4S3NA

Crystal structure of human oas3 domain i in complex with dsrna
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
359
structure length
343
Chain Sequence
MDLYSTPAAALDRFVARKLQPRKEFVEKARRALGALAAALRERPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2'-5'-oligoadenylate synthase 3
publication title Structural mechanism of sensing long dsRNA via a noncatalytic domain in human oligoadenylate synthetase 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 116
structure length 343
sequence length 359
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10421 OAS1_C 2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4s3nA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4s3nA01
1ZQQA 2PXIA 4O5EA 8ICTA 4I2EA 3UPQA 4QZ8A 5HREA 5IINA 3ISBA 9ICRA 4PHAA 2ZH7A 4RQ1A 2BCSA 3C2KA 4TURA 2I9GA 3HJ4A 4AT8A 8ICOA 8ICQA 7ICGA 8ICBA 4RT3A 5HRDA 4S3NA 4RWQA 2M2WA 5HHIA 3HJ1A 2IHMA 8ICYA 2FMPA 3JPOA 4F5OA 4WC6A 4I2DA 4KLMA 3H39A 4FH5A 3WFRE 5BOLA 1ZQJA 1F5AA 9ICOA 4EBKA 4P2HA 9ICLA 1TVAA 5EOZA 5DDYA 4XA5A 2ZH4A 1R8AA 1JQRA 4RWNA 4AT8B 4WC0A 3C5FA 3PMNA 9ICJA 4QZAA 5IIKA 5J0UA 4UB2A 2M2TA 4RQ5A 4M9JA 1YLQA 3JPPA 5J0PA 4R66A 1XSPA 4K4HA 1V4AA 2RFFA 3MDCA 4M04A 4X4VA 4UAWA 5IIIA 4RWOA 1KNYA 3RJEA 4EBJA 5HRHA 4IG8A 1R89A 4TUQA 4P4OA 4KLLA 8ICHA 4AT7A 5J0WA 1JAJA 4EP7A 8ICGA 1WOTA 2BCVA 4RQ7A 4I2BA 4M9GA 1TFYA 3HWTA 1ZJNA 8ICPA 1ZQIA 3RJIA 1JMSA 5J2CA 4NKUA 8ICLA 4XQ7A 1JN3A 4XQ8A 5CHGA 1RPLA 4X4UA 1HUZA 1VJ7A 4I2CA 1ZQYA 1ZQMA 5J0TA 8ICNA 1Q78A 4YMOA 4QZFA 3WFPA 5J2JA 4WCWA 2ZHBA 4R65A 3MGIA 4JWNA 1ZQVA 5DEDA 4I2GA 4AT7B 4X4RA 4X5VA 4Z6CA 4F5NA 1ZQTA 1FA0A 1Q79A 4RQ8A 4RPYA 3OVAA 2BCRA 4RPZA 4DO9A 1ZQZA 4P4MA 4WBZA 8ICFA 3AU2A 3C5GA 4X4PA 9ICTA 4KLEA 4K4GA 4UD5A 3OUYB 9ICHA 4X4NA 1UETA 1KDHA 5DB7A 8ICMA 4RQ4A 4KLQA 8ICCA 9ICEA 2PFOA 4MF8A 4NLNA 2BCQA 2GWSA 4UB1A 4IQVA 7ICJA 5DB6A 3JPNA 8ICSA 5CP2A 3UQ2A 2ZH3A 3JYYA 4KLJA 4QZ9A 4WBYA 4I2JA 7ICMA 3UXPA 9ICNA 2ZH5A 3K75D 1MQ3A 4I2FA 1ZJMA 4E8FA 4WC5A 4M9LA 5DKWA 4M47A 5HRFA 9ICCA 1NOMA 4M5DA 4FHWA 4MFFA 3C66A 1BPZA 4I28A 4PH5A 4WC3A 2ZH6A 1TV9A 2Q66A 5D49A 1ZQEA 5CB1A 3MGHA 8ICWA 4I2IA 3ISCA 1RZTA 3AU6A 2ISOA 4XUSA 9ICWA 4M2YA 2BPGA 2HHPA 3UPSA 4KLTA 2DR9A 5J0QA 3C2LA 7ICQA 3WFOA 4QZGA 5CJ7A 8ICVA 3PMLA 4O9MA 1BPDA 3H3AA 1VFGA 3UXOA 3RH4A 4DOAA 1BPEA 9ICPA 4GXJA 1KEJA 5IIJA 4RQ3A 4I2AA 1OU5A 3NYBA 1ZQDA 9ICUA 4WC2A 4RPXA 1ZQSA 4FHXA 4UD4A 9ICQA 4QZEA 2ZH9A 1ZQBA 1ZQAA 4Z6FA 1BPBA 4IQWA 4NLKA 5HRBA 4YD1A 4R64A 4IQTA 4RQ6A 2DR8A 7ICFA 1ZQNA 4NLZA 3UXNA 8ICXA 5J2GA 2ZH1A 2PFQA 3MDAA 4QZHA 3JPSA 3ISDA 8ICRA 3JPQA 4UAZA 3OUYA 5IIMA 1ZQFA 5DBAA 2O1PA 5J2EA 9ICMA 5J2DA 5D46A 5IIOA 3RJKA 7ICPA 4MFCA 3TFRA 4X4SA 1UEVA 3TFSA 4K4IA 2ZHAA 4O5CA 4UB3A 4AT9B 2PFNA 2NRKA 3V72A 8ICZA 4YN4A 5DBBA 4GXIA 7ICOA 4MF2A 4UBBA 9ICXA 1MIVA 4DOBA 4WC1A 1ZQWA 4X4TA 1ZQXA 3V7JA 1XSNA 3C18A 4F5RA 7ICEA 4ATBB 4LZDA 5DDMA 4PGYA 9ICKA 4YMMA 3HIYA 4P4PA 2BPFA 4YCXA 3AQMA 4PHDA 2O5AA 1PX5A 4QZBA 4Z6DA 4RT2A 1XSLA 4PPXA 4Z6EA 4QZCA 5HRGA 2DRBA 4I29A 4M0AA 3OVBA 2W9MA 2ID1A 9ICGA 3OGUA 3JZ0A 4KLSA 3RH5A 4F5PA 4RWPA 4PGQA 4PGXA 1ZQPA 4KLGA 9ICVA 4WC4A 5HRIA 7ICUA 4FH3A 8ICUA 1ZQRA 5J2HA 3HW8A 3HX0A 1ZQGA 3RJGA 3V7LA 4E7XA 9ICFA 4QZDA 5DBCA 4RQ2A 4TUPA 3GDXA 1ZQKA 1MQ2A 4QZIA 3RJJA 9ICBA 5HHHA 5J0OA 1R8CA 4UAYA 4KLHA 1ZQUA 3B0XA 1MIYA 5DECA 5BOMA 5HC9A 4LVSA 2ZH2A 3RH6A 4PHPA 7ICRA 2M2VA 4NKTA 2DR7A 4IQUA 2ISPA 1UEUA 2M2UA 4GXKA 4I27A 4KLOA 3H37A 5J2IA 4MFAA 5J0YA 2FMSA 4KLUA 1BPXA 4UBCA 2PBEA 2BCUA 1HUOA 1MIWA 8ICKA 3RJHA 5J2BA 4KLIA 4NXZA 8ICAA 4FHPA 3AQLA 8ICIA 5DB9A 4TUSA 2DVIA 5J2FA 2DR5A 3AUOA 3AQNA 5HRLA 4LT6A 3LK9A 3OVSA 2BE3A 4KLFA 5CR0A 4RQ0A 1NO5A 2DRAA 4JWMA 5J2KA 3MBYA 4X0BA 4AT9A 3AQKA 1ZQHA 5HR9A 4O5KA 4M9NA 4X0AA 3WFQE 4M9HA 4UB4A 7ICIA 7ICHA 4ATBA 3WFSC 4PHEA 4X4OA 3H38A 4NM2A 4YD2A 3UQ0A 7ICKA 4FHYA 4X4QA 4FO6A 3PNCA 7ICTA 4YMNA 1ZQLA 4DOCA 4NY8A 4I2HA 2BPCA 4FHVA 4XRHA 3OV7A 3V7KA 2P66A 9ICSA 2VANA 7ICVA 4KLDA 3L9DA 5IILA 2ZH8A 4NM1A 4E80A 7ICSA 5BPCA 1TFWA 3LQCB 5J0XA 5J0SA 5CA7A 9ICIA 8ICEA 5F2VO 5DB8A 5HRKA 4WC7A 4R63A 7ICLA 5TZVA 3C2MA 5CWRA 1ZQCA 3JPTA 1BPYA 4LZGA 9ICAA 3B0YA 3RJFA 5J2AA 3JPRA 2FMQA 2PFPA 5J29A 4UB5A 1R8BA 8ICJA 4F5QA 5D4BA 7ICNA 5J0RA 1ZQOA
chains in the Genus database with same CATH superfamily
1ZQQA 2PXIA 4O5EA 8ICTA 4I2EA 3UPQA 4QZ8A 5HREA 5IINA 3ISBA 9ICRA 4PHAA 2ZH7A 4RQ1A 2BCSA 3C2KA 3K7DA 4TURA 2I9GA 3HJ4A 4O6AA 4AT8A 8ICOA 8ICQA 7ICGA 8ICBA 4RT3A 5HRDA 4S3NA 4RWQA 2BBHA 2M2WA 5HHIA 3HJ1A 2IHMA 2FCLA 8ICYA 2FMPA 3JPOA 4F5OA 4WC6A 4I2DA 4KLMA 3H39A 3OWGA 4FH5A 3WFRE 5BOLA 1ZQJA 1F5AA 9ICOA 4OAGA 4EBKA 4P2HA 9ICLA 1TVAA 5EOZA 3ER8C 5DDYA 4XA5A 2ZH4A 1R8AA 1JQRA 4RWNA 4AT8B 4WC0A 4N7RA 5CHEA 3C5FA 3PMNA 9ICJA 4QZAA 5IIKA 5J0UA 4UB2A 2M2TA 4RQ5A 4M9JA 1YLQA 5J0PA 4R66A 3JPPA 1XSPA 4WQKA 3NWIA 4K4HA 1V4AA 2RFFA 4EGWA 3MDCA 4M04A 4X4VA 4UAWA 5IIIA 4RWOA 1KNYA 4JLXA 3RJEA 4EBJA 2BBJA 5HRHA 4IG8A 1R89A 4TUQA 4P4OA 4KLLA 8ICHA 4AT7A 5J0WA 1JAJA 4EP7A 2IUBA 4MKPA 1WOTA 8ICGA 2BCVA 4RQ7A 4I2BA 4M9GA 1TFYA 3HWTA 1ZJNA 8ICPA 1ZQIA 3RJIA 1JMSA 5J2CA 4NKUA 8ICLA 4XQ7A 1JN3A 4KM5A 4XQ8A 5CHGA 4X4UA 1RPLA 1HUZA 1VJ7A 4I2CA 1ZQYA 1ZQMA 5J0TA 8ICNA 1Q78A 4YMOA 4QZFA 3WFPA 5J2JA 4WCWA 2ZHBA 4R65A 3MGIA 4JWNA 1ZQVA 4WH5A 5DEDA 4I2GA 4AT7B 4X4RA 4X5VA 4K98A 4Z6CA 3EF2A 4F5NA 1ZQTA 1FA0A 1Q79A 4RQ8A 4OAIZ 3OVAA 4RPYA 2BCRA 4RPZA 4DO9A 1ZQZA 4P4MA 4WBZA 8ICFA 3AU2A 3C5GA 4X4PA 9ICTA 4KLEA 4K4GA 4UD5A 3OUYB 9ICHA 4X4NA 1UETA 2HN1A 4WQLA 1KDHA 5DB7A 8ICMA 4RQ4A 4KLQA 4K97A 8ICCA 9ICEA 2PFOA 4MF8A 4NLNA 2BCQA 2GWSA 4UB1A 4IQVA 4K9AA 7ICJA 5DB6A 3JPNA 8ICSA 5CP2A 3UQ2A 2ZH3A 4O69A 3JYYA 4KLJA 4QZ9A 4WBYA 4I2JA 7ICMA 3UXPA 9ICNA 2ZH5A 3K75D 1MQ3A 4I2FA 1ZJMA 4E8FA 4WC5A 4M9LA 5DKWA 4M47A 5HRFA 9ICCA 1NOMA 4M5DA 4FHWA 4MFFA 3C66A 1BPZA 4I28A 4PH5A 2ZH6A 4O67A 4WC3A 1TV9A 3CK6A 2Q66A 5D49A 1ZQEA 5CB1A 3MGHA 8ICWA 4I2IA 3ISCA 1RZTA 3AU6A 2ISOA 4XUSA 9ICWA 4M2YA 2BPGA 4EV6A 2HHPA 2GA9D 3UPSA 4KLTA 4EEBA 2DR9A 5J0QA 3C2LA 7ICQA 3WFOA 4QZGA 5CJ7A 8ICVA 3PMLA 4O9MA 4LEVA 1BPDA 3H3AA 5CFSA 1VFGA 3UXOA 3RH4A 4DOAA 1BPEA 9ICPA 4GXJA 1KEJA 5IIJA 4RQ3A 4I2AA 1OU5A 3NYBA 1ZQDA 9ICUA 4WC2A 4RPXA 1ZQSA 4K9BA 4FHXA 4UD4A 9ICQA 4QZEA 2ZH9A 1ZQBA 1ZQAA 4K99A 4Z6FA 1BPBA 4IQWA 4NLKA 5HRBA 5J0RA 4YD1A 3MCRA 2B51A 4OAFA 5CFUA 4R64A 4IQTA 2DR8A 4RQ6A 7ICFA 1ZQNA 4NLZA 3UXNA 8ICXA 2GAFD 5J2GA 2ZH1A 2PFQA 3MDAA 4QZHA 3JPSA 3ISDA 8ICRA 3JPQA 4LEYA 4UAZA 3JCFA 3OUYA 5IIMA 1ZQFA 5DBAA 4LEZA 2O1PA 5J2EA 1GPJA 9ICMA 5J2DA 5D46A 5IIOA 3RJKA 7ICPA 4MFCA 3TFRA 4NXVA 1UEVA 4X4SA 3TFSA 4K4IA 2ZHAA 4O5CA 4JLZA 4XJEA 4UB3A 4AT9B 2PFNA 2NRKA 3V72A 8ICZA 4YN4A 5DBBA 4GXIA 7ICOA 4MF2A 4UBBA 9ICXA 1MIVA 4DOBA 4EEDA 4WC1A 4X4TA 1ZQWA 1ZQXA 3V7JA 1XSNA 2IHOA 4NXWA 3C18A 4NXUA 4F5RA 7ICEA 3NKUA 4ATBB 4LZDA 5DDMA 4PGYA 9ICKA 4YMMA 3HIYA 4P4PA 2BPFA 4YCXA 3AQMA 4PHDA 2O5AA 1PX5A 4QZBA 4Z6DA 4RT2A 1XSLA 4PPXA 4QZCA 3NVOA 4Z6EA 2DRBA 5HRGA 5B3PA 4I29A 4M0AA 3OVBA 2W9MA 2ID1A 9ICGA 3OGUA 3JZ0A 4KLSA 3RH5A 4F5PA 4RWPA 4PGQA 4PGXA 1ZQPA 4KLGA 9ICVA 4WC4A 5HRIA 7ICUA 4FH3A 8ICUA 1ZQRA 5J2HA 3HW8A 3HX0A 1ZQGA 3RJGA 4E7XA 3V7LA 9ICFA 4K96A 5DBCA 4QZDA 4RQ2A 4TUPA 3GDXA 1ZQKA 1MQ2A 4QZIA 3RJJA 9ICBA 5HHHA 5J0OA 1R8CA 4UAYA 4KLHA 1ZQUA 3B0XA 1MIYA 5DECA 5BOMA 5HC9A 4LVSA 2ZH2A 3RH6A 4PHPA 7ICRA 2M2VA 4FO1A 4NKTA 2DR7A 4IQUA 2ISPA 1UEUA 2M2UA 4GXKA 4I27A 4KLOA 3H37A 5J2IA 4MFAA 5CFTA 5J0YA 2FMSA 4OAHA 4KLUA 1BPXA 4UBCA 2PBEA 2BCUA 1HUOA 1MIWA 8ICKA 3RJHA 5J2BA 4KLIA 4NXZA 8ICAA 4FHPA 3AQLA 8ICIA 2EWRA 5DB9A 4TUSA 2DVIA 5J2FA 2DR5A 3AUOA 3AQNA 5HRLA 4NXTA 4O68A 3ER9B 4LT6A 3LK9A 3OVSA 2BE3A 4KLFA 5CR0A 5JTGA 4RQ0A 5B3QA 2DRAA 5D61A 4JWMA 5J2KA 3MBYA 4HX0A 4X0BA 4AT9A 2B4VA 3AQKA 1ZQHA 4K8VA 5HR9A 4O5KA 5D62A 4M9NA 4X0AA 4I0UA 3WFQE 4LEWA 4M9HA 4UB4A 7ICIA 7ICHA 4ATBA 4KB6A 3WFSC 4PHEA 4X4OA 3H38A 4NM2A 4YD2A 3UQ0A 7ICKA 4FHYA 4X4QA 3ERCC 4FO6A 2B56A 3PNCA 4NXXA 7ICTA 4YMNA 1ZQLA 4DOCA 4NY8A 4I2HA 2BPCA 4FHVA 4XRHA 3OV7A 3V7KA 2P66A 9ICSA 5D63A 2VANA 7ICVA 4KLDA 3L9DA 5IILA 2ZH8A 2HN2A 4NM1A 4E80A 7ICSA 5BPCA 1TFWA 3LQCB 5J0XA 4WOYA 5J0SA 5CA7A 9ICIA 8ICEA 5F2VO 5DB8A 5HRKA 4WC7A 4R63A 7ICLA 5TZVA 3C2MA 5CWRA 1ZQCA 3JPTA 1BPYA 4LZGA 9ICAA 3B0YA 3RJFA 5J2AA 3JPRA 2FMQA 2PFPA 3PHZA 5J29A 4UB5A 1R8BA 8ICJA 4F5QA 5D4BA 7ICNA 1NO5A 1ZQOA
chains in the Genus database with same CATH topology
1ZQQA 2PXIA 4O5EA 8ICTA 4I2EA 3UPQA 4QZ8A 5HREA 5IINA 3ISBA 9ICRA 4PHAA 2ZH7A 4RQ1A 2BCSA 3C2KA 4TURA 2I9GA 3HJ4A 4AT8A 8ICOA 8ICQA 7ICGA 8ICBA 4RT3A 5HRDA 4S3NA 4RWQA 2M2WA 5HHIA 3HJ1A 2IHMA 8ICYA 2FMPA 3JPOA 4F5OA 4WC6A 4I2DA 4KLMA 3H39A 4FH5A 3WFRE 5BOLA 1ZQJA 1F5AA 9ICOA 4EBKA 4P2HA 9ICLA 1TVAA 5EOZA 5DDYA 4XA5A 2ZH4A 1R8AA 1JQRA 4RWNA 4AT8B 4WC0A 3C5FA 3PMNA 9ICJA 4QZAA 5IIKA 5J0UA 4UB2A 2M2TA 4RQ5A 4M9JA 1YLQA 3JPPA 5J0PA 4R66A 1XSPA 4K4HA 1V4AA 2RFFA 3MDCA 4M04A 4X4VA 4UAWA 5IIIA 4RWOA 1KNYA 3RJEA 4EBJA 5HRHA 4IG8A 1R89A 4TUQA 4P4OA 4KLLA 8ICHA 4AT7A 5J0WA 1JAJA 4EP7A 8ICGA 1WOTA 2BCVA 4RQ7A 4I2BA 4M9GA 1TFYA 3HWTA 1ZJNA 8ICPA 1ZQIA 3RJIA 1JMSA 5J2CA 4NKUA 8ICLA 4XQ7A 1JN3A 4XQ8A 5CHGA 1RPLA 4X4UA 1HUZA 1VJ7A 4I2CA 1ZQYA 1ZQMA 5J0TA 8ICNA 1Q78A 4YMOA 4QZFA 3WFPA 5J2JA 4WCWA 2ZHBA 4R65A 3MGIA 4JWNA 1ZQVA 5DEDA 4I2GA 4AT7B 4X4RA 4X5VA 4Z6CA 4F5NA 1ZQTA 1FA0A 1Q79A 4RQ8A 4RPYA 3OVAA 2BCRA 4RPZA 4DO9A 1ZQZA 4P4MA 4WBZA 8ICFA 3AU2A 3C5GA 4X4PA 9ICTA 4KLEA 4K4GA 4UD5A 3OUYB 9ICHA 4X4NA 1UETA 1KDHA 5DB7A 8ICMA 4RQ4A 4KLQA 8ICCA 9ICEA 2PFOA 4MF8A 4NLNA 2BCQA 2GWSA 4UB1A 4IQVA 7ICJA 5DB6A 3JPNA 8ICSA 5CP2A 3UQ2A 2ZH3A 3JYYA 4KLJA 4QZ9A 4WBYA 4I2JA 7ICMA 3UXPA 9ICNA 2ZH5A 3K75D 1MQ3A 4I2FA 1ZJMA 4E8FA 4WC5A 4M9LA 5DKWA 4M47A 5HRFA 9ICCA 1NOMA 4M5DA 4FHWA 4MFFA 3C66A 1BPZA 4I28A 4PH5A 4WC3A 2ZH6A 1TV9A 2Q66A 5D49A 1ZQEA 5CB1A 3MGHA 8ICWA 4I2IA 3ISCA 1RZTA 3AU6A 2ISOA 4XUSA 9ICWA 4M2YA 2BPGA 2HHPA 3UPSA 4KLTA 2DR9A 5J0QA 3C2LA 7ICQA 3WFOA 4QZGA 5CJ7A 8ICVA 3PMLA 4O9MA 1BPDA 3H3AA 1VFGA 3UXOA 3RH4A 4DOAA 1BPEA 9ICPA 4GXJA 1KEJA 5IIJA 4RQ3A 4I2AA 1OU5A 3NYBA 1ZQDA 9ICUA 4WC2A 4RPXA 1ZQSA 4FHXA 4UD4A 9ICQA 4QZEA 2ZH9A 1ZQBA 1ZQAA 4Z6FA 1BPBA 4IQWA 4NLKA 5HRBA 4YD1A 4R64A 4IQTA 4RQ6A 2DR8A 7ICFA 1ZQNA 4NLZA 3UXNA 8ICXA 5J2GA 2ZH1A 2PFQA 3MDAA 4QZHA 3JPSA 3ISDA 8ICRA 3JPQA 4UAZA 3OUYA 5IIMA 1ZQFA 5DBAA 2O1PA 5J2EA 9ICMA 5J2DA 5D46A 5IIOA 3RJKA 7ICPA 4MFCA 3TFRA 4X4SA 1UEVA 3TFSA 4K4IA 2ZHAA 4O5CA 4UB3A 4AT9B 2PFNA 2NRKA 3V72A 8ICZA 4YN4A 5DBBA 4GXIA 7ICOA 4MF2A 4UBBA 9ICXA 1MIVA 4DOBA 4WC1A 1ZQWA 4X4TA 1ZQXA 3V7JA 1XSNA 3C18A 4F5RA 7ICEA 4ATBB 4LZDA 5DDMA 4PGYA 9ICKA 4YMMA 3HIYA 4P4PA 2BPFA 4YCXA 3AQMA 4PHDA 2O5AA 1PX5A 4QZBA 4Z6DA 4RT2A 1XSLA 4PPXA 4Z6EA 4QZCA 5HRGA 2DRBA 4I29A 4M0AA 3OVBA 2W9MA 2ID1A 9ICGA 3OGUA 3JZ0A 4KLSA 3RH5A 4F5PA 4RWPA 4PGQA 4PGXA 1ZQPA 4KLGA 9ICVA 4WC4A 5HRIA 7ICUA 4FH3A 8ICUA 1ZQRA 5J2HA 3HW8A 3HX0A 1ZQGA 3RJGA 3V7LA 4E7XA 9ICFA 4QZDA 5DBCA 4RQ2A 4TUPA 3GDXA 1ZQKA 1MQ2A 4QZIA 3RJJA 9ICBA 5HHHA 5J0OA 1R8CA 4UAYA 4KLHA 1ZQUA 3B0XA 1MIYA 5DECA 5BOMA 5HC9A 4LVSA 2ZH2A 3RH6A 4PHPA 7ICRA 2M2VA 4NKTA 2DR7A 4IQUA 2ISPA 1UEUA 2M2UA 4GXKA 4I27A 4KLOA 3H37A 5J2IA 4MFAA 5J0YA 2FMSA 4KLUA 1BPXA 4UBCA 2PBEA 2BCUA 1HUOA 1MIWA 8ICKA 3RJHA 5J2BA 4KLIA 4NXZA 8ICAA 4FHPA 3AQLA 8ICIA 5DB9A 4TUSA 2DVIA 5J2FA 2DR5A 3AUOA 3AQNA 5HRLA 4LT6A 3LK9A 3OVSA 2BE3A 4KLFA 5CR0A 4RQ0A 1NO5A 2DRAA 4JWMA 5J2KA 3MBYA 4X0BA 4AT9A 3AQKA 1ZQHA 5HR9A 4O5KA 4M9NA 4X0AA 3WFQE 4M9HA 4UB4A 7ICIA 7ICHA 4ATBA 3WFSC 4PHEA 4X4OA 3H38A 4NM2A 4YD2A 3UQ0A 7ICKA 4FHYA 4X4QA 4FO6A 3PNCA 7ICTA 4YMNA 1ZQLA 4DOCA 4NY8A 4I2HA 2BPCA 4FHVA 4XRHA 3OV7A 3V7KA 2P66A 9ICSA 2VANA 7ICVA 4KLDA 3L9DA 5IILA 2ZH8A 4NM1A 4E80A 7ICSA 5BPCA 1TFWA 3LQCB 5J0XA 5J0SA 5CA7A 9ICIA 8ICEA 5F2VO 5DB8A 5HRKA 4WC7A 4R63A 7ICLA 5TZVA 3C2MA 5CWRA 1ZQCA 3JPTA 1BPYA 4LZGA 9ICAA 3B0YA 3RJFA 5J2AA 3JPRA 2FMQA 2PFPA 5J29A 4UB5A 1R8BA 8ICJA 4F5QA 5D4BA 7ICNA 5J0RA 1ZQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQQ A;  2PXI A;  4O5E A;  8ICT A;  4I2E A;  3UPQ A;  4QZ8 A;  5HRE A;  5IIN A;  3ISB A;  9ICR A;  4PHA A;  2ZH7 A;  4RQ1 A;  2BCS A;  3C2K A;  4TUR A;  2I9G A;  3HJ4 A;  4AT8 A;  8ICO A;  8ICQ A;  7ICG A;  8ICB A;  4RT3 A;  5HRD A;  4S3N A;  4RWQ A;  2M2W A;  5HHI A;  3HJ1 A;  2IHM A;  8ICY A;  2FMP A;  3JPO A;  4F5O A;  4WC6 A;  4I2D A;  4KLM A;  3H39 A;  4FH5 A;  3WFR E;  5BOL A;  1ZQJ A;  1F5A A;  9ICO A;  4EBK A;  4P2H A;  9ICL A;  1TVA A;  5EOZ A;  5DDY A;  4XA5 A;  2ZH4 A;  1R8A A;  1JQR A;  4RWN A;  4AT8 B;  4WC0 A;  3C5F A;  3PMN A;  9ICJ A;  4QZA A;  5IIK A;  5J0U A;  4UB2 A;  2M2T A;  4RQ5 A;  4M9J A;  1YLQ A;  3JPP A;  5J0P A;  4R66 A;  1XSP A;  4K4H A;  1V4A A;  2RFF A;  3MDC A;  4M04 A;  4X4V A;  4UAW A;  5III A;  4RWO A;  1KNY A;  3RJE A;  4EBJ A;  5HRH A;  4IG8 A;  1R89 A;  4TUQ A;  4P4O A;  4KLL A;  8ICH A;  4AT7 A;  5J0W A;  1JAJ A;  4EP7 A;  8ICG A;  1WOT A;  2BCV A;  4RQ7 A;  4I2B A;  4M9G A;  1TFY A;  3HWT A;  1ZJN A;  8ICP A;  1ZQI A;  3RJI A;  1JMS A;  5J2C A;  4NKU A;  8ICL A;  4XQ7 A;  1JN3 A;  4XQ8 A;  5CHG A;  1RPL A;  4X4U A;  1HUZ A;  1VJ7 A;  4I2C A;  1ZQY A;  1ZQM A;  5J0T A;  8ICN A;  1Q78 A;  4YMO A;  4QZF A;  3WFP A;  5J2J A;  4WCW A;  2ZHB A;  4R65 A;  3MGI A;  4JWN A;  1ZQV A;  5DED A;  4I2G A;  4AT7 B;  4X4R A;  4X5V A;  4Z6C A;  4F5N A;  1ZQT A;  1FA0 A;  1Q79 A;  4RQ8 A;  4RPY A;  3OVA A;  2BCR A;  4RPZ A;  4DO9 A;  1ZQZ A;  4P4M A;  4WBZ A;  8ICF A;  3AU2 A;  3C5G A;  4X4P A;  9ICT A;  4KLE A;  4K4G A;  4UD5 A;  3OUY B;  9ICH A;  4X4N A;  1UET A;  1KDH A;  5DB7 A;  8ICM A;  4RQ4 A;  4KLQ A;  8ICC A;  9ICE A;  2PFO A;  4MF8 A;  4NLN A;  2BCQ A;  2GWS A;  4UB1 A;  4IQV A;  7ICJ A;  5DB6 A;  3JPN A;  8ICS A;  5CP2 A;  3UQ2 A;  2ZH3 A;  3JYY A;  4KLJ A;  4QZ9 A;  4WBY A;  4I2J A;  7ICM A;  3UXP A;  9ICN A;  2ZH5 A;  3K75 D;  1MQ3 A;  4I2F A;  1ZJM A;  4E8F A;  4WC5 A;  4M9L A;  5DKW A;  4M47 A;  5HRF A;  9ICC A;  1NOM A;  4M5D A;  4FHW A;  4MFF A;  3C66 A;  1BPZ A;  4I28 A;  4PH5 A;  4WC3 A;  2ZH6 A;  1TV9 A;  2Q66 A;  5D49 A;  1ZQE A;  5CB1 A;  3MGH A;  8ICW A;  4I2I A;  3ISC A;  1RZT A;  3AU6 A;  2ISO A;  4XUS A;  9ICW A;  4M2Y A;  2BPG A;  2HHP A;  3UPS A;  4KLT A;  2DR9 A;  5J0Q A;  3C2L A;  7ICQ A;  3WFO A;  4QZG A;  5CJ7 A;  8ICV A;  3PML A;  4O9M A;  1BPD A;  3H3A A;  1VFG A;  3UXO A;  3RH4 A;  4DOA A;  1BPE A;  9ICP A;  4GXJ A;  1KEJ A;  5IIJ A;  4RQ3 A;  4I2A A;  1OU5 A;  3NYB A;  1ZQD A;  9ICU A;  4WC2 A;  4RPX A;  1ZQS A;  4FHX A;  4UD4 A;  9ICQ A;  4QZE A;  2ZH9 A;  1ZQB A;  1ZQA A;  4Z6F A;  1BPB A;  4IQW A;  4NLK A;  5HRB A;  4YD1 A;  4R64 A;  4IQT A;  4RQ6 A;  2DR8 A;  7ICF A;  1ZQN A;  4NLZ A;  3UXN A;  8ICX A;  5J2G A;  2ZH1 A;  2PFQ A;  3MDA A;  4QZH A;  3JPS A;  3ISD A;  8ICR A;  3JPQ A;  4UAZ A;  3OUY A;  5IIM A;  1ZQF A;  5DBA A;  2O1P A;  5J2E A;  9ICM A;  5J2D A;  5D46 A;  5IIO A;  3RJK A;  7ICP A;  4MFC A;  3TFR A;  4X4S A;  1UEV A;  3TFS A;  4K4I A;  2ZHA A;  4O5C A;  4UB3 A;  4AT9 B;  2PFN A;  2NRK A;  3V72 A;  8ICZ A;  4YN4 A;  5DBB A;  4GXI A;  7ICO A;  4MF2 A;  4UBB A;  9ICX A;  1MIV A;  4DOB A;  4WC1 A;  1ZQW A;  4X4T A;  1ZQX A;  3V7J A;  1XSN A;  3C18 A;  4F5R A;  7ICE A;  4ATB B;  4LZD A;  5DDM A;  4PGY A;  9ICK A;  4YMM A;  3HIY A;  4P4P A;  2BPF A;  4YCX A;  3AQM A;  4PHD A;  2O5A A;  1PX5 A;  4QZB A;  4Z6D A;  4RT2 A;  1XSL A;  4PPX A;  4Z6E A;  4QZC A;  5HRG A;  2DRB A;  4I29 A;  4M0A A;  3OVB A;  2W9M A;  2ID1 A;  9ICG A;  3OGU A;  3JZ0 A;  4KLS A;  3RH5 A;  4F5P A;  4RWP A;  4PGQ A;  4PGX A;  1ZQP A;  4KLG A;  9ICV A;  4WC4 A;  5HRI A;  7ICU A;  4FH3 A;  8ICU A;  1ZQR A;  5J2H A;  3HW8 A;  3HX0 A;  1ZQG A;  3RJG A;  3V7L A;  4E7X A;  9ICF A;  4QZD A;  5DBC A;  4RQ2 A;  4TUP A;  3GDX A;  1ZQK A;  1MQ2 A;  4QZI A;  3RJJ A;  9ICB A;  5HHH A;  5J0O A;  1R8C A;  4UAY A;  4KLH A;  1ZQU A;  3B0X A;  1MIY A;  5DEC A;  5BOM A;  5HC9 A;  4LVS A;  2ZH2 A;  3RH6 A;  4PHP A;  7ICR A;  2M2V A;  4NKT A;  2DR7 A;  4IQU A;  2ISP A;  1UEU A;  2M2U A;  4GXK A;  4I27 A;  4KLO A;  3H37 A;  5J2I A;  4MFA A;  5J0Y A;  2FMS A;  4KLU A;  1BPX A;  4UBC A;  2PBE A;  2BCU A;  1HUO A;  1MIW A;  8ICK A;  3RJH A;  5J2B A;  4KLI A;  4NXZ A;  8ICA A;  4FHP A;  3AQL A;  8ICI A;  5DB9 A;  4TUS A;  2DVI A;  5J2F A;  2DR5 A;  3AUO A;  3AQN A;  5HRL A;  4LT6 A;  3LK9 A;  3OVS A;  2BE3 A;  4KLF A;  5CR0 A;  4RQ0 A;  1NO5 A;  2DRA A;  4JWM A;  5J2K A;  3MBY A;  4X0B A;  4AT9 A;  3AQK A;  1ZQH A;  5HR9 A;  4O5K A;  4M9N A;  4X0A A;  3WFQ E;  4M9H A;  4UB4 A;  7ICI A;  7ICH A;  4ATB A;  3WFS C;  4PHE A;  4X4O A;  3H38 A;  4NM2 A;  4YD2 A;  3UQ0 A;  7ICK A;  4FHY A;  4X4Q A;  4FO6 A;  3PNC A;  7ICT A;  4YMN A;  1ZQL A;  4DOC A;  4NY8 A;  4I2H A;  2BPC A;  4FHV A;  4XRH A;  3OV7 A;  3V7K A;  2P66 A;  9ICS A;  2VAN A;  7ICV A;  4KLD A;  3L9D A;  5IIL A;  2ZH8 A;  4NM1 A;  4E80 A;  7ICS A;  5BPC A;  1TFW A;  3LQC B;  5J0X A;  5J0S A;  5CA7 A;  9ICI A;  8ICE A;  5F2V O;  5DB8 A;  5HRK A;  4WC7 A;  4R63 A;  7ICL A;  5TZV A;  3C2M A;  5CWR A;  1ZQC A;  3JPT A;  1BPY A;  4LZG A;  9ICA A;  3B0Y A;  3RJF A;  5J2A A;  3JPR A;  2FMQ A;  2PFP A;  5J29 A;  4UB5 A;  1R8B A;  8ICJ A;  4F5Q A;  5D4B A;  7ICN A;  5J0R A;  1ZQO A; 
#chains in the Genus database with same CATH topology
 1ZQQ A;  2PXI A;  4O5E A;  8ICT A;  4I2E A;  3UPQ A;  4QZ8 A;  5HRE A;  5IIN A;  3ISB A;  9ICR A;  4PHA A;  2ZH7 A;  4RQ1 A;  2BCS A;  3C2K A;  3K7D A;  4TUR A;  2I9G A;  3HJ4 A;  4O6A A;  4AT8 A;  8ICO A;  8ICQ A;  7ICG A;  8ICB A;  4RT3 A;  5HRD A;  4S3N A;  4RWQ A;  2BBH A;  2M2W A;  5HHI A;  3HJ1 A;  2IHM A;  2FCL A;  8ICY A;  2FMP A;  3JPO A;  4F5O A;  4WC6 A;  4I2D A;  4KLM A;  3H39 A;  3OWG A;  4FH5 A;  3WFR E;  5BOL A;  1ZQJ A;  1F5A A;  9ICO A;  4OAG A;  4EBK A;  4P2H A;  9ICL A;  1TVA A;  5EOZ A;  3ER8 C;  5DDY A;  4XA5 A;  2ZH4 A;  1R8A A;  1JQR A;  4RWN A;  4AT8 B;  4WC0 A;  4N7R A;  5CHE A;  3C5F A;  3PMN A;  9ICJ A;  4QZA A;  5IIK A;  5J0U A;  4UB2 A;  2M2T A;  4RQ5 A;  4M9J A;  1YLQ A;  5J0P A;  4R66 A;  3JPP A;  1XSP A;  4WQK A;  3NWI A;  4K4H A;  1V4A A;  2RFF A;  4EGW A;  3MDC A;  4M04 A;  4X4V A;  4UAW A;  5III A;  4RWO A;  1KNY A;  4JLX A;  3RJE A;  4EBJ A;  2BBJ A;  5HRH A;  4IG8 A;  1R89 A;  4TUQ A;  4P4O A;  4KLL A;  8ICH A;  4AT7 A;  5J0W A;  1JAJ A;  4EP7 A;  2IUB A;  4MKP A;  1WOT A;  8ICG A;  2BCV A;  4RQ7 A;  4I2B A;  4M9G A;  1TFY A;  3HWT A;  1ZJN A;  8ICP A;  1ZQI A;  3RJI A;  1JMS A;  5J2C A;  4NKU A;  8ICL A;  4XQ7 A;  1JN3 A;  4KM5 A;  4XQ8 A;  5CHG A;  4X4U A;  1RPL A;  1HUZ A;  1VJ7 A;  4I2C A;  1ZQY A;  1ZQM A;  5J0T A;  8ICN A;  1Q78 A;  4YMO A;  4QZF A;  3WFP A;  5J2J A;  4WCW A;  2ZHB A;  4R65 A;  3MGI A;  4JWN A;  1ZQV A;  4WH5 A;  5DED A;  4I2G A;  4AT7 B;  4X4R A;  4X5V A;  4K98 A;  4Z6C A;  3EF2 A;  4F5N A;  1ZQT A;  1FA0 A;  1Q79 A;  4RQ8 A;  4OAI Z;  3OVA A;  4RPY A;  2BCR A;  4RPZ A;  4DO9 A;  1ZQZ A;  4P4M A;  4WBZ A;  8ICF A;  3AU2 A;  3C5G A;  4X4P A;  9ICT A;  4KLE A;  4K4G A;  4UD5 A;  3OUY B;  9ICH A;  4X4N A;  1UET A;  2HN1 A;  4WQL A;  1KDH A;  5DB7 A;  8ICM A;  4RQ4 A;  4KLQ A;  4K97 A;  8ICC A;  9ICE A;  2PFO A;  4MF8 A;  4NLN A;  2BCQ A;  2GWS A;  4UB1 A;  4IQV A;  4K9A A;  7ICJ A;  5DB6 A;  3JPN A;  8ICS A;  5CP2 A;  3UQ2 A;  2ZH3 A;  4O69 A;  3JYY A;  4KLJ A;  4QZ9 A;  4WBY A;  4I2J A;  7ICM A;  3UXP A;  9ICN A;  2ZH5 A;  3K75 D;  1MQ3 A;  4I2F A;  1ZJM A;  4E8F A;  4WC5 A;  4M9L A;  5DKW A;  4M47 A;  5HRF A;  9ICC A;  1NOM A;  4M5D A;  4FHW A;  4MFF A;  3C66 A;  1BPZ A;  4I28 A;  4PH5 A;  2ZH6 A;  4O67 A;  4WC3 A;  1TV9 A;  3CK6 A;  2Q66 A;  5D49 A;  1ZQE A;  5CB1 A;  3MGH A;  8ICW A;  4I2I A;  3ISC A;  1RZT A;  3AU6 A;  2ISO A;  4XUS A;  9ICW A;  4M2Y A;  2BPG A;  4EV6 A;  2HHP A;  2GA9 D;  3UPS A;  4KLT A;  4EEB A;  2DR9 A;  5J0Q A;  3C2L A;  7ICQ A;  3WFO A;  4QZG A;  5CJ7 A;  8ICV A;  3PML A;  4O9M A;  4LEV A;  1BPD A;  3H3A A;  5CFS A;  1VFG A;  3UXO A;  3RH4 A;  4DOA A;  1BPE A;  9ICP A;  4GXJ A;  1KEJ A;  5IIJ A;  4RQ3 A;  4I2A A;  1OU5 A;  3NYB A;  1ZQD A;  9ICU A;  4WC2 A;  4RPX A;  1ZQS A;  4K9B A;  4FHX A;  4UD4 A;  9ICQ A;  4QZE A;  2ZH9 A;  1ZQB A;  1ZQA A;  4K99 A;  4Z6F A;  1BPB A;  4IQW A;  4NLK A;  5HRB A;  5J0R A;  4YD1 A;  3MCR A;  2B51 A;  4OAF A;  5CFU A;  4R64 A;  4IQT A;  2DR8 A;  4RQ6 A;  7ICF A;  1ZQN A;  4NLZ A;  3UXN A;  8ICX A;  2GAF D;  5J2G A;  2ZH1 A;  2PFQ A;  3MDA A;  4QZH A;  3JPS A;  3ISD A;  8ICR A;  3JPQ A;  4LEY A;  4UAZ A;  3JCF A;  3OUY A;  5IIM A;  1ZQF A;  5DBA A;  4LEZ A;  2O1P A;  5J2E A;  1GPJ A;  9ICM A;  5J2D A;  5D46 A;  5IIO A;  3RJK A;  7ICP A;  4MFC A;  3TFR A;  4NXV A;  1UEV A;  4X4S A;  3TFS A;  4K4I A;  2ZHA A;  4O5C A;  4JLZ A;  4XJE A;  4UB3 A;  4AT9 B;  2PFN A;  2NRK A;  3V72 A;  8ICZ A;  4YN4 A;  5DBB A;  4GXI A;  7ICO A;  4MF2 A;  4UBB A;  9ICX A;  1MIV A;  4DOB A;  4EED A;  4WC1 A;  4X4T A;  1ZQW A;  1ZQX A;  3V7J A;  1XSN A;  2IHO A;  4NXW A;  3C18 A;  4NXU A;  4F5R A;  7ICE A;  3NKU A;  4ATB B;  4LZD A;  5DDM A;  4PGY A;  9ICK A;  4YMM A;  3HIY A;  4P4P A;  2BPF A;  4YCX A;  3AQM A;  4PHD A;  2O5A A;  1PX5 A;  4QZB A;  4Z6D A;  4RT2 A;  1XSL A;  4PPX A;  4QZC A;  3NVO A;  4Z6E A;  2DRB A;  5HRG A;  5B3P A;  4I29 A;  4M0A A;  3OVB A;  2W9M A;  2ID1 A;  9ICG A;  3OGU A;  3JZ0 A;  4KLS A;  3RH5 A;  4F5P A;  4RWP A;  4PGQ A;  4PGX A;  1ZQP A;  4KLG A;  9ICV A;  4WC4 A;  5HRI A;  7ICU A;  4FH3 A;  8ICU A;  1ZQR A;  5J2H A;  3HW8 A;  3HX0 A;  1ZQG A;  3RJG A;  4E7X A;  3V7L A;  9ICF A;  4K96 A;  5DBC A;  4QZD A;  4RQ2 A;  4TUP A;  3GDX A;  1ZQK A;  1MQ2 A;  4QZI A;  3RJJ A;  9ICB A;  5HHH A;  5J0O A;  1R8C A;  4UAY A;  4KLH A;  1ZQU A;  3B0X A;  1MIY A;  5DEC A;  5BOM A;  5HC9 A;  4LVS A;  2ZH2 A;  3RH6 A;  4PHP A;  7ICR A;  2M2V A;  4FO1 A;  4NKT A;  2DR7 A;  4IQU A;  2ISP A;  1UEU A;  2M2U A;  4GXK A;  4I27 A;  4KLO A;  3H37 A;  5J2I A;  4MFA A;  5CFT A;  5J0Y A;  2FMS A;  4OAH A;  4KLU A;  1BPX A;  4UBC A;  2PBE A;  2BCU A;  1HUO A;  1MIW A;  8ICK A;  3RJH A;  5J2B A;  4KLI A;  4NXZ A;  8ICA A;  4FHP A;  3AQL A;  8ICI A;  2EWR A;  5DB9 A;  4TUS A;  2DVI A;  5J2F A;  2DR5 A;  3AUO A;  3AQN A;  5HRL A;  4NXT A;  4O68 A;  3ER9 B;  4LT6 A;  3LK9 A;  3OVS A;  2BE3 A;  4KLF A;  5CR0 A;  5JTG A;  4RQ0 A;  5B3Q A;  2DRA A;  5D61 A;  4JWM A;  5J2K A;  3MBY A;  4HX0 A;  4X0B A;  4AT9 A;  2B4V A;  3AQK A;  1ZQH A;  4K8V A;  5HR9 A;  4O5K A;  5D62 A;  4M9N A;  4X0A A;  4I0U A;  3WFQ E;  4LEW A;  4M9H A;  4UB4 A;  7ICI A;  7ICH A;  4ATB A;  4KB6 A;  3WFS C;  4PHE A;  4X4O A;  3H38 A;  4NM2 A;  4YD2 A;  3UQ0 A;  7ICK A;  4FHY A;  4X4Q A;  3ERC C;  4FO6 A;  2B56 A;  3PNC A;  4NXX A;  7ICT A;  4YMN A;  1ZQL A;  4DOC A;  4NY8 A;  4I2H A;  2BPC A;  4FHV A;  4XRH A;  3OV7 A;  3V7K A;  2P66 A;  9ICS A;  5D63 A;  2VAN A;  7ICV A;  4KLD A;  3L9D A;  5IIL A;  2ZH8 A;  2HN2 A;  4NM1 A;  4E80 A;  7ICS A;  5BPC A;  1TFW A;  3LQC B;  5J0X A;  4WOY A;  5J0S A;  5CA7 A;  9ICI A;  8ICE A;  5F2V O;  5DB8 A;  5HRK A;  4WC7 A;  4R63 A;  7ICL A;  5TZV A;  3C2M A;  5CWR A;  1ZQC A;  3JPT A;  1BPY A;  4LZG A;  9ICA A;  3B0Y A;  3RJF A;  5J2A A;  3JPR A;  2FMQ A;  2PFP A;  3PHZ A;  5J29 A;  4UB5 A;  1R8B A;  8ICJ A;  4F5Q A;  5D4B A;  7ICN A;  1NO5 A;  1ZQO A; 
#chains in the Genus database with same CATH homology
 1ZQQ A;  2PXI A;  4O5E A;  8ICT A;  4I2E A;  3UPQ A;  4QZ8 A;  5HRE A;  5IIN A;  3ISB A;  9ICR A;  4PHA A;  2ZH7 A;  4RQ1 A;  2BCS A;  3C2K A;  4TUR A;  2I9G A;  3HJ4 A;  4AT8 A;  8ICO A;  8ICQ A;  7ICG A;  8ICB A;  4RT3 A;  5HRD A;  4S3N A;  4RWQ A;  2M2W A;  5HHI A;  3HJ1 A;  2IHM A;  8ICY A;  2FMP A;  3JPO A;  4F5O A;  4WC6 A;  4I2D A;  4KLM A;  3H39 A;  4FH5 A;  3WFR E;  5BOL A;  1ZQJ A;  1F5A A;  9ICO A;  4EBK A;  4P2H A;  9ICL A;  1TVA A;  5EOZ A;  5DDY A;  4XA5 A;  2ZH4 A;  1R8A A;  1JQR A;  4RWN A;  4AT8 B;  4WC0 A;  3C5F A;  3PMN A;  9ICJ A;  4QZA A;  5IIK A;  5J0U A;  4UB2 A;  2M2T A;  4RQ5 A;  4M9J A;  1YLQ A;  3JPP A;  5J0P A;  4R66 A;  1XSP A;  4K4H A;  1V4A A;  2RFF A;  3MDC A;  4M04 A;  4X4V A;  4UAW A;  5III A;  4RWO A;  1KNY A;  3RJE A;  4EBJ A;  5HRH A;  4IG8 A;  1R89 A;  4TUQ A;  4P4O A;  4KLL A;  8ICH A;  4AT7 A;  5J0W A;  1JAJ A;  4EP7 A;  8ICG A;  1WOT A;  2BCV A;  4RQ7 A;  4I2B A;  4M9G A;  1TFY A;  3HWT A;  1ZJN A;  8ICP A;  1ZQI A;  3RJI A;  1JMS A;  5J2C A;  4NKU A;  8ICL A;  4XQ7 A;  1JN3 A;  4XQ8 A;  5CHG A;  1RPL A;  4X4U A;  1HUZ A;  1VJ7 A;  4I2C A;  1ZQY A;  1ZQM A;  5J0T A;  8ICN A;  1Q78 A;  4YMO A;  4QZF A;  3WFP A;  5J2J A;  4WCW A;  2ZHB A;  4R65 A;  3MGI A;  4JWN A;  1ZQV A;  5DED A;  4I2G A;  4AT7 B;  4X4R A;  4X5V A;  4Z6C A;  4F5N A;  1ZQT A;  1FA0 A;  1Q79 A;  4RQ8 A;  4RPY A;  3OVA A;  2BCR A;  4RPZ A;  4DO9 A;  1ZQZ A;  4P4M A;  4WBZ A;  8ICF A;  3AU2 A;  3C5G A;  4X4P A;  9ICT A;  4KLE A;  4K4G A;  4UD5 A;  3OUY B;  9ICH A;  4X4N A;  1UET A;  1KDH A;  5DB7 A;  8ICM A;  4RQ4 A;  4KLQ A;  8ICC A;  9ICE A;  2PFO A;  4MF8 A;  4NLN A;  2BCQ A;  2GWS A;  4UB1 A;  4IQV A;  7ICJ A;  5DB6 A;  3JPN A;  8ICS A;  5CP2 A;  3UQ2 A;  2ZH3 A;  3JYY A;  4KLJ A;  4QZ9 A;  4WBY A;  4I2J A;  7ICM A;  3UXP A;  9ICN A;  2ZH5 A;  3K75 D;  1MQ3 A;  4I2F A;  1ZJM A;  4E8F A;  4WC5 A;  4M9L A;  5DKW A;  4M47 A;  5HRF A;  9ICC A;  1NOM A;  4M5D A;  4FHW A;  4MFF A;  3C66 A;  1BPZ A;  4I28 A;  4PH5 A;  4WC3 A;  2ZH6 A;  1TV9 A;  2Q66 A;  5D49 A;  1ZQE A;  5CB1 A;  3MGH A;  8ICW A;  4I2I A;  3ISC A;  1RZT A;  3AU6 A;  2ISO A;  4XUS A;  9ICW A;  4M2Y A;  2BPG A;  2HHP A;  3UPS A;  4KLT A;  2DR9 A;  5J0Q A;  3C2L A;  7ICQ A;  3WFO A;  4QZG A;  5CJ7 A;  8ICV A;  3PML A;  4O9M A;  1BPD A;  3H3A A;  1VFG A;  3UXO A;  3RH4 A;  4DOA A;  1BPE A;  9ICP A;  4GXJ A;  1KEJ A;  5IIJ A;  4RQ3 A;  4I2A A;  1OU5 A;  3NYB A;  1ZQD A;  9ICU A;  4WC2 A;  4RPX A;  1ZQS A;  4FHX A;  4UD4 A;  9ICQ A;  4QZE A;  2ZH9 A;  1ZQB A;  1ZQA A;  4Z6F A;  1BPB A;  4IQW A;  4NLK A;  5HRB A;  4YD1 A;  4R64 A;  4IQT A;  4RQ6 A;  2DR8 A;  7ICF A;  1ZQN A;  4NLZ A;  3UXN A;  8ICX A;  5J2G A;  2ZH1 A;  2PFQ A;  3MDA A;  4QZH A;  3JPS A;  3ISD A;  8ICR A;  3JPQ A;  4UAZ A;  3OUY A;  5IIM A;  1ZQF A;  5DBA A;  2O1P A;  5J2E A;  9ICM A;  5J2D A;  5D46 A;  5IIO A;  3RJK A;  7ICP A;  4MFC A;  3TFR A;  4X4S A;  1UEV A;  3TFS A;  4K4I A;  2ZHA A;  4O5C A;  4UB3 A;  4AT9 B;  2PFN A;  2NRK A;  3V72 A;  8ICZ A;  4YN4 A;  5DBB A;  4GXI A;  7ICO A;  4MF2 A;  4UBB A;  9ICX A;  1MIV A;  4DOB A;  4WC1 A;  1ZQW A;  4X4T A;  1ZQX A;  3V7J A;  1XSN A;  3C18 A;  4F5R A;  7ICE A;  4ATB B;  4LZD A;  5DDM A;  4PGY A;  9ICK A;  4YMM A;  3HIY A;  4P4P A;  2BPF A;  4YCX A;  3AQM A;  4PHD A;  2O5A A;  1PX5 A;  4QZB A;  4Z6D A;  4RT2 A;  1XSL A;  4PPX A;  4Z6E A;  4QZC A;  5HRG A;  2DRB A;  4I29 A;  4M0A A;  3OVB A;  2W9M A;  2ID1 A;  9ICG A;  3OGU A;  3JZ0 A;  4KLS A;  3RH5 A;  4F5P A;  4RWP A;  4PGQ A;  4PGX A;  1ZQP A;  4KLG A;  9ICV A;  4WC4 A;  5HRI A;  7ICU A;  4FH3 A;  8ICU A;  1ZQR A;  5J2H A;  3HW8 A;  3HX0 A;  1ZQG A;  3RJG A;  3V7L A;  4E7X A;  9ICF A;  4QZD A;  5DBC A;  4RQ2 A;  4TUP A;  3GDX A;  1ZQK A;  1MQ2 A;  4QZI A;  3RJJ A;  9ICB A;  5HHH A;  5J0O A;  1R8C A;  4UAY A;  4KLH A;  1ZQU A;  3B0X A;  1MIY A;  5DEC A;  5BOM A;  5HC9 A;  4LVS A;  2ZH2 A;  3RH6 A;  4PHP A;  7ICR A;  2M2V A;  4NKT A;  2DR7 A;  4IQU A;  2ISP A;  1UEU A;  2M2U A;  4GXK A;  4I27 A;  4KLO A;  3H37 A;  5J2I A;  4MFA A;  5J0Y A;  2FMS A;  4KLU A;  1BPX A;  4UBC A;  2PBE A;  2BCU A;  1HUO A;  1MIW A;  8ICK A;  3RJH A;  5J2B A;  4KLI A;  4NXZ A;  8ICA A;  4FHP A;  3AQL A;  8ICI A;  5DB9 A;  4TUS A;  2DVI A;  5J2F A;  2DR5 A;  3AUO A;  3AQN A;  5HRL A;  4LT6 A;  3LK9 A;  3OVS A;  2BE3 A;  4KLF A;  5CR0 A;  4RQ0 A;  1NO5 A;  2DRA A;  4JWM A;  5J2K A;  3MBY A;  4X0B A;  4AT9 A;  3AQK A;  1ZQH A;  5HR9 A;  4O5K A;  4M9N A;  4X0A A;  3WFQ E;  4M9H A;  4UB4 A;  7ICI A;  7ICH A;  4ATB A;  3WFS C;  4PHE A;  4X4O A;  3H38 A;  4NM2 A;  4YD2 A;  3UQ0 A;  7ICK A;  4FHY A;  4X4Q A;  4FO6 A;  3PNC A;  7ICT A;  4YMN A;  1ZQL A;  4DOC A;  4NY8 A;  4I2H A;  2BPC A;  4FHV A;  4XRH A;  3OV7 A;  3V7K A;  2P66 A;  9ICS A;  2VAN A;  7ICV A;  4KLD A;  3L9D A;  5IIL A;  2ZH8 A;  4NM1 A;  4E80 A;  7ICS A;  5BPC A;  1TFW A;  3LQC B;  5J0X A;  5J0S A;  5CA7 A;  9ICI A;  8ICE A;  5F2V O;  5DB8 A;  5HRK A;  4WC7 A;  4R63 A;  7ICL A;  5TZV A;  3C2M A;  5CWR A;  1ZQC A;  3JPT A;  1BPY A;  4LZG A;  9ICA A;  3B0Y A;  3RJF A;  5J2A A;  3JPR A;  2FMQ A;  2PFP A;  5J29 A;  4UB5 A;  1R8B A;  8ICJ A;  4F5Q A;  5D4B A;  7ICN A;  5J0R A;  1ZQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...