4S3NA

Crystal structure of human oas3 domain i in complex with dsrna
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
359
structure length
343
Chain Sequence
MDLYSTPAAALDRFVARKLQPRKEFVEKARRALGALAAALRERPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2'-5'-oligoadenylate synthase 3
publication title Structural mechanism of sensing long dsRNA via a noncatalytic domain in human oligoadenylate synthetase 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 116
structure length 343
sequence length 359
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10421 OAS1_C 2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4s3nA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4s3nA01
5D4BA 2BPCA 4M9NA 4MF8A 1TFWA 1TVAA 2FMQA 4M9LA 5BPCA 4O5CA 4QZIA 1MQ2A 2BCQA 4I2GA 4YMOA 9ICUA 8ICZA 3JPSA 4KLGA 2W9MA 5DBAA 1UEVA 2ZH3A 4KLFA 4RQ7A 5J2CA 4WC7A 3RH5A 5CWRA 4RWPA 4RPXA 1HUZA 9ICBA 4RQ3A 5J2DA 4PHPA 4FO6A 5J2KA 3JPRA 2PFQA 1NO5A 9ICIA 4I2IA 8ICPA 4TURA 1JAJA 4XUSA 3OUYB 2DR7A 4I28A 4UAWA 4RWOA 2BCRA 7ICJA 4K4IA 4WC1A 5IILA 4Z6CA 5HRKA 1UEUA 4JWMA 5J2GA 8ICJA 4IQVA 3RJFA 4F5RA 4RQ4A 5DDYA 1ZQZA 4YN4A 4RQ1A 4UB3A 3NYBA 4I2BA 5J0UA 4P2HA 2VANA 4KLDA 2RFFA 4I2EA 2ZH6A 7ICQA 2DR8A 4XQ8A 4RPYA 3C18A 9ICAA 4IQTA 4UBCA 3MGHA 2O1PA 1BPZA 4DO9A 1R8CA 4WCWA 4AT9B 4PPXA 5DEDA 8ICWA 3RJGA 1BPDA 4KLMA 4M2YA 4AT8B 4KLTA 3C2LA 3JZ0A 4Z6EA 4EBKA 4KLIA 8ICXA 5CA7A 4YCXA 9ICHA 1KEJA 4R65A 5CB1A 4RQ8A 5IINA 4I2HA 4PHEA 3OVBA 3RJIA 4MFFA 5DB6A 4EBJA 5J29A 3AQMA 4FHPA 3V7JA 9ICWA 5J0RA 8ICNA 3JPQA 4NLNA 4YMMA 5HC9A 5HHHA 8ICYA 5DBBA 8ICLA 7ICGA 5J0PA 4MF2A 4AT9A 2Q66A 8ICTA 4UB5A 4KLUA 4AT7A 3PMNA 1JN3A 1WOTA 5J0TA 4XRHA 3RH6A 3TFSA 1HUOA 1FA0A 2DR9A 3HJ4A 7ICUA 2M2UA 4IQUA 1R8AA 8ICBA 3H39A 1MIYA 4TUSA 1F5AA 3RJEA 4O5KA 1XSPA 3V72A 8ICGA 3K75D 4PHAA 2DR5A 2FMPA 8ICUA 1XSNA 1NOMA 1KDHA 4KLOA 4KLHA 4E7XA 3AUOA 9ICQA 4K4HA 3AQLA 1JQRA 1KNYA 4O5EA 8ICAA 3AQKA 8ICIA 3AU2A 4F5OA 4RT2A 4RWNA 1ZQIA 3WFSC 4WBZA 5J2JA 3AQNA 3WFOA 5J0SA 3UQ2A 3MDCA 1ZQDA 4NLZA 2ZH4A 7ICLA 5HHIA 5DKWA 3UPSA 3C2KA 5J0QA 3LQCB 4WC5A 2IHMA 1ZQYA 9ICTA 2M2WA 1V4AA 4NM2A 2P66A 5DECA 4NY8A 8ICEA 7ICRA 5HRBA 3RJJA 9ICOA 4RQ6A 7ICIA 1ZQFA 2ZH9A 4UB4A 3L9DA 7ICOA 5DB7A 1VJ7A 5HRDA 2BPGA 4DOCA 1BPEA 4KLEA 4EP7A 5EOZA 1R8BA 4X5VA 4YMNA 3HIYA 3B0YA 4E8FA 4RQ0A 4QZ9A 1XSLA 4WC4A 4FHYA 4ATBB 4X4TA 4M5DA 4LZDA 3C5FA 4X0AA 1ZQJA 3OUYA 1YLQA 4I2AA 8ICRA 2DRAA 2PFPA 4E80A 4PGXA 5J2EA 4X4RA 5F2VO 4MFAA 4DOBA 5J0WA 4RQ5A 4QZAA 4WC3A 1ZQHA 8ICVA 4UB1A 5DB9A 3WFRE 5HREA 3C5GA 4I27A 1ZQOA 3JYYA 3H37A 4PHDA 2NRKA 2O5AA 5DDMA 4UAZA 3OV7A 5TZVA 5HRHA 5CR0A 1ZQCA 3JPTA 5J2FA 2PFNA 1ZQAA 1TFYA 4JWNA 4R63A 2ISOA 4M04A 4F5QA 4KLQA 1Q78A 4LT6A 1MIVA 4X0BA 4QZCA 5D46A 1MIWA 4UD5A 4GXIA 4NKUA 8ICSA 3V7KA 3B0XA 1ZQGA 4AT8A 1ZQSA 2PXIA 3HWTA 9ICEA 9ICNA 5IIMA 4YD1A 3HX0A 1ZQEA 4QZDA 3H38A 4X4UA 4MFCA 2ZH8A 4KLJA 7ICPA 1UETA 4PGYA 3PNCA 4RWQA 4QZ8A 4UBBA 3LK9A 4Z6FA 7ICSA 4XQ7A 1ZQNA 5CJ7A 4QZGA 4TUPA 1ZJNA 9ICMA 9ICJA 4WC0A 9ICSA 1ZQQA 1JMSA 4M47A 8ICQA 4X4PA 1BPYA 4RPZA 7ICHA 1ZQRA 7ICKA 4X4OA 3JPNA 4TUQA 1ZQKA 9ICXA 2BCVA 3OVAA 2ZHAA 4I2FA 1R89A 4KLSA 1ZQTA 4NM1A 3AU6A 4IQWA 4RT3A 2BCSA 4X4VA 2BPFA 3H3AA 5J0YA 4WC2A 4IG8A 4KLLA 8ICKA 1BPBA 3UXOA 3ISDA 5HRIA 2ZH5A 1MQ3A 8ICOA 9ICCA 4FH3A 9ICPA 4FHXA 3JPOA 7ICVA 3V7LA 3JPPA 5IIOA 4I2CA 3WFPA 2ZH7A 2PFOA 8ICMA 5HRGA 4M9GA 7ICEA 4I2DA 5J2AA 1RZTA 2DRBA 4UB2A 2ZHBA 4GXJA 4QZFA 9ICVA 3GDXA 2DVIA 5J0OA 3C2MA 4WBYA 4M0AA 5HRLA 4UAYA 4FHWA 2FMSA 5HRFA 4P4OA 4GXKA 7ICTA 2GWSA 3UQ0A 4F5NA 4PH5A 2HHPA 4P4MA 2ISPA 5J2HA 3C66A 4UD4A 4WC6A 1VFGA 4P4PA 3MDAA 5CP2A 3OVSA 3UPQA 2ZH1A 1ZQPA 5IIKA 1ZQBA 1ZQLA 3MBYA 8ICHA 2BCUA 1TV9A 4R66A 5IIJA 5BOLA 5IIIA 4I2JA 4M9JA 2ID1A 1ZQXA 2PBEA 3HJ1A 3OGUA 5J2IA 5D49A 5HR9A 1ZQWA 1ZQMA 3PMLA 5DB8A 7ICFA 1RPLA 8ICFA 5CHGA 4YD2A 3MGIA 4FH5A 4X4NA 4AT7B 4K4GA 4Z6DA 3TFRA 1OU5A 1ZQVA 3ISCA 4NXZA 3RJHA 4ATBA 1ZQUA 2M2TA 4PGQA 3HW8A 5BOMA 3RJKA 4QZBA 4NLKA 3WFQE 4R64A 9ICRA 1BPXA 2ZH2A 4O9MA 1Q79A 9ICFA 4DOAA 8ICCA 4S3NA 1PX5A 5J0XA 4M9HA 4QZEA 3ISBA 3UXNA 4RQ2A 7ICNA 4X4SA 4X4QA 9ICGA 4LVSA 9ICKA 9ICLA 4LZGA 7ICMA 4QZHA 4NKTA 4F5PA 5J2BA 5DBCA 2I9GA 3RH4A 1ZJMA 2M2VA 3UXPA 4FHVA 4I29A 2BE3A 4XA5A
chains in the Genus database with same CATH superfamily
5D4BA 2BPCA 4M9NA 4MF8A 1TFWA 1TVAA 2FMQA 4M9LA 5BPCA 4OAFA 4O5CA 4QZIA 4LEVA 1MQ2A 2BCQA 4I2GA 2HN2A 4YMOA 9ICUA 8ICZA 3EF2A 3JPSA 4KLGA 2W9MA 5DBAA 1UEVA 4NXWA 2ZH3A 4KLFA 4RQ7A 5J2CA 4WC7A 3RH5A 5CWRA 4I0UA 4RWPA 4RPXA 1HUZA 9ICBA 4RQ3A 5J2DA 2BBHA 5B3PA 4PHPA 4FO6A 2GA9D 5J2KA 3JPRA 2PFQA 1NO5A 9ICIA 4I2IA 8ICPA 4TURA 1JAJA 3OUYB 4MKPA 4XUSA 2DR7A 4I28A 4UAWA 4RWOA 2BCRA 7ICJA 4K4IA 4WC1A 5IILA 2BBJA 4Z6CA 5HRKA 1UEUA 4JLXA 5CFUA 4JWMA 5J2GA 8ICJA 4IQVA 3RJFA 2IHOA 4F5RA 4HX0A 4RQ4A 5DDYA 1ZQZA 4YN4A 4RQ1A 4UB3A 3NYBA 4I2BA 4N7RA 5J0UA 4P2HA 4OAGA 2VANA 4FO1A 4KLDA 2RFFA 4I2EA 2ZH6A 7ICQA 2DR8A 4XQ8A 4RPYA 3C18A 9ICAA 4IQTA 4UBCA 3MGHA 2O1PA 1BPZA 4DO9A 1R8CA 4AT9B 4WCWA 4PPXA 5DEDA 8ICWA 3RJGA 1BPDA 4KLMA 2GAFD 4M2YA 4AT8B 3PHZA 4KLTA 3C2LA 3JZ0A 5CHEA 4Z6EA 4EBKA 4KLIA 8ICXA 5CA7A 4YCXA 9ICHA 1KEJA 4R65A 5CB1A 4RQ8A 5D61A 5IINA 4I2HA 4PHEA 2EWRA 3OVBA 3RJIA 4MFFA 5DB6A 4EBJA 4LEZA 5J29A 4FHPA 3AQMA 3V7JA 9ICWA 5J0RA 8ICNA 3JPQA 4NLNA 4YMMA 5HC9A 5HHHA 8ICYA 5DBBA 8ICLA 7ICGA 4WH5A 5J0PA 2Q66A 4AT9A 4MF2A 8ICTA 4UB5A 3NKUA 4KLUA 4AT7A 2FCLA 3PMNA 1JN3A 1WOTA 5J0TA 4XRHA 3RH6A 3JCFA 3TFSA 1HUOA 1FA0A 2DR9A 3HJ4A 7ICUA 2M2UA 4IQUA 1R8AA 8ICBA 3H39A 1MIYA 4TUSA 4K9AA 1F5AA 4NXXA 3RJEA 4O5KA 1XSPA 3V72A 8ICGA 3K75D 4XJEA 4PHAA 2DR5A 2FMPA 8ICUA 1XSNA 1NOMA 1KDHA 4KLOA 4KLHA 4E7XA 3AUOA 9ICQA 4K4HA 3AQLA 1JQRA 1KNYA 4O5EA 5CFTA 8ICAA 3AQKA 8ICIA 3AU2A 4F5OA 4RT2A 4O67A 3ERCC 4RWNA 1ZQIA 3WFSC 4WBZA 5J2JA 3AQNA 3WFOA 5J0SA 3UQ2A 3MDCA 4EEDA 5B3QA 1ZQDA 4JLZA 4NLZA 2ZH4A 7ICLA 5HHIA 4O68A 5DKWA 3UPSA 3C2KA 3NWIA 5J0QA 3LQCB 4WC5A 2IHMA 5JTGA 1ZQYA 9ICTA 4LEYA 3CK6A 2M2WA 1V4AA 4NM2A 2P66A 5DECA 4NY8A 8ICEA 7ICRA 5HRBA 3RJJA 9ICOA 4RQ6A 7ICIA 1ZQFA 2ZH9A 4UB4A 3L9DA 7ICOA 5DB7A 1VJ7A 5HRDA 2BPGA 4DOCA 1BPEA 4KLEA 4EP7A 5EOZA 1R8BA 4K96A 4X5VA 4YMNA 3HIYA 4E8FA 3B0YA 4RQ0A 4QZ9A 4OAIZ 1XSLA 4WC4A 4FHYA 4ATBB 4X4TA 4M5DA 4LZDA 3C5FA 4X0AA 1ZQJA 5D63A 3OUYA 4K98A 1YLQA 4I2AA 8ICRA 2DRAA 2PFPA 4WQLA 4NXVA 4E80A 4PGXA 5J2EA 4X4RA 5F2VO 4MFAA 4DOBA 5J0WA 4RQ5A 4QZAA 4WC3A 1ZQHA 8ICVA 4NXUA 4UB1A 5DB9A 4NXTA 3WFRE 5HREA 3C5GA 4I27A 1ZQOA 3JYYA 3H37A 4PHDA 2NRKA 2O5AA 3OV7A 5DDMA 4UAZA 4EGWA 5TZVA 5HRHA 3ER9B 5CR0A 1ZQCA 3JPTA 5J2FA 2PFNA 1TFYA 1ZQAA 4JWNA 4R63A 2ISOA 4M04A 4F5QA 4KLQA 1Q78A 4LT6A 1MIVA 4X0BA 4QZCA 5D46A 4UD5A 1MIWA 4GXIA 3MCRA 4K8VA 4NKUA 8ICSA 3V7KA 3B0XA 1ZQGA 4AT8A 1ZQSA 2PXIA 3HWTA 9ICEA 9ICNA 5IIMA 4YD1A 3HX0A 1ZQEA 4QZDA 4KM5A 3H38A 4X4UA 4EV6A 4MFCA 2ZH8A 4KLJA 7ICPA 1UETA 4PGYA 3PNCA 4RWQA 4O6AA 4QZ8A 4UBBA 3LK9A 4Z6FA 7ICSA 4XQ7A 4OAHA 1ZQNA 5CJ7A 4QZGA 4TUPA 1ZJNA 9ICMA 9ICJA 4WC0A 2B4VA 1ZQQA 1JMSA 4M47A 9ICSA 8ICQA 4X4PA 1BPYA 1GPJA 4RPZA 7ICHA 1ZQRA 7ICKA 4X4OA 3K7DA 3JPNA 4TUQA 1ZQKA 3OWGA 9ICXA 2BCVA 3OVAA 2ZHAA 4I2FA 1R89A 4KLSA 1ZQTA 4NM1A 3AU6A 4IQWA 4RT3A 4X4VA 2BCSA 2BPFA 3H3AA 5J0YA 4WC2A 4IG8A 4KLLA 8ICKA 1BPBA 3UXOA 3ISDA 5HRIA 2ZH5A 1MQ3A 8ICOA 9ICCA 4FH3A 9ICPA 4FHXA 3JPOA 7ICVA 3V7LA 3JPPA 5IIOA 4I2CA 3WFPA 2B51A 2ZH7A 2PFOA 8ICMA 5HRGA 4M9GA 7ICEA 4I2DA 2DRBA 5J2AA 1RZTA 4UB2A 2ZHBA 4GXJA 4QZFA 9ICVA 2DVIA 3GDXA 4KB6A 5J0OA 3C2MA 4WBYA 3ER8C 4M0AA 5HRLA 4UAYA 4FHWA 2FMSA 5HRFA 4P4OA 4GXKA 7ICTA 2GWSA 3UQ0A 4F5NA 4PH5A 2HHPA 4P4MA 2ISPA 5J2HA 3C66A 4UD4A 4WC6A 2HN1A 1VFGA 4P4PA 3MDAA 5CP2A 3OVSA 3UPQA 2ZH1A 1ZQPA 5IIKA 4EEBA 1ZQBA 1ZQLA 4WQKA 3MBYA 8ICHA 2BCUA 1TV9A 4R66A 5IIJA 5BOLA 5IIIA 4I2JA 4M9JA 2ID1A 1ZQXA 2PBEA 3HJ1A 3OGUA 5J2IA 5D49A 5HR9A 1ZQWA 1ZQMA 3PMLA 5DB8A 7ICFA 1RPLA 8ICFA 5CHGA 4YD2A 3MGIA 4FH5A 4X4NA 4AT7B 4K4GA 4Z6DA 3TFRA 4K97A 1OU5A 1ZQVA 3ISCA 4NXZA 3RJHA 4ATBA 1ZQUA 2M2TA 4PGQA 3HW8A 5BOMA 4K9BA 4QZBA 3RJKA 3WFQE 4R64A 4NLKA 4K99A 9ICRA 1BPXA 2ZH2A 4O9MA 1Q79A 9ICFA 4O69A 4DOAA 8ICCA 5CFSA 4S3NA 1PX5A 5J0XA 4M9HA 4QZEA 3ISBA 3UXNA 4RQ2A 7ICNA 4X4SA 4WOYA 2B56A 4X4QA 9ICGA 2IUBA 4LVSA 9ICKA 9ICLA 4LZGA 7ICMA 4QZHA 4NKTA 4F5PA 5J2BA 5D62A 5DBCA 2I9GA 3RH4A 1ZJMA 2M2VA 3UXPA 4FHVA 4I29A 4LEWA 3NVOA 2BE3A 4XA5A
chains in the Genus database with same CATH topology
5D4BA 2BPCA 4M9NA 4MF8A 1TFWA 1TVAA 2FMQA 4M9LA 5BPCA 4O5CA 4QZIA 1MQ2A 2BCQA 4I2GA 4YMOA 9ICUA 8ICZA 3JPSA 4KLGA 2W9MA 5DBAA 1UEVA 2ZH3A 4KLFA 4RQ7A 5J2CA 4WC7A 3RH5A 5CWRA 4RWPA 4RPXA 1HUZA 9ICBA 4RQ3A 5J2DA 4PHPA 4FO6A 5J2KA 3JPRA 2PFQA 1NO5A 9ICIA 4I2IA 8ICPA 4TURA 1JAJA 4XUSA 3OUYB 2DR7A 4I28A 4UAWA 4RWOA 2BCRA 7ICJA 4K4IA 4WC1A 5IILA 4Z6CA 5HRKA 1UEUA 4JWMA 5J2GA 8ICJA 4IQVA 3RJFA 4F5RA 4RQ4A 5DDYA 1ZQZA 4YN4A 4RQ1A 4UB3A 3NYBA 4I2BA 5J0UA 4P2HA 2VANA 4KLDA 2RFFA 4I2EA 2ZH6A 7ICQA 2DR8A 4XQ8A 4RPYA 3C18A 9ICAA 4IQTA 4UBCA 3MGHA 2O1PA 1BPZA 4DO9A 1R8CA 4WCWA 4AT9B 4PPXA 5DEDA 8ICWA 3RJGA 1BPDA 4KLMA 4M2YA 4AT8B 4KLTA 3C2LA 3JZ0A 4Z6EA 4EBKA 4KLIA 8ICXA 5CA7A 4YCXA 9ICHA 1KEJA 4R65A 5CB1A 4RQ8A 5IINA 4I2HA 4PHEA 3OVBA 3RJIA 4MFFA 5DB6A 4EBJA 5J29A 3AQMA 4FHPA 3V7JA 9ICWA 5J0RA 8ICNA 3JPQA 4NLNA 4YMMA 5HC9A 5HHHA 8ICYA 5DBBA 8ICLA 7ICGA 5J0PA 4MF2A 4AT9A 2Q66A 8ICTA 4UB5A 4KLUA 4AT7A 3PMNA 1JN3A 1WOTA 5J0TA 4XRHA 3RH6A 3TFSA 1HUOA 1FA0A 2DR9A 3HJ4A 7ICUA 2M2UA 4IQUA 1R8AA 8ICBA 3H39A 1MIYA 4TUSA 1F5AA 3RJEA 4O5KA 1XSPA 3V72A 8ICGA 3K75D 4PHAA 2DR5A 2FMPA 8ICUA 1XSNA 1NOMA 1KDHA 4KLOA 4KLHA 4E7XA 3AUOA 9ICQA 4K4HA 3AQLA 1JQRA 1KNYA 4O5EA 8ICAA 3AQKA 8ICIA 3AU2A 4F5OA 4RT2A 4RWNA 1ZQIA 3WFSC 4WBZA 5J2JA 3AQNA 3WFOA 5J0SA 3UQ2A 3MDCA 1ZQDA 4NLZA 2ZH4A 7ICLA 5HHIA 5DKWA 3UPSA 3C2KA 5J0QA 3LQCB 4WC5A 2IHMA 1ZQYA 9ICTA 2M2WA 1V4AA 4NM2A 2P66A 5DECA 4NY8A 8ICEA 7ICRA 5HRBA 3RJJA 9ICOA 4RQ6A 7ICIA 1ZQFA 2ZH9A 4UB4A 3L9DA 7ICOA 5DB7A 1VJ7A 5HRDA 2BPGA 4DOCA 1BPEA 4KLEA 4EP7A 5EOZA 1R8BA 4X5VA 4YMNA 3HIYA 3B0YA 4E8FA 4RQ0A 4QZ9A 1XSLA 4WC4A 4FHYA 4ATBB 4X4TA 4M5DA 4LZDA 3C5FA 4X0AA 1ZQJA 3OUYA 1YLQA 4I2AA 8ICRA 2DRAA 2PFPA 4E80A 4PGXA 5J2EA 4X4RA 5F2VO 4MFAA 4DOBA 5J0WA 4RQ5A 4QZAA 4WC3A 1ZQHA 8ICVA 4UB1A 5DB9A 3WFRE 5HREA 3C5GA 4I27A 1ZQOA 3JYYA 3H37A 4PHDA 2NRKA 2O5AA 5DDMA 4UAZA 3OV7A 5TZVA 5HRHA 5CR0A 1ZQCA 3JPTA 5J2FA 2PFNA 1ZQAA 1TFYA 4JWNA 4R63A 2ISOA 4M04A 4F5QA 4KLQA 1Q78A 4LT6A 1MIVA 4X0BA 4QZCA 5D46A 1MIWA 4UD5A 4GXIA 4NKUA 8ICSA 3V7KA 3B0XA 1ZQGA 4AT8A 1ZQSA 2PXIA 3HWTA 9ICEA 9ICNA 5IIMA 4YD1A 3HX0A 1ZQEA 4QZDA 3H38A 4X4UA 4MFCA 2ZH8A 4KLJA 7ICPA 1UETA 4PGYA 3PNCA 4RWQA 4QZ8A 4UBBA 3LK9A 4Z6FA 7ICSA 4XQ7A 1ZQNA 5CJ7A 4QZGA 4TUPA 1ZJNA 9ICMA 9ICJA 4WC0A 9ICSA 1ZQQA 1JMSA 4M47A 8ICQA 4X4PA 1BPYA 4RPZA 7ICHA 1ZQRA 7ICKA 4X4OA 3JPNA 4TUQA 1ZQKA 9ICXA 2BCVA 3OVAA 2ZHAA 4I2FA 1R89A 4KLSA 1ZQTA 4NM1A 3AU6A 4IQWA 4RT3A 2BCSA 4X4VA 2BPFA 3H3AA 5J0YA 4WC2A 4IG8A 4KLLA 8ICKA 1BPBA 3UXOA 3ISDA 5HRIA 2ZH5A 1MQ3A 8ICOA 9ICCA 4FH3A 9ICPA 4FHXA 3JPOA 7ICVA 3V7LA 3JPPA 5IIOA 4I2CA 3WFPA 2ZH7A 2PFOA 8ICMA 5HRGA 4M9GA 7ICEA 4I2DA 5J2AA 1RZTA 2DRBA 4UB2A 2ZHBA 4GXJA 4QZFA 9ICVA 3GDXA 2DVIA 5J0OA 3C2MA 4WBYA 4M0AA 5HRLA 4UAYA 4FHWA 2FMSA 5HRFA 4P4OA 4GXKA 7ICTA 2GWSA 3UQ0A 4F5NA 4PH5A 2HHPA 4P4MA 2ISPA 5J2HA 3C66A 4UD4A 4WC6A 1VFGA 4P4PA 3MDAA 5CP2A 3OVSA 3UPQA 2ZH1A 1ZQPA 5IIKA 1ZQBA 1ZQLA 3MBYA 8ICHA 2BCUA 1TV9A 4R66A 5IIJA 5BOLA 5IIIA 4I2JA 4M9JA 2ID1A 1ZQXA 2PBEA 3HJ1A 3OGUA 5J2IA 5D49A 5HR9A 1ZQWA 1ZQMA 3PMLA 5DB8A 7ICFA 1RPLA 8ICFA 5CHGA 4YD2A 3MGIA 4FH5A 4X4NA 4AT7B 4K4GA 4Z6DA 3TFRA 1OU5A 1ZQVA 3ISCA 4NXZA 3RJHA 4ATBA 1ZQUA 2M2TA 4PGQA 3HW8A 5BOMA 3RJKA 4QZBA 4NLKA 3WFQE 4R64A 9ICRA 1BPXA 2ZH2A 4O9MA 1Q79A 9ICFA 4DOAA 8ICCA 4S3NA 1PX5A 5J0XA 4M9HA 4QZEA 3ISBA 3UXNA 4RQ2A 7ICNA 4X4SA 4X4QA 9ICGA 4LVSA 9ICKA 9ICLA 4LZGA 7ICMA 4QZHA 4NKTA 4F5PA 5J2BA 5DBCA 2I9GA 3RH4A 1ZJMA 2M2VA 3UXPA 4FHVA 4I29A 2BE3A 4XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D4B A;  2BPC A;  4M9N A;  4MF8 A;  1TFW A;  1TVA A;  2FMQ A;  4M9L A;  5BPC A;  4O5C A;  4QZI A;  1MQ2 A;  2BCQ A;  4I2G A;  4YMO A;  9ICU A;  8ICZ A;  3JPS A;  4KLG A;  2W9M A;  5DBA A;  1UEV A;  2ZH3 A;  4KLF A;  4RQ7 A;  5J2C A;  4WC7 A;  3RH5 A;  5CWR A;  4RWP A;  4RPX A;  1HUZ A;  9ICB A;  4RQ3 A;  5J2D A;  4PHP A;  4FO6 A;  5J2K A;  3JPR A;  2PFQ A;  1NO5 A;  9ICI A;  4I2I A;  8ICP A;  4TUR A;  1JAJ A;  4XUS A;  3OUY B;  2DR7 A;  4I28 A;  4UAW A;  4RWO A;  2BCR A;  7ICJ A;  4K4I A;  4WC1 A;  5IIL A;  4Z6C A;  5HRK A;  1UEU A;  4JWM A;  5J2G A;  8ICJ A;  4IQV A;  3RJF A;  4F5R A;  4RQ4 A;  5DDY A;  1ZQZ A;  4YN4 A;  4RQ1 A;  4UB3 A;  3NYB A;  4I2B A;  5J0U A;  4P2H A;  2VAN A;  4KLD A;  2RFF A;  4I2E A;  2ZH6 A;  7ICQ A;  2DR8 A;  4XQ8 A;  4RPY A;  3C18 A;  9ICA A;  4IQT A;  4UBC A;  3MGH A;  2O1P A;  1BPZ A;  4DO9 A;  1R8C A;  4WCW A;  4AT9 B;  4PPX A;  5DED A;  8ICW A;  3RJG A;  1BPD A;  4KLM A;  4M2Y A;  4AT8 B;  4KLT A;  3C2L A;  3JZ0 A;  4Z6E A;  4EBK A;  4KLI A;  8ICX A;  5CA7 A;  4YCX A;  9ICH A;  1KEJ A;  4R65 A;  5CB1 A;  4RQ8 A;  5IIN A;  4I2H A;  4PHE A;  3OVB A;  3RJI A;  4MFF A;  5DB6 A;  4EBJ A;  5J29 A;  3AQM A;  4FHP A;  3V7J A;  9ICW A;  5J0R A;  8ICN A;  3JPQ A;  4NLN A;  4YMM A;  5HC9 A;  5HHH A;  8ICY A;  5DBB A;  8ICL A;  7ICG A;  5J0P A;  4MF2 A;  4AT9 A;  2Q66 A;  8ICT A;  4UB5 A;  4KLU A;  4AT7 A;  3PMN A;  1JN3 A;  1WOT A;  5J0T A;  4XRH A;  3RH6 A;  3TFS A;  1HUO A;  1FA0 A;  2DR9 A;  3HJ4 A;  7ICU A;  2M2U A;  4IQU A;  1R8A A;  8ICB A;  3H39 A;  1MIY A;  4TUS A;  1F5A A;  3RJE A;  4O5K A;  1XSP A;  3V72 A;  8ICG A;  3K75 D;  4PHA A;  2DR5 A;  2FMP A;  8ICU A;  1XSN A;  1NOM A;  1KDH A;  4KLO A;  4KLH A;  4E7X A;  3AUO A;  9ICQ A;  4K4H A;  3AQL A;  1JQR A;  1KNY A;  4O5E A;  8ICA A;  3AQK A;  8ICI A;  3AU2 A;  4F5O A;  4RT2 A;  4RWN A;  1ZQI A;  3WFS C;  4WBZ A;  5J2J A;  3AQN A;  3WFO A;  5J0S A;  3UQ2 A;  3MDC A;  1ZQD A;  4NLZ A;  2ZH4 A;  7ICL A;  5HHI A;  5DKW A;  3UPS A;  3C2K A;  5J0Q A;  3LQC B;  4WC5 A;  2IHM A;  1ZQY A;  9ICT A;  2M2W A;  1V4A A;  4NM2 A;  2P66 A;  5DEC A;  4NY8 A;  8ICE A;  7ICR A;  5HRB A;  3RJJ A;  9ICO A;  4RQ6 A;  7ICI A;  1ZQF A;  2ZH9 A;  4UB4 A;  3L9D A;  7ICO A;  5DB7 A;  1VJ7 A;  5HRD A;  2BPG A;  4DOC A;  1BPE A;  4KLE A;  4EP7 A;  5EOZ A;  1R8B A;  4X5V A;  4YMN A;  3HIY A;  3B0Y A;  4E8F A;  4RQ0 A;  4QZ9 A;  1XSL A;  4WC4 A;  4FHY A;  4ATB B;  4X4T A;  4M5D A;  4LZD A;  3C5F A;  4X0A A;  1ZQJ A;  3OUY A;  1YLQ A;  4I2A A;  8ICR A;  2DRA A;  2PFP A;  4E80 A;  4PGX A;  5J2E A;  4X4R A;  5F2V O;  4MFA A;  4DOB A;  5J0W A;  4RQ5 A;  4QZA A;  4WC3 A;  1ZQH A;  8ICV A;  4UB1 A;  5DB9 A;  3WFR E;  5HRE A;  3C5G A;  4I27 A;  1ZQO A;  3JYY A;  3H37 A;  4PHD A;  2NRK A;  2O5A A;  5DDM A;  4UAZ A;  3OV7 A;  5TZV A;  5HRH A;  5CR0 A;  1ZQC A;  3JPT A;  5J2F A;  2PFN A;  1ZQA A;  1TFY A;  4JWN A;  4R63 A;  2ISO A;  4M04 A;  4F5Q A;  4KLQ A;  1Q78 A;  4LT6 A;  1MIV A;  4X0B A;  4QZC A;  5D46 A;  1MIW A;  4UD5 A;  4GXI A;  4NKU A;  8ICS A;  3V7K A;  3B0X A;  1ZQG A;  4AT8 A;  1ZQS A;  2PXI A;  3HWT A;  9ICE A;  9ICN A;  5IIM A;  4YD1 A;  3HX0 A;  1ZQE A;  4QZD A;  3H38 A;  4X4U A;  4MFC A;  2ZH8 A;  4KLJ A;  7ICP A;  1UET A;  4PGY A;  3PNC A;  4RWQ A;  4QZ8 A;  4UBB A;  3LK9 A;  4Z6F A;  7ICS A;  4XQ7 A;  1ZQN A;  5CJ7 A;  4QZG A;  4TUP A;  1ZJN A;  9ICM A;  9ICJ A;  4WC0 A;  9ICS A;  1ZQQ A;  1JMS A;  4M47 A;  8ICQ A;  4X4P A;  1BPY A;  4RPZ A;  7ICH A;  1ZQR A;  7ICK A;  4X4O A;  3JPN A;  4TUQ A;  1ZQK A;  9ICX A;  2BCV A;  3OVA A;  2ZHA A;  4I2F A;  1R89 A;  4KLS A;  1ZQT A;  4NM1 A;  3AU6 A;  4IQW A;  4RT3 A;  2BCS A;  4X4V A;  2BPF A;  3H3A A;  5J0Y A;  4WC2 A;  4IG8 A;  4KLL A;  8ICK A;  1BPB A;  3UXO A;  3ISD A;  5HRI A;  2ZH5 A;  1MQ3 A;  8ICO A;  9ICC A;  4FH3 A;  9ICP A;  4FHX A;  3JPO A;  7ICV A;  3V7L A;  3JPP A;  5IIO A;  4I2C A;  3WFP A;  2ZH7 A;  2PFO A;  8ICM A;  5HRG A;  4M9G A;  7ICE A;  4I2D A;  5J2A A;  1RZT A;  2DRB A;  4UB2 A;  2ZHB A;  4GXJ A;  4QZF A;  9ICV A;  3GDX A;  2DVI A;  5J0O A;  3C2M A;  4WBY A;  4M0A A;  5HRL A;  4UAY A;  4FHW A;  2FMS A;  5HRF A;  4P4O A;  4GXK A;  7ICT A;  2GWS A;  3UQ0 A;  4F5N A;  4PH5 A;  2HHP A;  4P4M A;  2ISP A;  5J2H A;  3C66 A;  4UD4 A;  4WC6 A;  1VFG A;  4P4P A;  3MDA A;  5CP2 A;  3OVS A;  3UPQ A;  2ZH1 A;  1ZQP A;  5IIK A;  1ZQB A;  1ZQL A;  3MBY A;  8ICH A;  2BCU A;  1TV9 A;  4R66 A;  5IIJ A;  5BOL A;  5III A;  4I2J A;  4M9J A;  2ID1 A;  1ZQX A;  2PBE A;  3HJ1 A;  3OGU A;  5J2I A;  5D49 A;  5HR9 A;  1ZQW A;  1ZQM A;  3PML A;  5DB8 A;  7ICF A;  1RPL A;  8ICF A;  5CHG A;  4YD2 A;  3MGI A;  4FH5 A;  4X4N A;  4AT7 B;  4K4G A;  4Z6D A;  3TFR A;  1OU5 A;  1ZQV A;  3ISC A;  4NXZ A;  3RJH A;  4ATB A;  1ZQU A;  2M2T A;  4PGQ A;  3HW8 A;  5BOM A;  3RJK A;  4QZB A;  4NLK A;  3WFQ E;  4R64 A;  9ICR A;  1BPX A;  2ZH2 A;  4O9M A;  1Q79 A;  9ICF A;  4DOA A;  8ICC A;  4S3N A;  1PX5 A;  5J0X A;  4M9H A;  4QZE A;  3ISB A;  3UXN A;  4RQ2 A;  7ICN A;  4X4S A;  4X4Q A;  9ICG A;  4LVS A;  9ICK A;  9ICL A;  4LZG A;  7ICM A;  4QZH A;  4NKT A;  4F5P A;  5J2B A;  5DBC A;  2I9G A;  3RH4 A;  1ZJM A;  2M2V A;  3UXP A;  4FHV A;  4I29 A;  2BE3 A;  4XA5 A; 
#chains in the Genus database with same CATH topology
 5D4B A;  2BPC A;  4M9N A;  4MF8 A;  1TFW A;  1TVA A;  2FMQ A;  4M9L A;  5BPC A;  4OAF A;  4O5C A;  4QZI A;  4LEV A;  1MQ2 A;  2BCQ A;  4I2G A;  2HN2 A;  4YMO A;  9ICU A;  8ICZ A;  3EF2 A;  3JPS A;  4KLG A;  2W9M A;  5DBA A;  1UEV A;  4NXW A;  2ZH3 A;  4KLF A;  4RQ7 A;  5J2C A;  4WC7 A;  3RH5 A;  5CWR A;  4I0U A;  4RWP A;  4RPX A;  1HUZ A;  9ICB A;  4RQ3 A;  5J2D A;  2BBH A;  5B3P A;  4PHP A;  4FO6 A;  2GA9 D;  5J2K A;  3JPR A;  2PFQ A;  1NO5 A;  9ICI A;  4I2I A;  8ICP A;  4TUR A;  1JAJ A;  3OUY B;  4MKP A;  4XUS A;  2DR7 A;  4I28 A;  4UAW A;  4RWO A;  2BCR A;  7ICJ A;  4K4I A;  4WC1 A;  5IIL A;  2BBJ A;  4Z6C A;  5HRK A;  1UEU A;  4JLX A;  5CFU A;  4JWM A;  5J2G A;  8ICJ A;  4IQV A;  3RJF A;  2IHO A;  4F5R A;  4HX0 A;  4RQ4 A;  5DDY A;  1ZQZ A;  4YN4 A;  4RQ1 A;  4UB3 A;  3NYB A;  4I2B A;  4N7R A;  5J0U A;  4P2H A;  4OAG A;  2VAN A;  4FO1 A;  4KLD A;  2RFF A;  4I2E A;  2ZH6 A;  7ICQ A;  2DR8 A;  4XQ8 A;  4RPY A;  3C18 A;  9ICA A;  4IQT A;  4UBC A;  3MGH A;  2O1P A;  1BPZ A;  4DO9 A;  1R8C A;  4AT9 B;  4WCW A;  4PPX A;  5DED A;  8ICW A;  3RJG A;  1BPD A;  4KLM A;  2GAF D;  4M2Y A;  4AT8 B;  3PHZ A;  4KLT A;  3C2L A;  3JZ0 A;  5CHE A;  4Z6E A;  4EBK A;  4KLI A;  8ICX A;  5CA7 A;  4YCX A;  9ICH A;  1KEJ A;  4R65 A;  5CB1 A;  4RQ8 A;  5D61 A;  5IIN A;  4I2H A;  4PHE A;  2EWR A;  3OVB A;  3RJI A;  4MFF A;  5DB6 A;  4EBJ A;  4LEZ A;  5J29 A;  4FHP A;  3AQM A;  3V7J A;  9ICW A;  5J0R A;  8ICN A;  3JPQ A;  4NLN A;  4YMM A;  5HC9 A;  5HHH A;  8ICY A;  5DBB A;  8ICL A;  7ICG A;  4WH5 A;  5J0P A;  2Q66 A;  4AT9 A;  4MF2 A;  8ICT A;  4UB5 A;  3NKU A;  4KLU A;  4AT7 A;  2FCL A;  3PMN A;  1JN3 A;  1WOT A;  5J0T A;  4XRH A;  3RH6 A;  3JCF A;  3TFS A;  1HUO A;  1FA0 A;  2DR9 A;  3HJ4 A;  7ICU A;  2M2U A;  4IQU A;  1R8A A;  8ICB A;  3H39 A;  1MIY A;  4TUS A;  4K9A A;  1F5A A;  4NXX A;  3RJE A;  4O5K A;  1XSP A;  3V72 A;  8ICG A;  3K75 D;  4XJE A;  4PHA A;  2DR5 A;  2FMP A;  8ICU A;  1XSN A;  1NOM A;  1KDH A;  4KLO A;  4KLH A;  4E7X A;  3AUO A;  9ICQ A;  4K4H A;  3AQL A;  1JQR A;  1KNY A;  4O5E A;  5CFT A;  8ICA A;  3AQK A;  8ICI A;  3AU2 A;  4F5O A;  4RT2 A;  4O67 A;  3ERC C;  4RWN A;  1ZQI A;  3WFS C;  4WBZ A;  5J2J A;  3AQN A;  3WFO A;  5J0S A;  3UQ2 A;  3MDC A;  4EED A;  5B3Q A;  1ZQD A;  4JLZ A;  4NLZ A;  2ZH4 A;  7ICL A;  5HHI A;  4O68 A;  5DKW A;  3UPS A;  3C2K A;  3NWI A;  5J0Q A;  3LQC B;  4WC5 A;  2IHM A;  5JTG A;  1ZQY A;  9ICT A;  4LEY A;  3CK6 A;  2M2W A;  1V4A A;  4NM2 A;  2P66 A;  5DEC A;  4NY8 A;  8ICE A;  7ICR A;  5HRB A;  3RJJ A;  9ICO A;  4RQ6 A;  7ICI A;  1ZQF A;  2ZH9 A;  4UB4 A;  3L9D A;  7ICO A;  5DB7 A;  1VJ7 A;  5HRD A;  2BPG A;  4DOC A;  1BPE A;  4KLE A;  4EP7 A;  5EOZ A;  1R8B A;  4K96 A;  4X5V A;  4YMN A;  3HIY A;  4E8F A;  3B0Y A;  4RQ0 A;  4QZ9 A;  4OAI Z;  1XSL A;  4WC4 A;  4FHY A;  4ATB B;  4X4T A;  4M5D A;  4LZD A;  3C5F A;  4X0A A;  1ZQJ A;  5D63 A;  3OUY A;  4K98 A;  1YLQ A;  4I2A A;  8ICR A;  2DRA A;  2PFP A;  4WQL A;  4NXV A;  4E80 A;  4PGX A;  5J2E A;  4X4R A;  5F2V O;  4MFA A;  4DOB A;  5J0W A;  4RQ5 A;  4QZA A;  4WC3 A;  1ZQH A;  8ICV A;  4NXU A;  4UB1 A;  5DB9 A;  4NXT A;  3WFR E;  5HRE A;  3C5G A;  4I27 A;  1ZQO A;  3JYY A;  3H37 A;  4PHD A;  2NRK A;  2O5A A;  3OV7 A;  5DDM A;  4UAZ A;  4EGW A;  5TZV A;  5HRH A;  3ER9 B;  5CR0 A;  1ZQC A;  3JPT A;  5J2F A;  2PFN A;  1TFY A;  1ZQA A;  4JWN A;  4R63 A;  2ISO A;  4M04 A;  4F5Q A;  4KLQ A;  1Q78 A;  4LT6 A;  1MIV A;  4X0B A;  4QZC A;  5D46 A;  4UD5 A;  1MIW A;  4GXI A;  3MCR A;  4K8V A;  4NKU A;  8ICS A;  3V7K A;  3B0X A;  1ZQG A;  4AT8 A;  1ZQS A;  2PXI A;  3HWT A;  9ICE A;  9ICN A;  5IIM A;  4YD1 A;  3HX0 A;  1ZQE A;  4QZD A;  4KM5 A;  3H38 A;  4X4U A;  4EV6 A;  4MFC A;  2ZH8 A;  4KLJ A;  7ICP A;  1UET A;  4PGY A;  3PNC A;  4RWQ A;  4O6A A;  4QZ8 A;  4UBB A;  3LK9 A;  4Z6F A;  7ICS A;  4XQ7 A;  4OAH A;  1ZQN A;  5CJ7 A;  4QZG A;  4TUP A;  1ZJN A;  9ICM A;  9ICJ A;  4WC0 A;  2B4V A;  1ZQQ A;  1JMS A;  4M47 A;  9ICS A;  8ICQ A;  4X4P A;  1BPY A;  1GPJ A;  4RPZ A;  7ICH A;  1ZQR A;  7ICK A;  4X4O A;  3K7D A;  3JPN A;  4TUQ A;  1ZQK A;  3OWG A;  9ICX A;  2BCV A;  3OVA A;  2ZHA A;  4I2F A;  1R89 A;  4KLS A;  1ZQT A;  4NM1 A;  3AU6 A;  4IQW A;  4RT3 A;  4X4V A;  2BCS A;  2BPF A;  3H3A A;  5J0Y A;  4WC2 A;  4IG8 A;  4KLL A;  8ICK A;  1BPB A;  3UXO A;  3ISD A;  5HRI A;  2ZH5 A;  1MQ3 A;  8ICO A;  9ICC A;  4FH3 A;  9ICP A;  4FHX A;  3JPO A;  7ICV A;  3V7L A;  3JPP A;  5IIO A;  4I2C A;  3WFP A;  2B51 A;  2ZH7 A;  2PFO A;  8ICM A;  5HRG A;  4M9G A;  7ICE A;  4I2D A;  2DRB A;  5J2A A;  1RZT A;  4UB2 A;  2ZHB A;  4GXJ A;  4QZF A;  9ICV A;  2DVI A;  3GDX A;  4KB6 A;  5J0O A;  3C2M A;  4WBY A;  3ER8 C;  4M0A A;  5HRL A;  4UAY A;  4FHW A;  2FMS A;  5HRF A;  4P4O A;  4GXK A;  7ICT A;  2GWS A;  3UQ0 A;  4F5N A;  4PH5 A;  2HHP A;  4P4M A;  2ISP A;  5J2H A;  3C66 A;  4UD4 A;  4WC6 A;  2HN1 A;  1VFG A;  4P4P A;  3MDA A;  5CP2 A;  3OVS A;  3UPQ A;  2ZH1 A;  1ZQP A;  5IIK A;  4EEB A;  1ZQB A;  1ZQL A;  4WQK A;  3MBY A;  8ICH A;  2BCU A;  1TV9 A;  4R66 A;  5IIJ A;  5BOL A;  5III A;  4I2J A;  4M9J A;  2ID1 A;  1ZQX A;  2PBE A;  3HJ1 A;  3OGU A;  5J2I A;  5D49 A;  5HR9 A;  1ZQW A;  1ZQM A;  3PML A;  5DB8 A;  7ICF A;  1RPL A;  8ICF A;  5CHG A;  4YD2 A;  3MGI A;  4FH5 A;  4X4N A;  4AT7 B;  4K4G A;  4Z6D A;  3TFR A;  4K97 A;  1OU5 A;  1ZQV A;  3ISC A;  4NXZ A;  3RJH A;  4ATB A;  1ZQU A;  2M2T A;  4PGQ A;  3HW8 A;  5BOM A;  4K9B A;  4QZB A;  3RJK A;  3WFQ E;  4R64 A;  4NLK A;  4K99 A;  9ICR A;  1BPX A;  2ZH2 A;  4O9M A;  1Q79 A;  9ICF A;  4O69 A;  4DOA A;  8ICC A;  5CFS A;  4S3N A;  1PX5 A;  5J0X A;  4M9H A;  4QZE A;  3ISB A;  3UXN A;  4RQ2 A;  7ICN A;  4X4S A;  4WOY A;  2B56 A;  4X4Q A;  9ICG A;  2IUB A;  4LVS A;  9ICK A;  9ICL A;  4LZG A;  7ICM A;  4QZH A;  4NKT A;  4F5P A;  5J2B A;  5D62 A;  5DBC A;  2I9G A;  3RH4 A;  1ZJM A;  2M2V A;  3UXP A;  4FHV A;  4I29 A;  4LEW A;  3NVO A;  2BE3 A;  4XA5 A; 
#chains in the Genus database with same CATH homology
 5D4B A;  2BPC A;  4M9N A;  4MF8 A;  1TFW A;  1TVA A;  2FMQ A;  4M9L A;  5BPC A;  4O5C A;  4QZI A;  1MQ2 A;  2BCQ A;  4I2G A;  4YMO A;  9ICU A;  8ICZ A;  3JPS A;  4KLG A;  2W9M A;  5DBA A;  1UEV A;  2ZH3 A;  4KLF A;  4RQ7 A;  5J2C A;  4WC7 A;  3RH5 A;  5CWR A;  4RWP A;  4RPX A;  1HUZ A;  9ICB A;  4RQ3 A;  5J2D A;  4PHP A;  4FO6 A;  5J2K A;  3JPR A;  2PFQ A;  1NO5 A;  9ICI A;  4I2I A;  8ICP A;  4TUR A;  1JAJ A;  4XUS A;  3OUY B;  2DR7 A;  4I28 A;  4UAW A;  4RWO A;  2BCR A;  7ICJ A;  4K4I A;  4WC1 A;  5IIL A;  4Z6C A;  5HRK A;  1UEU A;  4JWM A;  5J2G A;  8ICJ A;  4IQV A;  3RJF A;  4F5R A;  4RQ4 A;  5DDY A;  1ZQZ A;  4YN4 A;  4RQ1 A;  4UB3 A;  3NYB A;  4I2B A;  5J0U A;  4P2H A;  2VAN A;  4KLD A;  2RFF A;  4I2E A;  2ZH6 A;  7ICQ A;  2DR8 A;  4XQ8 A;  4RPY A;  3C18 A;  9ICA A;  4IQT A;  4UBC A;  3MGH A;  2O1P A;  1BPZ A;  4DO9 A;  1R8C A;  4WCW A;  4AT9 B;  4PPX A;  5DED A;  8ICW A;  3RJG A;  1BPD A;  4KLM A;  4M2Y A;  4AT8 B;  4KLT A;  3C2L A;  3JZ0 A;  4Z6E A;  4EBK A;  4KLI A;  8ICX A;  5CA7 A;  4YCX A;  9ICH A;  1KEJ A;  4R65 A;  5CB1 A;  4RQ8 A;  5IIN A;  4I2H A;  4PHE A;  3OVB A;  3RJI A;  4MFF A;  5DB6 A;  4EBJ A;  5J29 A;  3AQM A;  4FHP A;  3V7J A;  9ICW A;  5J0R A;  8ICN A;  3JPQ A;  4NLN A;  4YMM A;  5HC9 A;  5HHH A;  8ICY A;  5DBB A;  8ICL A;  7ICG A;  5J0P A;  4MF2 A;  4AT9 A;  2Q66 A;  8ICT A;  4UB5 A;  4KLU A;  4AT7 A;  3PMN A;  1JN3 A;  1WOT A;  5J0T A;  4XRH A;  3RH6 A;  3TFS A;  1HUO A;  1FA0 A;  2DR9 A;  3HJ4 A;  7ICU A;  2M2U A;  4IQU A;  1R8A A;  8ICB A;  3H39 A;  1MIY A;  4TUS A;  1F5A A;  3RJE A;  4O5K A;  1XSP A;  3V72 A;  8ICG A;  3K75 D;  4PHA A;  2DR5 A;  2FMP A;  8ICU A;  1XSN A;  1NOM A;  1KDH A;  4KLO A;  4KLH A;  4E7X A;  3AUO A;  9ICQ A;  4K4H A;  3AQL A;  1JQR A;  1KNY A;  4O5E A;  8ICA A;  3AQK A;  8ICI A;  3AU2 A;  4F5O A;  4RT2 A;  4RWN A;  1ZQI A;  3WFS C;  4WBZ A;  5J2J A;  3AQN A;  3WFO A;  5J0S A;  3UQ2 A;  3MDC A;  1ZQD A;  4NLZ A;  2ZH4 A;  7ICL A;  5HHI A;  5DKW A;  3UPS A;  3C2K A;  5J0Q A;  3LQC B;  4WC5 A;  2IHM A;  1ZQY A;  9ICT A;  2M2W A;  1V4A A;  4NM2 A;  2P66 A;  5DEC A;  4NY8 A;  8ICE A;  7ICR A;  5HRB A;  3RJJ A;  9ICO A;  4RQ6 A;  7ICI A;  1ZQF A;  2ZH9 A;  4UB4 A;  3L9D A;  7ICO A;  5DB7 A;  1VJ7 A;  5HRD A;  2BPG A;  4DOC A;  1BPE A;  4KLE A;  4EP7 A;  5EOZ A;  1R8B A;  4X5V A;  4YMN A;  3HIY A;  3B0Y A;  4E8F A;  4RQ0 A;  4QZ9 A;  1XSL A;  4WC4 A;  4FHY A;  4ATB B;  4X4T A;  4M5D A;  4LZD A;  3C5F A;  4X0A A;  1ZQJ A;  3OUY A;  1YLQ A;  4I2A A;  8ICR A;  2DRA A;  2PFP A;  4E80 A;  4PGX A;  5J2E A;  4X4R A;  5F2V O;  4MFA A;  4DOB A;  5J0W A;  4RQ5 A;  4QZA A;  4WC3 A;  1ZQH A;  8ICV A;  4UB1 A;  5DB9 A;  3WFR E;  5HRE A;  3C5G A;  4I27 A;  1ZQO A;  3JYY A;  3H37 A;  4PHD A;  2NRK A;  2O5A A;  5DDM A;  4UAZ A;  3OV7 A;  5TZV A;  5HRH A;  5CR0 A;  1ZQC A;  3JPT A;  5J2F A;  2PFN A;  1ZQA A;  1TFY A;  4JWN A;  4R63 A;  2ISO A;  4M04 A;  4F5Q A;  4KLQ A;  1Q78 A;  4LT6 A;  1MIV A;  4X0B A;  4QZC A;  5D46 A;  1MIW A;  4UD5 A;  4GXI A;  4NKU A;  8ICS A;  3V7K A;  3B0X A;  1ZQG A;  4AT8 A;  1ZQS A;  2PXI A;  3HWT A;  9ICE A;  9ICN A;  5IIM A;  4YD1 A;  3HX0 A;  1ZQE A;  4QZD A;  3H38 A;  4X4U A;  4MFC A;  2ZH8 A;  4KLJ A;  7ICP A;  1UET A;  4PGY A;  3PNC A;  4RWQ A;  4QZ8 A;  4UBB A;  3LK9 A;  4Z6F A;  7ICS A;  4XQ7 A;  1ZQN A;  5CJ7 A;  4QZG A;  4TUP A;  1ZJN A;  9ICM A;  9ICJ A;  4WC0 A;  9ICS A;  1ZQQ A;  1JMS A;  4M47 A;  8ICQ A;  4X4P A;  1BPY A;  4RPZ A;  7ICH A;  1ZQR A;  7ICK A;  4X4O A;  3JPN A;  4TUQ A;  1ZQK A;  9ICX A;  2BCV A;  3OVA A;  2ZHA A;  4I2F A;  1R89 A;  4KLS A;  1ZQT A;  4NM1 A;  3AU6 A;  4IQW A;  4RT3 A;  2BCS A;  4X4V A;  2BPF A;  3H3A A;  5J0Y A;  4WC2 A;  4IG8 A;  4KLL A;  8ICK A;  1BPB A;  3UXO A;  3ISD A;  5HRI A;  2ZH5 A;  1MQ3 A;  8ICO A;  9ICC A;  4FH3 A;  9ICP A;  4FHX A;  3JPO A;  7ICV A;  3V7L A;  3JPP A;  5IIO A;  4I2C A;  3WFP A;  2ZH7 A;  2PFO A;  8ICM A;  5HRG A;  4M9G A;  7ICE A;  4I2D A;  5J2A A;  1RZT A;  2DRB A;  4UB2 A;  2ZHB A;  4GXJ A;  4QZF A;  9ICV A;  3GDX A;  2DVI A;  5J0O A;  3C2M A;  4WBY A;  4M0A A;  5HRL A;  4UAY A;  4FHW A;  2FMS A;  5HRF A;  4P4O A;  4GXK A;  7ICT A;  2GWS A;  3UQ0 A;  4F5N A;  4PH5 A;  2HHP A;  4P4M A;  2ISP A;  5J2H A;  3C66 A;  4UD4 A;  4WC6 A;  1VFG A;  4P4P A;  3MDA A;  5CP2 A;  3OVS A;  3UPQ A;  2ZH1 A;  1ZQP A;  5IIK A;  1ZQB A;  1ZQL A;  3MBY A;  8ICH A;  2BCU A;  1TV9 A;  4R66 A;  5IIJ A;  5BOL A;  5III A;  4I2J A;  4M9J A;  2ID1 A;  1ZQX A;  2PBE A;  3HJ1 A;  3OGU A;  5J2I A;  5D49 A;  5HR9 A;  1ZQW A;  1ZQM A;  3PML A;  5DB8 A;  7ICF A;  1RPL A;  8ICF A;  5CHG A;  4YD2 A;  3MGI A;  4FH5 A;  4X4N A;  4AT7 B;  4K4G A;  4Z6D A;  3TFR A;  1OU5 A;  1ZQV A;  3ISC A;  4NXZ A;  3RJH A;  4ATB A;  1ZQU A;  2M2T A;  4PGQ A;  3HW8 A;  5BOM A;  3RJK A;  4QZB A;  4NLK A;  3WFQ E;  4R64 A;  9ICR A;  1BPX A;  2ZH2 A;  4O9M A;  1Q79 A;  9ICF A;  4DOA A;  8ICC A;  4S3N A;  1PX5 A;  5J0X A;  4M9H A;  4QZE A;  3ISB A;  3UXN A;  4RQ2 A;  7ICN A;  4X4S A;  4X4Q A;  9ICG A;  4LVS A;  9ICK A;  9ICL A;  4LZG A;  7ICM A;  4QZH A;  4NKT A;  4F5P A;  5J2B A;  5DBC A;  2I9G A;  3RH4 A;  1ZJM A;  2M2V A;  3UXP A;  4FHV A;  4I29 A;  2BE3 A;  4XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...