4SGBI

Structure of the complex of streptomyces griseus proteinase b and polypeptide chymotrypsin inhibitor-1 from russet burbank potato tubers at 2.1 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
PICTNCCAGYKGCNYYSANGAFICEGQSDPKKPKACPLNCDPHIAYSKCPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEINASE B
publication title Structure of the complex of Streptomyces griseus proteinase B and polypeptide chymotrypsin inhibitor-1 from Russet Burbank potato tubers at 2.1 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Complex(serine proteinase-inhibitor)
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1989-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4sgbI00
1IY5A 1YTPA 1SGNI 3B4VC 1KMAA 2KCXA 2F3CI 1Y1CA 1LR7A 4GI3C 1CGJI 2JYYA 1SGYI 1M8CA 2N17A 2KMQA 1NUBA 2JZMA 1BMOA 1TIHA 3QTLD 2KMOA 2ERWA 1LR8A 2NU1I 2GKRI 1OMUA 1Y1BA 3SEKC 1PPFI 1UVGA 1HJAI 1CE3A 1CGII 1CT4I 5DAEA 2NU4I 1CHOI 2JXDA 1AN1I 1IW4A 1UVFA 1CT0I 2OVOA 2V53A 2GKVA 1HDLA 1OYVI 1DS2I 1PJUA 2KMRA 1R0RI 1BUSA 1SGPI 2NU3I 2SGQI 1DS3I 2ARPF 3OVOA 1FYBA 3SGQI 1CSOI 1N13A 1PCEA 1SGEI 1IY6A 2P6AC 2SGEI 2NU2I 1OVOA 1TBRR 1OMTA 2NU0I 4HGUA 3TJQA 1SGDI 2QQCA 4OVOA 1Z7KB 1SGQI 2M5XA 1TBQR 1YU6C 3HH2C 1TUSA 1HPTA 1TURA 2LEOA 3SGBI 1H0ZA 2XRCA 1M8BA 2QQDA 2B0UC 2GKTI 4SGBI 1LR9A 2KMPA 1TGSI 2SGPI 1UUCA 2BUSA 1MT1A 1SGRI 1CT2I 5JHWC 2SGFI 2WCYA 2N52A 2SGDI 2N71A
chains in the Genus database with same CATH superfamily
3FSXA 1IY5A 3E59A 3FSYA 1YTPA 1XX6A 2PQ8A 1FARA 1FAQA 1MJAA 1SGNI 3GOXA 5FUVA 2ODDA 2V1CA 3B4VC 1X74A 5CCLA 1KMAA 2W0TA 2ENZA 2KCXA 2CWFA 2F3CI 1Y1CA 3UEYA 1LR7A 1MJBA 2CWHA 2X3TA 3OL0A 5HI7A 4GI3C 4UXIA 1CGJI 3BJIA 3MEKA 2JYYA 3QAHA 1SGYI 2YQPA 1M8CA 2ROWA 5FUYA 2CJSC 2N17A 2UVOA 4AMLA 2KMQA 1TBNA 3R5DA 1NUBA 4WP4A 2JZMA 1BMOA 1TIHA 3PDNA 2V1CC 3E2IA 3QTLD 2KMOA 2ERWA 1WGCA 1LR8A 2NU1I 2GKRI 1ULKA 2JW6A 1OMUA 1Y1BA 3R5AA 3SEKC 3TO6A 1PPFI 1UVGA 2YUUA 1K7VA 5E3QA 1FY7A 3UGLA 1WKXA 1HJAI 1W3SA 2WGCA 2WVJA 2X52A 3OXGA 3UGIA 3FC3A 1CE3A 1CGII 2N1AB 5EX0A 3VDUA 2VRWB 1KBFA 1CT4I 2LUYA 2NU4I 1CHOI 3CXLA 5DAEA 4UXJA 2JXDA 1K7TA 5E3RA 1AN1I 1IW4A 1UVFA 2LB7A 2ENNA 1CT0I 2OVOA 2V53A 3TOAA 3VE5A 1ULNA 5CCMA 3KY9A 9WGAA 5J8CA 2DKVA 2GKVA 2N52A 1W4RA 2ORWA 1OYVI 1HDLA 1DS2I 1PJUA 2KMRA 1R0RI 2QQ0A 1NXUA 3UEJA 1V1IA 1BUSA 2QQEA 4FKDA 2UZ3A 1ULMA 1SGPI 2NU3I 2SGQI 1DS3I 2ARPF 3OVOA 4L9MA 3TOBA 1FYBA 3SGQI 1WTJA 3TO9A 1CSOI 1N13A 1PCEA 2A20A 3VDPA 1SGEI 2E5RA 1WGTA 4E1RA 1IY6A 1Y8FA 2DB6A 2P6AC 2SGEI 3D00A 7WGAA 2NU2I 2J87A 5J8FA 3R5BA 4UXHA 1S20A 2CWGA 1OVOA 1TBOA 1KBEA 1TBRR 5E3PA 1OMTA 1XA6A 2NU0I 1HEVA 1X4SA 5HQ8A 2L8EA 4HGUA 1R79A 3TJQA 2GVIA 1SGDI 2ORVA 2QQCA 3RU0A 2OU2A 4OVOA 1PTRA 2K9HA 1Z7KB 1TOTA 4B6DA 1Q9BA 1SGQI 2QPOA 5EX3A 2RIJA 3UGDA 2M5XA 1TBQR 3OXLA 1YU6C 1Z2IA 3HH2C 2L7XA 2DIPA 4JCVE 4MPIA 1K7UA 1TUSA 1HPTA 3QWPA 5FUWA 2FNFX 1TURA 2LEOA 5FUXA 3SGBI 1H0ZA 1V1HA 2J9RA 2XRCA 3OXFA 2SGDI 1M8BA 2OD1A 3UOEA 2QQDA 2B0UC 1RFHA 2GKTI 1VDDA 4E1PA 2Y0MA 2RC4A 4A24A 1P9ZA 1P9GA 2GIVA 4SGBI 1LR9A 2KMPA 1U5KA 1UHAA 1TGSI 3TO7A 2SGPI 1UUCA 2ELIA 2BUSA 1PTQA 1MT1A 2JA1A 1SGRI 1CT2I 5JHWC 2SGFI 2WCYA 3R5CA 4DNCA 2E73A 1MJ9A 2OZUA 2N71A 2B8TA 1XBTA 3UFFA
chains in the Genus database with same CATH topology
1IY5A 3E59A 1YTPA 1XX6A 1FARA 1FAQA 1SGNI 3GOXA 5FUVA 2ODDA 2V1CA 3B4VC 1X74A 5CCLA 1KMAA 2W0TA 2ENZA 2KCXA 2F3CI 1Y1CA 3UEYA 1LR7A 3OL0A 5HI7A 4GI3C 4UXIA 1CGJI 3BJIA 3MEKA 2JYYA 1SGYI 2YQPA 1M8CA 2ROWA 5FUYA 2CJSC 2N17A 2KMQA 1TBNA 1NUBA 2JZMA 1BMOA 1TIHA 3PDNA 2V1CC 3E2IA 3QTLD 2KMOA 2ERWA 1LR8A 2NU1I 2GKRI 2JW6A 1OMUA 1Y1BA 3SEKC 1PPFI 1UVGA 2YUUA 3UGLA 1HJAI 1W3SA 3OXGA 2WVJA 3UGIA 3FC3A 1CE3A 1CGII 2N1AB 5EX0A 3VDUA 2VRWB 1KBFA 1CT4I 2LUYA 2NU4I 1CHOI 3CXLA 5DAEA 4UXJA 2JXDA 1AN1I 1IW4A 1UVFA 2ENNA 1CT0I 2OVOA 2V53A 3VE5A 5CCMA 3KY9A 2GKVA 2ORWA 1W4RA 1HDLA 1OYVI 1DS2I 1PJUA 2KMRA 1R0RI 2QQ0A 3UEJA 1V1IA 1BUSA 2QQEA 4FKDA 2UZ3A 1SGPI 2NU3I 2SGQI 1DS3I 2ARPF 3OVOA 4L9MA 1FYBA 3SGQI 1CSOI 1N13A 1PCEA 2A20A 3VDPA 1SGEI 2E5RA 1IY6A 4E1RA 1Y8FA 2DB6A 2P6AC 2SGEI 3D00A 2NU2I 2J87A 4UXHA 1OVOA 1TBOA 1KBEA 1TBRR 1OMTA 1XA6A 2NU0I 1X4SA 5HQ8A 2L8EA 4HGUA 1R79A 3TJQA 2GVIA 1SGDI 2ORVA 2QQCA 3RU0A 4OVOA 1PTRA 2K9HA 1Z7KB 1TOTA 4B6DA 1SGQI 2QPOA 5EX3A 3UGDA 2M5XA 1TBQR 3OXLA 1YU6C 3HH2C 2L7XA 2DIPA 4JCVE 1TUSA 1HPTA 3QWPA 5FUWA 2FNFX 1TURA 2LEOA 5FUXA 3SGBI 1H0ZA 1V1HA 2J9RA 2XRCA 3OXFA 1M8BA 2OD1A 2QQDA 2B0UC 1RFHA 2GKTI 1VDDA 4E1PA 4A24A 4SGBI 1LR9A 2KMPA 1U5KA 1TGSI 2SGPI 1UUCA 2ELIA 2BUSA 1PTQA 1MT1A 2JA1A 1SGRI 1CT2I 5JHWC 2SGFI 2WCYA 2E73A 2N52A 2SGDI 2N71A 2B8TA 1XBTA 3UFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IY5 A;  1YTP A;  1SGN I;  3B4V C;  1KMA A;  2KCX A;  2F3C I;  1Y1C A;  1LR7 A;  4GI3 C;  1CGJ I;  2JYY A;  1SGY I;  1M8C A;  2N17 A;  2KMQ A;  1NUB A;  2JZM A;  1BMO A;  1TIH A;  3QTL D;  2KMO A;  2ERW A;  1LR8 A;  2NU1 I;  2GKR I;  1OMU A;  1Y1B A;  3SEK C;  1PPF I;  1UVG A;  1HJA I;  1CE3 A;  1CGI I;  1CT4 I;  5DAE A;  2NU4 I;  1CHO I;  2JXD A;  1AN1 I;  1IW4 A;  1UVF A;  1CT0 I;  2OVO A;  2V53 A;  2GKV A;  1HDL A;  1OYV I;  1DS2 I;  1PJU A;  2KMR A;  1R0R I;  1BUS A;  1SGP I;  2NU3 I;  2SGQ I;  1DS3 I;  2ARP F;  3OVO A;  1FYB A;  3SGQ I;  1CSO I;  1N13 A;  1PCE A;  1SGE I;  1IY6 A;  2P6A C;  2SGE I;  2NU2 I;  1OVO A;  1TBR R;  1OMT A;  2NU0 I;  4HGU A;  3TJQ A;  1SGD I;  2QQC A;  4OVO A;  1Z7K B;  1SGQ I;  2M5X A;  1TBQ R;  1YU6 C;  3HH2 C;  1TUS A;  1HPT A;  1TUR A;  2LEO A;  3SGB I;  1H0Z A;  2XRC A;  1M8B A;  2QQD A;  2B0U C;  2GKT I;  4SGB I;  1LR9 A;  2KMP A;  1TGS I;  2SGP I;  1UUC A;  2BUS A;  1MT1 A;  1SGR I;  1CT2 I;  5JHW C;  2SGF I;  2WCY A;  2N52 A;  2SGD I;  2N71 A; 
#chains in the Genus database with same CATH topology
 3FSX A;  1IY5 A;  3E59 A;  3FSY A;  1YTP A;  1XX6 A;  2PQ8 A;  1FAR A;  1FAQ A;  1MJA A;  1SGN I;  3GOX A;  5FUV A;  2ODD A;  2V1C A;  3B4V C;  1X74 A;  5CCL A;  1KMA A;  2W0T A;  2ENZ A;  2KCX A;  2CWF A;  2F3C I;  1Y1C A;  3UEY A;  1LR7 A;  1MJB A;  2CWH A;  2X3T A;  3OL0 A;  5HI7 A;  4GI3 C;  4UXI A;  1CGJ I;  3BJI A;  3MEK A;  2JYY A;  3QAH A;  1SGY I;  2YQP A;  1M8C A;  2ROW A;  5FUY A;  2CJS C;  2N17 A;  2UVO A;  4AML A;  2KMQ A;  1TBN A;  3R5D A;  1NUB A;  4WP4 A;  2JZM A;  1BMO A;  1TIH A;  3PDN A;  2V1C C;  3E2I A;  3QTL D;  2KMO A;  2ERW A;  1WGC A;  1LR8 A;  2NU1 I;  2GKR I;  1ULK A;  2JW6 A;  1OMU A;  1Y1B A;  3R5A A;  3SEK C;  3TO6 A;  1PPF I;  1UVG A;  2YUU A;  1K7V A;  5E3Q A;  1FY7 A;  3UGL A;  1WKX A;  1HJA I;  1W3S A;  2WGC A;  2WVJ A;  2X52 A;  3OXG A;  3UGI A;  3FC3 A;  1CE3 A;  1CGI I;  2N1A B;  5EX0 A;  3VDU A;  2VRW B;  1KBF A;  1CT4 I;  2LUY A;  2NU4 I;  1CHO I;  3CXL A;  5DAE A;  4UXJ A;  2JXD A;  1K7T A;  5E3R A;  1AN1 I;  1IW4 A;  1UVF A;  2LB7 A;  2ENN A;  1CT0 I;  2OVO A;  2V53 A;  3TOA A;  3VE5 A;  1ULN A;  5CCM A;  3KY9 A;  9WGA A;  5J8C A;  2DKV A;  2GKV A;  2N52 A;  1W4R A;  2ORW A;  1OYV I;  1HDL A;  1DS2 I;  1PJU A;  2KMR A;  1R0R I;  2QQ0 A;  1NXU A;  3UEJ A;  1V1I A;  1BUS A;  2QQE A;  4FKD A;  2UZ3 A;  1ULM A;  1SGP I;  2NU3 I;  2SGQ I;  1DS3 I;  2ARP F;  3OVO A;  4L9M A;  3TOB A;  1FYB A;  3SGQ I;  1WTJ A;  3TO9 A;  1CSO I;  1N13 A;  1PCE A;  2A20 A;  3VDP A;  1SGE I;  2E5R A;  1WGT A;  4E1R A;  1IY6 A;  1Y8F A;  2DB6 A;  2P6A C;  2SGE I;  3D00 A;  7WGA A;  2NU2 I;  2J87 A;  5J8F A;  3R5B A;  4UXH A;  1S20 A;  2CWG A;  1OVO A;  1TBO A;  1KBE A;  1TBR R;  5E3P A;  1OMT A;  1XA6 A;  2NU0 I;  1HEV A;  1X4S A;  5HQ8 A;  2L8E A;  4HGU A;  1R79 A;  3TJQ A;  2GVI A;  1SGD I;  2ORV A;  2QQC A;  3RU0 A;  2OU2 A;  4OVO A;  1PTR A;  2K9H A;  1Z7K B;  1TOT A;  4B6D A;  1Q9B A;  1SGQ I;  2QPO A;  5EX3 A;  2RIJ A;  3UGD A;  2M5X A;  1TBQ R;  3OXL A;  1YU6 C;  1Z2I A;  3HH2 C;  2L7X A;  2DIP A;  4JCV E;  4MPI A;  1K7U A;  1TUS A;  1HPT A;  3QWP A;  5FUW A;  2FNF X;  1TUR A;  2LEO A;  5FUX A;  3SGB I;  1H0Z A;  1V1H A;  2J9R A;  2XRC A;  3OXF A;  2SGD I;  1M8B A;  2OD1 A;  3UOE A;  2QQD A;  2B0U C;  1RFH A;  2GKT I;  1VDD A;  4E1P A;  2Y0M A;  2RC4 A;  4A24 A;  1P9Z A;  1P9G A;  2GIV A;  4SGB I;  1LR9 A;  2KMP A;  1U5K A;  1UHA A;  1TGS I;  3TO7 A;  2SGP I;  1UUC A;  2ELI A;  2BUS A;  1PTQ A;  1MT1 A;  2JA1 A;  1SGR I;  1CT2 I;  5JHW C;  2SGF I;  2WCY A;  3R5C A;  4DNC A;  2E73 A;  1MJ9 A;  2OZU A;  2N71 A;  2B8T A;  1XBT A;  3UFF A; 
#chains in the Genus database with same CATH homology
 1IY5 A;  3E59 A;  1YTP A;  1XX6 A;  1FAR A;  1FAQ A;  1SGN I;  3GOX A;  5FUV A;  2ODD A;  2V1C A;  3B4V C;  1X74 A;  5CCL A;  1KMA A;  2W0T A;  2ENZ A;  2KCX A;  2F3C I;  1Y1C A;  3UEY A;  1LR7 A;  3OL0 A;  5HI7 A;  4GI3 C;  4UXI A;  1CGJ I;  3BJI A;  3MEK A;  2JYY A;  1SGY I;  2YQP A;  1M8C A;  2ROW A;  5FUY A;  2CJS C;  2N17 A;  2KMQ A;  1TBN A;  1NUB A;  2JZM A;  1BMO A;  1TIH A;  3PDN A;  2V1C C;  3E2I A;  3QTL D;  2KMO A;  2ERW A;  1LR8 A;  2NU1 I;  2GKR I;  2JW6 A;  1OMU A;  1Y1B A;  3SEK C;  1PPF I;  1UVG A;  2YUU A;  3UGL A;  1HJA I;  1W3S A;  3OXG A;  2WVJ A;  3UGI A;  3FC3 A;  1CE3 A;  1CGI I;  2N1A B;  5EX0 A;  3VDU A;  2VRW B;  1KBF A;  1CT4 I;  2LUY A;  2NU4 I;  1CHO I;  3CXL A;  5DAE A;  4UXJ A;  2JXD A;  1AN1 I;  1IW4 A;  1UVF A;  2ENN A;  1CT0 I;  2OVO A;  2V53 A;  3VE5 A;  5CCM A;  3KY9 A;  2GKV A;  2ORW A;  1W4R A;  1HDL A;  1OYV I;  1DS2 I;  1PJU A;  2KMR A;  1R0R I;  2QQ0 A;  3UEJ A;  1V1I A;  1BUS A;  2QQE A;  4FKD A;  2UZ3 A;  1SGP I;  2NU3 I;  2SGQ I;  1DS3 I;  2ARP F;  3OVO A;  4L9M A;  1FYB A;  3SGQ I;  1CSO I;  1N13 A;  1PCE A;  2A20 A;  3VDP A;  1SGE I;  2E5R A;  1IY6 A;  4E1R A;  1Y8F A;  2DB6 A;  2P6A C;  2SGE I;  3D00 A;  2NU2 I;  2J87 A;  4UXH A;  1OVO A;  1TBO A;  1KBE A;  1TBR R;  1OMT A;  1XA6 A;  2NU0 I;  1X4S A;  5HQ8 A;  2L8E A;  4HGU A;  1R79 A;  3TJQ A;  2GVI A;  1SGD I;  2ORV A;  2QQC A;  3RU0 A;  4OVO A;  1PTR A;  2K9H A;  1Z7K B;  1TOT A;  4B6D A;  1SGQ I;  2QPO A;  5EX3 A;  3UGD A;  2M5X A;  1TBQ R;  3OXL A;  1YU6 C;  3HH2 C;  2L7X A;  2DIP A;  4JCV E;  1TUS A;  1HPT A;  3QWP A;  5FUW A;  2FNF X;  1TUR A;  2LEO A;  5FUX A;  3SGB I;  1H0Z A;  1V1H A;  2J9R A;  2XRC A;  3OXF A;  1M8B A;  2OD1 A;  2QQD A;  2B0U C;  1RFH A;  2GKT I;  1VDD A;  4E1P A;  4A24 A;  4SGB I;  1LR9 A;  2KMP A;  1U5K A;  1TGS I;  2SGP I;  1UUC A;  2ELI A;  2BUS A;  1PTQ A;  1MT1 A;  2JA1 A;  1SGR I;  1CT2 I;  5JHW C;  2SGF I;  2WCY A;  2E73 A;  2N52 A;  2SGD I;  2N71 A;  2B8T A;  1XBT A;  3UFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...