4STDA

High resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological ph
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
molecule keywords Scytalone dehydratase
total genus 46
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4stdA00
1HKXA 1S5AA 4U13A 3RGAA 1OCVA 3NBRA 3JUOA 5DREA 1OGXA 1ASKA 1DMQA 3Q90A 4HM8B 2BMQB 3GZXB 5D81A 2YFJB 3MKIA 2RFRA 3FKAA 1JKGB 3VGNA 2GXFA 3EBYA 1Q40B 3NUVA 4K1UA 5G2GA 4OUQA 2BNGA 2Z77A 3DZLA 3EBTA 3FH1A 3G16A 5CLKA 2HMMB 2Z76A 1GS3A 1E3RA 3CNMA 2BMRB 1ISKA 4XB5A 5IG4A 1OHSA 2XR8B 5AIIA 8CHOA 3KZTA 3OWYA 2BMOB 3JUNA 4HM1B 2F98A 4I4KA 1O7MB 3H3HA 1O7HB 1GY7A 3CNXA 2HMOB 1QJGA 4STDA 3FZWA 3OXAA 3ECFA 3F40A 1OH0A 3DMCA 3K7CA 3GZYB 4L7KA 4MJDA 4K1VA 4Q53A 3EC9A 2OWPA 3LYGA 2JQ5A 5IF6A 1WQLB 3E99A 4H3UA 4KVHA 5AIGA 3FLJA 2QIYA 3I0YA 1EA2A 4HM5B 1QMAA 3KKGA 3ROBA 4HM2B 5KP4A 2B1XB 5IG0A 1DMMA 4FCMA 5AI1A 1BUQA 1OHOA 1Q40A 4J9AA 3CPOA 3K0ZA 2YFLB 2Z7AA 3SOAA 3T8NA 2YFIB 1TUHA 1OPYA 3EN8A 1IDPA 2F86B 5JPPA 3M8CA 2CKFB 2INXA 3OWSA 4HJLB 2K54A 3OV4A 1OGZA 1STDA 5CF2A 1O7WB 3EF8A 5KP3A 5IEPA 2GEXA 3F7SA 3KE7A 1A2KA 1K41A 4WYKA 3B8LA 4HM0B 5EVHA 3DM8A 4L8PA 3DUKA 1O7NB 3IPTA 2R4IA 1GY6A 1Q42A 4WYKB 1VZZA 4XM4A 5FW5A 2RGQA 3F8HA 2HMJB 4HZBB 5TGNA 1NDOB 3VSYA 5AEWB 3MSOA 1E97A 1OHPA 1W02A 1W01A 2GBWB 4HM7B 4IIAA 4X2HA 5D83A 5HGRA 4HM4B 4OVMA 5JPUA 1U5OA 3JUMA 4WWUC 3GWRA 1ZX2A 3MHEA 4CDLA 2IMJA 3NM2A 4HZ9B 1EG9B 3DXOA 4WP5A 4XBXA 4RZMA 5BXQA 3CU3A 3GZBA 3KSPA 4L8OA 3H51A 1ULIB 3F7XA 3LZAA 4R1KA 3FGYA 3HZPA 3MYTA 1UUVB 3UNLA 4R9LA 2HMKB 4XBYA 3JUPA 3S5CA 3WMDA 6STDA 2XRXB 3BB9A 3MG2A 2W2CA 5AIFA 2XSOB 3OX9A 3NHXA 4HM3B 5CK6A 3HX8A 2F99A 3EHCA 3G8ZA 1GY5A 1O7PB 1OF5B 1JB5A 4HKVB 4ORLA 3STDA 3BLZA 3F14A 4N3VA 5DRVA 3NV0A 5STDA 2XSHB 2A15A 5BVBA 1AR0A 1JN5A 5AIHA 2HMNB 2PZVA 3EQQB 2UX0A 3FF0A 1ZO2A 3FSDA 3GZRA 1O7GB 5D82A 5IEOA 5IERA 3UJMA 5IG3A 1Z1SA 1W6YA 3EJVA 3SEDA 4XDVA 3B4OA 5AEUB 5IENA 5KP1A 3HK4A 4LMIA 1GYBA 2B24B 4XBTA 1DMNA 4J8TA 2GEYA 3D9RA 1NWWA 4XDWA 4R9KA 5CXOA 3RGRA 1JB2A 1W00A 2CHCA 1E3VA 3MG3A 2HMLB 2STDA 5IG5A 3JUQA 1JB4A 2RCDA 3F8XA 1JKGA 1ULJB 2QGUA 3FF2A 4GB5A 3A76A 3GRDA 1OUNA 4PEJA 5CF1A 3OWUA 1UUWB 1SJWA 4LEHA 4X2OA 3EN1B 3ER7A 2GBXB 3MG1A 3NV0B 3NXJA 1TP6A 4LGQA 3SOYA 1JN5B 7STDA 3EX9A 2I9WA 4HM6B 1CQSA 3T8UA 1NU3A 1OF5A 3B7CA 3F9SA 4FCJA 1C7HA 4HVNA 3B4PA 3G0KA
chains in the Genus database with same CATH superfamily
1HKXA 1LOYA 1MNLA 1UUGB 3RGAA 5RNTA 1NB5I 3CME3 1TFKA 3NBRA 1WMOA 3JUOA 1BSAA 1M9GA 1OGXA 2KXGA 1ASKA 1PFPA 1FUSA 1B2XA 3Q90A 2Y74A 5D81A 2P05A 3MPHA 1I70A 4ILFA 3CCJ3 4RNZA 3VGNA 5A0OB 2KF5A 1Q40B 1UI8A 4K1UA 1X1WA 3RDEA 1N9JA 4OUQA 3S27A 3Q3FA 3G16A 5CLKA 1E3RA 2BO9B 1US1A 3CNMA 2BMRB 3UL5A 1IV7A 2K0MA 3WA3A 3BU4A 2P09A 3LTAA 5BIRA 3X3YA 1BRGA 3CCQ3 1VQP3 1O7HB 1DETA 1UCLA 1M1K4 1CH0A 3F40A 3SYUA 2ZHXB 1K9M4 4L7KA 5LC7A 4JF8A 1BNJA 1N5PA 1LQGC 1HU9A 4LZIA 5AIGA 1FGQA 2QIYA 3FG4A 1JBRA 1BNIA 1FGMA 1SIHA 5IG0A 1AY7A 1DMMA 3BNBA 1RGEA 3GAXA 4QWTA 5AI1A 1JJ22 4IT7A 1WTHA 2OOVC 3X3ZA 1KC84 3EN8A 4HOHA 1IDPA 2Y73A 3GSPA 1GSPA 5JPPA 2INXA 5G1LA 2KF6A 3OWSA 1OGZA 1I3FA 4K90B 2KCDA 2GEXA 3LT9A 2RBIA 3KE7A 1CYVA 7RNTA 3CCR3 5AYSC 1IQYA 4HM0B 3WA2X 3DM8A 4L8PA 4WYKB 3SOAA 2LQVA 1UGHI 2R4IA 5FW5A 1RNBA 1YHQ3 2H0HA 3F8HA 1TU5A 2RNTA 1QVF2 4RNYA 1WMNA 2WGOA 2BIRA 4IIAA 1I2FA 3D5GA 1IK3A 3EB8A 4NHFA 3JUMA 3S29A 1AVKA 1TTOA 3GWRA 4CDLA 2F5MA 2IUKA 3NM2A 5M1AA 2CG1A 4BL3A 1BRHA 1RTUA 2XFTA 5CF1A 2YX9A 3FGYA 2ML6A 3UNLA 4ZM8A 2BU4A 2RSXA 5HOHA 3LTCA 1G0TA 5EQLA 5G1KA 2W2CA 5AIFA 1YGEA 3OX9A 1MWUA 5ELJA 1BUJA 2P0MA 1JNQA 2XGNA 1KD14 1RRLA 1K8A4 3PYJA 4N6TA 3D79A 3F14A 1BRSA 4N3VA 1RDSA 2XSHB 2XF3A 1VQO3 1MWTA 3EQQB 5IEOA 1YJW3 1RN1A 3KN4A 1RGHA 3PCRA 4G1MB 1QAFA 1W6YA 3LMLA 3UJMA 5AEUB 3PS8A 3HK4A 2B24B 1GYBA 3LXUX 4XBTA 1DMNA 1RHLA 1YVBI 2GEYA 1R4YA 1UCKA 1B2SA 4R9KA 1RN4A 6RNTA 1WNHA 4KZ1A 1UI7A 2HMLB 1I8VA 1B2UA 4LGQA 1I0XA 1A2PA 1M1XB 1ULJB 3FF2A 3K9MC 3GRDA 3PCSA 4PEJA 3UL6A 3U1WA 3FCSB 3G4S3 4LEHA 4O8SA 3NXJA 2HOHA 2V1LA 1V74A 1I3IA 1JN5B 3S28A 3T8UA 1OF5A 3F9SA 1C7HA 4HVNA 1S5AA 1KSIA 2FNQA 4TX4A 1VQM3 1OACA 1YJN3 1YNVX 3BIRA 1RJOA 2BMQB 2D42A 3GZXB 1W6GA 3NM7A 2YFJB 3MKIA 4N6NB 1F8NA 1JBSA 3EE1A 1JKGB 2GXFA 3EBYA 4FMDA 4JRFA 2CC3A 1GOYA 4BTYA 1AV4A 2XEPA 2LYXA 1R4CA 3A5EA 4RNTA 4WHAA 1IVXA 5IG4A 2KRTA 5FGOA 2XR8B 3FG3A 4KT3B 1GOUA 3KZTA 8RNTA 3OWYA 2BMOB 3CC43 2OQEC 3SXXA 1Q864 3CNXA 2P38A 2D1WA 1QJGA 3FZWA 2M7OA 1A67A 3ECFA 3D5IA 1OH0A 3DMCA 3K7CA 3GZYB 2IYJA 4MJDA 1RMSA 1DYUA 3LYGA 1WQLB 1IQ8A 1Q7HA 3I0YA 1MWRA 2ZDJA 1MOLA 4HM2B 4IPBA 3SVAA 3I563 3MWZA 1DVDA 3G713 1Q40A 1X1XA 3AMOB 1TJDA 4J9AA 3T0UA 3V98A 3CPOA 3K0ZA 2YFLB 3T8NA 3CCE3 3OW22 1TUHA 3DGOA 3ALAA 4N6MA 4N6OB 2F86B 1U8CB 2C11A 1Q7Y4 3CCU3 3OV4A 1STDA 4AEQA 1QAKA 3F7SA 1B2ZA 4WYKA 3B8LA 2O9UX 3DUKA 4XM4A 1GY6A 1Q42A 3K5TA 1B2MA 5TGNA 3NBBA 2KF4A 5AEWB 1E97A 1IYYA 1W02A 2GBWB 4X2HA 3SX1A 4EW5A 1U5OA 1D6YA 4MMYB 2C10A 4GL6A 5LC6A 4WWUC 1BRJA 1SPUA 4R80A 5EEOA 3MHEA 1JBTA 4HZ9B 2C4BA 1FGRA 3CD63 4XBXA 1BSDA 3CU3A 5D83A 4R1KA 2WOHA 3MYTA 2WO0A 4LYLB 2GSPA 4R9LA 4XBYA 1LRAA 4GHOA 1Q824 3MG2A 4BIRA 3NHXA 1AVLA 4HM3B 3HOHA 3KSED 1B27A 1BRIA 2F99A 3J7Yd 2UGIA 1GY5A 3N9HA 1FGOA 1JB5A 3DGNA 1UDII 3BLZA 5BVBA 2E2TA 2ZA4A 2A15A 2CX1A 1AR0A 3DY5A 1BNRA 2HMNB 2PZVA 3KIIA 4FR9A 1FUTA 1ZO2A 1W2ZA 1O7GB 1VQ63 5IERA 5IG3A 4EXRA 2W6JH 3HI7A 2IA7A 1VQN3 1JV2B 3HIIA 4OK0A 3CCV3 1HZ1A 5CXOA 1RGCA 3D9RA 3Q2PA 1D6ZA 3RGRA 2WOFA 1YIJ3 3MG3A 2CHCA 3CXC2 4GB5A 1JB4A 2RCDA 1GMQA 1JKGA 2QGUA 3CC23 1IVUA 1K28A 3OWUA 1BGSA 3EN1B 3ER7A 3MG1A 3NV0B 3CCM3 4EYCA 2CWUA 3SOYA 3EX9A 4BL2A 4AKZA 2KAAA 1EUIC 1L5GB 2CFDA 1Q814 2CIUA 1B3SA 1OCVA 4FCZA 1LVNA 4J5KA 4H61A 4KFFA 1DMQA 4AKYA 1JRQA 1MGWA 4HM8B 2FXTA 3NBJA 2FGTA 2RFRA 3IMAB 4HBRA 1ROVA 1STFI 3NUVA 5BU4A 5M19A 2L4VA 2ML5A 1YI23 3WR2A 3DZLA 3FH1A 5M18A 2Z76A 1RGGA 1AQZA 4RBNA 2QA43 1I2GA 1ISKA 4XB5A 3CPW2 1SARA 2JDIH 4O2HA 3WDGB 3PXMA 4KFEA 4HM1B 1FYSA 1UW1A 1O7MB 2CW9A 1RLSA 3LTBA 4K61A 1FA3A 1W7CA 2HMOB 4HYZA 1JZOA 4STDA 1IQXA 4NPBA 2OTL3 2W9QA 3OXAA 2W04A 1BVIA 1PU4A 4K1VA 2OWPA 4FMBA 1TFOA 1Q9EA 3E99A 3BNCA 3WHOA 4CPKA 1YJ93 1KQS2 4MMZB 1W6CA 3AGNA 1M904 3KKGA 2CH9A 3ROBA 5KP4A 2QEX3 3D4AA 2AADA 2W9PA 4MEIA 4N6UA 1BUQA 3DGMA 1OHOA 3LH4A 2Z6BA 1SQWA 2Z7AA 3AMOA 3KCHA 1K734 1Y4KA 1VQ43 5ELUA 1GMPA 5AYRB 2IUJA 2W56A 2CKFB 3G6E3 4HJLB 2K54A 3RNTA 2F4YA 1IVWA 3ZFZA 5CF2A 1QVG2 5KP3A 2OOVA 3DGYA 5IEPA 1BANA 1BU4A 1A2KA 1K41A 1UGIA 4WFOA 5EVHA 5GSPA 3ZG0A 4FMAA 1O7NB 1BSBA 3BNDA 4NREA 3CCS3 3VSYA 2HMJB 1NDOB 2MF7A 1VQ93 1ROAA 3MSOA 2W03A 2W0QA 3DH2A 1OHPA 1I2EA 1W01A 4HM7B 1NB3I 1W2B2 1TRQA 2OTJ3 4HM4B 5JPUA 2KF3A 1VQ73 2BT3A 1ZX2A 1CEWI 2IMJA 2ZL8A 1EG9B 5IF6A 4RZMA 3GZBA 3KSPA 1VQ83 3H51A 1ULIB 6GSPA 1BNFA 1J2BA 1C54A 3TDGA 3NQZA 3WMDA 2XRXB 3BB9A 1YIT3 3PZWA 3AHSA 3X41A 5CK6A 3HX8A 4MMXB 3I553 1RNTA 3G8ZA 4HKVB 4ORLA 3V92A 2MC8A 3KFQC 5STDA 4BU4A 4EV5A 2H0GA 1JN5A 3D3LA 5AIHA 4O02B 3FSDA 2E2VA 1BOXA 3CCL3 3SLUA 1RGFA 3SEDA 5IENA 5KP1A 1IT7A 4LMIA 1T3BA 7GSPA 1G96A 1RGKA 4J8TA 2BHMA 4N6LA 2PNCA 1W00A 4I5QA 5IG5A 2STDA 1D6UA 3JUQA 3F8XA 1N8R4 3WOFB 2CX0A 1OUNA 1BSCA 2XH9A 3Q1CA 4X2OA 1NO3A 2GBXB 7STDA 1TP6A 3X40A 1LQMB 3AHWA 3L0RA 3QRDA 4HM6B 1NU3A 2W56B 3VF1A 3B7CA 2IY2A 4FCJA 4BTXA 1LNHA 3B4PA 3N8BA 4U13A 1RCLA 1GD4A 1RSNA 5DREA 1EQKA 1ZS7A 4GSPA 3O8YA 1FZUA 3IJEB 1VQK3 1IVVA 3N54B 1RKYA 3FKAA 5G2GA 1UCIA 9RNTA 2SBLA 2BNGA 2Z77A 1FGTA 3EBTA 2SARA 2HMMB 1GS3A 1T2HA 1VQQA 5JBSA 1YVSA 1S723 1BNGA 1OHSA 5AIIA 3NX0A 8CHOA 1FW7A 2AAEA 2OCTA 3JUNA 4I4KA 2F98A 2O3OA 3H3HA 1GY7A 2F56A 4BTWA 2CFKA 1LXEA 3WODG 4EC6A 3V99A 1IU7A 4HAAA 1BNEA 2K3DA 1YGWA 2WGQA 1GD3A 3JVCA 3QK9A 1UCJA 2XFSA 3EC9A 4FMCA 4Q53A 2JQ5A 2OQEA 4H3UA 1VQ53 4KVHA 4KFDA 3FLJA 1EA2A 1LOWA 1QMAA 4HM5B 1N9EA 1N8QA 3HIGA 2B1XB 2F5WA 1IV9A 1BRKA 4FCMA 1BIRA 1EKMA 1PY3A 1X1YA 1RGLA 2YFIB 1OPYA 1CYUA 2R41A 4DKIA 3M8CA 1B20A 1G02A 1BNSA 3PGBA 1NJI4 2L1SA 1A2VA 1LOXA 3UB1A 1O7WB 3EF8A 1KWIA 1VQL3 1W4NA 1N5HA 2H0IA 2E2UA 1TRPA 2CG0A 1MGRA 3IPTA 4CJNA 1ZGXA 1VZZA 4CCVA 2RGQA 3K63A 4HZBB 2CK3H 4EBGA 1V57A 4N6V0 2Q07A 5HGRA 4R4KA 1LOVA 4OVMA 2GU3A 3CMA3 2CFWA 1X1UA 2CWTA 3DXOA 3FG1A 4WP5A 5BXQA 1DE3A 1BRNL 1GMRA 1PYLA 4L8OA 1RCKA 3F7XA 3LZAA 3URPA 1FUWA 3HZPA 1BAOA 1UUVB 2HMKB 3S5CA 3JUPA 1MWSA 6STDA 4O3VA 3S67A 1NNVA 2XSOB 1A90A 1DVCA 3DGLA 4J5GA 3EHCA 3LT8A 1O7PB 3LOYA 1OF5B 2P0XA 1TIJA 1EEJA 3STDA 1B21A 5DRVA 3NV0A 2GU1A 1T2IA 4LSOA 3LTDA 1RGAA 2CWVA 3CC73 3FF0A 2UX0A 5D82A 1HYFA 3GZRA 3X42A 1V58A 1Z1SA 3EJVA 2CFLA 4XDVA 1RRHA 3B4OA 1RN7A 2CFGA 5I97A 4EV2A 2XGLA 3BNEA 3NQYA 1WMPA 1NWWA 1T5YA 1IT8A 4XDWA 1JB2A 1E3VA 2UUGC 3A76A 3WOEB 1UUWB 1W5ZA 1SJWA 5IW9A 1BSEA 3U97A 1GOVA 3AGOA 3ZG5A 2I9WA 1CQSA 1QALA 2J8XB 1I0VA 1JZDA 1LNIA 3X3XA 1SIIA 3G0KA
chains in the Genus database with same CATH topology
1HKXA 1MNLA 3RGAA 1NB5I 3CME3 1TFKA 3NBRA 1WMOA 3JUOA 1M9GA 1OGXA 2KXGA 1ASKA 1PFPA 3Q90A 2Y74A 5D81A 2P05A 3MPHA 3CCJ3 4RNZA 3VGNA 5A0OB 4K1UA 1Q40B 1UI8A 3RDEA 1N9JA 4OUQA 3S27A 3G16A 5CLKA 1E3RA 2BO9B 1US1A 3CNMA 2BMRB 3UL5A 1IV7A 2K0MA 3WA3A 2P09A 3LTAA 3X3YA 3CCQ3 1VQP3 1O7HB 1M1K4 3F40A 1K9M4 4L7KA 5LC7A 4JF8A 1N5PA 1HU9A 4LZIA 5AIGA 1FGQA 2QIYA 3FG4A 1FGMA 1SIHA 5IG0A 1DMMA 3BNBA 4QWTA 1JJ22 3GAXA 5AI1A 4IT7A 1WTHA 2OOVC 3X3ZA 1KC84 3EN8A 1IDPA 2Y73A 5JPPA 2INXA 3OWSA 1OGZA 4K90B 2KCDA 2GEXA 3LT9A 3KE7A 1CYVA 3CCR3 5AYSC 1IQYA 4HM0B 3WA2X 3DM8A 4L8PA 4WYKB 3SOAA 2LQVA 2R4IA 5FW5A 1YHQ3 1TU5A 3F8HA 1QVF2 4RNYA 1WMNA 2WGOA 4IIAA 1IK3A 3EB8A 4NHFA 3JUMA 3S29A 1AVKA 3GWRA 4CDLA 2IUKA 3NM2A 2CG1A 2XFTA 5CF1A 2YX9A 3FGYA 2ML6A 3UNLA 4ZM8A 2RSXA 3LTCA 5EQLA 2W2CA 5AIFA 1YGEA 3OX9A 5ELJA 2P0MA 1JNQA 2XGNA 1RRLA 1K8A4 3PYJA 4N6TA 3F14A 4N3VA 2XSHB 2XF3A 1VQO3 3EQQB 5IEOA 1YJW3 3KN4A 4G1MB 3PCRA 3UJMA 1QAFA 1W6YA 3LMLA 5AEUB 3PS8A 3HK4A 1GYBA 2B24B 3LXUX 4XBTA 1DMNA 1KD14 1YVBI 2GEYA 3CC73 4R9KA 1WNHA 4KZ1A 1UI7A 2HMLB 4LGQA 1ULJB 1M1XB 3FF2A 3K9MC 3PCSA 3GRDA 4PEJA 3UL6A 3U1WA 3FCSB 3G4S3 4LEHA 4O8SA 3NXJA 2V1LA 1V74A 1JN5B 3S28A 3T8UA 1OF5A 3F9SA 1C7HA 4HVNA 1S5AA 1KSIA 2FNQA 4TX4A 1VQM3 1OACA 1YJN3 1RJOA 2BMQB 2D42A 3GZXB 1W6GA 3NM7A 2YFJB 3MKIA 4N6NB 1F8NA 3EE1A 1JKGB 2GXFA 3EBYA 4FMDA 4JRFA 2CC3A 4BTYA 1AV4A 2XEPA 2LYXA 1R4CA 4WHAA 1IVXA 5IG4A 2KRTA 5FGOA 2XR8B 3FG3A 3KZTA 3OWYA 2BMOB 3CC43 2OQEC 3SXXA 1Q864 2P38A 2D1WA 1QJGA 3FZWA 2M7OA 1A67A 3ECFA 1OH0A 3DMCA 3K7CA 3GZYB 4MJDA 1DYUA 3LYGA 1WQLB 1IQ8A 3I0YA 2ZDJA 1MOLA 4HM2B 4IPBA 3SVAA 3I563 3MWZA 1DVDA 3G713 1Q40A 3AMOB 3T0UA 4J9AA 3V98A 3CCE3 3CPOA 3K0ZA 2YFLB 3T8NA 3OW22 1TUHA 3DGOA 3ALAA 4N6MA 4N6OB 2F86B 1U8CB 2C11A 1Q7Y4 3CCU3 3OV4A 1STDA 4AEQA 1QAKA 3F7SA 4WYKA 3B8LA 2O9UX 3DUKA 4XM4A 1GY6A 1Q42A 3K5TA 5TGNA 3NBBA 5AEWB 1E97A 1W02A 2GBWB 4X2HA 3SX1A 1U5OA 1D6YA 4MMYB 2C10A 4GL6A 5LC6A 4WWUC 5EEOA 1SPUA 4R80A 3MHEA 4HZ9B 3CD63 1FGRA 4XBXA 3CU3A 5D83A 4R1KA 2WOHA 3MYTA 2WO0A 4R9LA 4XBYA 1Q824 3MG2A 3NHXA 1AVLA 4HM3B 3KSED 2F99A 3J7Yd 1GY5A 3N9HA 1FGOA 1JB5A 3DGNA 3BLZA 5BVBA 2E2TA 2A15A 3DY5A 1AR0A 2HMNB 2PZVA 3KIIA 4FR9A 1ZO2A 1W2ZA 1O7GB 1VQ63 5IERA 5IG3A 4EXRA 2W6JH 3HI7A 2IA7A 1VQN3 1JV2B 3HIIA 4OK0A 3CCV3 5CXOA 3D9RA 3Q2PA 3RGRA 1D6ZA 2WOFA 1YIJ3 3MG3A 2CHCA 3CXC2 4GB5A 1JB4A 2RCDA 1JKGA 2QGUA 3CC23 1IVUA 1K28A 3OWUA 3EN1B 3ER7A 3MG1A 3NV0B 3CCM3 4EYCA 2CWUA 3SOYA 3EX9A 4AKZA 1L5GB 2CFDA 1Q814 2CIUA 1OCVA 4FCZA 1LVNA 4H61A 4KFFA 1DMQA 4AKYA 1JRQA 4HM8B 2FXTA 3NBJA 2FGTA 2RFRA 3IMAB 4HBRA 1ROVA 1STFI 3NUVA 2L4VA 2ML5A 1YI23 3DZLA 3FH1A 2Z76A 2QA43 4RBNA 1ISKA 4XB5A 3CPW2 2JDIH 4O2HA 3WDGB 3PXMA 4KFEA 4HM1B 1UW1A 2CW9A 1O7MB 1FA3A 3LTBA 4K61A 1SIIA 1W7CA 2HMOB 4HYZA 4STDA 1IQXA 2OTL3 2W9QA 3OXAA 2W04A 1PU4A 4K1VA 2OWPA 4FMBA 1TFOA 3E99A 3BNCA 1YJ93 1KQS2 4MMZB 1W6CA 1M904 3KKGA 2CH9A 3ROBA 5KP4A 2QEX3 4MEIA 2W9PA 4N6UA 1BUQA 3DGMA 1OHOA 3LH4A 2Z6BA 1SQWA 2Z7AA 3AMOA 1K734 1VQ43 1Y4KA 5ELUA 5AYRB 2IUJA 2W56A 2CKFB 3G6E3 4HJLB 2K54A 5CF2A 1IVWA 1QVG2 5KP3A 2OOVA 5IEPA 1A2KA 1K41A 4WFOA 5EVHA 4FMAA 1O7NB 3BNDA 4NREA 3CCS3 3VSYA 2HMJB 1NDOB 2MF7A 1VQ93 1ROAA 3MSOA 2W03A 2W0QA 1OHPA 4HM7B 1W01A 1W2B2 1NB3I 2OTJ3 4HM4B 5JPUA 1VQ73 2BT3A 1ZX2A 1CEWI 2IMJA 2ZL8A 1EG9B 5IF6A 4RZMA 3GZBA 3KSPA 1VQ83 3H51A 1ULIB 1J2BA 3TDGA 3NQZA 3WMDA 2XRXB 3BB9A 1YIT3 3PZWA 3X41A 5CK6A 3HX8A 4MMXB 3I553 3G8ZA 4HKVB 4ORLA 3V92A 2MC8A 3KFQC 5STDA 4EV5A 1JN5A 3D3LA 5AIHA 4O02B 3FSDA 2E2VA 3CCL3 3SLUA 3SEDA 5IENA 5KP1A 1IT7A 4LMIA 1G96A 4J8TA 4N6LA 2BHMA 2PNCA 1W00A 5IG5A 2STDA 1D6UA 3JUQA 3F8XA 1N8R4 3WOFB 1OUNA 2XH9A 3Q1CA 4X2OA 1NO3A 2GBXB 7STDA 1TP6A 3X40A 3L0RA 3QRDA 4HM6B 1NU3A 2W56B 3VF1A 3B7CA 4FCJA 4BTXA 1LNHA 3B4PA 3N8BA 4U13A 1GD4A 5DREA 1EQKA 3O8YA 3IJEB 1VQK3 1IVVA 3N54B 1RKYA 3FKAA 5G2GA 2SBLA 2BNGA 2Z77A 1FGTA 3EBTA 2HMMB 1GS3A 5JBSA 1S723 1OHSA 5AIIA 3NX0A 8CHOA 2OCTA 3JUNA 4I4KA 2F98A 2O3OA 3H3HA 1GY7A 4BTWA 2CFKA 1LXEA 3WODG 4EC6A 3V99A 1IU7A 2WGQA 4FMCA 1GD3A 3JVCA 3QK9A 4Q53A 2XFSA 3EC9A 1VQ53 2JQ5A 2OQEA 4H3UA 4KVHA 4KFDA 3FLJA 1EA2A 4HM5B 1QMAA 1N9EA 1N8QA 3HIGA 2B1XB 1IV9A 4FCMA 1EKMA 2YFIB 1OPYA 1CYUA 3M8CA 3PGBA 1NJI4 1A2VA 1LOXA 3UB1A 1O7WB 3EF8A 1KWIA 1VQL3 1W4NA 1N5HA 2E2UA 2CG0A 3IPTA 1VZZA 4CCVA 2RGQA 3K63A 4HZBB 2CK3H 4EBGA 4N6V0 2Q07A 5HGRA 4R4KA 4OVMA 2GU3A 3CMA3 2CFWA 2CWTA 3DXOA 3FG1A 4WP5A 5BXQA 4L8OA 3F7XA 3LZAA 1FUWA 3HZPA 1UUVB 2HMKB 3S5CA 3JUPA 6STDA 4O3VA 3S67A 2XSOB 1A90A 1DVCA 3DGLA 3EHCA 3LT8A 1O7PB 3LOYA 1OF5B 2P0XA 1TIJA 3STDA 5DRVA 3NV0A 2GU1A 4LSOA 3LTDA 2CWVA 3FF0A 2UX0A 5D82A 3GZRA 3X42A 1Z1SA 3EJVA 2CFLA 4XDVA 1RRHA 3B4OA 1RN7A 2CFGA 5I97A 4EV2A 3BNEA 2XGLA 3NQYA 1NWWA 1WMPA 1T5YA 1IT8A 4XDWA 1JB2A 1E3VA 3A76A 3WOEB 1UUWB 1W5ZA 1SJWA 5IW9A 3U97A 2I9WA 1CQSA 1QALA 3X3XA 3CNXA 3G0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKX A;  1S5A A;  4U13 A;  3RGA A;  1OCV A;  3NBR A;  3JUO A;  5DRE A;  1OGX A;  1ASK A;  1DMQ A;  3Q90 A;  4HM8 B;  2BMQ B;  3GZX B;  5D81 A;  2YFJ B;  3MKI A;  2RFR A;  3FKA A;  1JKG B;  3VGN A;  2GXF A;  3EBY A;  1Q40 B;  3NUV A;  4K1U A;  5G2G A;  4OUQ A;  2BNG A;  2Z77 A;  3DZL A;  3EBT A;  3FH1 A;  3G16 A;  5CLK A;  2HMM B;  2Z76 A;  1GS3 A;  1E3R A;  3CNM A;  2BMR B;  1ISK A;  4XB5 A;  5IG4 A;  1OHS A;  2XR8 B;  5AII A;  8CHO A;  3KZT A;  3OWY A;  2BMO B;  3JUN A;  4HM1 B;  2F98 A;  4I4K A;  1O7M B;  3H3H A;  1O7H B;  1GY7 A;  3CNX A;  2HMO B;  1QJG A;  4STD A;  3FZW A;  3OXA A;  3ECF A;  3F40 A;  1OH0 A;  3DMC A;  3K7C A;  3GZY B;  4L7K A;  4MJD A;  4K1V A;  4Q53 A;  3EC9 A;  2OWP A;  3LYG A;  2JQ5 A;  5IF6 A;  1WQL B;  3E99 A;  4H3U A;  4KVH A;  5AIG A;  3FLJ A;  2QIY A;  3I0Y A;  1EA2 A;  4HM5 B;  1QMA A;  3KKG A;  3ROB A;  4HM2 B;  5KP4 A;  2B1X B;  5IG0 A;  1DMM A;  4FCM A;  5AI1 A;  1BUQ A;  1OHO A;  1Q40 A;  4J9A A;  3CPO A;  3K0Z A;  2YFL B;  2Z7A A;  3SOA A;  3T8N A;  2YFI B;  1TUH A;  1OPY A;  3EN8 A;  1IDP A;  2F86 B;  5JPP A;  3M8C A;  2CKF B;  2INX A;  3OWS A;  4HJL B;  2K54 A;  3OV4 A;  1OGZ A;  1STD A;  5CF2 A;  1O7W B;  3EF8 A;  5KP3 A;  5IEP A;  2GEX A;  3F7S A;  3KE7 A;  1A2K A;  1K41 A;  4WYK A;  3B8L A;  4HM0 B;  5EVH A;  3DM8 A;  4L8P A;  3DUK A;  1O7N B;  3IPT A;  2R4I A;  1GY6 A;  1Q42 A;  4WYK B;  1VZZ A;  4XM4 A;  5FW5 A;  2RGQ A;  3F8H A;  2HMJ B;  4HZB B;  5TGN A;  1NDO B;  3VSY A;  5AEW B;  3MSO A;  1E97 A;  1OHP A;  1W02 A;  1W01 A;  2GBW B;  4HM7 B;  4IIA A;  4X2H A;  5D83 A;  5HGR A;  4HM4 B;  4OVM A;  5JPU A;  1U5O A;  3JUM A;  4WWU C;  3GWR A;  1ZX2 A;  3MHE A;  4CDL A;  2IMJ A;  3NM2 A;  4HZ9 B;  1EG9 B;  3DXO A;  4WP5 A;  4XBX A;  4RZM A;  5BXQ A;  3CU3 A;  3GZB A;  3KSP A;  4L8O A;  3H51 A;  1ULI B;  3F7X A;  3LZA A;  4R1K A;  3FGY A;  3HZP A;  3MYT A;  1UUV B;  3UNL A;  4R9L A;  2HMK B;  4XBY A;  3JUP A;  3S5C A;  3WMD A;  6STD A;  2XRX B;  3BB9 A;  3MG2 A;  2W2C A;  5AIF A;  2XSO B;  3OX9 A;  3NHX A;  4HM3 B;  5CK6 A;  3HX8 A;  2F99 A;  3EHC A;  3G8Z A;  1GY5 A;  1O7P B;  1OF5 B;  1JB5 A;  4HKV B;  4ORL A;  3STD A;  3BLZ A;  3F14 A;  4N3V A;  5DRV A;  3NV0 A;  5STD A;  2XSH B;  2A15 A;  5BVB A;  1AR0 A;  1JN5 A;  5AIH A;  2HMN B;  2PZV A;  3EQQ B;  2UX0 A;  3FF0 A;  1ZO2 A;  3FSD A;  3GZR A;  1O7G B;  5D82 A;  5IEO A;  5IER A;  3UJM A;  5IG3 A;  1Z1S A;  1W6Y A;  3EJV A;  3SED A;  4XDV A;  3B4O A;  5AEU B;  5IEN A;  5KP1 A;  3HK4 A;  4LMI A;  1GYB A;  2B24 B;  4XBT A;  1DMN A;  4J8T A;  2GEY A;  3D9R A;  1NWW A;  4XDW A;  4R9K A;  5CXO A;  3RGR A;  1JB2 A;  1W00 A;  2CHC A;  1E3V A;  3MG3 A;  2HML B;  2STD A;  5IG5 A;  3JUQ A;  1JB4 A;  2RCD A;  3F8X A;  1JKG A;  1ULJ B;  2QGU A;  3FF2 A;  4GB5 A;  3A76 A;  3GRD A;  1OUN A;  4PEJ A;  5CF1 A;  3OWU A;  1UUW B;  1SJW A;  4LEH A;  4X2O A;  3EN1 B;  3ER7 A;  2GBX B;  3MG1 A;  3NV0 B;  3NXJ A;  1TP6 A;  4LGQ A;  3SOY A;  1JN5 B;  7STD A;  3EX9 A;  2I9W A;  4HM6 B;  1CQS A;  3T8U A;  1NU3 A;  1OF5 A;  3B7C A;  3F9S A;  4FCJ A;  1C7H A;  4HVN A;  3B4P A;  3G0K A; 
#chains in the Genus database with same CATH topology
 1HKX A;  1LOY A;  1MNL A;  1UUG B;  3RGA A;  5RNT A;  1NB5 I;  3CME 3;  1TFK A;  3NBR A;  1WMO A;  3JUO A;  1BSA A;  1M9G A;  1OGX A;  2KXG A;  1ASK A;  1PFP A;  1FUS A;  1B2X A;  3Q90 A;  2Y74 A;  5D81 A;  2P05 A;  3MPH A;  1I70 A;  4ILF A;  3CCJ 3;  4RNZ A;  3VGN A;  5A0O B;  2KF5 A;  1Q40 B;  1UI8 A;  4K1U A;  1X1W A;  3RDE A;  1N9J A;  4OUQ A;  3S27 A;  3Q3F A;  3G16 A;  5CLK A;  1E3R A;  2BO9 B;  1US1 A;  3CNM A;  2BMR B;  3UL5 A;  1IV7 A;  2K0M A;  3WA3 A;  3BU4 A;  2P09 A;  3LTA A;  5BIR A;  3X3Y A;  1BRG A;  3CCQ 3;  1VQP 3;  1O7H B;  1DET A;  1UCL A;  1M1K 4;  1CH0 A;  3F40 A;  3SYU A;  2ZHX B;  1K9M 4;  4L7K A;  5LC7 A;  4JF8 A;  1BNJ A;  1N5P A;  1LQG C;  1HU9 A;  4LZI A;  5AIG A;  1FGQ A;  2QIY A;  3FG4 A;  1JBR A;  1BNI A;  1FGM A;  1SIH A;  5IG0 A;  1AY7 A;  1DMM A;  3BNB A;  1RGE A;  3GAX A;  4QWT A;  5AI1 A;  1JJ2 2;  4IT7 A;  1WTH A;  2OOV C;  3X3Z A;  1KC8 4;  3EN8 A;  4HOH A;  1IDP A;  2Y73 A;  3GSP A;  1GSP A;  5JPP A;  2INX A;  5G1L A;  2KF6 A;  3OWS A;  1OGZ A;  1I3F A;  4K90 B;  2KCD A;  2GEX A;  3LT9 A;  2RBI A;  3KE7 A;  1CYV A;  7RNT A;  3CCR 3;  5AYS C;  1IQY A;  4HM0 B;  3WA2 X;  3DM8 A;  4L8P A;  4WYK B;  3SOA A;  2LQV A;  1UGH I;  2R4I A;  5FW5 A;  1RNB A;  1YHQ 3;  2H0H A;  3F8H A;  1TU5 A;  2RNT A;  1QVF 2;  4RNY A;  1WMN A;  2WGO A;  2BIR A;  4IIA A;  1I2F A;  3D5G A;  1IK3 A;  3EB8 A;  4NHF A;  3JUM A;  3S29 A;  1AVK A;  1TTO A;  3GWR A;  4CDL A;  2F5M A;  2IUK A;  3NM2 A;  5M1A A;  2CG1 A;  4BL3 A;  1BRH A;  1RTU A;  2XFT A;  5CF1 A;  2YX9 A;  3FGY A;  2ML6 A;  3UNL A;  4ZM8 A;  2BU4 A;  2RSX A;  5HOH A;  3LTC A;  1G0T A;  5EQL A;  5G1K A;  2W2C A;  5AIF A;  1YGE A;  3OX9 A;  1MWU A;  5ELJ A;  1BUJ A;  2P0M A;  1JNQ A;  2XGN A;  1KD1 4;  1RRL A;  1K8A 4;  3PYJ A;  4N6T A;  3D79 A;  3F14 A;  1BRS A;  4N3V A;  1RDS A;  2XSH B;  2XF3 A;  1VQO 3;  1MWT A;  3EQQ B;  5IEO A;  1YJW 3;  1RN1 A;  3KN4 A;  1RGH A;  3PCR A;  4G1M B;  1QAF A;  1W6Y A;  3LML A;  3UJM A;  5AEU B;  3PS8 A;  3HK4 A;  2B24 B;  1GYB A;  3LXU X;  4XBT A;  1DMN A;  1RHL A;  1YVB I;  2GEY A;  1R4Y A;  1UCK A;  1B2S A;  4R9K A;  1RN4 A;  6RNT A;  1WNH A;  4KZ1 A;  1UI7 A;  2HML B;  1I8V A;  1B2U A;  4LGQ A;  1I0X A;  1A2P A;  1M1X B;  1ULJ B;  3FF2 A;  3K9M C;  3GRD A;  3PCS A;  4PEJ A;  3UL6 A;  3U1W A;  3FCS B;  3G4S 3;  4LEH A;  4O8S A;  3NXJ A;  2HOH A;  2V1L A;  1V74 A;  1I3I A;  1JN5 B;  3S28 A;  3T8U A;  1OF5 A;  3F9S A;  1C7H A;  4HVN A;  1S5A A;  1KSI A;  2FNQ A;  4TX4 A;  1VQM 3;  1OAC A;  1YJN 3;  1YNV X;  3BIR A;  1RJO A;  2BMQ B;  2D42 A;  3GZX B;  1W6G A;  3NM7 A;  2YFJ B;  3MKI A;  4N6N B;  1F8N A;  1JBS A;  3EE1 A;  1JKG B;  2GXF A;  3EBY A;  4FMD A;  4JRF A;  2CC3 A;  1GOY A;  4BTY A;  1AV4 A;  2XEP A;  2LYX A;  1R4C A;  3A5E A;  4RNT A;  4WHA A;  1IVX A;  5IG4 A;  2KRT A;  5FGO A;  2XR8 B;  3FG3 A;  4KT3 B;  1GOU A;  3KZT A;  8RNT A;  3OWY A;  2BMO B;  3CC4 3;  2OQE C;  3SXX A;  1Q86 4;  3CNX A;  2P38 A;  2D1W A;  1QJG A;  3FZW A;  2M7O A;  1A67 A;  3ECF A;  3D5I A;  1OH0 A;  3DMC A;  3K7C A;  3GZY B;  2IYJ A;  4MJD A;  1RMS A;  1DYU A;  3LYG A;  1WQL B;  1IQ8 A;  1Q7H A;  3I0Y A;  1MWR A;  2ZDJ A;  1MOL A;  4HM2 B;  4IPB A;  3SVA A;  3I56 3;  3MWZ A;  1DVD A;  3G71 3;  1Q40 A;  1X1X A;  3AMO B;  1TJD A;  4J9A A;  3T0U A;  3V98 A;  3CPO A;  3K0Z A;  2YFL B;  3T8N A;  3CCE 3;  3OW2 2;  1TUH A;  3DGO A;  3ALA A;  4N6M A;  4N6O B;  2F86 B;  1U8C B;  2C11 A;  1Q7Y 4;  3CCU 3;  3OV4 A;  1STD A;  4AEQ A;  1QAK A;  3F7S A;  1B2Z A;  4WYK A;  3B8L A;  2O9U X;  3DUK A;  4XM4 A;  1GY6 A;  1Q42 A;  3K5T A;  1B2M A;  5TGN A;  3NBB A;  2KF4 A;  5AEW B;  1E97 A;  1IYY A;  1W02 A;  2GBW B;  4X2H A;  3SX1 A;  4EW5 A;  1U5O A;  1D6Y A;  4MMY B;  2C10 A;  4GL6 A;  5LC6 A;  4WWU C;  1BRJ A;  1SPU A;  4R80 A;  5EEO A;  3MHE A;  1JBT A;  4HZ9 B;  2C4B A;  1FGR A;  3CD6 3;  4XBX A;  1BSD A;  3CU3 A;  5D83 A;  4R1K A;  2WOH A;  3MYT A;  2WO0 A;  4LYL B;  2GSP A;  4R9L A;  4XBY A;  1LRA A;  4GHO A;  1Q82 4;  3MG2 A;  4BIR A;  3NHX A;  1AVL A;  4HM3 B;  3HOH A;  3KSE D;  1B27 A;  1BRI A;  2F99 A;  3J7Y d;  2UGI A;  1GY5 A;  3N9H A;  1FGO A;  1JB5 A;  3DGN A;  1UDI I;  3BLZ A;  5BVB A;  2E2T A;  2ZA4 A;  2A15 A;  2CX1 A;  1AR0 A;  3DY5 A;  1BNR A;  2HMN B;  2PZV A;  3KII A;  4FR9 A;  1FUT A;  1ZO2 A;  1W2Z A;  1O7G B;  1VQ6 3;  5IER A;  5IG3 A;  4EXR A;  2W6J H;  3HI7 A;  2IA7 A;  1VQN 3;  1JV2 B;  3HII A;  4OK0 A;  3CCV 3;  1HZ1 A;  5CXO A;  1RGC A;  3D9R A;  3Q2P A;  1D6Z A;  3RGR A;  2WOF A;  1YIJ 3;  3MG3 A;  2CHC A;  3CXC 2;  4GB5 A;  1JB4 A;  2RCD A;  1GMQ A;  1JKG A;  2QGU A;  3CC2 3;  1IVU A;  1K28 A;  3OWU A;  1BGS A;  3EN1 B;  3ER7 A;  3MG1 A;  3NV0 B;  3CCM 3;  4EYC A;  2CWU A;  3SOY A;  3EX9 A;  4BL2 A;  4AKZ A;  2KAA A;  1EUI C;  1L5G B;  2CFD A;  1Q81 4;  2CIU A;  1B3S A;  1OCV A;  4FCZ A;  1LVN A;  4J5K A;  4H61 A;  4KFF A;  1DMQ A;  4AKY A;  1JRQ A;  1MGW A;  4HM8 B;  2FXT A;  3NBJ A;  2FGT A;  2RFR A;  3IMA B;  4HBR A;  1ROV A;  1STF I;  3NUV A;  5BU4 A;  5M19 A;  2L4V A;  2ML5 A;  1YI2 3;  3WR2 A;  3DZL A;  3FH1 A;  5M18 A;  2Z76 A;  1RGG A;  1AQZ A;  4RBN A;  2QA4 3;  1I2G A;  1ISK A;  4XB5 A;  3CPW 2;  1SAR A;  2JDI H;  4O2H A;  3WDG B;  3PXM A;  4KFE A;  4HM1 B;  1FYS A;  1UW1 A;  1O7M B;  2CW9 A;  1RLS A;  3LTB A;  4K61 A;  1FA3 A;  1W7C A;  2HMO B;  4HYZ A;  1JZO A;  4STD A;  1IQX A;  4NPB A;  2OTL 3;  2W9Q A;  3OXA A;  2W04 A;  1BVI A;  1PU4 A;  4K1V A;  2OWP A;  4FMB A;  1TFO A;  1Q9E A;  3E99 A;  3BNC A;  3WHO A;  4CPK A;  1YJ9 3;  1KQS 2;  4MMZ B;  1W6C A;  3AGN A;  1M90 4;  3KKG A;  2CH9 A;  3ROB A;  5KP4 A;  2QEX 3;  3D4A A;  2AAD A;  2W9P A;  4MEI A;  4N6U A;  1BUQ A;  3DGM A;  1OHO A;  3LH4 A;  2Z6B A;  1SQW A;  2Z7A A;  3AMO A;  3KCH A;  1K73 4;  1Y4K A;  1VQ4 3;  5ELU A;  1GMP A;  5AYR B;  2IUJ A;  2W56 A;  2CKF B;  3G6E 3;  4HJL B;  2K54 A;  3RNT A;  2F4Y A;  1IVW A;  3ZFZ A;  5CF2 A;  1QVG 2;  5KP3 A;  2OOV A;  3DGY A;  5IEP A;  1BAN A;  1BU4 A;  1A2K A;  1K41 A;  1UGI A;  4WFO A;  5EVH A;  5GSP A;  3ZG0 A;  4FMA A;  1O7N B;  1BSB A;  3BND A;  4NRE A;  3CCS 3;  3VSY A;  2HMJ B;  1NDO B;  2MF7 A;  1VQ9 3;  1ROA A;  3MSO A;  2W03 A;  2W0Q A;  3DH2 A;  1OHP A;  1I2E A;  1W01 A;  4HM7 B;  1NB3 I;  1W2B 2;  1TRQ A;  2OTJ 3;  4HM4 B;  5JPU A;  2KF3 A;  1VQ7 3;  2BT3 A;  1ZX2 A;  1CEW I;  2IMJ A;  2ZL8 A;  1EG9 B;  5IF6 A;  4RZM A;  3GZB A;  3KSP A;  1VQ8 3;  3H51 A;  1ULI B;  6GSP A;  1BNF A;  1J2B A;  1C54 A;  3TDG A;  3NQZ A;  3WMD A;  2XRX B;  3BB9 A;  1YIT 3;  3PZW A;  3AHS A;  3X41 A;  5CK6 A;  3HX8 A;  4MMX B;  3I55 3;  1RNT A;  3G8Z A;  4HKV B;  4ORL A;  3V92 A;  2MC8 A;  3KFQ C;  5STD A;  4BU4 A;  4EV5 A;  2H0G A;  1JN5 A;  3D3L A;  5AIH A;  4O02 B;  3FSD A;  2E2V A;  1BOX A;  3CCL 3;  3SLU A;  1RGF A;  3SED A;  5IEN A;  5KP1 A;  1IT7 A;  4LMI A;  1T3B A;  7GSP A;  1G96 A;  1RGK A;  4J8T A;  2BHM A;  4N6L A;  2PNC A;  1W00 A;  4I5Q A;  5IG5 A;  2STD A;  1D6U A;  3JUQ A;  3F8X A;  1N8R 4;  3WOF B;  2CX0 A;  1OUN A;  1BSC A;  2XH9 A;  3Q1C A;  4X2O A;  1NO3 A;  2GBX B;  7STD A;  1TP6 A;  3X40 A;  1LQM B;  3AHW A;  3L0R A;  3QRD A;  4HM6 B;  1NU3 A;  2W56 B;  3VF1 A;  3B7C A;  2IY2 A;  4FCJ A;  4BTX A;  1LNH A;  3B4P A;  3N8B A;  4U13 A;  1RCL A;  1GD4 A;  1RSN A;  5DRE A;  1EQK A;  1ZS7 A;  4GSP A;  3O8Y A;  1FZU A;  3IJE B;  1VQK 3;  1IVV A;  3N54 B;  1RKY A;  3FKA A;  5G2G A;  1UCI A;  9RNT A;  2SBL A;  2BNG A;  2Z77 A;  1FGT A;  3EBT A;  2SAR A;  2HMM B;  1GS3 A;  1T2H A;  1VQQ A;  5JBS A;  1YVS A;  1S72 3;  1BNG A;  1OHS A;  5AII A;  3NX0 A;  8CHO A;  1FW7 A;  2AAE A;  2OCT A;  3JUN A;  4I4K A;  2F98 A;  2O3O A;  3H3H A;  1GY7 A;  2F56 A;  4BTW A;  2CFK A;  1LXE A;  3WOD G;  4EC6 A;  3V99 A;  1IU7 A;  4HAA A;  1BNE A;  2K3D A;  1YGW A;  2WGQ A;  1GD3 A;  3JVC A;  3QK9 A;  1UCJ A;  2XFS A;  3EC9 A;  4FMC A;  4Q53 A;  2JQ5 A;  2OQE A;  4H3U A;  1VQ5 3;  4KVH A;  4KFD A;  3FLJ A;  1EA2 A;  1LOW A;  1QMA A;  4HM5 B;  1N9E A;  1N8Q A;  3HIG A;  2B1X B;  2F5W A;  1IV9 A;  1BRK A;  4FCM A;  1BIR A;  1EKM A;  1PY3 A;  1X1Y A;  1RGL A;  2YFI B;  1OPY A;  1CYU A;  2R41 A;  4DKI A;  3M8C A;  1B20 A;  1G02 A;  1BNS A;  3PGB A;  1NJI 4;  2L1S A;  1A2V A;  1LOX A;  3UB1 A;  1O7W B;  3EF8 A;  1KWI A;  1VQL 3;  1W4N A;  1N5H A;  2H0I A;  2E2U A;  1TRP A;  2CG0 A;  1MGR A;  3IPT A;  4CJN A;  1ZGX A;  1VZZ A;  4CCV A;  2RGQ A;  3K63 A;  4HZB B;  2CK3 H;  4EBG A;  1V57 A;  4N6V 0;  2Q07 A;  5HGR A;  4R4K A;  1LOV A;  4OVM A;  2GU3 A;  3CMA 3;  2CFW A;  1X1U A;  2CWT A;  3DXO A;  3FG1 A;  4WP5 A;  5BXQ A;  1DE3 A;  1BRN L;  1GMR A;  1PYL A;  4L8O A;  1RCK A;  3F7X A;  3LZA A;  3URP A;  1FUW A;  3HZP A;  1BAO A;  1UUV B;  2HMK B;  3S5C A;  3JUP A;  1MWS A;  6STD A;  4O3V A;  3S67 A;  1NNV A;  2XSO B;  1A90 A;  1DVC A;  3DGL A;  4J5G A;  3EHC A;  3LT8 A;  1O7P B;  3LOY A;  1OF5 B;  2P0X A;  1TIJ A;  1EEJ A;  3STD A;  1B21 A;  5DRV A;  3NV0 A;  2GU1 A;  1T2I A;  4LSO A;  3LTD A;  1RGA A;  2CWV A;  3CC7 3;  3FF0 A;  2UX0 A;  5D82 A;  1HYF A;  3GZR A;  3X42 A;  1V58 A;  1Z1S A;  3EJV A;  2CFL A;  4XDV A;  1RRH A;  3B4O A;  1RN7 A;  2CFG A;  5I97 A;  4EV2 A;  2XGL A;  3BNE A;  3NQY A;  1WMP A;  1NWW A;  1T5Y A;  1IT8 A;  4XDW A;  1JB2 A;  1E3V A;  2UUG C;  3A76 A;  3WOE B;  1UUW B;  1W5Z A;  1SJW A;  5IW9 A;  1BSE A;  3U97 A;  1GOV A;  3AGO A;  3ZG5 A;  2I9W A;  1CQS A;  1QAL A;  2J8X B;  1I0V A;  1JZD A;  1LNI A;  3X3X A;  1SII A;  3G0K A; 
#chains in the Genus database with same CATH homology
 1HKX A;  1MNL A;  3RGA A;  1NB5 I;  3CME 3;  1TFK A;  3NBR A;  1WMO A;  3JUO A;  1M9G A;  1OGX A;  2KXG A;  1ASK A;  1PFP A;  3Q90 A;  2Y74 A;  5D81 A;  2P05 A;  3MPH A;  3CCJ 3;  4RNZ A;  3VGN A;  5A0O B;  4K1U A;  1Q40 B;  1UI8 A;  3RDE A;  1N9J A;  4OUQ A;  3S27 A;  3G16 A;  5CLK A;  1E3R A;  2BO9 B;  1US1 A;  3CNM A;  2BMR B;  3UL5 A;  1IV7 A;  2K0M A;  3WA3 A;  2P09 A;  3LTA A;  3X3Y A;  3CCQ 3;  1VQP 3;  1O7H B;  1M1K 4;  3F40 A;  1K9M 4;  4L7K A;  5LC7 A;  4JF8 A;  1N5P A;  1HU9 A;  4LZI A;  5AIG A;  1FGQ A;  2QIY A;  3FG4 A;  1FGM A;  1SIH A;  5IG0 A;  1DMM A;  3BNB A;  4QWT A;  1JJ2 2;  3GAX A;  5AI1 A;  4IT7 A;  1WTH A;  2OOV C;  3X3Z A;  1KC8 4;  3EN8 A;  1IDP A;  2Y73 A;  5JPP A;  2INX A;  3OWS A;  1OGZ A;  4K90 B;  2KCD A;  2GEX A;  3LT9 A;  3KE7 A;  1CYV A;  3CCR 3;  5AYS C;  1IQY A;  4HM0 B;  3WA2 X;  3DM8 A;  4L8P A;  4WYK B;  3SOA A;  2LQV A;  2R4I A;  5FW5 A;  1YHQ 3;  1TU5 A;  3F8H A;  1QVF 2;  4RNY A;  1WMN A;  2WGO A;  4IIA A;  1IK3 A;  3EB8 A;  4NHF A;  3JUM A;  3S29 A;  1AVK A;  3GWR A;  4CDL A;  2IUK A;  3NM2 A;  2CG1 A;  2XFT A;  5CF1 A;  2YX9 A;  3FGY A;  2ML6 A;  3UNL A;  4ZM8 A;  2RSX A;  3LTC A;  5EQL A;  2W2C A;  5AIF A;  1YGE A;  3OX9 A;  5ELJ A;  2P0M A;  1JNQ A;  2XGN A;  1RRL A;  1K8A 4;  3PYJ A;  4N6T A;  3F14 A;  4N3V A;  2XSH B;  2XF3 A;  1VQO 3;  3EQQ B;  5IEO A;  1YJW 3;  3KN4 A;  4G1M B;  3PCR A;  3UJM A;  1QAF A;  1W6Y A;  3LML A;  5AEU B;  3PS8 A;  3HK4 A;  1GYB A;  2B24 B;  3LXU X;  4XBT A;  1DMN A;  1KD1 4;  1YVB I;  2GEY A;  3CC7 3;  4R9K A;  1WNH A;  4KZ1 A;  1UI7 A;  2HML B;  4LGQ A;  1ULJ B;  1M1X B;  3FF2 A;  3K9M C;  3PCS A;  3GRD A;  4PEJ A;  3UL6 A;  3U1W A;  3FCS B;  3G4S 3;  4LEH A;  4O8S A;  3NXJ A;  2V1L A;  1V74 A;  1JN5 B;  3S28 A;  3T8U A;  1OF5 A;  3F9S A;  1C7H A;  4HVN A;  1S5A A;  1KSI A;  2FNQ A;  4TX4 A;  1VQM 3;  1OAC A;  1YJN 3;  1RJO A;  2BMQ B;  2D42 A;  3GZX B;  1W6G A;  3NM7 A;  2YFJ B;  3MKI A;  4N6N B;  1F8N A;  3EE1 A;  1JKG B;  2GXF A;  3EBY A;  4FMD A;  4JRF A;  2CC3 A;  4BTY A;  1AV4 A;  2XEP A;  2LYX A;  1R4C A;  4WHA A;  1IVX A;  5IG4 A;  2KRT A;  5FGO A;  2XR8 B;  3FG3 A;  3KZT A;  3OWY A;  2BMO B;  3CC4 3;  2OQE C;  3SXX A;  1Q86 4;  2P38 A;  2D1W A;  1QJG A;  3FZW A;  2M7O A;  1A67 A;  3ECF A;  1OH0 A;  3DMC A;  3K7C A;  3GZY B;  4MJD A;  1DYU A;  3LYG A;  1WQL B;  1IQ8 A;  3I0Y A;  2ZDJ A;  1MOL A;  4HM2 B;  4IPB A;  3SVA A;  3I56 3;  3MWZ A;  1DVD A;  3G71 3;  1Q40 A;  3AMO B;  3T0U A;  4J9A A;  3V98 A;  3CCE 3;  3CPO A;  3K0Z A;  2YFL B;  3T8N A;  3OW2 2;  1TUH A;  3DGO A;  3ALA A;  4N6M A;  4N6O B;  2F86 B;  1U8C B;  2C11 A;  1Q7Y 4;  3CCU 3;  3OV4 A;  1STD A;  4AEQ A;  1QAK A;  3F7S A;  4WYK A;  3B8L A;  2O9U X;  3DUK A;  4XM4 A;  1GY6 A;  1Q42 A;  3K5T A;  5TGN A;  3NBB A;  5AEW B;  1E97 A;  1W02 A;  2GBW B;  4X2H A;  3SX1 A;  1U5O A;  1D6Y A;  4MMY B;  2C10 A;  4GL6 A;  5LC6 A;  4WWU C;  5EEO A;  1SPU A;  4R80 A;  3MHE A;  4HZ9 B;  3CD6 3;  1FGR A;  4XBX A;  3CU3 A;  5D83 A;  4R1K A;  2WOH A;  3MYT A;  2WO0 A;  4R9L A;  4XBY A;  1Q82 4;  3MG2 A;  3NHX A;  1AVL A;  4HM3 B;  3KSE D;  2F99 A;  3J7Y d;  1GY5 A;  3N9H A;  1FGO A;  1JB5 A;  3DGN A;  3BLZ A;  5BVB A;  2E2T A;  2A15 A;  3DY5 A;  1AR0 A;  2HMN B;  2PZV A;  3KII A;  4FR9 A;  1ZO2 A;  1W2Z A;  1O7G B;  1VQ6 3;  5IER A;  5IG3 A;  4EXR A;  2W6J H;  3HI7 A;  2IA7 A;  1VQN 3;  1JV2 B;  3HII A;  4OK0 A;  3CCV 3;  5CXO A;  3D9R A;  3Q2P A;  3RGR A;  1D6Z A;  2WOF A;  1YIJ 3;  3MG3 A;  2CHC A;  3CXC 2;  4GB5 A;  1JB4 A;  2RCD A;  1JKG A;  2QGU A;  3CC2 3;  1IVU A;  1K28 A;  3OWU A;  3EN1 B;  3ER7 A;  3MG1 A;  3NV0 B;  3CCM 3;  4EYC A;  2CWU A;  3SOY A;  3EX9 A;  4AKZ A;  1L5G B;  2CFD A;  1Q81 4;  2CIU A;  1OCV A;  4FCZ A;  1LVN A;  4H61 A;  4KFF A;  1DMQ A;  4AKY A;  1JRQ A;  4HM8 B;  2FXT A;  3NBJ A;  2FGT A;  2RFR A;  3IMA B;  4HBR A;  1ROV A;  1STF I;  3NUV A;  2L4V A;  2ML5 A;  1YI2 3;  3DZL A;  3FH1 A;  2Z76 A;  2QA4 3;  4RBN A;  1ISK A;  4XB5 A;  3CPW 2;  2JDI H;  4O2H A;  3WDG B;  3PXM A;  4KFE A;  4HM1 B;  1UW1 A;  2CW9 A;  1O7M B;  1FA3 A;  3LTB A;  4K61 A;  1SII A;  1W7C A;  2HMO B;  4HYZ A;  4STD A;  1IQX A;  2OTL 3;  2W9Q A;  3OXA A;  2W04 A;  1PU4 A;  4K1V A;  2OWP A;  4FMB A;  1TFO A;  3E99 A;  3BNC A;  1YJ9 3;  1KQS 2;  4MMZ B;  1W6C A;  1M90 4;  3KKG A;  2CH9 A;  3ROB A;  5KP4 A;  2QEX 3;  4MEI A;  2W9P A;  4N6U A;  1BUQ A;  3DGM A;  1OHO A;  3LH4 A;  2Z6B A;  1SQW A;  2Z7A A;  3AMO A;  1K73 4;  1VQ4 3;  1Y4K A;  5ELU A;  5AYR B;  2IUJ A;  2W56 A;  2CKF B;  3G6E 3;  4HJL B;  2K54 A;  5CF2 A;  1IVW A;  1QVG 2;  5KP3 A;  2OOV A;  5IEP A;  1A2K A;  1K41 A;  4WFO A;  5EVH A;  4FMA A;  1O7N B;  3BND A;  4NRE A;  3CCS 3;  3VSY A;  2HMJ B;  1NDO B;  2MF7 A;  1VQ9 3;  1ROA A;  3MSO A;  2W03 A;  2W0Q A;  1OHP A;  4HM7 B;  1W01 A;  1W2B 2;  1NB3 I;  2OTJ 3;  4HM4 B;  5JPU A;  1VQ7 3;  2BT3 A;  1ZX2 A;  1CEW I;  2IMJ A;  2ZL8 A;  1EG9 B;  5IF6 A;  4RZM A;  3GZB A;  3KSP A;  1VQ8 3;  3H51 A;  1ULI B;  1J2B A;  3TDG A;  3NQZ A;  3WMD A;  2XRX B;  3BB9 A;  1YIT 3;  3PZW A;  3X41 A;  5CK6 A;  3HX8 A;  4MMX B;  3I55 3;  3G8Z A;  4HKV B;  4ORL A;  3V92 A;  2MC8 A;  3KFQ C;  5STD A;  4EV5 A;  1JN5 A;  3D3L A;  5AIH A;  4O02 B;  3FSD A;  2E2V A;  3CCL 3;  3SLU A;  3SED A;  5IEN A;  5KP1 A;  1IT7 A;  4LMI A;  1G96 A;  4J8T A;  4N6L A;  2BHM A;  2PNC A;  1W00 A;  5IG5 A;  2STD A;  1D6U A;  3JUQ A;  3F8X A;  1N8R 4;  3WOF B;  1OUN A;  2XH9 A;  3Q1C A;  4X2O A;  1NO3 A;  2GBX B;  7STD A;  1TP6 A;  3X40 A;  3L0R A;  3QRD A;  4HM6 B;  1NU3 A;  2W56 B;  3VF1 A;  3B7C A;  4FCJ A;  4BTX A;  1LNH A;  3B4P A;  3N8B A;  4U13 A;  1GD4 A;  5DRE A;  1EQK A;  3O8Y A;  3IJE B;  1VQK 3;  1IVV A;  3N54 B;  1RKY A;  3FKA A;  5G2G A;  2SBL A;  2BNG A;  2Z77 A;  1FGT A;  3EBT A;  2HMM B;  1GS3 A;  5JBS A;  1S72 3;  1OHS A;  5AII A;  3NX0 A;  8CHO A;  2OCT A;  3JUN A;  4I4K A;  2F98 A;  2O3O A;  3H3H A;  1GY7 A;  4BTW A;  2CFK A;  1LXE A;  3WOD G;  4EC6 A;  3V99 A;  1IU7 A;  2WGQ A;  4FMC A;  1GD3 A;  3JVC A;  3QK9 A;  4Q53 A;  2XFS A;  3EC9 A;  1VQ5 3;  2JQ5 A;  2OQE A;  4H3U A;  4KVH A;  4KFD A;  3FLJ A;  1EA2 A;  4HM5 B;  1QMA A;  1N9E A;  1N8Q A;  3HIG A;  2B1X B;  1IV9 A;  4FCM A;  1EKM A;  2YFI B;  1OPY A;  1CYU A;  3M8C A;  3PGB A;  1NJI 4;  1A2V A;  1LOX A;  3UB1 A;  1O7W B;  3EF8 A;  1KWI A;  1VQL 3;  1W4N A;  1N5H A;  2E2U A;  2CG0 A;  3IPT A;  1VZZ A;  4CCV A;  2RGQ A;  3K63 A;  4HZB B;  2CK3 H;  4EBG A;  4N6V 0;  2Q07 A;  5HGR A;  4R4K A;  4OVM A;  2GU3 A;  3CMA 3;  2CFW A;  2CWT A;  3DXO A;  3FG1 A;  4WP5 A;  5BXQ A;  4L8O A;  3F7X A;  3LZA A;  1FUW A;  3HZP A;  1UUV B;  2HMK B;  3S5C A;  3JUP A;  6STD A;  4O3V A;  3S67 A;  2XSO B;  1A90 A;  1DVC A;  3DGL A;  3EHC A;  3LT8 A;  1O7P B;  3LOY A;  1OF5 B;  2P0X A;  1TIJ A;  3STD A;  5DRV A;  3NV0 A;  2GU1 A;  4LSO A;  3LTD A;  2CWV A;  3FF0 A;  2UX0 A;  5D82 A;  3GZR A;  3X42 A;  1Z1S A;  3EJV A;  2CFL A;  4XDV A;  1RRH A;  3B4O A;  1RN7 A;  2CFG A;  5I97 A;  4EV2 A;  3BNE A;  2XGL A;  3NQY A;  1NWW A;  1WMP A;  1T5Y A;  1IT8 A;  4XDW A;  1JB2 A;  1E3V A;  3A76 A;  3WOE B;  1UUW B;  1W5Z A;  1SJW A;  5IW9 A;  3U97 A;  2I9W A;  1CQS A;  1QAL A;  3X3X A;  3CNX A;  3G0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...