4STDA

High resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological ph
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
b'GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalone dehydratase
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
total genus 46
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4stdA00
1OGXA 1WQLB 4OUQA 1JB4A 2INXA 1JN5A 3HX8A 1E3RA 5IG3A 5KP3A 3CPOA 2HMOB 3MSOA 2F99A 3EBYA 4R9LA 4XDVA 5DRVA 3I0YA 4MJDA 1JB2A 1GY7A 4WYKA 5IG4A 2B1XB 2Z7AA 2YFJB 7STDA 2BMOB 4HM1B 1GS3A 4R9KA 3NUVA 2BMQB 3VSYA 3EBTA 5D83A 1TP6A 5AIGA 2BMRB 3EF8A 3STDA 3M8CA 4L7KA 2QIYA 3E99A 2RCDA 1O7NB 2GEXA 3JUOA 2HMKB 5AI1A 1OHOA 3CU3A 3LZAA 3H51A 3B8LA 3FKAA 1E3VA 8CHOA 5KP1A 3FZWA 3DM8A 1IDPA 5CF2A 2GBXB 3S5CA 1ZO2A 3HK4A 3DUKA 1ASKA 3IPTA 3Q90A 2GEYA 4WWUC 4HZ9B 3EN1B 3F8HA 3MKIA 4LGQA 4HM2B 4HZBB 2RFRA 1CQSA 5D82A 3FLJA 3GZXB 3CNXA 3LYGA 5DREA 4HM8B 3B4OA 2XSHB 1SJWA 3K7CA 3F7XA 3OXAA 5BXQA 1NDOB 4IIAA 4CDLA 4LEHA 1DMNA 1QMAA 3UNLA 4WP5A 2HMNB 5AIFA 4HM4B 1AR0A 3KE7A 3F9SA 3WMDA 4OVMA 1C7HA 3HZPA 3F7SA 3EJVA 4K1UA 3FH1A 1U5OA 3NHXA 2RGQA 3MG1A 2OWPA 1ULIB 1ZX2A 3GWRA 4HM7B 1Q40B 5HGRA 2W2CA 3FGYA 4ORLA 2I9WA 3OX9A 3NXJA 3B7CA 3GZRA 3G8ZA 1JKGA 5IERA 1S5AA 1O7GB 3FSDA 4R1KA 1GY5A 3EQQB 6STDA 1OF5A 1ISKA 4HM3B 5IENA 3GZYB 2BNGA 2PZVA 3EN8A 2UX0A 1Q42A 3K0ZA 5AEWB 1A2KA 3GRDA 3T8NA 1E97A 5BVBA 5STDA 1OHPA 5CLKA 2YFLB 1UUVB 3MG3A 3OWUA 4XBTA 1OUNA 2R4IA 3SOAA 2F86B 2CKFB 1TUHA 5IG5A 2XRXB 3BLZA 4RZMA 3JUPA 1W02A 2Z76A 4U13A 4PEJA 1ULJB 1EG9B 4XDWA 3KSPA 2QGUA 4XBYA 3ER7A 4HM5B 3KZTA 3MHEA 3CNMA 5AIIA 4H3UA 1W00A 1JN5B 3D9RA 1OPYA 2JQ5A 1OGZA 1Z1SA 3JUQA 3NM2A 3MYTA 2HMMB 4WYKB 4HKVB 2A15A 4HM0B 5D81A 5JPPA 5KP4A 1OHSA 3H3HA 5CK6A 3T8UA 1OH0A 3JUNA 4J8TA 5TGNA 2CHCA 2F98A 4HVNA 4FCMA 4STDA 4K1VA 5IG0A 1OF5B 3KKGA 3DMCA 3NV0A 1O7MB 2XSOB 2STDA 4FCJA 3G16A 3MG2A 4L8PA 3G0KA 1VZZA 3EX9A 3OWSA 1QJGA 3ROBA 2GBWB 2HMJB 4N3VA 2K54A 4Q53A 4XBXA 3EC9A 5IEOA 1BUQA 4LMIA 5CXOA 3OV4A 5IEPA 3SOYA 3RGRA 5AIHA 5FW5A 3RGAA 3UJMA 1Q40A 3ECFA 5CF1A 1GYBA 2Z77A 1GY6A 5AEUB 1JB5A 2XR8B 3F14A 3EHCA 1W6YA 2GXFA 3DXOA 3DZLA 3B4PA 2YFIB 3F40A 5JPUA 4GB5A 3JUMA 3F8XA 1HKXA 1OCVA 1W01A 2IMJA 3NBRA 4I4KA 5EVHA 1K41A 5IF6A 4XM4A 4HJLB 3VGNA 1STDA 4KVHA 5G2GA 3FF0A 4XB5A 4X2HA 3BB9A 1O7PB 3NV0B 3A76A 3OWYA 1NU3A 1DMQA 1O7WB 1UUWB 1NWWA 1EA2A 1O7HB 3GZBA 2HMLB 4X2OA 2B24B 4J9AA 3FF2A 1DMMA 4L8OA 1JKGB 3SEDA 4HM6B
chains in the Genus database with same CATH superfamily
1OGXA 1IQXA 1ZGXA 1RGCA 1GOVA 3D5GA 1JZDA 1WQLB 4FMDA 4OUQA 3X41A 1JB4A 2INXA 1DETA 1UCIA 1RNTA 1JN5A 1YVSA 1EKMA 2L1SA 1E3RA 3HX8A 5IG3A 1LOYA 1T3BA 2RBIA 5KP3A 3O8YA 4KT3B 3DGOA 1RDSA 4K90B 3S27A 3CPOA 1MWUA 2HMOB 3HIIA 3SYUA 2XFSA 1W6GA 2LQVA 8RNTA 3MSOA 3NQYA 1BSEA 2F99A 3EBYA 4R9LA 1UCLA 4XDVA 3ZFZA 9RNTA 3CC73 2FGTA 5DRVA 3I0YA 1QVF2 4MJDA 1B20A 3LTBA 4MMYB 1IT8A 1QALA 1JB2A 1RN1A 1YI23 4LSOA 1GY7A 4WYKA 1UGHI 2W03A 5IG4A 1BU4A 1BSAA 3RDEA 1BNFA 1Q9EA 2B1XB 2CWTA 2Z7AA 1TIJA 2YFJB 1SQWA 1TU5A 1D6UA 1BNIA 2SARA 6RNTA 2C11A 2BMOB 4HM1B 7STDA 1GS3A 3U97A 2CFLA 4R9KA 4EBGA 1PY3A 1BRIA 1UDII 1SPUA 4TX4A 3S28A 1VQ93 3NUVA 2BMQB 1US1A 3DGLA 1LOVA 1YHQ3 4NREA 5IW9A 3BNCA 3IJEB 3CME3 2SBLA 4EV5A 1VQ53 3VSYA 1LNIA 3WHOA 3EBTA 1DVDA 1OACA 5D83A 1TP6A 5AIGA 1BNEA 1YJW3 4KFEA 2BMRB 1RKYA 1I2FA 3AMOA 3EF8A 1RGLA 3STDA 1A2VA 1RGGA 3M8CA 1T2IA 2K3DA 2KRTA 4L7KA 2QIYA 3E99A 2RCDA 1HZ1A 1QVG2 1CH0A 1O7NB 2WO0A 2GEXA 1RNBA 3JUOA 2HMKB 5G1KA 1GOYA 1CYVA 5AI1A 1IQYA 1OHOA 2H0IA 1VQ83 3CU3A 1HU9A 1NNVA 1X1XA 2E2UA 2UGIA 3LZAA 1N5HA 3H51A 4N6MA 2C4BA 1JZOA 1YIT3 3CCL3 4HAAA 1BNRA 2K0MA 1FYSA 3B8LA 1CYUA 1RRHA 3FKAA 4EW5A 4JF8A 1BSBA 1Q824 1E3VA 5G1LA 8CHOA 5KP1A 3FZWA 2C10A 1GMQA 2WOHA 2RSXA 4ZM8A 1KD14 4R80A 3IMAB 4LZIA 1AY7A 3HIGA 2CFKA 3KN4A 3DM8A 1TTOA 2CG0A 1YJ93 1KQS2 1IDPA 2OTL3 3LXUX 3OW22 3CCS3 5CF2A 1RTUA 3I563 1SARA 2GBXB 3S5CA 1BGSA 3D3LA 3LT8A 3SLUA 1ZO2A 1RN4A 5RNTA 4MMZB 1RLSA 2FXTA 1TJDA 3HK4A 3DUKA 2KAAA 5ELJA 4BL3A 1GOUA 5I97A 1W6CA 1JNQA 1SIIA 3G6E3 1VQL3 1ASKA 3IPTA 3Q90A 1W2ZA 4J5KA 2GEYA 3GSPA 3ZG5A 2F5MA 1FGQA 3EE1A 1IV7A 4WWUC 3EN1B 4HZ9B 3AGOA 4LYLB 5HOHA 3F8HA 3MKIA 4LGQA 1FA3A 4HM2B 4HZBB 2CC3A 1M1XB 2RFRA 3K63A 4N6LA 1CQSA 1SIHA 4KFDA 1BRSA 2F56A 1QAFA 5D82A 1DYUA 3DGMA 1MGWA 1T5YA 1U8CB 1LRAA 3FLJA 3GZXB 3PZWA 3URPA 3CNXA 3X3YA 3CXC2 3CCQ3 1IQ8A 1WMOA 3LYGA 2MC8A 1Q7HA 4ILFA 2BO9B 2OCTA 1F8NA 5DREA 3CC23 1WMNA 4HM8B 2IUJA 3Q3FA 1RGFA 3B4OA 2XSHB 1SJWA 1B21A 1T2HA 3K7CA 1IVVA 1KWIA 4I5QA 1MOLA 1RJOA 4NHFA 2W0QA 3F7XA 4NPBA 3OXAA 2CG1A 5BXQA 1HYFA 1NDOB 4IIAA 1LOXA 4CDLA 4LEHA 1DMNA 1QMAA 3UNLA 1JBSA 4WP5A 1LOWA 1AVKA 1UI7A 1N9EA 2HMNB 2M7OA 5AIFA 4HM4B 1BOXA 1AR0A 3KE7A 3F9SA 4QWTA 1BVIA 3WMDA 2OOVA 4OVMA 4WFOA 1RCLA 1BRJA 1EUIC 2O3OA 1GD3A 1BANA 4EV2A 1VQN3 2CW9A 1GMRA 3KSED 3WA2X 1C7HA 1BRNL 2IA7A 3HZPA 3F7SA 2XGNA 3AMOB 3EJVA 4K1UA 1IVXA 3NBBA 1TRPA 3FH1A 1FGMA 4KFFA 2H0HA 1BIRA 1U5OA 3NHXA 1PU4A 2RGQA 3MG1A 2OWPA 1N8R4 1ULIB 1BRKA 1ZX2A 3GWRA 2W6JH 3CPW2 1YGWA 2CFDA 4HM7B 4RBNA 1Q40B 5HGRA 2W2CA 3FGYA 5M1AA 1B2MA 2P38A 4ORLA 3WR2A 2WOFA 4GL6A 2I9WA 3NX0A 3OX9A 4OK0A 3NXJA 1Q814 1V74A 3B7CA 1VQ73 2AAEA 2KXGA 3G8ZA 3GZRA 4H61A 3VF1A 1I3FA 2Z6BA 3K5TA 1JKGA 4RNZA 4AKZA 1K9M4 1K28A 5IERA 1S5AA 1O7GB 2AADA 1IT7A 3FSDA 4R1KA 1GY5A 1RGKA 3EQQB 6STDA 1OF5A 1BNGA 4DKIA 1AVLA 1NB5I 1ISKA 4HM3B 3AHSA 5IENA 3GZYB 1NJI4 2BNGA 3TDGA 2PZVA 3AHWA 1AV4A 3EN8A 4N6V0 1YIJ3 2JDIH 2F5WA 3CD63 1BNJA 1Q42A 2UX0A 2ZHXB 1A2KA 3K0ZA 5AEWB 1BAOA 2XH9A 3ALAA 3GRDA 4R4KA 3T8NA 1Y4KA 1YJN3 2ZDJA 2F4YA 3KFQC 1CEWI 1B2ZA 1E97A 5BVBA 2KCDA 5M19A 1JRQA 1RGHA 3LTDA 5STDA 1B2UA 1B2SA 1OHPA 2WGOA 2FNQA 2YFLB 5CLKA 3WDGB 1UUVB 3MG3A 2MF7A 3FG1A 4JRFA 1WTHA 2W9QA 3WOEB 4J5GA 1MWTA 3OWUA 1X1YA 1PYLA 1OUNA 2R4IA 4XBTA 1NB3I 3G713 2Q07A 1K8A4 3CCJ3 3SOAA 1LVNA 2CIUA 1Q864 1NO3A 4O3VA 1TFKA 2F86B 2CKFB 1TRQA 1BSCA 1TUHA 1D6ZA 2XRXB 5IG5A 1W5ZA 4BTXA 3BLZA 4RZMA 1R4YA 3JUPA 3V99A 2KF4A 1W02A 3CMA3 4WHAA 2Z76A 1LNHA 3PCRA 2LYXA 4U13A 2Y73A 1UUGB 4PEJA 1LQGC 2O9UX 3WOFB 1ULJB 1YNVX 2OOVC 5JBSA 2GU3A 1AQZA 2P05A 1EG9B 5AYSC 4XDWA 2V1LA 3KSPA 2QGUA 3CCR3 2IY2A 4XBYA 3BU4A 3DH2A 3CCV3 1M904 4G1MB 1IYYA 3ER7A 3UB1A 3CCM3 3X40A 4HM5B 2QEX3 1LXEA 1M9GA 3KZTA 4CCVA 3MHEA 3CNMA 1L5GB 1K734 5AIIA 1EEJA 1JV2B 3QK9A 4H3UA 4EXRA 1YGEA 5M18A 3HOHA 1VQ63 1W00A 4O2HA 4BTYA 1I8VA 5GSPA 1JN5B 2OTJ3 3L0RA 2D42A 3D9RA 1OPYA 2R41A 4IT7A 3NBJA 3PGBA 3FCSB 1J2BA 1N5PA 5A0OB 4CPKA 1ZS7A 3Q2PA 2Y74A 2JQ5A 1FUTA 3BIRA 3WODG 1OGZA 1Z1SA 3JUQA 1FGTA 3NM2A 4GSPA 3U1WA 1IVUA 1UGIA 3MYTA 2HMMB 4N6NB 1ROAA 4BIRA 1UW1A 4WYKB 4HKVB 3X42A 4CJNA 2A15A 4HM0B 4KZ1A 2BHMA 4HYZA 1RN7A 5D81A 1VQP3 2ML6A 5JPPA 5KP4A 1X1UA 3NQZA 3UL5A 1IU7A 1OHSA 3H3HA 5CK6A 3N54B 2W56A 3T8UA 1RGAA 1OH0A 1I2GA 3JUNA 4J8TA 5TGNA 1UCJA 2CFWA 1IK3A 2CHCA 2KF3A 2QA43 1RRLA 2F98A 3LTCA 3MPHA 4HVNA 7GSPA 4FCMA 4STDA 2HOHA 1JBRA 5AYRB 3NM7A 3S67A 3V92A 4K1VA 4O02B 5IG0A 3AGNA 1A90A 1OF5B 1A2PA 3KKGA 5LC6A 2OQEA 2CH9A 3RNTA 2P0XA 3DMCA 3D4AA 3NV0A 1W4NA 5FGOA 3JVCA 1O7MB 2XSOB 2STDA 4BTWA 4FMBA 2CFGA 1DVCA 1BSDA 2W9PA 4FCJA 3G16A 2PNCA 3MG2A 1N9JA 1G96A 4L8PA 2KF6A 1UI8A 1B2XA 3S29A 3LOYA 3G0KA 1FZUA 1VZZA 3EX9A 1EQKA 3D79A 3ZG0A 2XF3A 3CCU3 1GMPA 3OWSA 4FMAA 3SX1A 2E2TA 3WA3A 1QJGA 1ROVA 2UUGC 3BNBA 3G4S3 1DE3A 1RCKA 3ROBA 1FGRA 1FGOA 1X1WA 2GBWB 2HMJB 2P0MA 4N3VA 1VQK3 1MWSA 4GHOA 2K54A 3PS8A 4Q53A 5LC7A 4EC6A 4XBXA 1RHLA 3K9MC 2BT3A 3EC9A 1JBTA 1RMSA 3DGYA 3I553 5IEOA 3LTAA 2ZL8A 1FUWA 1BUQA 2J8XB 3EB8A 1A67A 1VQ43 4LMIA 1GD4A 1D6YA 5CXOA 1I0XA 1STFI 1S723 3OV4A 5IEPA 2L4VA 3SOYA 1GSPA 7RNTA 1KC84 3LT9A 3RGRA 5AIHA 2BIRA 3X3ZA 1N8QA 5EEOA 5FW5A 1MNLA 3RGAA 1W7CA 3QRDA 1MGRA 3UJMA 3N8BA 1BRHA 1Q40A 2GSPA 3ECFA 3X3XA 3KCHA 4IPBA 1RGEA 2CWUA 5CF1A 2ZA4A 1UCKA 1GYBA 2Z77A 4N6TA 4AKYA 1VQO3 1GY6A 3PXMA 5BU4A 5AEUB 1JB5A 2XR8B 4BU4A 3F14A 3EHCA 1W6YA 3BNDA 2GXFA 3DXOA 3DZLA 2IYJA 4MMXB 3B4PA 1PFPA 2YFIB 1MWRA 3F40A 2H0GA 4HOHA 5JPUA 4EYCA 4GB5A 3JUMA 2IUKA 3F8XA 1HKXA 1B27A 1YVBI 4FMCA 4FCZA 1OCVA 1W01A 1IVWA 2IMJA 4AEQA 2XFTA 3NBRA 2BU4A 4I4KA 2GU1A 4O8SA 3V98A 5EVHA 2OQEC 1K41A 1WNHA 5IF6A 1JJ22 1BRGA 1IV9A 3BNEA 1V57A 2CX0A 4RNYA 1B3SA 4XM4A 2KF5A 1VQM3 1RSNA 1M1K4 1QAKA 2W56B 1BUJA 4BL2A 3GAXA 3N9HA 1I2EA 1FUSA 3DY5A 4HJLB 3VGNA 1STDA 4MEIA 3FG3A 1W2B2 1R4CA 1LQMB 4KVHA 5G2GA 3UL6A 2W04A 3KIIA 2CX1A 1C54A 3FF0A 2ML5A 4XB5A 3FG4A 4K61A 4N6OB 4X2HA 6GSPA 3BB9A 2CK3H 2YX9A 3PCSA 3A5EA 1O7PB 2XEPA 3SVAA 3T0UA 3LH4A 3SXXA 2XGLA 1WMPA 1BNSA 3NV0B 5BIRA 2RNTA 3A76A 1NU3A 1DMQA 1O7WB 1G0TA 1UUWB 1V58A 3OWYA 1NWWA 1EA2A 3D5IA 1O7HB 3GZBA 5ELUA 1TFOA 5EQLA 3PYJA 2HMLB 4RNTA 3LMLA 4X2OA 2B24B 1G02A 4J9AA 1I70A 4HBRA 3FF2A 1FW7A 1VQQA 1DMMA 2E2VA 3J7Yd 3HI7A 3MWZA 3Q1CA 1I0VA 2D1WA 3CCE3 2P09A 1Q7Y4 3DGNA 4L8OA 1I3IA 1JKGB 2WGQA 4FR9A 3CC43 2CWVA 4N6UA 3SEDA 4HM6B 1KSIA
chains in the Genus database with same CATH topology
1OGXA 1IQXA 4FMDA 1WQLB 4OUQA 3X41A 1JB4A 2INXA 1JN5A 1EKMA 3HX8A 1E3RA 5IG3A 5KP3A 3O8YA 3DGOA 4K90B 3S27A 3CPOA 2HMOB 3HIIA 2XFSA 1W6GA 2LQVA 3MSOA 3NQYA 2F99A 3EBYA 4R9LA 4XDVA 3CC73 2FGTA 5DRVA 3I0YA 1QVF2 4MJDA 4MMYB 3LTBA 1IT8A 1QALA 1JB2A 1YI23 4LSOA 1GY7A 4WYKA 2W03A 5IG4A 3RDEA 2B1XB 2CWTA 2Z7AA 1TIJA 2YFJB 1SQWA 1TU5A 1D6UA 7STDA 2C11A 2BMOB 4HM1B 1GS3A 3U97A 2CFLA 4R9KA 4EBGA 3S28A 1SPUA 4TX4A 1VQ93 3NUVA 2BMQB 1US1A 3DGLA 1YHQ3 4NREA 5IW9A 3BNCA 3IJEB 3CME3 2SBLA 4EV5A 1VQ53 3VSYA 3EBTA 1DVDA 1OACA 5D83A 1TP6A 5AIGA 1YJW3 4KFEA 2BMRB 1RKYA 3AMOA 3EF8A 3STDA 1A2VA 3M8CA 2KRTA 4L7KA 2QIYA 3E99A 2RCDA 1QVG2 1O7NB 2WO0A 2GEXA 3JUOA 2HMKB 1CYVA 5AI1A 1IQYA 1OHOA 1VQ83 3CU3A 1HU9A 2E2UA 3LZAA 1N5HA 3H51A 4N6MA 1YIT3 3CCL3 2K0MA 3B8LA 1CYUA 1RRHA 3FKAA 4JF8A 1Q824 1E3VA 8CHOA 5KP1A 3FZWA 2C10A 2WOHA 2RSXA 4ZM8A 1KD14 4R80A 3IMAB 4LZIA 3HIGA 2CFKA 3KN4A 3DM8A 2CG0A 1YJ93 1KQS2 2OTL3 1IDPA 3LXUX 3OW22 3CCS3 5CF2A 3I563 2GBXB 3S5CA 3D3LA 3LT8A 3SLUA 1ZO2A 4MMZB 2FXTA 3HK4A 3DUKA 5ELJA 5I97A 1W6CA 1JNQA 1SIIA 3G6E3 1VQL3 1ASKA 3IPTA 3Q90A 1W2ZA 2GEYA 1FGQA 3EE1A 1IV7A 4WWUC 3EN1B 4HZ9B 3F8HA 3MKIA 4LGQA 1FA3A 4HM2B 4HZBB 2CC3A 1M1XB 2RFRA 3K63A 4N6LA 1CQSA 1SIHA 4KFDA 5D82A 1QAFA 1DYUA 3DGMA 1T5YA 3FLJA 1U8CB 3GZXB 3PZWA 3CXC2 3CNXA 3X3YA 3CCQ3 1IQ8A 1WMOA 3LYGA 2MC8A 2BO9B 2OCTA 1F8NA 5DREA 3CC23 1WMNA 4HM8B 2IUJA 3B4OA 2XSHB 1SJWA 3K7CA 1IVVA 1KWIA 1MOLA 1RJOA 4NHFA 2W0QA 3F7XA 2CG1A 3OXAA 5BXQA 1NDOB 4IIAA 1LOXA 4CDLA 4LEHA 1DMNA 1QMAA 3UNLA 4WP5A 1AVKA 1UI7A 1N9EA 2HMNB 2M7OA 5AIFA 4HM4B 1AR0A 3KE7A 3F9SA 4QWTA 3WMDA 2OOVA 4OVMA 4WFOA 2O3OA 1VQN3 4EV2A 1GD3A 2CW9A 3KSED 3WA2X 1C7HA 2IA7A 3HZPA 3F7SA 2XGNA 3AMOB 3EJVA 4K1UA 1IVXA 3NBBA 4KFFA 3FH1A 1FGMA 1U5OA 3NHXA 1PU4A 2RGQA 3MG1A 2OWPA 1N8R4 1ULIB 1ZX2A 3GWRA 2W6JH 3CPW2 2CFDA 4HM7B 4RBNA 1Q40B 5HGRA 2W2CA 3FGYA 2P38A 4ORLA 2WOFA 4GL6A 2I9WA 3NX0A 3OX9A 4OK0A 3NXJA 1Q814 1V74A 3B7CA 1VQ73 2KXGA 3GZRA 3G8ZA 4H61A 3VF1A 2Z6BA 3K5TA 1JKGA 4RNZA 4AKZA 1K9M4 1K28A 5IERA 1S5AA 1O7GB 1IT7A 3FSDA 4R1KA 1GY5A 3EQQB 6STDA 1OF5A 1ISKA 1AVLA 1NB5I 4HM3B 5IENA 3GZYB 1NJI4 2BNGA 3TDGA 2PZVA 3EN8A 1AV4A 4N6V0 1YIJ3 2JDIH 3CD63 2UX0A 1Q42A 3K0ZA 5AEWB 1A2KA 2XH9A 3ALAA 3GRDA 4R4KA 3T8NA 1Y4KA 1YJN3 2ZDJA 3KFQC 1CEWI 1E97A 5BVBA 2KCDA 1JRQA 3LTDA 5STDA 1OHPA 2WGOA 2FNQA 2YFLB 5CLKA 3WDGB 1UUVB 3MG3A 2MF7A 3FG1A 4JRFA 1WTHA 2W9QA 3WOEB 3OWUA 4XBTA 1OUNA 2R4IA 1NB3I 3G713 2Q07A 1K8A4 3CCJ3 3SOAA 1LVNA 2CIUA 1Q864 1NO3A 4O3VA 1TFKA 2F86B 2CKFB 1TUHA 5IG5A 1D6ZA 2XRXB 1W5ZA 4BTXA 3BLZA 4RZMA 3JUPA 3V99A 1W02A 3CMA3 4WHAA 2Z76A 1LNHA 3PCRA 2LYXA 4U13A 2Y73A 4PEJA 2O9UX 3WOFB 1ULJB 2OOVC 5JBSA 2GU3A 2P05A 1EG9B 5AYSC 4XDWA 2V1LA 3KSPA 2QGUA 3CCR3 4XBYA 3CCV3 1M904 4G1MB 3ER7A 3UB1A 3CCM3 3X40A 4HM5B 2QEX3 1LXEA 1M9GA 3KZTA 4CCVA 3MHEA 3CNMA 1L5GB 1K734 5AIIA 1JV2B 3QK9A 4H3UA 4EXRA 1YGEA 1VQ63 1W00A 4O2HA 4BTYA 1JN5B 2OTJ3 3L0RA 2D42A 3D9RA 1OPYA 4IT7A 3NBJA 3PGBA 3FCSB 1J2BA 1N5PA 5A0OB 3Q2PA 2Y74A 2JQ5A 3WODG 1OGZA 1Z1SA 3JUQA 1FGTA 3NM2A 3U1WA 1IVUA 3MYTA 2HMMB 4N6NB 1ROAA 1UW1A 4WYKB 4HKVB 3X42A 2A15A 4HM0B 4KZ1A 2BHMA 4HYZA 1RN7A 5D81A 1VQP3 2ML6A 5JPPA 5KP4A 3NQZA 3UL5A 1IU7A 1OHSA 3H3HA 5CK6A 3N54B 2W56A 3T8UA 1OH0A 3JUNA 4J8TA 5TGNA 1IK3A 2CFWA 2CHCA 2QA43 1RRLA 2F98A 3LTCA 3MPHA 4HVNA 4FCMA 4STDA 5AYRB 3NM7A 3S67A 3V92A 4K1VA 4O02B 5IG0A 1A90A 1OF5B 3KKGA 5LC6A 2OQEA 2CH9A 2P0XA 3DMCA 3NV0A 1W4NA 5FGOA 3JVCA 1O7MB 2XSOB 2STDA 4BTWA 4FMBA 2CFGA 1DVCA 2W9PA 4FCJA 3G16A 2PNCA 3MG2A 1N9JA 1G96A 4L8PA 3S29A 1UI8A 3LOYA 3G0KA 1VZZA 3EX9A 1EQKA 2XF3A 3CCU3 3OWSA 4FMAA 3SX1A 2E2TA 3WA3A 1QJGA 1ROVA 3BNBA 3G4S3 3ROBA 1FGRA 1FGOA 2GBWB 2HMJB 4N3VA 2P0MA 1VQK3 5LC7A 2K54A 3PS8A 4Q53A 4EC6A 4XBXA 3K9MC 2BT3A 3EC9A 3I553 5IEOA 3LTAA 2ZL8A 1FUWA 1BUQA 3EB8A 1A67A 1VQ43 4LMIA 1GD4A 1D6YA 5CXOA 1STFI 1S723 3OV4A 5IEPA 2L4VA 3SOYA 1KC84 3LT9A 3RGRA 5AIHA 3X3ZA 1N8QA 5EEOA 5FW5A 1MNLA 3RGAA 1W7CA 3QRDA 3UJMA 3N8BA 1Q40A 3X3XA 3ECFA 4IPBA 2CWUA 5CF1A 4N6TA 1GYBA 2Z77A 4AKYA 1VQO3 1GY6A 3PXMA 5AEUB 1JB5A 2XR8B 3F14A 3EHCA 1W6YA 3BNDA 2GXFA 3DXOA 3DZLA 4MMXB 3B4PA 1PFPA 2YFIB 3F40A 5JPUA 4EYCA 4GB5A 3JUMA 2IUKA 3F8XA 1HKXA 1YVBI 4FMCA 4FCZA 1OCVA 1W01A 1IVWA 2IMJA 4AEQA 2XFTA 3NBRA 4O8SA 4I4KA 2GU1A 3V98A 5EVHA 2OQEC 1K41A 1WNHA 5IF6A 1JJ22 1IV9A 3BNEA 4RNYA 4XM4A 1VQM3 1M1K4 1QAKA 2W56B 3GAXA 3N9HA 3DY5A 4HJLB 3VGNA 1STDA 4MEIA 3FG3A 1W2B2 1R4CA 4KVHA 5G2GA 3UL6A 2W04A 3KIIA 3FF0A 2ML5A 4XB5A 3FG4A 4K61A 4N6OB 4X2HA 3BB9A 2CK3H 2YX9A 3PCSA 1O7PB 2XEPA 3SVAA 3T0UA 3LH4A 3SXXA 2XGLA 1WMPA 3NV0B 3A76A 1NU3A 1DMQA 1O7WB 1UUWB 3OWYA 1NWWA 1EA2A 1O7HB 3GZBA 5ELUA 1TFOA 5EQLA 3PYJA 2HMLB 3LMLA 4X2OA 2B24B 4J9AA 4HBRA 3FF2A 2E2VA 1DMMA 3J7Yd 3HI7A 3MWZA 3Q1CA 2D1WA 3CCE3 2P09A 1Q7Y4 3DGNA 4L8OA 2WGQA 1JKGB 4FR9A 3CC43 2CWVA 4N6UA 3SEDA 4HM6B 1KSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGX A;  1WQL B;  4OUQ A;  1JB4 A;  2INX A;  1JN5 A;  3HX8 A;  1E3R A;  5IG3 A;  5KP3 A;  3CPO A;  2HMO B;  3MSO A;  2F99 A;  3EBY A;  4R9L A;  4XDV A;  5DRV A;  3I0Y A;  4MJD A;  1JB2 A;  1GY7 A;  4WYK A;  5IG4 A;  2B1X B;  2Z7A A;  2YFJ B;  7STD A;  2BMO B;  4HM1 B;  1GS3 A;  4R9K A;  3NUV A;  2BMQ B;  3VSY A;  3EBT A;  5D83 A;  1TP6 A;  5AIG A;  2BMR B;  3EF8 A;  3STD A;  3M8C A;  4L7K A;  2QIY A;  3E99 A;  2RCD A;  1O7N B;  2GEX A;  3JUO A;  2HMK B;  5AI1 A;  1OHO A;  3CU3 A;  3LZA A;  3H51 A;  3B8L A;  3FKA A;  1E3V A;  8CHO A;  5KP1 A;  3FZW A;  3DM8 A;  1IDP A;  5CF2 A;  2GBX B;  3S5C A;  1ZO2 A;  3HK4 A;  3DUK A;  1ASK A;  3IPT A;  3Q90 A;  2GEY A;  4WWU C;  4HZ9 B;  3EN1 B;  3F8H A;  3MKI A;  4LGQ A;  4HM2 B;  4HZB B;  2RFR A;  1CQS A;  5D82 A;  3FLJ A;  3GZX B;  3CNX A;  3LYG A;  5DRE A;  4HM8 B;  3B4O A;  2XSH B;  1SJW A;  3K7C A;  3F7X A;  3OXA A;  5BXQ A;  1NDO B;  4IIA A;  4CDL A;  4LEH A;  1DMN A;  1QMA A;  3UNL A;  4WP5 A;  2HMN B;  5AIF A;  4HM4 B;  1AR0 A;  3KE7 A;  3F9S A;  3WMD A;  4OVM A;  1C7H A;  3HZP A;  3F7S A;  3EJV A;  4K1U A;  3FH1 A;  1U5O A;  3NHX A;  2RGQ A;  3MG1 A;  2OWP A;  1ULI B;  1ZX2 A;  3GWR A;  4HM7 B;  1Q40 B;  5HGR A;  2W2C A;  3FGY A;  4ORL A;  2I9W A;  3OX9 A;  3NXJ A;  3B7C A;  3GZR A;  3G8Z A;  1JKG A;  5IER A;  1S5A A;  1O7G B;  3FSD A;  4R1K A;  1GY5 A;  3EQQ B;  6STD A;  1OF5 A;  1ISK A;  4HM3 B;  5IEN A;  3GZY B;  2BNG A;  2PZV A;  3EN8 A;  2UX0 A;  1Q42 A;  3K0Z A;  5AEW B;  1A2K A;  3GRD A;  3T8N A;  1E97 A;  5BVB A;  5STD A;  1OHP A;  5CLK A;  2YFL B;  1UUV B;  3MG3 A;  3OWU A;  4XBT A;  1OUN A;  2R4I A;  3SOA A;  2F86 B;  2CKF B;  1TUH A;  5IG5 A;  2XRX B;  3BLZ A;  4RZM A;  3JUP A;  1W02 A;  2Z76 A;  4U13 A;  4PEJ A;  1ULJ B;  1EG9 B;  4XDW A;  3KSP A;  2QGU A;  4XBY A;  3ER7 A;  4HM5 B;  3KZT A;  3MHE A;  3CNM A;  5AII A;  4H3U A;  1W00 A;  1JN5 B;  3D9R A;  1OPY A;  2JQ5 A;  1OGZ A;  1Z1S A;  3JUQ A;  3NM2 A;  3MYT A;  2HMM B;  4WYK B;  4HKV B;  2A15 A;  4HM0 B;  5D81 A;  5JPP A;  5KP4 A;  1OHS A;  3H3H A;  5CK6 A;  3T8U A;  1OH0 A;  3JUN A;  4J8T A;  5TGN A;  2CHC A;  2F98 A;  4HVN A;  4FCM A;  4STD A;  4K1V A;  5IG0 A;  1OF5 B;  3KKG A;  3DMC A;  3NV0 A;  1O7M B;  2XSO B;  2STD A;  4FCJ A;  3G16 A;  3MG2 A;  4L8P A;  3G0K A;  1VZZ A;  3EX9 A;  3OWS A;  1QJG A;  3ROB A;  2GBW B;  2HMJ B;  4N3V A;  2K54 A;  4Q53 A;  4XBX A;  3EC9 A;  5IEO A;  1BUQ A;  4LMI A;  5CXO A;  3OV4 A;  5IEP A;  3SOY A;  3RGR A;  5AIH A;  5FW5 A;  3RGA A;  3UJM A;  1Q40 A;  3ECF A;  5CF1 A;  1GYB A;  2Z77 A;  1GY6 A;  5AEU B;  1JB5 A;  2XR8 B;  3F14 A;  3EHC A;  1W6Y A;  2GXF A;  3DXO A;  3DZL A;  3B4P A;  2YFI B;  3F40 A;  5JPU A;  4GB5 A;  3JUM A;  3F8X A;  1HKX A;  1OCV A;  1W01 A;  2IMJ A;  3NBR A;  4I4K A;  5EVH A;  1K41 A;  5IF6 A;  4XM4 A;  4HJL B;  3VGN A;  1STD A;  4KVH A;  5G2G A;  3FF0 A;  4XB5 A;  4X2H A;  3BB9 A;  1O7P B;  3NV0 B;  3A76 A;  3OWY A;  1NU3 A;  1DMQ A;  1O7W B;  1UUW B;  1NWW A;  1EA2 A;  1O7H B;  3GZB A;  2HML B;  4X2O A;  2B24 B;  4J9A A;  3FF2 A;  1DMM A;  4L8O A;  1JKG B;  3SED A;  4HM6 B; 
#chains in the Genus database with same CATH topology
 1OGX A;  1IQX A;  1ZGX A;  1RGC A;  1GOV A;  3D5G A;  1JZD A;  1WQL B;  4FMD A;  4OUQ A;  3X41 A;  1JB4 A;  2INX A;  1DET A;  1UCI A;  1RNT A;  1JN5 A;  1YVS A;  1EKM A;  2L1S A;  1E3R A;  3HX8 A;  5IG3 A;  1LOY A;  1T3B A;  2RBI A;  5KP3 A;  3O8Y A;  4KT3 B;  3DGO A;  1RDS A;  4K90 B;  3S27 A;  3CPO A;  1MWU A;  2HMO B;  3HII A;  3SYU A;  2XFS A;  1W6G A;  2LQV A;  8RNT A;  3MSO A;  3NQY A;  1BSE A;  2F99 A;  3EBY A;  4R9L A;  1UCL A;  4XDV A;  3ZFZ A;  9RNT A;  3CC7 3;  2FGT A;  5DRV A;  3I0Y A;  1QVF 2;  4MJD A;  1B20 A;  3LTB A;  4MMY B;  1IT8 A;  1QAL A;  1JB2 A;  1RN1 A;  1YI2 3;  4LSO A;  1GY7 A;  4WYK A;  1UGH I;  2W03 A;  5IG4 A;  1BU4 A;  1BSA A;  3RDE A;  1BNF A;  1Q9E A;  2B1X B;  2CWT A;  2Z7A A;  1TIJ A;  2YFJ B;  1SQW A;  1TU5 A;  1D6U A;  1BNI A;  2SAR A;  6RNT A;  2C11 A;  2BMO B;  4HM1 B;  7STD A;  1GS3 A;  3U97 A;  2CFL A;  4R9K A;  4EBG A;  1PY3 A;  1BRI A;  1UDI I;  1SPU A;  4TX4 A;  3S28 A;  1VQ9 3;  3NUV A;  2BMQ B;  1US1 A;  3DGL A;  1LOV A;  1YHQ 3;  4NRE A;  5IW9 A;  3BNC A;  3IJE B;  3CME 3;  2SBL A;  4EV5 A;  1VQ5 3;  3VSY A;  1LNI A;  3WHO A;  3EBT A;  1DVD A;  1OAC A;  5D83 A;  1TP6 A;  5AIG A;  1BNE A;  1YJW 3;  4KFE A;  2BMR B;  1RKY A;  1I2F A;  3AMO A;  3EF8 A;  1RGL A;  3STD A;  1A2V A;  1RGG A;  3M8C A;  1T2I A;  2K3D A;  2KRT A;  4L7K A;  2QIY A;  3E99 A;  2RCD A;  1HZ1 A;  1QVG 2;  1CH0 A;  1O7N B;  2WO0 A;  2GEX A;  1RNB A;  3JUO A;  2HMK B;  5G1K A;  1GOY A;  1CYV A;  5AI1 A;  1IQY A;  1OHO A;  2H0I A;  1VQ8 3;  3CU3 A;  1HU9 A;  1NNV A;  1X1X A;  2E2U A;  2UGI A;  3LZA A;  1N5H A;  3H51 A;  4N6M A;  2C4B A;  1JZO A;  1YIT 3;  3CCL 3;  4HAA A;  1BNR A;  2K0M A;  1FYS A;  3B8L A;  1CYU A;  1RRH A;  3FKA A;  4EW5 A;  4JF8 A;  1BSB A;  1Q82 4;  1E3V A;  5G1L A;  8CHO A;  5KP1 A;  3FZW A;  2C10 A;  1GMQ A;  2WOH A;  2RSX A;  4ZM8 A;  1KD1 4;  4R80 A;  3IMA B;  4LZI A;  1AY7 A;  3HIG A;  2CFK A;  3KN4 A;  3DM8 A;  1TTO A;  2CG0 A;  1YJ9 3;  1KQS 2;  1IDP A;  2OTL 3;  3LXU X;  3OW2 2;  3CCS 3;  5CF2 A;  1RTU A;  3I56 3;  1SAR A;  2GBX B;  3S5C A;  1BGS A;  3D3L A;  3LT8 A;  3SLU A;  1ZO2 A;  1RN4 A;  5RNT A;  4MMZ B;  1RLS A;  2FXT A;  1TJD A;  3HK4 A;  3DUK A;  2KAA A;  5ELJ A;  4BL3 A;  1GOU A;  5I97 A;  1W6C A;  1JNQ A;  1SII A;  3G6E 3;  1VQL 3;  1ASK A;  3IPT A;  3Q90 A;  1W2Z A;  4J5K A;  2GEY A;  3GSP A;  3ZG5 A;  2F5M A;  1FGQ A;  3EE1 A;  1IV7 A;  4WWU C;  3EN1 B;  4HZ9 B;  3AGO A;  4LYL B;  5HOH A;  3F8H A;  3MKI A;  4LGQ A;  1FA3 A;  4HM2 B;  4HZB B;  2CC3 A;  1M1X B;  2RFR A;  3K63 A;  4N6L A;  1CQS A;  1SIH A;  4KFD A;  1BRS A;  2F56 A;  1QAF A;  5D82 A;  1DYU A;  3DGM A;  1MGW A;  1T5Y A;  1U8C B;  1LRA A;  3FLJ A;  3GZX B;  3PZW A;  3URP A;  3CNX A;  3X3Y A;  3CXC 2;  3CCQ 3;  1IQ8 A;  1WMO A;  3LYG A;  2MC8 A;  1Q7H A;  4ILF A;  2BO9 B;  2OCT A;  1F8N A;  5DRE A;  3CC2 3;  1WMN A;  4HM8 B;  2IUJ A;  3Q3F A;  1RGF A;  3B4O A;  2XSH B;  1SJW A;  1B21 A;  1T2H A;  3K7C A;  1IVV A;  1KWI A;  4I5Q A;  1MOL A;  1RJO A;  4NHF A;  2W0Q A;  3F7X A;  4NPB A;  3OXA A;  2CG1 A;  5BXQ A;  1HYF A;  1NDO B;  4IIA A;  1LOX A;  4CDL A;  4LEH A;  1DMN A;  1QMA A;  3UNL A;  1JBS A;  4WP5 A;  1LOW A;  1AVK A;  1UI7 A;  1N9E A;  2HMN B;  2M7O A;  5AIF A;  4HM4 B;  1BOX A;  1AR0 A;  3KE7 A;  3F9S A;  4QWT A;  1BVI A;  3WMD A;  2OOV A;  4OVM A;  4WFO A;  1RCL A;  1BRJ A;  1EUI C;  2O3O A;  1GD3 A;  1BAN A;  4EV2 A;  1VQN 3;  2CW9 A;  1GMR A;  3KSE D;  3WA2 X;  1C7H A;  1BRN L;  2IA7 A;  3HZP A;  3F7S A;  2XGN A;  3AMO B;  3EJV A;  4K1U A;  1IVX A;  3NBB A;  1TRP A;  3FH1 A;  1FGM A;  4KFF A;  2H0H A;  1BIR A;  1U5O A;  3NHX A;  1PU4 A;  2RGQ A;  3MG1 A;  2OWP A;  1N8R 4;  1ULI B;  1BRK A;  1ZX2 A;  3GWR A;  2W6J H;  3CPW 2;  1YGW A;  2CFD A;  4HM7 B;  4RBN A;  1Q40 B;  5HGR A;  2W2C A;  3FGY A;  5M1A A;  1B2M A;  2P38 A;  4ORL A;  3WR2 A;  2WOF A;  4GL6 A;  2I9W A;  3NX0 A;  3OX9 A;  4OK0 A;  3NXJ A;  1Q81 4;  1V74 A;  3B7C A;  1VQ7 3;  2AAE A;  2KXG A;  3G8Z A;  3GZR A;  4H61 A;  3VF1 A;  1I3F A;  2Z6B A;  3K5T A;  1JKG A;  4RNZ A;  4AKZ A;  1K9M 4;  1K28 A;  5IER A;  1S5A A;  1O7G B;  2AAD A;  1IT7 A;  3FSD A;  4R1K A;  1GY5 A;  1RGK A;  3EQQ B;  6STD A;  1OF5 A;  1BNG A;  4DKI A;  1AVL A;  1NB5 I;  1ISK A;  4HM3 B;  3AHS A;  5IEN A;  3GZY B;  1NJI 4;  2BNG A;  3TDG A;  2PZV A;  3AHW A;  1AV4 A;  3EN8 A;  4N6V 0;  1YIJ 3;  2JDI H;  2F5W A;  3CD6 3;  1BNJ A;  1Q42 A;  2UX0 A;  2ZHX B;  1A2K A;  3K0Z A;  5AEW B;  1BAO A;  2XH9 A;  3ALA A;  3GRD A;  4R4K A;  3T8N A;  1Y4K A;  1YJN 3;  2ZDJ A;  2F4Y A;  3KFQ C;  1CEW I;  1B2Z A;  1E97 A;  5BVB A;  2KCD A;  5M19 A;  1JRQ A;  1RGH A;  3LTD A;  5STD A;  1B2U A;  1B2S A;  1OHP A;  2WGO A;  2FNQ A;  2YFL B;  5CLK A;  3WDG B;  1UUV B;  3MG3 A;  2MF7 A;  3FG1 A;  4JRF A;  1WTH A;  2W9Q A;  3WOE B;  4J5G A;  1MWT A;  3OWU A;  1X1Y A;  1PYL A;  1OUN A;  2R4I A;  4XBT A;  1NB3 I;  3G71 3;  2Q07 A;  1K8A 4;  3CCJ 3;  3SOA A;  1LVN A;  2CIU A;  1Q86 4;  1NO3 A;  4O3V A;  1TFK A;  2F86 B;  2CKF B;  1TRQ A;  1BSC A;  1TUH A;  1D6Z A;  2XRX B;  5IG5 A;  1W5Z A;  4BTX A;  3BLZ A;  4RZM A;  1R4Y A;  3JUP A;  3V99 A;  2KF4 A;  1W02 A;  3CMA 3;  4WHA A;  2Z76 A;  1LNH A;  3PCR A;  2LYX A;  4U13 A;  2Y73 A;  1UUG B;  4PEJ A;  1LQG C;  2O9U X;  3WOF B;  1ULJ B;  1YNV X;  2OOV C;  5JBS A;  2GU3 A;  1AQZ A;  2P05 A;  1EG9 B;  5AYS C;  4XDW A;  2V1L A;  3KSP A;  2QGU A;  3CCR 3;  2IY2 A;  4XBY A;  3BU4 A;  3DH2 A;  3CCV 3;  1M90 4;  4G1M B;  1IYY A;  3ER7 A;  3UB1 A;  3CCM 3;  3X40 A;  4HM5 B;  2QEX 3;  1LXE A;  1M9G A;  3KZT A;  4CCV A;  3MHE A;  3CNM A;  1L5G B;  1K73 4;  5AII A;  1EEJ A;  1JV2 B;  3QK9 A;  4H3U A;  4EXR A;  1YGE A;  5M18 A;  3HOH A;  1VQ6 3;  1W00 A;  4O2H A;  4BTY A;  1I8V A;  5GSP A;  1JN5 B;  2OTJ 3;  3L0R A;  2D42 A;  3D9R A;  1OPY A;  2R41 A;  4IT7 A;  3NBJ A;  3PGB A;  3FCS B;  1J2B A;  1N5P A;  5A0O B;  4CPK A;  1ZS7 A;  3Q2P A;  2Y74 A;  2JQ5 A;  1FUT A;  3BIR A;  3WOD G;  1OGZ A;  1Z1S A;  3JUQ A;  1FGT A;  3NM2 A;  4GSP A;  3U1W A;  1IVU A;  1UGI A;  3MYT A;  2HMM B;  4N6N B;  1ROA A;  4BIR A;  1UW1 A;  4WYK B;  4HKV B;  3X42 A;  4CJN A;  2A15 A;  4HM0 B;  4KZ1 A;  2BHM A;  4HYZ A;  1RN7 A;  5D81 A;  1VQP 3;  2ML6 A;  5JPP A;  5KP4 A;  1X1U A;  3NQZ A;  3UL5 A;  1IU7 A;  1OHS A;  3H3H A;  5CK6 A;  3N54 B;  2W56 A;  3T8U A;  1RGA A;  1OH0 A;  1I2G A;  3JUN A;  4J8T A;  5TGN A;  1UCJ A;  2CFW A;  1IK3 A;  2CHC A;  2KF3 A;  2QA4 3;  1RRL A;  2F98 A;  3LTC A;  3MPH A;  4HVN A;  7GSP A;  4FCM A;  4STD A;  2HOH A;  1JBR A;  5AYR B;  3NM7 A;  3S67 A;  3V92 A;  4K1V A;  4O02 B;  5IG0 A;  3AGN A;  1A90 A;  1OF5 B;  1A2P A;  3KKG A;  5LC6 A;  2OQE A;  2CH9 A;  3RNT A;  2P0X A;  3DMC A;  3D4A A;  3NV0 A;  1W4N A;  5FGO A;  3JVC A;  1O7M B;  2XSO B;  2STD A;  4BTW A;  4FMB A;  2CFG A;  1DVC A;  1BSD A;  2W9P A;  4FCJ A;  3G16 A;  2PNC A;  3MG2 A;  1N9J A;  1G96 A;  4L8P A;  2KF6 A;  1UI8 A;  1B2X A;  3S29 A;  3LOY A;  3G0K A;  1FZU A;  1VZZ A;  3EX9 A;  1EQK A;  3D79 A;  3ZG0 A;  2XF3 A;  3CCU 3;  1GMP A;  3OWS A;  4FMA A;  3SX1 A;  2E2T A;  3WA3 A;  1QJG A;  1ROV A;  2UUG C;  3BNB A;  3G4S 3;  1DE3 A;  1RCK A;  3ROB A;  1FGR A;  1FGO A;  1X1W A;  2GBW B;  2HMJ B;  2P0M A;  4N3V A;  1VQK 3;  1MWS A;  4GHO A;  2K54 A;  3PS8 A;  4Q53 A;  5LC7 A;  4EC6 A;  4XBX A;  1RHL A;  3K9M C;  2BT3 A;  3EC9 A;  1JBT A;  1RMS A;  3DGY A;  3I55 3;  5IEO A;  3LTA A;  2ZL8 A;  1FUW A;  1BUQ A;  2J8X B;  3EB8 A;  1A67 A;  1VQ4 3;  4LMI A;  1GD4 A;  1D6Y A;  5CXO A;  1I0X A;  1STF I;  1S72 3;  3OV4 A;  5IEP A;  2L4V A;  3SOY A;  1GSP A;  7RNT A;  1KC8 4;  3LT9 A;  3RGR A;  5AIH A;  2BIR A;  3X3Z A;  1N8Q A;  5EEO A;  5FW5 A;  1MNL A;  3RGA A;  1W7C A;  3QRD A;  1MGR A;  3UJM A;  3N8B A;  1BRH A;  1Q40 A;  2GSP A;  3ECF A;  3X3X A;  3KCH A;  4IPB A;  1RGE A;  2CWU A;  5CF1 A;  2ZA4 A;  1UCK A;  1GYB A;  2Z77 A;  4N6T A;  4AKY A;  1VQO 3;  1GY6 A;  3PXM A;  5BU4 A;  5AEU B;  1JB5 A;  2XR8 B;  4BU4 A;  3F14 A;  3EHC A;  1W6Y A;  3BND A;  2GXF A;  3DXO A;  3DZL A;  2IYJ A;  4MMX B;  3B4P A;  1PFP A;  2YFI B;  1MWR A;  3F40 A;  2H0G A;  4HOH A;  5JPU A;  4EYC A;  4GB5 A;  3JUM A;  2IUK A;  3F8X A;  1HKX A;  1B27 A;  1YVB I;  4FMC A;  4FCZ A;  1OCV A;  1W01 A;  1IVW A;  2IMJ A;  4AEQ A;  2XFT A;  3NBR A;  2BU4 A;  4I4K A;  2GU1 A;  4O8S A;  3V98 A;  5EVH A;  2OQE C;  1K41 A;  1WNH A;  5IF6 A;  1JJ2 2;  1BRG A;  1IV9 A;  3BNE A;  1V57 A;  2CX0 A;  4RNY A;  1B3S A;  4XM4 A;  2KF5 A;  1VQM 3;  1RSN A;  1M1K 4;  1QAK A;  2W56 B;  1BUJ A;  4BL2 A;  3GAX A;  3N9H A;  1I2E A;  1FUS A;  3DY5 A;  4HJL B;  3VGN A;  1STD A;  4MEI A;  3FG3 A;  1W2B 2;  1R4C A;  1LQM B;  4KVH A;  5G2G A;  3UL6 A;  2W04 A;  3KII A;  2CX1 A;  1C54 A;  3FF0 A;  2ML5 A;  4XB5 A;  3FG4 A;  4K61 A;  4N6O B;  4X2H A;  6GSP A;  3BB9 A;  2CK3 H;  2YX9 A;  3PCS A;  3A5E A;  1O7P B;  2XEP A;  3SVA A;  3T0U A;  3LH4 A;  3SXX A;  2XGL A;  1WMP A;  1BNS A;  3NV0 B;  5BIR A;  2RNT A;  3A76 A;  1NU3 A;  1DMQ A;  1O7W B;  1G0T A;  1UUW B;  1V58 A;  3OWY A;  1NWW A;  1EA2 A;  3D5I A;  1O7H B;  3GZB A;  5ELU A;  1TFO A;  5EQL A;  3PYJ A;  2HML B;  4RNT A;  3LML A;  4X2O A;  2B24 B;  1G02 A;  4J9A A;  1I70 A;  4HBR A;  3FF2 A;  1FW7 A;  1VQQ A;  1DMM A;  2E2V A;  3J7Y d;  3HI7 A;  3MWZ A;  3Q1C A;  1I0V A;  2D1W A;  3CCE 3;  2P09 A;  1Q7Y 4;  3DGN A;  4L8O A;  1I3I A;  1JKG B;  2WGQ A;  4FR9 A;  3CC4 3;  2CWV A;  4N6U A;  3SED A;  4HM6 B;  1KSI A; 
#chains in the Genus database with same CATH homology
 1OGX A;  1IQX A;  4FMD A;  1WQL B;  4OUQ A;  3X41 A;  1JB4 A;  2INX A;  1JN5 A;  1EKM A;  3HX8 A;  1E3R A;  5IG3 A;  5KP3 A;  3O8Y A;  3DGO A;  4K90 B;  3S27 A;  3CPO A;  2HMO B;  3HII A;  2XFS A;  1W6G A;  2LQV A;  3MSO A;  3NQY A;  2F99 A;  3EBY A;  4R9L A;  4XDV A;  3CC7 3;  2FGT A;  5DRV A;  3I0Y A;  1QVF 2;  4MJD A;  4MMY B;  3LTB A;  1IT8 A;  1QAL A;  1JB2 A;  1YI2 3;  4LSO A;  1GY7 A;  4WYK A;  2W03 A;  5IG4 A;  3RDE A;  2B1X B;  2CWT A;  2Z7A A;  1TIJ A;  2YFJ B;  1SQW A;  1TU5 A;  1D6U A;  7STD A;  2C11 A;  2BMO B;  4HM1 B;  1GS3 A;  3U97 A;  2CFL A;  4R9K A;  4EBG A;  3S28 A;  1SPU A;  4TX4 A;  1VQ9 3;  3NUV A;  2BMQ B;  1US1 A;  3DGL A;  1YHQ 3;  4NRE A;  5IW9 A;  3BNC A;  3IJE B;  3CME 3;  2SBL A;  4EV5 A;  1VQ5 3;  3VSY A;  3EBT A;  1DVD A;  1OAC A;  5D83 A;  1TP6 A;  5AIG A;  1YJW 3;  4KFE A;  2BMR B;  1RKY A;  3AMO A;  3EF8 A;  3STD A;  1A2V A;  3M8C A;  2KRT A;  4L7K A;  2QIY A;  3E99 A;  2RCD A;  1QVG 2;  1O7N B;  2WO0 A;  2GEX A;  3JUO A;  2HMK B;  1CYV A;  5AI1 A;  1IQY A;  1OHO A;  1VQ8 3;  3CU3 A;  1HU9 A;  2E2U A;  3LZA A;  1N5H A;  3H51 A;  4N6M A;  1YIT 3;  3CCL 3;  2K0M A;  3B8L A;  1CYU A;  1RRH A;  3FKA A;  4JF8 A;  1Q82 4;  1E3V A;  8CHO A;  5KP1 A;  3FZW A;  2C10 A;  2WOH A;  2RSX A;  4ZM8 A;  1KD1 4;  4R80 A;  3IMA B;  4LZI A;  3HIG A;  2CFK A;  3KN4 A;  3DM8 A;  2CG0 A;  1YJ9 3;  1KQS 2;  2OTL 3;  1IDP A;  3LXU X;  3OW2 2;  3CCS 3;  5CF2 A;  3I56 3;  2GBX B;  3S5C A;  3D3L A;  3LT8 A;  3SLU A;  1ZO2 A;  4MMZ B;  2FXT A;  3HK4 A;  3DUK A;  5ELJ A;  5I97 A;  1W6C A;  1JNQ A;  1SII A;  3G6E 3;  1VQL 3;  1ASK A;  3IPT A;  3Q90 A;  1W2Z A;  2GEY A;  1FGQ A;  3EE1 A;  1IV7 A;  4WWU C;  3EN1 B;  4HZ9 B;  3F8H A;  3MKI A;  4LGQ A;  1FA3 A;  4HM2 B;  4HZB B;  2CC3 A;  1M1X B;  2RFR A;  3K63 A;  4N6L A;  1CQS A;  1SIH A;  4KFD A;  5D82 A;  1QAF A;  1DYU A;  3DGM A;  1T5Y A;  3FLJ A;  1U8C B;  3GZX B;  3PZW A;  3CXC 2;  3CNX A;  3X3Y A;  3CCQ 3;  1IQ8 A;  1WMO A;  3LYG A;  2MC8 A;  2BO9 B;  2OCT A;  1F8N A;  5DRE A;  3CC2 3;  1WMN A;  4HM8 B;  2IUJ A;  3B4O A;  2XSH B;  1SJW A;  3K7C A;  1IVV A;  1KWI A;  1MOL A;  1RJO A;  4NHF A;  2W0Q A;  3F7X A;  2CG1 A;  3OXA A;  5BXQ A;  1NDO B;  4IIA A;  1LOX A;  4CDL A;  4LEH A;  1DMN A;  1QMA A;  3UNL A;  4WP5 A;  1AVK A;  1UI7 A;  1N9E A;  2HMN B;  2M7O A;  5AIF A;  4HM4 B;  1AR0 A;  3KE7 A;  3F9S A;  4QWT A;  3WMD A;  2OOV A;  4OVM A;  4WFO A;  2O3O A;  1VQN 3;  4EV2 A;  1GD3 A;  2CW9 A;  3KSE D;  3WA2 X;  1C7H A;  2IA7 A;  3HZP A;  3F7S A;  2XGN A;  3AMO B;  3EJV A;  4K1U A;  1IVX A;  3NBB A;  4KFF A;  3FH1 A;  1FGM A;  1U5O A;  3NHX A;  1PU4 A;  2RGQ A;  3MG1 A;  2OWP A;  1N8R 4;  1ULI B;  1ZX2 A;  3GWR A;  2W6J H;  3CPW 2;  2CFD A;  4HM7 B;  4RBN A;  1Q40 B;  5HGR A;  2W2C A;  3FGY A;  2P38 A;  4ORL A;  2WOF A;  4GL6 A;  2I9W A;  3NX0 A;  3OX9 A;  4OK0 A;  3NXJ A;  1Q81 4;  1V74 A;  3B7C A;  1VQ7 3;  2KXG A;  3GZR A;  3G8Z A;  4H61 A;  3VF1 A;  2Z6B A;  3K5T A;  1JKG A;  4RNZ A;  4AKZ A;  1K9M 4;  1K28 A;  5IER A;  1S5A A;  1O7G B;  1IT7 A;  3FSD A;  4R1K A;  1GY5 A;  3EQQ B;  6STD A;  1OF5 A;  1ISK A;  1AVL A;  1NB5 I;  4HM3 B;  5IEN A;  3GZY B;  1NJI 4;  2BNG A;  3TDG A;  2PZV A;  3EN8 A;  1AV4 A;  4N6V 0;  1YIJ 3;  2JDI H;  3CD6 3;  2UX0 A;  1Q42 A;  3K0Z A;  5AEW B;  1A2K A;  2XH9 A;  3ALA A;  3GRD A;  4R4K A;  3T8N A;  1Y4K A;  1YJN 3;  2ZDJ A;  3KFQ C;  1CEW I;  1E97 A;  5BVB A;  2KCD A;  1JRQ A;  3LTD A;  5STD A;  1OHP A;  2WGO A;  2FNQ A;  2YFL B;  5CLK A;  3WDG B;  1UUV B;  3MG3 A;  2MF7 A;  3FG1 A;  4JRF A;  1WTH A;  2W9Q A;  3WOE B;  3OWU A;  4XBT A;  1OUN A;  2R4I A;  1NB3 I;  3G71 3;  2Q07 A;  1K8A 4;  3CCJ 3;  3SOA A;  1LVN A;  2CIU A;  1Q86 4;  1NO3 A;  4O3V A;  1TFK A;  2F86 B;  2CKF B;  1TUH A;  5IG5 A;  1D6Z A;  2XRX B;  1W5Z A;  4BTX A;  3BLZ A;  4RZM A;  3JUP A;  3V99 A;  1W02 A;  3CMA 3;  4WHA A;  2Z76 A;  1LNH A;  3PCR A;  2LYX A;  4U13 A;  2Y73 A;  4PEJ A;  2O9U X;  3WOF B;  1ULJ B;  2OOV C;  5JBS A;  2GU3 A;  2P05 A;  1EG9 B;  5AYS C;  4XDW A;  2V1L A;  3KSP A;  2QGU A;  3CCR 3;  4XBY A;  3CCV 3;  1M90 4;  4G1M B;  3ER7 A;  3UB1 A;  3CCM 3;  3X40 A;  4HM5 B;  2QEX 3;  1LXE A;  1M9G A;  3KZT A;  4CCV A;  3MHE A;  3CNM A;  1L5G B;  1K73 4;  5AII A;  1JV2 B;  3QK9 A;  4H3U A;  4EXR A;  1YGE A;  1VQ6 3;  1W00 A;  4O2H A;  4BTY A;  1JN5 B;  2OTJ 3;  3L0R A;  2D42 A;  3D9R A;  1OPY A;  4IT7 A;  3NBJ A;  3PGB A;  3FCS B;  1J2B A;  1N5P A;  5A0O B;  3Q2P A;  2Y74 A;  2JQ5 A;  3WOD G;  1OGZ A;  1Z1S A;  3JUQ A;  1FGT A;  3NM2 A;  3U1W A;  1IVU A;  3MYT A;  2HMM B;  4N6N B;  1ROA A;  1UW1 A;  4WYK B;  4HKV B;  3X42 A;  2A15 A;  4HM0 B;  4KZ1 A;  2BHM A;  4HYZ A;  1RN7 A;  5D81 A;  1VQP 3;  2ML6 A;  5JPP A;  5KP4 A;  3NQZ A;  3UL5 A;  1IU7 A;  1OHS A;  3H3H A;  5CK6 A;  3N54 B;  2W56 A;  3T8U A;  1OH0 A;  3JUN A;  4J8T A;  5TGN A;  1IK3 A;  2CFW A;  2CHC A;  2QA4 3;  1RRL A;  2F98 A;  3LTC A;  3MPH A;  4HVN A;  4FCM A;  4STD A;  5AYR B;  3NM7 A;  3S67 A;  3V92 A;  4K1V A;  4O02 B;  5IG0 A;  1A90 A;  1OF5 B;  3KKG A;  5LC6 A;  2OQE A;  2CH9 A;  2P0X A;  3DMC A;  3NV0 A;  1W4N A;  5FGO A;  3JVC A;  1O7M B;  2XSO B;  2STD A;  4BTW A;  4FMB A;  2CFG A;  1DVC A;  2W9P A;  4FCJ A;  3G16 A;  2PNC A;  3MG2 A;  1N9J A;  1G96 A;  4L8P A;  3S29 A;  1UI8 A;  3LOY A;  3G0K A;  1VZZ A;  3EX9 A;  1EQK A;  2XF3 A;  3CCU 3;  3OWS A;  4FMA A;  3SX1 A;  2E2T A;  3WA3 A;  1QJG A;  1ROV A;  3BNB A;  3G4S 3;  3ROB A;  1FGR A;  1FGO A;  2GBW B;  2HMJ B;  4N3V A;  2P0M A;  1VQK 3;  5LC7 A;  2K54 A;  3PS8 A;  4Q53 A;  4EC6 A;  4XBX A;  3K9M C;  2BT3 A;  3EC9 A;  3I55 3;  5IEO A;  3LTA A;  2ZL8 A;  1FUW A;  1BUQ A;  3EB8 A;  1A67 A;  1VQ4 3;  4LMI A;  1GD4 A;  1D6Y A;  5CXO A;  1STF I;  1S72 3;  3OV4 A;  5IEP A;  2L4V A;  3SOY A;  1KC8 4;  3LT9 A;  3RGR A;  5AIH A;  3X3Z A;  1N8Q A;  5EEO A;  5FW5 A;  1MNL A;  3RGA A;  1W7C A;  3QRD A;  3UJM A;  3N8B A;  1Q40 A;  3X3X A;  3ECF A;  4IPB A;  2CWU A;  5CF1 A;  4N6T A;  1GYB A;  2Z77 A;  4AKY A;  1VQO 3;  1GY6 A;  3PXM A;  5AEU B;  1JB5 A;  2XR8 B;  3F14 A;  3EHC A;  1W6Y A;  3BND A;  2GXF A;  3DXO A;  3DZL A;  4MMX B;  3B4P A;  1PFP A;  2YFI B;  3F40 A;  5JPU A;  4EYC A;  4GB5 A;  3JUM A;  2IUK A;  3F8X A;  1HKX A;  1YVB I;  4FMC A;  4FCZ A;  1OCV A;  1W01 A;  1IVW A;  2IMJ A;  4AEQ A;  2XFT A;  3NBR A;  4O8S A;  4I4K A;  2GU1 A;  3V98 A;  5EVH A;  2OQE C;  1K41 A;  1WNH A;  5IF6 A;  1JJ2 2;  1IV9 A;  3BNE A;  4RNY A;  4XM4 A;  1VQM 3;  1M1K 4;  1QAK A;  2W56 B;  3GAX A;  3N9H A;  3DY5 A;  4HJL B;  3VGN A;  1STD A;  4MEI A;  3FG3 A;  1W2B 2;  1R4C A;  4KVH A;  5G2G A;  3UL6 A;  2W04 A;  3KII A;  3FF0 A;  2ML5 A;  4XB5 A;  3FG4 A;  4K61 A;  4N6O B;  4X2H A;  3BB9 A;  2CK3 H;  2YX9 A;  3PCS A;  1O7P B;  2XEP A;  3SVA A;  3T0U A;  3LH4 A;  3SXX A;  2XGL A;  1WMP A;  3NV0 B;  3A76 A;  1NU3 A;  1DMQ A;  1O7W B;  1UUW B;  3OWY A;  1NWW A;  1EA2 A;  1O7H B;  3GZB A;  5ELU A;  1TFO A;  5EQL A;  3PYJ A;  2HML B;  3LML A;  4X2O A;  2B24 B;  4J9A A;  4HBR A;  3FF2 A;  2E2V A;  1DMM A;  3J7Y d;  3HI7 A;  3MWZ A;  3Q1C A;  2D1W A;  3CCE 3;  2P09 A;  1Q7Y 4;  3DGN A;  4L8O A;  2WGQ A;  1JKG B;  4FR9 A;  3CC4 3;  2CWV A;  4N6U A;  3SED A;  4HM6 B;  1KSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...