4SGBI

Structure of the complex of streptomyces griseus proteinase b and polypeptide chymotrypsin inhibitor-1 from russet burbank potato tubers at 2.1 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
b'PICTNCCAGYKGCNYYSANGAFICEGQSDPKKPKACPLNCDPHIAYSKCPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEINASE B
publication title Structure of the complex of Streptomyces griseus proteinase B and polypeptide chymotrypsin inhibitor-1 from Russet Burbank potato tubers at 2.1 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Complex(serine proteinase-inhibitor)
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1989-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4sgbI00
1BMOA 1R0RI 1TUSA 2JZMA 1HJAI 2KMOA 1BUSA 1OVOA 1Y1CA 2LEOA 2KMRA 2JXDA 1TIHA 1OYVI 2KCXA 2WCYA 1FYBA 2M5XA 2SGQI 1OMUA 1HDLA 1N13A 1CSOI 2N52A 2NU1I 2NU2I 1PCEA 1PJUA 2GKRI 1SGQI 2SGEI 2KMQA 1KMAA 2NU0I 3SGQI 2SGPI 2F3CI 1M8CA 1YTPA 2NU3I 1SGEI 1SGDI 1NUBA 1CT2I 1IY6A 1CE3A 2V53A 3TJQA 2GKVA 1UVFA 1TBQR 1Y1BA 1DS3I 2SGFI 1H0ZA 1IY5A 1LR8A 4GI3C 1CHOI 1LR7A 1SGRI 1HPTA 2P6AC 2OVOA 2ARPF 1IW4A 2GKTI 5DAEA 1LR9A 1DS2I 3SGBI 1M8BA 1CGJI 1SGYI 1UVGA 4SGBI 2BUSA 1YU6C 2KMPA 1CT4I 1CT0I 1TGSI 3B4VC 2XRCA 1SGNI 1AN1I 1PPFI 2N17A 3HH2C 3OVOA 1TURA 1CGII 4OVOA 1TBRR 2QQDA 2ERWA 2QQCA 3SEKC 1UUCA 2NU4I 1OMTA 1MT1A 2B0UC 2JYYA 2N71A 5JHWC 2SGDI 4HGUA 1SGPI 1Z7KB 3QTLD
chains in the Genus database with same CATH superfamily
1BMOA 2ROWA 1R0RI 1TUSA 2JZMA 4L9MA 1HJAI 2KMOA 1BUSA 1OVOA 1Y1CA 1K7VA 2LEOA 5J8CA 1P9GA 2KMRA 2JXDA 3TOAA 1K7UA 4UXHA 1TIHA 2JA1A 1OYVI 3FSXA 2V1CC 5EX0A 3UGDA 2LB7A 4UXJA 2KCXA 1Q9BA 2WCYA 1FYBA 2M5XA 2QQEA 9WGAA 3VDPA 2SGQI 5FUVA 3BJIA 1U5KA 2CWGA 1R79A 3TOBA 1OMUA 2DKVA 1HDLA 2J9RA 1N13A 1P9ZA 1S20A 1CSOI 5HI7A 3OXLA 2N52A 2NU1I 2ENZA 2OZUA 5FUXA 2DB6A 3FC3A 3UEJA 1FARA 4WP4A 4FKDA 2NU2I 1WGCA 1PCEA 3UFFA 2GIVA 1V1HA 1FY7A 3OXGA 4E1RA 1PJUA 3MEKA 2L8EA 5FUWA 2J87A 2B8TA 2GKRI 1SGQI 2SGEI 3VE5A 2KMQA 1ULKA 2OD1A 1KMAA 3E2IA 4MPIA 2NU0I 1NXUA 5EX3A 3E59A 3PDNA 3SGQI 1WTJA 3R5DA 2X3TA 3RU0A 2RIJA 2SGPI 2F3CI 2W0TA 1M8CA 1W3SA 1YTPA 2ELIA 2NU3I 2X52A 1SGEI 4E1PA 1SGDI 1UHAA 1NUBA 1CT2I 1ULMA 1VDDA 1MJBA 2CWFA 3R5CA 1TBOA 2Y0MA 3GOXA 2ORVA 1IY6A 1FAQA 1CE3A 3UGLA 2V53A 2YQPA 3TO9A 3TJQA 5E3PA 2GKVA 2L7XA 4B6DA 1UVFA 1TBQR 1DS3I 1Y1BA 2GVIA 2SGFI 2YUUA 1H0ZA 1MJAA 1WKXA 5HQ8A 3KY9A 1LR8A 3R5AA 7WGAA 4GI3C 1IY5A 1CHOI 3FSYA 2RC4A 3QWPA 4JCVE 5J8FA 5CCLA 3TO7A 1LR7A 1SGRI 2K9HA 5E3QA 1RFHA 2CWHA 2WVJA 1KBEA 1HPTA 2PQ8A 2P6AC 2OVOA 4UXIA 2ARPF 1IW4A 2GKTI 2LUYA 3QAHA 5DAEA 2CJSC 1LR9A 2E5RA 1DS2I 1XBTA 3SGBI 1M8BA 1V1IA 1CGJI 5FUYA 1SGYI 1UVGA 4SGBI 1XA6A 2BUSA 2DIPA 2WGCA 4AMLA 3R5BA 1YU6C 2KMPA 1CT4I 1PTRA 1TOTA 1K7TA 1WGTA 1Y8FA 3D00A 1CT0I 1TGSI 3B4VC 2ORWA 2XRCA 1SGNI 1AN1I 5CCMA 1PPFI 5E3RA 1TBNA 2N17A 2A20A 3OXFA 2UVOA 1KBFA 3OL0A 2E73A 3HH2C 3OVOA 2OU2A 1MJ9A 1TURA 1CGII 2ODDA 4OVOA 3CXLA 1X74A 1TBRR 1W4RA 2ENNA 2QQDA 3UEYA 1HEVA 2ERWA 2QQCA 3SEKC 1UUCA 2N1AB 2QQ0A 1XX6A 2NU4I 2JW6A 1OMTA 3VDUA 4A24A 1MT1A 2B0UC 2V1CA 2VRWB 3UOEA 2JYYA 2N71A 5JHWC 2FNFX 1PTQA 3TO6A 1Z2IA 2QPOA 3UGIA 2SGDI 1ULNA 2UZ3A 4HGUA 1SGPI 1Z7KB 4DNCA 1X4SA 3QTLD
chains in the Genus database with same CATH topology
1BMOA 2ROWA 1R0RI 1TUSA 2JZMA 4L9MA 1HJAI 2KMOA 1BUSA 1OVOA 1Y1CA 2LEOA 2KMRA 2JXDA 4UXHA 5EX0A 1TIHA 2JA1A 1OYVI 2V1CC 3UGDA 4UXJA 2KCXA 2WCYA 1FYBA 2M5XA 2QQEA 3VDPA 2SGQI 5FUVA 3BJIA 1U5KA 1R79A 1OMUA 1HDLA 2J9RA 1N13A 1CSOI 5HI7A 3OXLA 2N52A 2NU1I 2ENZA 5FUXA 2DB6A 3FC3A 3UEJA 1FARA 4FKDA 2NU2I 1PCEA 3UFFA 1V1HA 3OXGA 4E1RA 1PJUA 3MEKA 2L8EA 5FUWA 2J87A 2B8TA 2GKRI 1SGQI 2SGEI 3VE5A 2KMQA 1KMAA 2OD1A 3E2IA 2NU0I 5EX3A 3E59A 3PDNA 3SGQI 3RU0A 2SGPI 2F3CI 2W0TA 1M8CA 1W3SA 1YTPA 2ELIA 2NU3I 1SGEI 4E1PA 1SGDI 1NUBA 1CT2I 1VDDA 1FAQA 1TBOA 3GOXA 2ORVA 1IY6A 1CE3A 3UGLA 2V53A 2YQPA 3TJQA 2GKVA 2L7XA 4B6DA 1UVFA 1TBQR 1Y1BA 1DS3I 2GVIA 2SGFI 2YUUA 1H0ZA 5HQ8A 3KY9A 1LR8A 1IY5A 4GI3C 1CHOI 3QWPA 4JCVE 5CCLA 1LR7A 1SGRI 2K9HA 1RFHA 2WVJA 1KBEA 1HPTA 2P6AC 2OVOA 4UXIA 2ARPF 1IW4A 2GKTI 2LUYA 5DAEA 2CJSC 1LR9A 2E5RA 1DS2I 1XBTA 3SGBI 1M8BA 1CGJI 1V1IA 5FUYA 1SGYI 1UVGA 4SGBI 1XA6A 2BUSA 2DIPA 1YU6C 2KMPA 1CT4I 1PTRA 1TOTA 1Y8FA 3D00A 1CT0I 1TGSI 3B4VC 2ORWA 2XRCA 1SGNI 1AN1I 5CCMA 1PPFI 1TBNA 2N17A 2A20A 3OXFA 1KBFA 3OL0A 2E73A 3HH2C 3OVOA 1TURA 1CGII 2ODDA 4OVOA 3CXLA 1X74A 1TBRR 1W4RA 2ENNA 2QQDA 3UEYA 2ERWA 2QQCA 3SEKC 1UUCA 2N1AB 2QQ0A 1XX6A 2NU4I 2JW6A 1OMTA 3VDUA 4A24A 1MT1A 2B0UC 2V1CA 2VRWB 2JYYA 2N71A 5JHWC 2FNFX 1PTQA 2QPOA 3UGIA 2SGDI 2UZ3A 4HGUA 1SGPI 1Z7KB 1X4SA 3QTLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  1R0R I;  1TUS A;  2JZM A;  1HJA I;  2KMO A;  1BUS A;  1OVO A;  1Y1C A;  2LEO A;  2KMR A;  2JXD A;  1TIH A;  1OYV I;  2KCX A;  2WCY A;  1FYB A;  2M5X A;  2SGQ I;  1OMU A;  1HDL A;  1N13 A;  1CSO I;  2N52 A;  2NU1 I;  2NU2 I;  1PCE A;  1PJU A;  2GKR I;  1SGQ I;  2SGE I;  2KMQ A;  1KMA A;  2NU0 I;  3SGQ I;  2SGP I;  2F3C I;  1M8C A;  1YTP A;  2NU3 I;  1SGE I;  1SGD I;  1NUB A;  1CT2 I;  1IY6 A;  1CE3 A;  2V53 A;  3TJQ A;  2GKV A;  1UVF A;  1TBQ R;  1Y1B A;  1DS3 I;  2SGF I;  1H0Z A;  1IY5 A;  1LR8 A;  4GI3 C;  1CHO I;  1LR7 A;  1SGR I;  1HPT A;  2P6A C;  2OVO A;  2ARP F;  1IW4 A;  2GKT I;  5DAE A;  1LR9 A;  1DS2 I;  3SGB I;  1M8B A;  1CGJ I;  1SGY I;  1UVG A;  4SGB I;  2BUS A;  1YU6 C;  2KMP A;  1CT4 I;  1CT0 I;  1TGS I;  3B4V C;  2XRC A;  1SGN I;  1AN1 I;  1PPF I;  2N17 A;  3HH2 C;  3OVO A;  1TUR A;  1CGI I;  4OVO A;  1TBR R;  2QQD A;  2ERW A;  2QQC A;  3SEK C;  1UUC A;  2NU4 I;  1OMT A;  1MT1 A;  2B0U C;  2JYY A;  2N71 A;  5JHW C;  2SGD I;  4HGU A;  1SGP I;  1Z7K B;  3QTL D; 
#chains in the Genus database with same CATH topology
 1BMO A;  2ROW A;  1R0R I;  1TUS A;  2JZM A;  4L9M A;  1HJA I;  2KMO A;  1BUS A;  1OVO A;  1Y1C A;  1K7V A;  2LEO A;  5J8C A;  1P9G A;  2KMR A;  2JXD A;  3TOA A;  1K7U A;  4UXH A;  1TIH A;  2JA1 A;  1OYV I;  3FSX A;  2V1C C;  5EX0 A;  3UGD A;  2LB7 A;  4UXJ A;  2KCX A;  1Q9B A;  2WCY A;  1FYB A;  2M5X A;  2QQE A;  9WGA A;  3VDP A;  2SGQ I;  5FUV A;  3BJI A;  1U5K A;  2CWG A;  1R79 A;  3TOB A;  1OMU A;  2DKV A;  1HDL A;  2J9R A;  1N13 A;  1P9Z A;  1S20 A;  1CSO I;  5HI7 A;  3OXL A;  2N52 A;  2NU1 I;  2ENZ A;  2OZU A;  5FUX A;  2DB6 A;  3FC3 A;  3UEJ A;  1FAR A;  4WP4 A;  4FKD A;  2NU2 I;  1WGC A;  1PCE A;  3UFF A;  2GIV A;  1V1H A;  1FY7 A;  3OXG A;  4E1R A;  1PJU A;  3MEK A;  2L8E A;  5FUW A;  2J87 A;  2B8T A;  2GKR I;  1SGQ I;  2SGE I;  3VE5 A;  2KMQ A;  1ULK A;  2OD1 A;  1KMA A;  3E2I A;  4MPI A;  2NU0 I;  1NXU A;  5EX3 A;  3E59 A;  3PDN A;  3SGQ I;  1WTJ A;  3R5D A;  2X3T A;  3RU0 A;  2RIJ A;  2SGP I;  2F3C I;  2W0T A;  1M8C A;  1W3S A;  1YTP A;  2ELI A;  2NU3 I;  2X52 A;  1SGE I;  4E1P A;  1SGD I;  1UHA A;  1NUB A;  1CT2 I;  1ULM A;  1VDD A;  1MJB A;  2CWF A;  3R5C A;  1TBO A;  2Y0M A;  3GOX A;  2ORV A;  1IY6 A;  1FAQ A;  1CE3 A;  3UGL A;  2V53 A;  2YQP A;  3TO9 A;  3TJQ A;  5E3P A;  2GKV A;  2L7X A;  4B6D A;  1UVF A;  1TBQ R;  1DS3 I;  1Y1B A;  2GVI A;  2SGF I;  2YUU A;  1H0Z A;  1MJA A;  1WKX A;  5HQ8 A;  3KY9 A;  1LR8 A;  3R5A A;  7WGA A;  4GI3 C;  1IY5 A;  1CHO I;  3FSY A;  2RC4 A;  3QWP A;  4JCV E;  5J8F A;  5CCL A;  3TO7 A;  1LR7 A;  1SGR I;  2K9H A;  5E3Q A;  1RFH A;  2CWH A;  2WVJ A;  1KBE A;  1HPT A;  2PQ8 A;  2P6A C;  2OVO A;  4UXI A;  2ARP F;  1IW4 A;  2GKT I;  2LUY A;  3QAH A;  5DAE A;  2CJS C;  1LR9 A;  2E5R A;  1DS2 I;  1XBT A;  3SGB I;  1M8B A;  1V1I A;  1CGJ I;  5FUY A;  1SGY I;  1UVG A;  4SGB I;  1XA6 A;  2BUS A;  2DIP A;  2WGC A;  4AML A;  3R5B A;  1YU6 C;  2KMP A;  1CT4 I;  1PTR A;  1TOT A;  1K7T A;  1WGT A;  1Y8F A;  3D00 A;  1CT0 I;  1TGS I;  3B4V C;  2ORW A;  2XRC A;  1SGN I;  1AN1 I;  5CCM A;  1PPF I;  5E3R A;  1TBN A;  2N17 A;  2A20 A;  3OXF A;  2UVO A;  1KBF A;  3OL0 A;  2E73 A;  3HH2 C;  3OVO A;  2OU2 A;  1MJ9 A;  1TUR A;  1CGI I;  2ODD A;  4OVO A;  3CXL A;  1X74 A;  1TBR R;  1W4R A;  2ENN A;  2QQD A;  3UEY A;  1HEV A;  2ERW A;  2QQC A;  3SEK C;  1UUC A;  2N1A B;  2QQ0 A;  1XX6 A;  2NU4 I;  2JW6 A;  1OMT A;  3VDU A;  4A24 A;  1MT1 A;  2B0U C;  2V1C A;  2VRW B;  3UOE A;  2JYY A;  2N71 A;  5JHW C;  2FNF X;  1PTQ A;  3TO6 A;  1Z2I A;  2QPO A;  3UGI A;  2SGD I;  1ULN A;  2UZ3 A;  4HGU A;  1SGP I;  1Z7K B;  4DNC A;  1X4S A;  3QTL D; 
#chains in the Genus database with same CATH homology
 1BMO A;  2ROW A;  1R0R I;  1TUS A;  2JZM A;  4L9M A;  1HJA I;  2KMO A;  1BUS A;  1OVO A;  1Y1C A;  2LEO A;  2KMR A;  2JXD A;  4UXH A;  5EX0 A;  1TIH A;  2JA1 A;  1OYV I;  2V1C C;  3UGD A;  4UXJ A;  2KCX A;  2WCY A;  1FYB A;  2M5X A;  2QQE A;  3VDP A;  2SGQ I;  5FUV A;  3BJI A;  1U5K A;  1R79 A;  1OMU A;  1HDL A;  2J9R A;  1N13 A;  1CSO I;  5HI7 A;  3OXL A;  2N52 A;  2NU1 I;  2ENZ A;  5FUX A;  2DB6 A;  3FC3 A;  3UEJ A;  1FAR A;  4FKD A;  2NU2 I;  1PCE A;  3UFF A;  1V1H A;  3OXG A;  4E1R A;  1PJU A;  3MEK A;  2L8E A;  5FUW A;  2J87 A;  2B8T A;  2GKR I;  1SGQ I;  2SGE I;  3VE5 A;  2KMQ A;  1KMA A;  2OD1 A;  3E2I A;  2NU0 I;  5EX3 A;  3E59 A;  3PDN A;  3SGQ I;  3RU0 A;  2SGP I;  2F3C I;  2W0T A;  1M8C A;  1W3S A;  1YTP A;  2ELI A;  2NU3 I;  1SGE I;  4E1P A;  1SGD I;  1NUB A;  1CT2 I;  1VDD A;  1FAQ A;  1TBO A;  3GOX A;  2ORV A;  1IY6 A;  1CE3 A;  3UGL A;  2V53 A;  2YQP A;  3TJQ A;  2GKV A;  2L7X A;  4B6D A;  1UVF A;  1TBQ R;  1Y1B A;  1DS3 I;  2GVI A;  2SGF I;  2YUU A;  1H0Z A;  5HQ8 A;  3KY9 A;  1LR8 A;  1IY5 A;  4GI3 C;  1CHO I;  3QWP A;  4JCV E;  5CCL A;  1LR7 A;  1SGR I;  2K9H A;  1RFH A;  2WVJ A;  1KBE A;  1HPT A;  2P6A C;  2OVO A;  4UXI A;  2ARP F;  1IW4 A;  2GKT I;  2LUY A;  5DAE A;  2CJS C;  1LR9 A;  2E5R A;  1DS2 I;  1XBT A;  3SGB I;  1M8B A;  1CGJ I;  1V1I A;  5FUY A;  1SGY I;  1UVG A;  4SGB I;  1XA6 A;  2BUS A;  2DIP A;  1YU6 C;  2KMP A;  1CT4 I;  1PTR A;  1TOT A;  1Y8F A;  3D00 A;  1CT0 I;  1TGS I;  3B4V C;  2ORW A;  2XRC A;  1SGN I;  1AN1 I;  5CCM A;  1PPF I;  1TBN A;  2N17 A;  2A20 A;  3OXF A;  1KBF A;  3OL0 A;  2E73 A;  3HH2 C;  3OVO A;  1TUR A;  1CGI I;  2ODD A;  4OVO A;  3CXL A;  1X74 A;  1TBR R;  1W4R A;  2ENN A;  2QQD A;  3UEY A;  2ERW A;  2QQC A;  3SEK C;  1UUC A;  2N1A B;  2QQ0 A;  1XX6 A;  2NU4 I;  2JW6 A;  1OMT A;  3VDU A;  4A24 A;  1MT1 A;  2B0U C;  2V1C A;  2VRW B;  2JYY A;  2N71 A;  5JHW C;  2FNF X;  1PTQ A;  2QPO A;  3UGI A;  2SGD I;  2UZ3 A;  4HGU A;  1SGP I;  1Z7K B;  1X4S A;  3QTL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...