ A;  4R63 A;  5J0W A;  4RQ8 A;  1MQ3 A;  3WFR E;  2BCV A;  3RH4 A;  4P4O A;  4XQ8 A;  4RQ3 A;  4RPY A;  8ICE A;  4UB2 A;  3PNC A;  4EP7 A;  2ZH3 A;  3OVB A;  4RQ5 A;  9ICX A;  4IQU A;  5J29 A;  5J2K A;  4RPZ A;  3RJE A;  2ISO A;  4M9L A;  4YD2 A;  4K4G A;  4RQ6 A;  8ICB A;  3PMN A;  9ICG A;  3L9D A;  1ZQH A;  2ZHA A;  4RT3 A;  4MFA A;  2PXI A;  1R8A A;  1KDH A;  2DRB A;  5IIJ A;  1Q78 A;  7ICI A;  4P2H A;  4AT7 B;  4K4I A;  3NYB A;  8ICC A;  8ICA A;  5J0R A;  4NKU A;  3TFR A;  4M9G A;  2M2V A;  4UAY A;  5CR0 A;  4FHW A;  3RJI A;  4KLQ A;  2ISP A;  3HJ1 A;  7ICU A;  4I29 A;  3RJG A;  4IG8 A;  3JPS A;  5J2C A;  4WC1 A;  4YCX A;  2VAN A;  1TFW A;  4DOC A;  3HW8 A;  9ICH A;  4UD4 A;  5DKW A;  4I27 A;  8ICO A;  4X4U A;  4FH5 A;  5IIL A;  1ZQP A;  2DR7 A;  8ICZ A;  1MIY A;  2ZH8 A;  3B0Y A;  5J0T A;  4KLG A;  4XRH A;  1ZQU A;  3C2K A;  7ICJ A;  8ICQ A;  3HWT A;  8ICX A;  4PH5 A;  1ZQM A;  1YLQ A;  1ZQS A;  1JN3 A;  4PGY A;  1ZQD A;  4QZH A;  4NM1 A;  7ICE A;  4I2B A;  2ZH9 A;  4I2D A;  8ICY A;  4O5K A;  2DRA A;  4RQ7 A;  9ICI A;  4F5O A;  8ICF A;  1RPL A;  3C18 A;  4TUR A;  3UPQ A;  2BCR A;  1BPZ A;  4JWN A;  2ZH6 A;  4QZC A;  3OUY B;  3LK9 A;  3AQM A;  5J0P A;  3WFQ E;  4UB4 A;  3V7J A;  3AU6 A;  5HRG A;  2FMS A;  1NO5 A;  2NRK A;  5J0U A;  3OVS A;  5J2D A;  4I2J A;  1MIW A;  1V4A A;  4K4H A;  9ICN A;  5DDY A;  2DVI A;  3B0X A;  5DB7 A;  1HUZ A;  9ICT A;  4WC0 A;  7ICS A;  4DOA A;  3UQ0 A;  4M04 A;  9ICQ A;  2BPF A;  5HR9 A;  1ZQC A;  2GWS A;  3OGU A;  3RH6 A;  4YD1 A;  5HRF A;  9ICC A;  4EBJ A;  9ICB A;  3H37 A;  5J2H A;  3RJK A;  9ICA A;  5J0X A;  2ZH5 A;  4LZG A;  4I2A A;  2M2W A;  4AT8 B;  5BPC A;  4LT6 A;  3UXP A;  4RWP A;  2ZH4 A;  4WC7 A;  8ICS A;  3RJF A;  1OU5 A;  8ICI A;  2ID1 A;  1ZQF A;  4PHP A;  7ICR A;  5HRI A;  3C5F A;  2BCS A;  3JPR A;  5IIM A;  4NLN A;  8ICJ A;  4Z6E A;  4KLE A;  9ICP A;  3C66 A;  4KLJ A;  4FHX A;  4X4R A;  1R8C A;  4PHA A;  1ZQT A;  5DEC A;  9ICF A;  4R66 A;  8ICT A;  4RT2 A;  1ZQR A;  5F2V O;  4UAZ A;  1ZQA A;  2I9G A;  5BOM A;  3V7K A;  4PHD A;  3OVA A;  3AUO A;  9ICE A;  1BPD A;  4KLL A;  2M2U A;  4IQT A;  3AU2 A;  2HHP A;  5HHI A;  2PFQ A;  2ZH1 A;  4KLH A;  4GXK A;  4E7X A;  4RQ2 A;  3JPO A;  4X4S A;  4KLI A;  4F5N A;  1R8B A;  4FHY A;  4RQ1 A;  4X5V A;  4X4T A;  3TFS A;  1KEJ A;  4RWN A;  1ZQL A;  1TV9 A;  4S3N A;  5EOZ A;  5J0Y A;  7ICL A;  4QZI A;  3JPQ A;  4WC2 A;  3AQL A;  8ICN A;  4NLK A;  1NOM A;  5DBB A;  5CHG A;  4I28 A;  2PFO A;  4AT9 A;  2BCU A;  1UET A;  2BE3 A;  5IIN A;  2ZHB A;  4KLM A;  4PGX A;  3JZ0 A;  4YMM A;  5D4B A;  4X4N A;  4KLT A;  1WOT A;  5TZV A;  3AQN A;  3JYY A;  2ZH7 A;  4UB1 A;  7ICG A;  4RWQ A;  2BPC A;  9ICW A;  4O9M A;  1KNY A;  3ISB A;  1XSP A;  1TFY A;  3H38 A;  4X4O A;  3C2M A;  7ICQ A;  4R65 A;  5DED A;  4TUQ A;  4DOB A;  5III A;  1ZQE A;  3H3A A;  4I2I A;  4P4P A;  4FHV A;  3UXO A;  4X0A A;  4QZ8 A;  4UAW A;  3HIY A;  4M2Y A;  4M0A A;  5DBC A;  4QZ9 A;  4GXI A;  1ZQQ A;  5CA7 A;  1FA0 A;  4Z6C A;  1JAJ A;  1UEU A;  2FMP A;  5J2B A;  8ICH A;  7ICF A;  9ICL A;  1VJ7 A;  3JPP A;  4WC4 A;  3RJH A;  4QZB A;  4MF8 A;  4UB5 A;  4I2H A;  2O1P A;  4ATB A;  3MDC A;  7ICM A;  4NY8 A;  2FMQ A;  1XSL A;  1Q79 A;  1BPX A;  4M9J A;  3ISC A;  1ZQW A;  3WFO A;  9ICS A;  1ZQG A;  3RJJ A;  4WCW A;  4I2E A;  5DB8 A;  4M47 A;  4YMO A;  4MFF A;  5J0Q A;  8ICU A;  3UPS A;  3V7L A;  4WC6 A;  9ICO A;  1F5A A;  8ICK A;  5HRL A;  7ICO A;  5HRE A;  2O5A A;  1ZQI A;  4KLF A;  3MBY A;  1ZQX A; 
#chains in the Genus database with same CATH topology
 4X4V A;  4UBC A;  9ICV A;  1XSN A;  3NWI A;  3UXN A;  5CB1 A;  3K7D A;  1BPB A;  2PFP A;  5J2I A;  5IIO A;  4NXU A;  4F5R A;  5HC9 A;  4X0B A;  2DR9 A;  4KLS A;  3WFS C;  4OAG A;  4UD5 A;  1UEV A;  4LZD A;  7ICH A;  4P4M A;  3H39 A;  1R89 A;  4WBZ A;  7ICT A;  4I2C A;  4M5D A;  4RQ4 A;  9ICK A;  1VFG A;  3AQK A;  2Q66 A;  5J2E A;  7ICN A;  2PFN A;  5D46 A;  5J0S A;  3HJ4 A;  4M9H A;  4RWO A;  5HRD A;  4AT7 A;  5DDM A;  4WC5 A;  8ICW A;  5CP2 A;  3PML A;  3JPN A;  2HN1 A;  1ZJM A;  2HN2 A;  4WOY A;  5HRK A;  2DR5 A;  1ZQN A;  9ICU A;  1MIV A;  5J2A A;  4NKT A;  4X4Q A;  1ZQK A;  9ICM A;  5DB6 A;  4PGQ A;  4QZG A;  2PBE A;  4I2F A;  4F5Q A;  4AT9 B;  5J2G A;  1HUO A;  4KLO A;  4RQ0 A;  5J2J A;  3ISD A;  9ICJ A;  1RZT A;  4E80 A;  2B56 A;  4F5P A;  4QZD A;  5CWR A;  7ICP A;  3C2L A;  4X4P A;  4UBB A;  5JTG A;  4UB3 A;  4NXZ A;  5D49 A;  4QZA A;  4K98 A;  4WC3 A;  3JPT A;  4NLZ A;  1BPE A;  3K75 D;  3GDX A;  4K97 A;  4WQK A;  4Z6F A;  1ZQO A;  4RPX A;  5BOL A;  1ZQY A;  8ICM A;  4O69 A;  3MGI A;  4JLZ A;  1BPY A;  4XQ7 A;  2DR8 A;  1ZQZ A;  3OUY A;  3MCR A;  1ZQJ A;  3ER8 C;  4KM5 A;  4WBY A;  4PHE A;  1ZQV A;  2BPG A;  8ICV A;  5CJ7 A;  8ICR A;  4EBK A;  5J0O A;  5IIK A;  4TUS A;  2GA9 D;  1TVA A;  3MGH A;  4JWM A;  3RH5 A;  4GXJ A;  4M9N A;  7ICV A;  3C5G A;  4NXT A;  4FHP A;  4O5C A;  5DBA A;  4K99 A;  4K96 A;  4NM2 A;  5J2F A;  4MF2 A;  4KLU A;  4MKP A;  3WFP A;  4O5E A;  2ZH2 A;  2W9M A;  4FH3 A;  4XUS A;  4FO6 A;  4MFC A;  1PX5 A;  4K9A A;  2BBH A;  7ICK A;  4YMN A;  4XA5 A;  3NVO A;  4IQV A;  5DB9 A;  4TUP A;  5HRH A;  4YN4 A;  5HRB A;  2P66 A;  4O6A A;  3CK6 A;  4LVS A;  9ICR A;  4PPX A;  4ATB B;  4I2G A;  4KLD A;  5B3P A;  4IQW A;  3MDA A;  3LQC B;  3OV7 A;  4AT8 A;  3V72 A;  4N7R A;  4Z6D A;  4E8F A;  5D62 A;  4R64 A;  3HX0 A;  2RFF A;  8ICG A;  5CHE A;  2M2T A;  1ZJN A;  2IHM A;  3UQ2 A;  4QZE A;  4O68 A;  4QZF A;  8ICP A;  1JQR A;  1ZQB A;  2EWR A;  1JMS A;  8ICL A;  5HHH A;  4HX0 A;  1MQ2 A;  4DO9 A;  2BCQ A;  4R63 A;  5J0W A;  4RQ8 A;  1MQ3 A;  3WFR E;  2BCV A;  3RH4 A;  4P4O A;  4XQ8 A;  4FO1 A;  4RQ3 A;  4RPY A;  8ICE A;  4UB2 A;  3OVB A;  4EP7 A;  2ZH3 A;  3PNC A;  4RQ5 A;  9ICX A;  3PHZ A;  4IQU A;  5J29 A;  4XJE A;  5J2K A;  4RPZ A;  3RJE A;  5CFT A;  2ISO A;  4M9L A;  4YD2 A;  4K4G A;  4RQ6 A;  8ICB A;  3PMN A;  9ICG A;  3L9D A;  1ZQH A;  2ZHA A;  4RT3 A;  4MFA A;  2PXI A;  1R8A A;  2IUB A;  1KDH A;  2DRB A;  5IIJ A;  1Q78 A;  7ICI A;  4P2H A;  4AT7 B;  4K4I A;  3NYB A;  8ICC A;  8ICA A;  5J0R A;  4NKU A;  3TFR A;  4M9G A;  2GAF D;  2M2V A;  4UAY A;  5CR0 A;  4FHW A;  3RJI A;  4KLQ A;  2ISP A;  3HJ1 A;  7ICU A;  4I29 A;  3RJG A;  4IG8 A;  3JCF A;  3JPS A;  5J2C A;  4WC1 A;  4YCX A;  1TFW A;  2VAN A;  4DOC A;  3HW8 A;  9ICH A;  4UD4 A;  5DKW A;  4I27 A;  8ICO A;  4X4U A;  4FH5 A;  4EED A;  5IIL A;  1ZQP A;  4WQL A;  2DR7 A;  8ICZ A;  1MIY A;  2ZH8 A;  3B0Y A;  5J0T A;  4KLG A;  4XRH A;  1ZQU A;  3C2K A;  7ICJ A;  8ICQ A;  3HWT A;  8ICX A;  4PH5 A;  1ZQM A;  1YLQ A;  1ZQS A;  1JN3 A;  4PGY A;  1ZQD A;  4LEW A;  4QZH A;  4NM1 A;  7ICE A;  4I2B A;  2ZH9 A;  4I2D A;  8ICY A;  4O5K A;  2DRA A;  4RQ7 A;  9ICI A;  4F5O A;  8ICF A;  1RPL A;  3C18 A;  4TUR A;  3UPQ A;  2BCR A;  1BPZ A;  4JWN A;  2ZH6 A;  4QZC A;  3OUY B;  3LK9 A;  3AQM A;  5J0P A;  3WFQ E;  4I0U A;  4UB4 A;  3EF2 A;  3V7J A;  3AU6 A;  4WH5 A;  5HRG A;  2FMS A;  1NO5 A;  2NRK A;  5J0U A;  3OVS A;  5J2D A;  4I2J A;  1MIW A;  1V4A A;  4K4H A;  9ICN A;  4OAI Z;  5DDY A;  2DVI A;  3B0X A;  5DB7 A;  1HUZ A;  9ICT A;  4WC0 A;  7ICS A;  4DOA A;  3UQ0 A;  4M04 A;  9ICQ A;  4K9B A;  2BPF A;  5HR9 A;  1ZQC A;  2GWS A;  3OGU A;  3RH6 A;  4YD1 A;  2BBJ A;  5HRF A;  9ICC A;  4EBJ A;  9ICB A;  3H37 A;  5J2H A;  3RJK A;  9ICA A;  5J0X A;  3NKU A;  2ZH5 A;  4LZG A;  4I2A A;  2M2W A;  4AT8 B;  5BPC A;  4LT6 A;  3UXP A;  4RWP A;  2ZH4 A;  4WC7 A;  8ICS A;  2B51 A;  3RJF A;  1OU5 A;  4EV6 A;  4KB6 A;  2FCL A;  2ID1 A;  8ICI A;  4EGW A;  1ZQF A;  4PHP A;  7ICR A;  5HRI A;  3C5F A;  2BCS A;  3JPR A;  5IIM A;  4NLN A;  8ICJ A;  4Z6E A;  4KLE A;  9ICP A;  3C66 A;  4KLJ A;  4FHX A;  4X4R A;  1R8C A;  4PHA A;  1ZQT A;  5DEC A;  9ICF A;  4R66 A;  8ICT A;  4RT2 A;  1ZQR A;  5F2V O;  4UAZ A;  1ZQA A;  2I9G A;  5BOM A;  3V7K A;  3OVA A;  4PHD A;  3AUO A;  9ICE A;  1BPD A;  4LEZ A;  2M2U A;  4KLL A;  4IQT A;  3AU2 A;  2HHP A;  4OAH A;  5HHI A;  2PFQ A;  4OAF A;  4NXW A;  2ZH1 A;  4KLH A;  4GXK A;  4E7X A;  4RQ2 A;  3JPO A;  4X4S A;  4KLI A;  4F5N A;  1R8B A;  4FHY A;  4RQ1 A;  4X5V A;  4X4T A;  3TFS A;  1GPJ A;  1KEJ A;  4RWN A;  1ZQL A;  1TV9 A;  4S3N A;  5EOZ A;  5J0Y A;  7ICL A;  4K8V A;  4QZI A;  3JPQ A;  4WC2 A;  3AQL A;  8ICN A;  4NLK A;  1NOM A;  5DBB A;  5CHG A;  4I28 A;  2PFO A;  4AT9 A;  2BCU A;  1UET A;  2BE3 A;  5IIN A;  2ZHB A;  4KLM A;  4PGX A;  3JZ0 A;  4YMM A;  4X4N A;  5D4B A;  4KLT A;  1WOT A;  5TZV A;  3AQN A;  4LEV A;  3JYY A;  2ZH7 A;  4UB1 A;  7ICG A;  4RWQ A;  2BPC A;  9ICW A;  5D61 A;  4O9M A;  1KNY A;  5CFS A;  3ISB A;  1TFY A;  5B3Q A;  1XSP A;  3OWG A;  4NXV A;  3H38 A;  4X4O A;  3C2M A;  7ICQ A;  4R65 A;  5DED A;  4TUQ A;  4DOB A;  5III A;  1ZQE A;  3H3A A;  4I2I A;  4P4P A;  4FHV A;  3UXO A;  4X0A A;  4QZ8 A;  2B4V A;  4UAW A;  3HIY A;  3ER9 B;  4M2Y A;  4M0A A;  5DBC A;  4QZ9 A;  4GXI A;  1ZQQ A;  5CA7 A;  1FA0 A;  4Z6C A;  1JAJ A;  1UEU A;  2FMP A;  5J2B A;  8ICH A;  3ERC C;  7ICF A;  9ICL A;  1VJ7 A;  3JPP A;  4WC4 A;  3RJH A;  4QZB A;  5D63 A;  4MF8 A;  4UB5 A;  4I2H A;  2O1P A;  4ATB A;  3MDC A;  7ICM A;  4NY8 A;  2FMQ A;  1XSL A;  1Q79 A;  4NXX A;  1BPX A;  4M9J A;  4EEB A;  3ISC A;  1ZQW A;  3WFO A;  9ICS A;  2IHO A;  1ZQG A;  3RJJ A;  4JLX A;  4WCW A;  4I2E A;  5CFU A;  5DB8 A;  4M47 A;  4YMO A;  4MFF A;  5J0Q A;  8ICU A;  4O67 A;  3UPS A;  3V7L A;  4WC6 A;  9ICO A;  1F5A A;  8ICK A;  4LEY A;  5HRL A;  7ICO A;  5HRE A;  2O5A A;  1ZQI A;  4KLF A;  3MBY A;  1ZQX A; 
#chains in the Genus database with same CATH homology
 4X4V A;  4UBC A;  9ICV A;  1XSN A;  3UXN A;  5CB1 A;  1BPB A;  2PFP A;  5J2I A;  5IIO A;  4F5R A;  5HC9 A;  4X0B A;  2DR9 A;  4KLS A;  3WFS C;  4UD5 A;  1UEV A;  4LZD A;  7ICH A;  4P4M A;  3H39 A;  1R89 A;  4WBZ A;  7ICT A;  4I2C A;  4M5D A;  4RQ4 A;  9ICK A;  1VFG A;  3AQK A;  2Q66 A;  5J2E A;  7ICN A;  2PFN A;  5D46 A;  5J0S A;  3HJ4 A;  4M9H A;  4RWO A;  5HRD A;  4AT7 A;  5DDM A;  4WC5 A;  8ICW A;  5CP2 A;  3PML A;  3JPN A;  1ZJM A;  5HRK A;  2DR5 A;  1ZQN A;  9ICU A;  1MIV A;  5J2A A;  4NKT A;  4X4Q A;  1ZQK A;  9ICM A;  5DB6 A;  4PGQ A;  4QZG A;  2PBE A;  4I2F A;  4F5Q A;  4AT9 B;  5J2G A;  1HUO A;  4KLO A;  4RQ0 A;  5J2J A;  3ISD A;  9ICJ A;  1RZT A;  4E80 A;  4F5P A;  4QZD A;  5CWR A;  7ICP A;  3C2L A;  4X4P A;  4UBB A;  4UB3 A;  4NXZ A;  5D49 A;  4QZA A;  4WC3 A;  3JPT A;  4NLZ A;  1BPE A;  3K75 D;  3GDX A;  4Z6F A;  1ZQO A;  4RPX A;  5BOL A;  1ZQY A;  8ICM A;  3MGI A;  1BPY A;  4XQ7 A;  2DR8 A;  1ZQZ A;  3OUY A;  1ZQJ A;  4WBY A;  4PHE A;  1ZQV A;  2BPG A;  8ICV A;  5CJ7 A;  8ICR A;  4EBK A;  5J0O A;  5IIK A;  4TUS A;  1TVA A;  3MGH A;  4JWM A;  3RH5 A;  4GXJ A;  4M9N A;  7ICV A;  3C5G A;  4FHP A;  4O5C A;  5DBA A;  4NM2 A;  5J2F A;  4MF2 A;  4KLU A;  3WFP A;  4O5E A;  2ZH2 A;  4FH3 A;  2W9M A;  4XUS A;  4FO6 A;  4MFC A;  1PX5 A;  7ICK A;  4YMN A;  4XA5 A;  4IQV A;  4TUP A;  5DB9 A;  5HRH A;  4YN4 A;  5HRB A;  2P66 A;  4LVS A;  9ICR A;  4PPX A;  4ATB B;  4I2G A;  4KLD A;  4IQW A;  3MDA A;  3LQC B;  3OV7 A;  4AT8 A;  3V72 A;  4Z6D A;  4E8F A;  4R64 A;  3HX0 A;  2RFF A;  8ICG A;  2M2T A;  1ZJN A;  2IHM A;  3UQ2 A;  4QZE A;  4QZF A;  8ICP A;  1JQR A;  1ZQB A;  8ICL A;  1JMS A;  5HHH A;  1MQ2 A;  4DO9 A;  2BCQ A;  4R63 A;  5J0W A;  4RQ8 A;  1MQ3 A;  3WFR E;  2BCV A;  3RH4 A;  4P4O A;  4XQ8 A;  4RQ3 A;  4RPY A;  8ICE A;  4UB2 A;  3PNC A;  4EP7 A;  2ZH3 A;  3OVB A;  4RQ5 A;  9ICX A;  4IQU A;  5J29 A;  5J2K A;  4RPZ A;  3RJE A;  2ISO A;  4M9L A;  4YD2 A;  4K4G A;  4RQ6 A;  8ICB A;  3PMN A;  9ICG A;  3L9D A;  1ZQH A;  2ZHA A;  4RT3 A;  4MFA A;  2PXI A;  1R8A A;  1KDH A;  2DRB A;  5IIJ A;  1Q78 A;  7ICI A;  4P2H A;  4AT7 B;  4K4I A;  3NYB A;  8ICC A;  8ICA A;  5J0R A;  4NKU A;  3TFR A;  4M9G A;  2M2V A;  4UAY A;  5CR0 A;  4FHW A;  3RJI A;  4KLQ A;  2ISP A;  3HJ1 A;  7ICU A;  4I29 A;  3RJG A;  4IG8 A;  3JPS A;  5J2C A;  4WC1 A;  4YCX A;  2VAN A;  1TFW A;  4DOC A;  3HW8 A;  9ICH A;  4UD4 A;  5DKW A;  4I27 A;  8ICO A;  4X4U A;  4FH5 A;  5IIL A;  1ZQP A;  2DR7 A;  8ICZ A;  1MIY A;  2ZH8 A;  3B0Y A;  5J0T A;  4KLG A;  4XRH A;  1ZQU A;  3C2K A;  7ICJ A;  8ICQ A;  3HWT A;  8ICX A;  4PH5 A;  1ZQM A;  1YLQ A;  1ZQS A;  1JN3 A;  4PGY A;  1ZQD A;  4QZH A;  4NM1 A;  7ICE A;  4I2B A;  2ZH9 A;  4I2D A;  8ICY A;  4O5K A;  2DRA A;  4RQ7 A;  9ICI A;  4F5O A;  8ICF A;  1RPL A;  3C18 A;  4TUR A;  3UPQ A;  2BCR A;  1BPZ A;  4JWN A;  2ZH6 A;  4QZC A;  3OUY B;  3LK9 A;  3AQM A;  5J0P A;  3WFQ E;  4UB4 A;  3V7J A;  3AU6 A;  5HRG A;  2FMS A;  1NO5 A;  2NRK A;  5J0U A;  3OVS A;  5J2D A;  4I2J A;  1MIW A;  1V4A A;  4K4H A;  9ICN A;  5DDY A;  2DVI A;  3B0X A;  5DB7 A;  1HUZ A;  9ICT A;  4WC0 A;  7ICS A;  4DOA A;  3UQ0 A;  4M04 A;  9ICQ A;  2BPF A;  5HR9 A;  1ZQC A;  2GWS A;  3OGU A;  3RH6 A;  4YD1 A;  5HRF A;  9ICC A;  4EBJ A;  9ICB A;  3H37 A;  5J2H A;  3RJK A;  9ICA A;  5J0X A;  2ZH5 A;  4LZG A;  4I2A A;  2M2W A;  4AT8 B;  5BPC A;  4LT6 A;  3UXP A;  4RWP A;  2ZH4 A;  4WC7 A;  8ICS A;  3RJF A;  1OU5 A;  8ICI A;  2ID1 A;  1ZQF A;  4PHP A;  7ICR A;  5HRI A;  3C5F A;  2BCS A;  3JPR A;  5IIM A;  4NLN A;  8ICJ A;  4Z6E A;  4KLE A;  9ICP A;  3C66 A;  4KLJ A;  4FHX A;  4X4R A;  1R8C A;  4PHA A;  1ZQT A;  5DEC A;  9ICF A;  4R66 A;  8ICT A;  4RT2 A;  1ZQR A;  5F2V O;  4UAZ A;  1ZQA A;  2I9G A;  5BOM A;  3V7K A;  4PHD A;  3OVA A;  3AUO A;  9ICE A;  1BPD A;  4KLL A;  2M2U A;  4IQT A;  3AU2 A;  2HHP A;  5HHI A;  2PFQ A;  2ZH1 A;  4KLH A;  4GXK A;  4E7X A;  4RQ2 A;  3JPO A;  4X4S A;  4KLI A;  4F5N A;  1R8B A;  4FHY A;  4RQ1 A;  4X5V A;  4X4T A;  3TFS A;  1KEJ A;  4RWN A;  1ZQL A;  1TV9 A;  4S3N A;  5EOZ A;  5J0Y A;  7ICL A;  4QZI A;  3JPQ A;  4WC2 A;  3AQL A;  8ICN A;  4NLK A;  1NOM A;  5DBB A;  5CHG A;  4I28 A;  2PFO A;  4AT9 A;  2BCU A;  1UET A;  2BE3 A;  5IIN A;  2ZHB A;  4KLM A;  4PGX A;  3JZ0 A;  4YMM A;  5D4B A;  4X4N A;  4KLT A;  1WOT A;  5TZV A;  3AQN A;  3JYY A;  2ZH7 A;  4UB1 A;  7ICG A;  4RWQ A;  2BPC A;  9ICW A;  4O9M A;  1KNY A;  3ISB A;  1XSP A;  1TFY A;  3H38 A;  4X4O A;  3C2M A;  7ICQ A;  4R65 A;  5DED A;  4TUQ A;  4DOB A;  5III A;  1ZQE A;  3H3A A;  4I2I A;  4P4P A;  4FHV A;  3UXO A;  4X0A A;  4QZ8 A;  4UAW A;  3HIY A;  4M2Y A;  4M0A A;  5DBC A;  4QZ9 A;  4GXI A;  1ZQQ A;  5CA7 A;  1FA0 A;  4Z6C A;  1JAJ A;  1UEU A;  2FMP A;  5J2B A;  8ICH A;  7ICF A;  9ICL A;  1VJ7 A;  3JPP A;  4WC4 A;  3RJH A;  4QZB A;  4MF8 A;  4UB5 A;  4I2H A;  2O1P A;  4ATB A;  3MDC A;  7ICM A;  4NY8 A;  2FMQ A;  1XSL A;  1Q79 A;  1BPX A;  4M9J A;  3ISC A;  1ZQW A;  3WFO A;  9ICS A;  1ZQG A;  3RJJ A;  4WCW A;  4I2E A;  5DB8 A;  4M47 A;  4YMO A;  4MFF A;  5J0Q A;  8ICU A;  3UPS A;  3V7L A;  4WC6 A;  9ICO A;  1F5A A;  8ICK A;  5HRL A;  7ICO A;  5HRE A;  2O5A A;  1ZQI A;  4KLF A;  3MBY A;  1ZQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...