4STDA

High resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological ph
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
molecule keywords Scytalone dehydratase
total genus 46
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4stdA00
4LMIA 3EQQB 3FZWA 2B24B 2BMOB 3Q90A 4L7KA 3NXJA 4I4KA 1GYBA 1OUNA 5AIHA 5CF2A 3OV4A 1Q42A 3EN8A 3DZLA 2IMJA 1JB4A 1AR0A 1S5AA 3EC9A 4WYKB 5EVHA 3MYTA 1OPYA 3MG3A 4LEHA 4X2OA 5D82A 1STDA 3F8HA 3KZTA 3HK4A 3MG2A 2HMMB 1ULIB 1CQSA 2XR8B 4WYKA 2F86B 4HM2B 4XBXA 5HGRA 1K41A 2OWPA 2STDA 4R1KA 3F9SA 1ZX2A 3B8LA 2INXA 4ORLA 3G16A 3FKAA 4HM6B 5TGNA 3H3HA 5AEWB 4HM7B 3JUNA 4PEJA 4U13A 1OCVA 1W02A 4X2HA 5DRVA 2YFIB 4L8PA 5BXQA 5STDA 3HX8A 4HM1B 4CDLA 1UUVB 3GWRA 4FCMA 3LYGA 2YFJB 5CXOA 3KSPA 1JB2A 1QMAA 1ZO2A 2QIYA 1OF5B 3DUKA 3FH1A 1Q40A 2Z77A 3T8UA 2XSOB 1VZZA 5DREA 3VGNA 3FF2A 3OWUA 5AI1A 1EG9B 1GY6A 1OHSA 3EJVA 4HKVB 4HVNA 4R9KA 5KP4A 3OXAA 3NUVA 5G2GA 3JUOA 4XDVA 2BNGA 3NV0B 3STDA 2GEXA 2QGUA 3M8CA 5AEUB 5BVBA 3GZXB 3BLZA 3EBTA 1O7NB 2JQ5A 3EN1B 3MKIA 1ASKA 2YFLB 3NHXA 3EX9A 1BUQA 4FCJA 2I9WA 1GS3A 4XB5A 1OHPA 3E99A 3FGYA 4HZ9B 5AIGA 5CK6A 3CNMA 2Z76A 2UX0A 2XSHB 3ER7A 3HZPA 2GEYA 1O7WB 2F99A 5AIFA 5JPPA 3WMDA 3UNLA 1IDPA 2BMRB 3LZAA 3OWYA 4HM5B 3K0ZA 5CLKA 4WWUC 3F8XA 1JN5A 1ISKA 4HJLB 3ECFA 3SOYA 2HMKB 2R4IA 2Z7AA 3F7XA 2K54A 2W2CA 4L8OA 5D83A 5IF6A 4XBYA 3BB9A 1OHOA 1U5OA 3EBYA 3JUPA 1JKGA 2HMOB 3G0KA 4GB5A 1O7MB 3DMCA 2RFRA 3I0YA 3GZRA 3OX9A 4XM4A 1O7HB 2HMJB 4HZBB 5FW5A 2HMNB 1JKGB 3D9RA 3B7CA 3KKGA 5KP1A 4Q53A 5D81A 1E97A 4HM0B 3JUMA 5IG4A 3CNXA 4N3VA 3A76A 4R9LA 5KP3A 4OVMA 2GBXB 1Q40B 1NWWA 2HMLB 3S5CA 3H51A 3IPTA 3NBRA 1GY5A 4WP5A 1A2KA 5IG5A 1UUWB 1TP6A 2XRXB 3MSOA 3SOAA 5IG3A 2GBWB 3EF8A 3F7SA 4K1UA 3RGRA 5IEOA 1TUHA 3MG1A 3NM2A 5IG0A 2F98A 3GZYB 3NV0A 4XDWA 3UJMA 5IENA 4STDA 6STDA 3MHEA 1GY7A 1JB5A 1OGZA 3DXOA 3FSDA 4MJDA 1EA2A 1O7GB 3OWSA 3SEDA 1OF5A 3FF0A 1E3VA 1W01A 1O7PB 2CHCA 3JUQA 4IIAA 4K1VA 4KVHA 1C7HA 5AIIA 1W6YA 4J8TA 3RGAA 1DMNA 3F14A 1DMMA 3EHCA 4LGQA 1W00A 3CPOA 4XBTA 1SJWA 4HM8B 2CKFB 8CHOA 1WQLB 3CU3A 2PZVA 3VSYA 5IEPA 4HM4B 3FLJA 3GRDA 4H3UA 1OH0A 1JN5B 3B4OA 1ULJB 1HKXA 4OUQA 2A15A 3GZBA 1E3RA 5CF1A 1NU3A 1Z1SA 2RCDA 3G8ZA 3K7CA 4HM3B 3ROBA 3KE7A 2RGQA 3F40A 3DM8A 4RZMA 3T8NA 7STDA 5IERA 5JPUA 4J9AA 2GXFA 1DMQA 2BMQB 1QJGA 1NDOB 3B4PA 1OGXA 2B1XB
chains in the Genus database with same CATH superfamily
3MPHA 4L7KA 5AIHA 2B24B 4FMAA 1VQK3 3FCSB 2CFLA 1SIHA 1GYBA 2IUKA 3NXJA 4I4KA 1B2XA 4IT7A 1RKYA 1Q42A 1QAKA 1V58A 2W04A 3DZLA 1IVUA 1R4CA 1BU4A 1YGWA 1AR0A 3EC9A 5AYSC 3MYTA 3X41A 4X2OA 1GD3A 5KP4A 1CQSA 3HIIA 5HGRA 3S67A 1K41A 3F9SA 3ALAA 3FKAA 2RNTA 3KN4A 3H3HA 1PYLA 4X2HA 1W7CA 4L8PA 1DMQA 1KQS2 3HX8A 1VQO3 3T0UA 4FCMA 1RJOA 3LYGA 3SXXA 2UGIA 3BIRA 3KSPA 3LTCA 4N6UA 4KT3B 3DUKA 1BVIA 1OF5B 2F56A 3QRDA 1GD4A 2XSOB 2D42A 1DETA 3VGNA 1TTOA 2H0GA 1MGRA 1WTHA 3MWZA 3D4AA 4HVNA 3CCU3 5AEUB 2GEXA 2QGUA 1RCKA 2XFTA 1BSAA 1KSIA 2OCTA 1HYFA 3AGNA 1I2EA 4G1MB 1FGQA 1CYUA 4XB5A 3Q1CA 1AVKA 1OHPA 3WHOA 1RGCA 1IVWA 1MOLA 3FGYA 5EQLA 4EBGA 2Z76A 2P38A 3HZPA 1IQXA 2GEYA 1SIIA 3DY5A 1B2MA 3WMDA 3UNLA 1VQ53 1IDPA 3NQYA 1Q9EA 3LMLA 3N54B 3CCJ3 1BSDA 2HOHA 3AHWA 3V99A 2J8XB 2W6JH 5ELJA 4N6NB 4EYCA 1M904 1B3SA 2Z7AA 5IF6A 1PY3A 3BB9A 1TIJA 3EBYA 3JUPA 4KZ1A 4HBRA 1Q814 3NBJA 1VQQA 2HMJB 1UGHI 3QK9A 1MNLA 2HMNB 3Q2PA 4Q53A 4NHFA 5D81A 3CPW2 1GSPA 1M9GA 1ZS7A 4N3VA 3S29A 1FA3A 1YJ93 2CWUA 4OVMA 1G96A 3CC73 1Q40B 3S5CA 1Y4KA 4LYLB 3IPTA 1GY5A 3N8BA 5IG5A 3CCL3 2CH9A 2F5MA 1UUWB 2YX9A 3PCSA 1QVF2 3EF8A 3F7SA 1JBRA 4K1UA 3RGRA 1ROVA 2XEPA 2KXGA 1IV7A 1TUHA 3MG1A 5IEOA 1CH0A 4XDWA 2ZL8A 1F8NA 4STDA 2E2TA 2CX0A 4RNZA 1OGZA 4EV5A 1VQM3 1BRJA 1O7GB 4TX4A 1I8VA 3S27A 4JRFA 1DE3A 2KRTA 3CCR3 2KF5A 1UCJA 4IIAA 5AIIA 1BRKA 1W6YA 2AADA 3GSPA 5A0OB 1IT8A 2MC8A 1RN1A 3SLUA 3CPOA 1PU4A 1WQLB 1BNEA 3X3YA 1WMPA 5IEPA 1MWRA 2BIRA 4EW5A 4AEQA 3B4OA 4OUQA 3KFQC 3G8ZA 2RCDA 3F40A 5IERA 1M1XB 1C54A 4CDLA 1QJGA 3CMA3 1RGLA 1CYVA 1JJ22 1AQZA 3CCM3 1Q7Y4 3UL6A 2IMJA 1LQMB 1RRLA 4MEIA 1BAOA 2FNQA 5D82A 3GAXA 3MG2A 3KZTA 3X42A 4WYKA 5ELUA 4XBXA 2FXTA 1DVDA 3G4S3 1I2GA 3NX0A 1EQKA 4ORLA 3I553 5TGNA 3G16A 4HM6B 2O3OA 3LTBA 4U13A 5AEWB 2P05A 2R41A 2BT3A 3NBBA 3NM7A 5EEOA 1GOVA 2IUJA 3V92A 4N6LA 4CPKA 1W6CA 3GWRA 2QA43 1K8A4 2D1WA 3WR2A 5CXOA 1QMAA 1D6UA 1FGRA 1ZO2A 2FGTA 4J5KA 2Z77A 1IU7A 2W9PA 3HIGA 2XH9A 2C4BA 5AI1A 1J2BA 1OHSA 4HKVB 4AKZA 4XDVA 2ZHXB 3SYUA 3JVCA 2BNGA 1BRGA 3M8CA 1UCLA 3BNCA 1TFOA 3MKIA 1T3BA 4ZM8A 3D5GA 1N5HA 3EX9A 3Q3FA 4FCJA 2I9WA 5M1AA 3WOEB 2XGLA 1US1A 4HZ9B 2E2UA 9RNTA 1RHLA 3FG3A 2L1SA 1MWUA 1BIRA 3LTDA 2IY2A 1W2B2 3OWYA 1V57A 1TU5A 2L4VA 2SBLA 3AGOA 3D5IA 1QAFA 1N9JA 2KF3A 4FMBA 4LZIA 4CJNA 1RGEA 2KCDA 2HMKB 2P0MA 2K54A 4RNTA 1NO3A 3LH4A 1OHOA 1U5OA 3UL5A 2GU1A 3I0YA 4XM4A 1D6YA 3GZRA 3OX9A 5FW5A 1O7HB 3WA2X 3KKGA 4O2HA 1ROAA 1SQWA 1UW1A 1E97A 3PXMA 4FMCA 2CWTA 2GBXB 4WHAA 3CCE3 1JBTA 3NBRA 2KF6A 1A2KA 2XF3A 3S28A 1TP6A 2XRXB 3MSOA 3ZFZA 1JV2B 3LXUX 5JBSA 3LTAA 1FUSA 1GMQA 1LOXA 2GBWB 1LNHA 2CW9A 3GZYB 4MMYB 3NV0A 2C10A 3MHEA 1GY7A 1BSBA 1B2ZA 1T2HA 4K61A 1EA2A 3OWSA 2WGQA 3K9MC 1AY7A 1OF5A 1VQ63 1W01A 1BRSA 4K1VA 3JUQA 4KVHA 3RGAA 1GOYA 3X40A 4BTWA 4EXRA 3F14A 4LGQA 4N6MA 3ZG0A 8CHOA 1JRQA 4HM8B 1WMOA 4KFDA 1BUJA 2PZVA 1Q7HA 2H0HA 3VSYA 4HM4B 3FLJA 1OH0A 1JN5B 1ULJB 3CXC2 2WGOA 1FGMA 1VQ73 2E2VA 5CF1A 1LOVA 1NU3A 3ROBA 3DH2A 3OW22 1VQN3 5FGOA 5JPUA 2RGQA 2CG0A 7STDA 4NPBA 5BIRA 4J9AA 1B27A 4XBTA 3K63A 5LC7A 4KFEA 1AV4A 1UDII 2BMOB 1W6GA 3WODG 5CF2A 2W56A 1OUNA 3X3XA 3EN8A 1LVNA 3BNEA 1JB4A 1AVLA 1S5AA 2OQEC 4WYKB 1OPYA 3MG3A 5STDA 4I5QA 1IYYA 3HK4A 3FG1A 1A2PA 1TJDA 2F86B 1YJW3 1JNQA 1K28A 2W9QA 1KWIA 1VQL3 1ZX2A 3B8LA 2Q07A 3JUNA 1OCVA 1W02A 5DRVA 1RN4A 1UI8A 2YFIB 2BU4A 2OOVA 5BXQA 1RNBA 4EC6A 2OTL3 4R4KA 5AYRB 4HM1B 4GSPA 1RSNA 4IPBA 3J7Yd 2YFJB 8RNTA 2XFSA 7GSPA 2QIYA 1KC84 1Q40A 2Y74A 1YVSA 2RBIA 3T8UA 7RNTA 1VZZA 4CCVA 3RNTA 5BU4A 2XGNA 2IA7A 3FF2A 3OWUA 1EG9B 4R80A 1GY6A 3EJVA 1RRHA 1VQP3 5G2GA 1FZUA 3NUVA 1GMPA 1QVG2 2JDIH 4EV2A 1BNFA 3STDA 3NV0B 2K3DA 5BVBA 4DKIA 1NB3I 3BLZA 3GZXB 3EN1B 1O7NB 2JQ5A 5HOHA 3G6E3 5IW9A 2AAEA 1BUQA 1D6ZA 1B21A 5AIGA 1A2VA 1YIT3 1LOYA 1N8QA 1S723 1FUTA 2UX0A 2XSHB 1B20A 3ER7A 1RN7A 1O7WB 2WOHA 1X1XA 2F99A 3SVAA 2F4YA 5JPPA 1BRHA 3VF1A 3CC43 3CD63 3LZAA 2K0MA 5CLKA 3K0ZA 3SX1A 1JN5A 1HZ1A 3K5TA 4K90B 1BOXA 4HJLB 3ECFA 1NNVA 3SOYA 2ML6A 2R4IA 3F7XA 5D83A 1FUWA 1YNVX 2W2CA 4BIRA 1SPUA 1JBSA 2RSXA 3O8YA 3TDGA 3G0KA 4GB5A 3DMCA 5GSPA 3KIIA 1N5PA 3B7CA 2UUGC 1X1UA 2CX1A 3DGMA 4HM0B 3CCS3 5IG4A 3CNXA 2WO0A 4FMDA 3A76A 4R9LA 1UCIA 5M18A 2H0IA 3UB1A 2CFKA 1VQ93 2HMLB 2WOFA 1FGTA 1YVBI 1LNIA 5IG3A 1WNHA 5RNTA 1VQ43 1I70A 1W5ZA 1I2FA 1RGKA 1RLSA 4HYZA 5LC6A 3NM2A 2Y73A 2F98A 1L5GB 5IENA 2LYXA 6STDA 3DXOA 1RMSA 2ZDJA 4MJDA 4N6V0 3FG4A 1I0VA 1UI7A 2BHMA 1BANA 1E3VA 1LXEA 2CHCA 4O3VA 1BRNL 2CK3H 4J8TA 3LT8A 3KCHA 1UCKA 4O02B 1DYUA 3EHCA 1SJWA 2CKFB 3X3ZA 2LQVA 6RNTA 3IMAB 4H3UA 1W4NA 4BTXA 1RGHA 1IVVA 2F5WA 3GZBA 3K7CA 1OACA 3BNBA 1NJI4 1M1K4 3DM8A 1BNRA 1MWTA 1B2SA 2BMQB 4OK0A 1NDOB 3B4PA 1T5YA 1OGXA 2B1XB 3OXAA 4FCZA 3EQQB 3DGOA 3FZWA 3Q90A 4LMIA 1B2UA 2KF4A 4R1KA 2CFWA 1YI23 4ILFA 1BSEA 3OV4A 1BRIA 1BNGA 4O8SA 5EVHA 1RGGA 3UJMA 4LEHA 1STDA 2OOVC 3F8HA 3NQZA 1BSCA 2HMMB 1ULIB 2XR8B 1ISKA 4HM2B 2OWPA 2STDA 1WMNA 2V1LA 2INXA 4BL3A 1EKMA 1GMRA 1EEJA 4BL2A 2CFDA 4HM7B 3G713 4PEJA 3BU4A 1ZGXA 3V98A 4MMZB 1MWSA 3EE1A 1CEWI 1W2ZA 4GHOA 1UUVB 2MF7A 4J5GA 1MGWA 2IYJA 3A5EA 1JB2A 2CFGA 4QWTA 3FH1A 3RDEA 3PGBA 4LSOA 5M19A 5DREA 1IQ8A 1IK3A 1TFKA 2OQEA 4BTYA 3CME3 3LOYA 4R9KA 1I0XA 3JUOA 3N9HA 4BU4A 3WA3A 3BNDA 1JZDA 3DGYA 4JF8A 1YGEA 4HOHA 3EBTA 3NHXA 1I3IA 1I3FA 1ASKA 2YFLB 2W03A 3KSED 1R4YA 1GS3A 3HOHA 3E99A 3URPA 5CK6A 3CNMA 4GL6A 4H61A 1IT7A 1QALA 5I97A 1LQGC 2M7OA 2SARA 3L0RA 2GU3A 3PCRA 5AIFA 1VQ83 1G0TA 3CC23 2BMRB 4HM5B 3IJEB 3LT9A 1X1WA 1IV9A 4WWUC 3PZWA 3F8XA 2CWVA 3ZG5A 2PNCA 4AKYA 3EB8A 3WOFB 2CC3A 1GOUA 1JZOA 1UGIA 4WFOA 2P09A 4RBNA 1UUGB 4L8OA 1BNJA 4RNYA 4NREA 4XBYA 1Q824 1TRQA 1TRPA 1JKGA 2HMOB 3I563 1O7MB 2C11A 2RFRA 1YIJ3 1K9M4 1PFPA 4HZBB 1NB5I 1T2IA 2W56B 4KFFA 1JKGB 3D9RA 2GSPA 5KP1A 1EUIC 3WDGB 1V74A 2ZA4A 3JUMA 2QEX3 2CIUA 5KP3A 1FGOA 1FW7A 1NWWA 1RCLA 1BGSA 2W0QA 3H51A 4WP5A 1YHQ3 1RGFA 1LOWA 3SOAA 1G02A 3AMOB 1IVXA 1LRAA 2Z6BA 1BNSA 3AMOA 1A90A 1YJN3 1N9EA 5IG0A 2CG1A 3CCQ3 3D79A 3PS8A 1HU9A 3AHSA 1KD14 2BO9B 1JB5A 4N6OB 3FSDA 1RTUA 1RNTA 3SEDA 3D3LA 3FF0A 5G1LA 1Q864 1K734 2OTJ3 1O7PB 2P0XA 4HAAA 1C7HA 3DGLA 3DGNA 3PYJA 1DMNA 1RGAA 1U8CB 1SARA 1DMMA 4MMXB 5G1KA 1W00A 6GSPA 3CCV3 1X1YA 1IQYA 3CU3A 1FYSA 1BNIA 3U1WA 3GRDA 3U97A 2O9UX 2KAAA 1HKXA 2A15A 1N8R4 1DVCA 1E3RA 1Z1SA 3HI7A 4HM3B 1A67A 3T8NA 3KE7A 4RZMA 4N6TA 2ML5A 2GXFA 1STFI 1RDSA 4FR9A
chains in the Genus database with same CATH topology
3MPHA 4L7KA 5AIHA 2B24B 4FMAA 1VQK3 3FCSB 2CFLA 1SIHA 1GYBA 2IUKA 3NXJA 4I4KA 4IT7A 1RKYA 1Q42A 1QAKA 2W04A 3DZLA 1IVUA 1R4CA 5AYSC 1AR0A 3EC9A 3MYTA 3X41A 4X2OA 1GD3A 5KP4A 1CQSA 3HIIA 5HGRA 3S67A 1K41A 3F9SA 3ALAA 3FKAA 3KN4A 3H3HA 4X2HA 1W7CA 4L8PA 1DMQA 1KQS2 3HX8A 1VQO3 3T0UA 4FCMA 1RJOA 3LYGA 3SXXA 3KSPA 3LTCA 4N6UA 3DUKA 1OF5B 3QRDA 1GD4A 2XSOB 2D42A 3VGNA 1WTHA 3MWZA 4HVNA 3CCU3 5AEUB 2GEXA 2QGUA 2XFTA 1KSIA 2OCTA 4G1MB 1FGQA 1CYUA 4XB5A 3Q1CA 1AVKA 1OHPA 3FGYA 1IVWA 1MOLA 5EQLA 4EBGA 2Z76A 2P38A 3HZPA 1IQXA 2GEYA 1SIIA 3DY5A 3WMDA 3UNLA 1VQ53 1IDPA 3NQYA 3LMLA 3N54B 3CCJ3 3V99A 2W6JH 5ELJA 4N6NB 4EYCA 1M904 2Z7AA 5IF6A 3BB9A 3EBYA 1TIJA 3JUPA 4KZ1A 1Q814 4HBRA 3NBJA 2HMJB 3QK9A 1MNLA 2HMNB 3Q2PA 4Q53A 4NHFA 5D81A 3CPW2 1M9GA 4N3VA 3S29A 1FA3A 1YJ93 2CWUA 4OVMA 1G96A 3CC73 1Q40B 3S5CA 1Y4KA 3IPTA 1GY5A 3N8BA 5IG5A 3CCL3 2CH9A 1UUWB 2YX9A 3PCSA 1QVF2 3EF8A 3F7SA 4K1UA 3RGRA 1ROVA 2XEPA 2KXGA 1IV7A 1TUHA 3MG1A 5IEOA 4XDWA 2ZL8A 1F8NA 4STDA 2E2TA 4RNZA 1OGZA 4EV5A 1VQM3 1O7GB 4TX4A 3S27A 4JRFA 2KRTA 3CCR3 4IIAA 5AIIA 1W6YA 5A0OB 1IT8A 2MC8A 3SLUA 3CPOA 1PU4A 1WQLB 3X3YA 1WMPA 5IEPA 4AEQA 3B4OA 4OUQA 3KFQC 3G8ZA 2RCDA 3F40A 5IERA 1M1XB 4CDLA 1QJGA 3CMA3 1CYVA 1JJ22 3CCM3 1Q7Y4 3UL6A 2IMJA 4MEIA 1RRLA 2FNQA 5D82A 3GAXA 3MG2A 3KZTA 3X42A 4WYKA 5ELUA 4XBXA 2FXTA 1DVDA 3G4S3 3NX0A 1EQKA 4ORLA 3I553 5TGNA 3G16A 4HM6B 2O3OA 3LTBA 4U13A 5AEWB 2P05A 2BT3A 3NBBA 3NM7A 5EEOA 2IUJA 3V92A 4N6LA 1W6CA 3GWRA 2QA43 1K8A4 2D1WA 5CXOA 1QMAA 1D6UA 1FGRA 1ZO2A 2FGTA 2Z77A 1IU7A 2W9PA 3HIGA 2XH9A 5AI1A 1J2BA 1OHSA 4HKVB 4AKZA 4XDVA 3JVCA 2BNGA 3M8CA 3BNCA 1TFOA 3MKIA 4ZM8A 1N5HA 3EX9A 3WOEB 4FCJA 2I9WA 2XGLA 1US1A 4HZ9B 2E2UA 3FG3A 3LTDA 1W2B2 3OWYA 1TU5A 2L4VA 2SBLA 1QAFA 1N9JA 4FMBA 4LZIA 2KCDA 2HMKB 2P0MA 2K54A 1NO3A 3LH4A 1OHOA 1U5OA 3UL5A 2GU1A 3I0YA 4XM4A 1D6YA 3GZRA 3OX9A 5FW5A 1O7HB 3WA2X 3KKGA 4O2HA 1ROAA 1SQWA 1UW1A 1E97A 3PXMA 4FMCA 2CWTA 2GBXB 4WHAA 3CCE3 3NBRA 1A2KA 2XF3A 3S28A 1TP6A 2XRXB 3MSOA 1JV2B 3LXUX 5JBSA 3LTAA 2GBWB 1LOXA 1LNHA 2CW9A 3GZYB 4MMYB 3NV0A 2C10A 3MHEA 1GY7A 4K61A 1EA2A 3OWSA 2WGQA 3K9MC 1OF5A 1VQ63 1W01A 4K1VA 4KVHA 3JUQA 4BTWA 3RGAA 3X40A 4EXRA 3F14A 4LGQA 4N6MA 8CHOA 1JRQA 4HM8B 1WMOA 4KFDA 2PZVA 3VSYA 4HM4B 3FLJA 1OH0A 1JN5B 1ULJB 3CXC2 2WGOA 1FGMA 1VQ73 2E2VA 5CF1A 3OW22 1NU3A 3ROBA 1VQN3 5FGOA 5JPUA 2RGQA 2CG0A 7STDA 4J9AA 4XBTA 3K63A 5LC7A 4KFEA 1AV4A 3WODG 2BMOB 1W6GA 5CF2A 2W56A 1OUNA 3X3XA 3EN8A 1LVNA 3BNEA 1JB4A 1AVLA 1S5AA 2OQEC 4WYKB 1OPYA 3MG3A 5STDA 3HK4A 3FG1A 2F86B 1YJW3 1JNQA 1K28A 2W9QA 1KWIA 1VQL3 1ZX2A 3B8LA 2Q07A 3JUNA 1OCVA 1W02A 5DRVA 1UI8A 2YFIB 2OOVA 5BXQA 2OTL3 4EC6A 4R4KA 5AYRB 4HM1B 4IPBA 3J7Yd 2YFJB 2XFSA 2QIYA 1KC84 1Q40A 2Y74A 3T8UA 1VZZA 4CCVA 2XGNA 2IA7A 3FF2A 3OWUA 1EG9B 4R80A 1GY6A 3EJVA 1RRHA 1VQP3 5G2GA 3NUVA 1QVG2 2JDIH 4EV2A 3STDA 3NV0B 5BVBA 1NB3I 3BLZA 3GZXB 3EN1B 1O7NB 2JQ5A 3G6E3 5IW9A 1BUQA 1D6ZA 5AIGA 1A2VA 1YIT3 1N8QA 1S723 2UX0A 2XSHB 3ER7A 1RN7A 1O7WB 2WOHA 2F99A 3SVAA 5JPPA 3CC43 3VF1A 3CD63 3LZAA 2K0MA 5CLKA 3K0ZA 3SX1A 1JN5A 3K5TA 4K90B 4HJLB 3ECFA 3SOYA 2ML6A 2R4IA 3F7XA 5D83A 1FUWA 2W2CA 1SPUA 2RSXA 3TDGA 3G0KA 4GB5A 3DMCA 3KIIA 1N5PA 3B7CA 3DGMA 4HM0B 3CCS3 5IG4A 3CNXA 2WO0A 4FMDA 3A76A 4R9LA 3UB1A 2CFKA 1VQ93 2HMLB 2WOFA 1FGTA 1YVBI 5IG3A 1WNHA 1VQ43 1W5ZA 4HYZA 5LC6A 3NM2A 2Y73A 2F98A 1L5GB 5IENA 2LYXA 6STDA 3DXOA 2ZDJA 4MJDA 4N6V0 3FG4A 1UI7A 2BHMA 1LXEA 1E3VA 2CHCA 4O3VA 2CK3H 4J8TA 3LT8A 4O02B 1DYUA 3EHCA 1SJWA 2CKFB 3X3ZA 2LQVA 3IMAB 4H3UA 1W4NA 4BTXA 1IVVA 3GZBA 3K7CA 1OACA 3BNBA 1NJI4 1M1K4 3DM8A 2BMQB 4OK0A 1NDOB 3B4PA 1T5YA 1OGXA 2B1XB 3OXAA 4FCZA 3EQQB 3DGOA 3FZWA 3Q90A 4LMIA 4R1KA 1YI23 2CFWA 3OV4A 4O8SA 5EVHA 3UJMA 4LEHA 1STDA 2OOVC 3F8HA 3NQZA 1ISKA 2HMMB 1ULIB 2XR8B 4HM2B 2OWPA 2STDA 1WMNA 2V1LA 2INXA 1EKMA 2CFDA 4HM7B 3G713 4PEJA 3V98A 4MMZB 3EE1A 1CEWI 1W2ZA 1UUVB 2MF7A 1JB2A 2CFGA 4QWTA 3FH1A 3RDEA 3PGBA 4LSOA 5DREA 1IQ8A 1IK3A 1TFKA 2OQEA 4BTYA 3CME3 3LOYA 4R9KA 3JUOA 3N9HA 3WA3A 3BNDA 4JF8A 1YGEA 3EBTA 3NHXA 1ASKA 2YFLB 2W03A 3KSED 1GS3A 3E99A 5CK6A 3CNMA 4GL6A 4H61A 1IT7A 1QALA 5I97A 3L0RA 2M7OA 3PCRA 1VQ83 2GU3A 5AIFA 3CC23 2BMRB 4HM5B 3IJEB 3LT9A 1IV9A 4WWUC 3PZWA 3F8XA 2CWVA 4AKYA 2PNCA 3EB8A 3WOFB 2CC3A 4WFOA 2P09A 4RBNA 4RNYA 4L8OA 4NREA 4XBYA 1Q824 1JKGA 2HMOB 3I563 1O7MB 2C11A 2RFRA 1YIJ3 1K9M4 1PFPA 4HZBB 1NB5I 2W56B 4KFFA 1JKGB 3D9RA 5KP1A 3WDGB 1V74A 3JUMA 2QEX3 2CIUA 5KP3A 1FGOA 1NWWA 2W0QA 3H51A 4WP5A 1YHQ3 3SOAA 3AMOB 1IVXA 2Z6BA 3AMOA 1A90A 1YJN3 1N9EA 5IG0A 2CG1A 3CCQ3 3PS8A 1HU9A 1KD14 2BO9B 1JB5A 4N6OB 3FSDA 3SEDA 3D3LA 3FF0A 1Q864 1K734 2OTJ3 1O7PB 2P0XA 1C7HA 3DGLA 3DGNA 3PYJA 1DMNA 1U8CB 3CCV3 1DMMA 4MMXB 1W00A 1IQYA 3CU3A 3U1WA 3GRDA 3U97A 2O9UX 1HKXA 2A15A 1N8R4 1DVCA 1E3RA 1Z1SA 3HI7A 4HM3B 1A67A 3T8NA 3KE7A 4RZMA 4N6TA 2ML5A 2GXFA 1STFI 3O8YA 4FR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMI A;  3EQQ B;  3FZW A;  2B24 B;  2BMO B;  3Q90 A;  4L7K A;  3NXJ A;  4I4K A;  1GYB A;  1OUN A;  5AIH A;  5CF2 A;  3OV4 A;  1Q42 A;  3EN8 A;  3DZL A;  2IMJ A;  1JB4 A;  1AR0 A;  1S5A A;  3EC9 A;  4WYK B;  5EVH A;  3MYT A;  1OPY A;  3MG3 A;  4LEH A;  4X2O A;  5D82 A;  1STD A;  3F8H A;  3KZT A;  3HK4 A;  3MG2 A;  2HMM B;  1ULI B;  1CQS A;  2XR8 B;  4WYK A;  2F86 B;  4HM2 B;  4XBX A;  5HGR A;  1K41 A;  2OWP A;  2STD A;  4R1K A;  3F9S A;  1ZX2 A;  3B8L A;  2INX A;  4ORL A;  3G16 A;  3FKA A;  4HM6 B;  5TGN A;  3H3H A;  5AEW B;  4HM7 B;  3JUN A;  4PEJ A;  4U13 A;  1OCV A;  1W02 A;  4X2H A;  5DRV A;  2YFI B;  4L8P A;  5BXQ A;  5STD A;  3HX8 A;  4HM1 B;  4CDL A;  1UUV B;  3GWR A;  4FCM A;  3LYG A;  2YFJ B;  5CXO A;  3KSP A;  1JB2 A;  1QMA A;  1ZO2 A;  2QIY A;  1OF5 B;  3DUK A;  3FH1 A;  1Q40 A;  2Z77 A;  3T8U A;  2XSO B;  1VZZ A;  5DRE A;  3VGN A;  3FF2 A;  3OWU A;  5AI1 A;  1EG9 B;  1GY6 A;  1OHS A;  3EJV A;  4HKV B;  4HVN A;  4R9K A;  5KP4 A;  3OXA A;  3NUV A;  5G2G A;  3JUO A;  4XDV A;  2BNG A;  3NV0 B;  3STD A;  2GEX A;  2QGU A;  3M8C A;  5AEU B;  5BVB A;  3GZX B;  3BLZ A;  3EBT A;  1O7N B;  2JQ5 A;  3EN1 B;  3MKI A;  1ASK A;  2YFL B;  3NHX A;  3EX9 A;  1BUQ A;  4FCJ A;  2I9W A;  1GS3 A;  4XB5 A;  1OHP A;  3E99 A;  3FGY A;  4HZ9 B;  5AIG A;  5CK6 A;  3CNM A;  2Z76 A;  2UX0 A;  2XSH B;  3ER7 A;  3HZP A;  2GEY A;  1O7W B;  2F99 A;  5AIF A;  5JPP A;  3WMD A;  3UNL A;  1IDP A;  2BMR B;  3LZA A;  3OWY A;  4HM5 B;  3K0Z A;  5CLK A;  4WWU C;  3F8X A;  1JN5 A;  1ISK A;  4HJL B;  3ECF A;  3SOY A;  2HMK B;  2R4I A;  2Z7A A;  3F7X A;  2K54 A;  2W2C A;  4L8O A;  5D83 A;  5IF6 A;  4XBY A;  3BB9 A;  1OHO A;  1U5O A;  3EBY A;  3JUP A;  1JKG A;  2HMO B;  3G0K A;  4GB5 A;  1O7M B;  3DMC A;  2RFR A;  3I0Y A;  3GZR A;  3OX9 A;  4XM4 A;  1O7H B;  2HMJ B;  4HZB B;  5FW5 A;  2HMN B;  1JKG B;  3D9R A;  3B7C A;  3KKG A;  5KP1 A;  4Q53 A;  5D81 A;  1E97 A;  4HM0 B;  3JUM A;  5IG4 A;  3CNX A;  4N3V A;  3A76 A;  4R9L A;  5KP3 A;  4OVM A;  2GBX B;  1Q40 B;  1NWW A;  2HML B;  3S5C A;  3H51 A;  3IPT A;  3NBR A;  1GY5 A;  4WP5 A;  1A2K A;  5IG5 A;  1UUW B;  1TP6 A;  2XRX B;  3MSO A;  3SOA A;  5IG3 A;  2GBW B;  3EF8 A;  3F7S A;  4K1U A;  3RGR A;  5IEO A;  1TUH A;  3MG1 A;  3NM2 A;  5IG0 A;  2F98 A;  3GZY B;  3NV0 A;  4XDW A;  3UJM A;  5IEN A;  4STD A;  6STD A;  3MHE A;  1GY7 A;  1JB5 A;  1OGZ A;  3DXO A;  3FSD A;  4MJD A;  1EA2 A;  1O7G B;  3OWS A;  3SED A;  1OF5 A;  3FF0 A;  1E3V A;  1W01 A;  1O7P B;  2CHC A;  3JUQ A;  4IIA A;  4K1V A;  4KVH A;  1C7H A;  5AII A;  1W6Y A;  4J8T A;  3RGA A;  1DMN A;  3F14 A;  1DMM A;  3EHC A;  4LGQ A;  1W00 A;  3CPO A;  4XBT A;  1SJW A;  4HM8 B;  2CKF B;  8CHO A;  1WQL B;  3CU3 A;  2PZV A;  3VSY A;  5IEP A;  4HM4 B;  3FLJ A;  3GRD A;  4H3U A;  1OH0 A;  1JN5 B;  3B4O A;  1ULJ B;  1HKX A;  4OUQ A;  2A15 A;  3GZB A;  1E3R A;  5CF1 A;  1NU3 A;  1Z1S A;  2RCD A;  3G8Z A;  3K7C A;  4HM3 B;  3ROB A;  3KE7 A;  2RGQ A;  3F40 A;  3DM8 A;  4RZM A;  3T8N A;  7STD A;  5IER A;  5JPU A;  4J9A A;  2GXF A;  1DMQ A;  2BMQ B;  1QJG A;  1NDO B;  3B4P A;  1OGX A;  2B1X B; 
#chains in the Genus database with same CATH topology
 3MPH A;  4L7K A;  5AIH A;  2B24 B;  4FMA A;  1VQK 3;  3FCS B;  2CFL A;  1SIH A;  1GYB A;  2IUK A;  3NXJ A;  4I4K A;  1B2X A;  4IT7 A;  1RKY A;  1Q42 A;  1QAK A;  1V58 A;  2W04 A;  3DZL A;  1IVU A;  1R4C A;  1BU4 A;  1YGW A;  1AR0 A;  3EC9 A;  5AYS C;  3MYT A;  3X41 A;  4X2O A;  1GD3 A;  5KP4 A;  1CQS A;  3HII A;  5HGR A;  3S67 A;  1K41 A;  3F9S A;  3ALA A;  3FKA A;  2RNT A;  3KN4 A;  3H3H A;  1PYL A;  4X2H A;  1W7C A;  4L8P A;  1DMQ A;  1KQS 2;  3HX8 A;  1VQO 3;  3T0U A;  4FCM A;  1RJO A;  3LYG A;  3SXX A;  2UGI A;  3BIR A;  3KSP A;  3LTC A;  4N6U A;  4KT3 B;  3DUK A;  1BVI A;  1OF5 B;  2F56 A;  3QRD A;  1GD4 A;  2XSO B;  2D42 A;  1DET A;  3VGN A;  1TTO A;  2H0G A;  1MGR A;  1WTH A;  3MWZ A;  3D4A A;  4HVN A;  3CCU 3;  5AEU B;  2GEX A;  2QGU A;  1RCK A;  2XFT A;  1BSA A;  1KSI A;  2OCT A;  1HYF A;  3AGN A;  1I2E A;  4G1M B;  1FGQ A;  1CYU A;  4XB5 A;  3Q1C A;  1AVK A;  1OHP A;  3WHO A;  1RGC A;  1IVW A;  1MOL A;  3FGY A;  5EQL A;  4EBG A;  2Z76 A;  2P38 A;  3HZP A;  1IQX A;  2GEY A;  1SII A;  3DY5 A;  1B2M A;  3WMD A;  3UNL A;  1VQ5 3;  1IDP A;  3NQY A;  1Q9E A;  3LML A;  3N54 B;  3CCJ 3;  1BSD A;  2HOH A;  3AHW A;  3V99 A;  2J8X B;  2W6J H;  5ELJ A;  4N6N B;  4EYC A;  1M90 4;  1B3S A;  2Z7A A;  5IF6 A;  1PY3 A;  3BB9 A;  1TIJ A;  3EBY A;  3JUP A;  4KZ1 A;  4HBR A;  1Q81 4;  3NBJ A;  1VQQ A;  2HMJ B;  1UGH I;  3QK9 A;  1MNL A;  2HMN B;  3Q2P A;  4Q53 A;  4NHF A;  5D81 A;  3CPW 2;  1GSP A;  1M9G A;  1ZS7 A;  4N3V A;  3S29 A;  1FA3 A;  1YJ9 3;  2CWU A;  4OVM A;  1G96 A;  3CC7 3;  1Q40 B;  3S5C A;  1Y4K A;  4LYL B;  3IPT A;  1GY5 A;  3N8B A;  5IG5 A;  3CCL 3;  2CH9 A;  2F5M A;  1UUW B;  2YX9 A;  3PCS A;  1QVF 2;  3EF8 A;  3F7S A;  1JBR A;  4K1U A;  3RGR A;  1ROV A;  2XEP A;  2KXG A;  1IV7 A;  1TUH A;  3MG1 A;  5IEO A;  1CH0 A;  4XDW A;  2ZL8 A;  1F8N A;  4STD A;  2E2T A;  2CX0 A;  4RNZ A;  1OGZ A;  4EV5 A;  1VQM 3;  1BRJ A;  1O7G B;  4TX4 A;  1I8V A;  3S27 A;  4JRF A;  1DE3 A;  2KRT A;  3CCR 3;  2KF5 A;  1UCJ A;  4IIA A;  5AII A;  1BRK A;  1W6Y A;  2AAD A;  3GSP A;  5A0O B;  1IT8 A;  2MC8 A;  1RN1 A;  3SLU A;  3CPO A;  1PU4 A;  1WQL B;  1BNE A;  3X3Y A;  1WMP A;  5IEP A;  1MWR A;  2BIR A;  4EW5 A;  4AEQ A;  3B4O A;  4OUQ A;  3KFQ C;  3G8Z A;  2RCD A;  3F40 A;  5IER A;  1M1X B;  1C54 A;  4CDL A;  1QJG A;  3CMA 3;  1RGL A;  1CYV A;  1JJ2 2;  1AQZ A;  3CCM 3;  1Q7Y 4;  3UL6 A;  2IMJ A;  1LQM B;  1RRL A;  4MEI A;  1BAO A;  2FNQ A;  5D82 A;  3GAX A;  3MG2 A;  3KZT A;  3X42 A;  4WYK A;  5ELU A;  4XBX A;  2FXT A;  1DVD A;  3G4S 3;  1I2G A;  3NX0 A;  1EQK A;  4ORL A;  3I55 3;  5TGN A;  3G16 A;  4HM6 B;  2O3O A;  3LTB A;  4U13 A;  5AEW B;  2P05 A;  2R41 A;  2BT3 A;  3NBB A;  3NM7 A;  5EEO A;  1GOV A;  2IUJ A;  3V92 A;  4N6L A;  4CPK A;  1W6C A;  3GWR A;  2QA4 3;  1K8A 4;  2D1W A;  3WR2 A;  5CXO A;  1QMA A;  1D6U A;  1FGR A;  1ZO2 A;  2FGT A;  4J5K A;  2Z77 A;  1IU7 A;  2W9P A;  3HIG A;  2XH9 A;  2C4B A;  5AI1 A;  1J2B A;  1OHS A;  4HKV B;  4AKZ A;  4XDV A;  2ZHX B;  3SYU A;  3JVC A;  2BNG A;  1BRG A;  3M8C A;  1UCL A;  3BNC A;  1TFO A;  3MKI A;  1T3B A;  4ZM8 A;  3D5G A;  1N5H A;  3EX9 A;  3Q3F A;  4FCJ A;  2I9W A;  5M1A A;  3WOE B;  2XGL A;  1US1 A;  4HZ9 B;  2E2U A;  9RNT A;  1RHL A;  3FG3 A;  2L1S A;  1MWU A;  1BIR A;  3LTD A;  2IY2 A;  1W2B 2;  3OWY A;  1V57 A;  1TU5 A;  2L4V A;  2SBL A;  3AGO A;  3D5I A;  1QAF A;  1N9J A;  2KF3 A;  4FMB A;  4LZI A;  4CJN A;  1RGE A;  2KCD A;  2HMK B;  2P0M A;  2K54 A;  4RNT A;  1NO3 A;  3LH4 A;  1OHO A;  1U5O A;  3UL5 A;  2GU1 A;  3I0Y A;  4XM4 A;  1D6Y A;  3GZR A;  3OX9 A;  5FW5 A;  1O7H B;  3WA2 X;  3KKG A;  4O2H A;  1ROA A;  1SQW A;  1UW1 A;  1E97 A;  3PXM A;  4FMC A;  2CWT A;  2GBX B;  4WHA A;  3CCE 3;  1JBT A;  3NBR A;  2KF6 A;  1A2K A;  2XF3 A;  3S28 A;  1TP6 A;  2XRX B;  3MSO A;  3ZFZ A;  1JV2 B;  3LXU X;  5JBS A;  3LTA A;  1FUS A;  1GMQ A;  1LOX A;  2GBW B;  1LNH A;  2CW9 A;  3GZY B;  4MMY B;  3NV0 A;  2C10 A;  3MHE A;  1GY7 A;  1BSB A;  1B2Z A;  1T2H A;  4K61 A;  1EA2 A;  3OWS A;  2WGQ A;  3K9M C;  1AY7 A;  1OF5 A;  1VQ6 3;  1W01 A;  1BRS A;  4K1V A;  3JUQ A;  4KVH A;  3RGA A;  1GOY A;  3X40 A;  4BTW A;  4EXR A;  3F14 A;  4LGQ A;  4N6M A;  3ZG0 A;  8CHO A;  1JRQ A;  4HM8 B;  1WMO A;  4KFD A;  1BUJ A;  2PZV A;  1Q7H A;  2H0H A;  3VSY A;  4HM4 B;  3FLJ A;  1OH0 A;  1JN5 B;  1ULJ B;  3CXC 2;  2WGO A;  1FGM A;  1VQ7 3;  2E2V A;  5CF1 A;  1LOV A;  1NU3 A;  3ROB A;  3DH2 A;  3OW2 2;  1VQN 3;  5FGO A;  5JPU A;  2RGQ A;  2CG0 A;  7STD A;  4NPB A;  5BIR A;  4J9A A;  1B27 A;  4XBT A;  3K63 A;  5LC7 A;  4KFE A;  1AV4 A;  1UDI I;  2BMO B;  1W6G A;  3WOD G;  5CF2 A;  2W56 A;  1OUN A;  3X3X A;  3EN8 A;  1LVN A;  3BNE A;  1JB4 A;  1AVL A;  1S5A A;  2OQE C;  4WYK B;  1OPY A;  3MG3 A;  5STD A;  4I5Q A;  1IYY A;  3HK4 A;  3FG1 A;  1A2P A;  1TJD A;  2F86 B;  1YJW 3;  1JNQ A;  1K28 A;  2W9Q A;  1KWI A;  1VQL 3;  1ZX2 A;  3B8L A;  2Q07 A;  3JUN A;  1OCV A;  1W02 A;  5DRV A;  1RN4 A;  1UI8 A;  2YFI B;  2BU4 A;  2OOV A;  5BXQ A;  1RNB A;  4EC6 A;  2OTL 3;  4R4K A;  5AYR B;  4HM1 B;  4GSP A;  1RSN A;  4IPB A;  3J7Y d;  2YFJ B;  8RNT A;  2XFS A;  7GSP A;  2QIY A;  1KC8 4;  1Q40 A;  2Y74 A;  1YVS A;  2RBI A;  3T8U A;  7RNT A;  1VZZ A;  4CCV A;  3RNT A;  5BU4 A;  2XGN A;  2IA7 A;  3FF2 A;  3OWU A;  1EG9 B;  4R80 A;  1GY6 A;  3EJV A;  1RRH A;  1VQP 3;  5G2G A;  1FZU A;  3NUV A;  1GMP A;  1QVG 2;  2JDI H;  4EV2 A;  1BNF A;  3STD A;  3NV0 B;  2K3D A;  5BVB A;  4DKI A;  1NB3 I;  3BLZ A;  3GZX B;  3EN1 B;  1O7N B;  2JQ5 A;  5HOH A;  3G6E 3;  5IW9 A;  2AAE A;  1BUQ A;  1D6Z A;  1B21 A;  5AIG A;  1A2V A;  1YIT 3;  1LOY A;  1N8Q A;  1S72 3;  1FUT A;  2UX0 A;  2XSH B;  1B20 A;  3ER7 A;  1RN7 A;  1O7W B;  2WOH A;  1X1X A;  2F99 A;  3SVA A;  2F4Y A;  5JPP A;  1BRH A;  3VF1 A;  3CC4 3;  3CD6 3;  3LZA A;  2K0M A;  5CLK A;  3K0Z A;  3SX1 A;  1JN5 A;  1HZ1 A;  3K5T A;  4K90 B;  1BOX A;  4HJL B;  3ECF A;  1NNV A;  3SOY A;  2ML6 A;  2R4I A;  3F7X A;  5D83 A;  1FUW A;  1YNV X;  2W2C A;  4BIR A;  1SPU A;  1JBS A;  2RSX A;  3O8Y A;  3TDG A;  3G0K A;  4GB5 A;  3DMC A;  5GSP A;  3KII A;  1N5P A;  3B7C A;  2UUG C;  1X1U A;  2CX1 A;  3DGM A;  4HM0 B;  3CCS 3;  5IG4 A;  3CNX A;  2WO0 A;  4FMD A;  3A76 A;  4R9L A;  1UCI A;  5M18 A;  2H0I A;  3UB1 A;  2CFK A;  1VQ9 3;  2HML B;  2WOF A;  1FGT A;  1YVB I;  1LNI A;  5IG3 A;  1WNH A;  5RNT A;  1VQ4 3;  1I70 A;  1W5Z A;  1I2F A;  1RGK A;  1RLS A;  4HYZ A;  5LC6 A;  3NM2 A;  2Y73 A;  2F98 A;  1L5G B;  5IEN A;  2LYX A;  6STD A;  3DXO A;  1RMS A;  2ZDJ A;  4MJD A;  4N6V 0;  3FG4 A;  1I0V A;  1UI7 A;  2BHM A;  1BAN A;  1E3V A;  1LXE A;  2CHC A;  4O3V A;  1BRN L;  2CK3 H;  4J8T A;  3LT8 A;  3KCH A;  1UCK A;  4O02 B;  1DYU A;  3EHC A;  1SJW A;  2CKF B;  3X3Z A;  2LQV A;  6RNT A;  3IMA B;  4H3U A;  1W4N A;  4BTX A;  1RGH A;  1IVV A;  2F5W A;  3GZB A;  3K7C A;  1OAC A;  3BNB A;  1NJI 4;  1M1K 4;  3DM8 A;  1BNR A;  1MWT A;  1B2S A;  2BMQ B;  4OK0 A;  1NDO B;  3B4P A;  1T5Y A;  1OGX A;  2B1X B;  3OXA A;  4FCZ A;  3EQQ B;  3DGO A;  3FZW A;  3Q90 A;  4LMI A;  1B2U A;  2KF4 A;  4R1K A;  2CFW A;  1YI2 3;  4ILF A;  1BSE A;  3OV4 A;  1BRI A;  1BNG A;  4O8S A;  5EVH A;  1RGG A;  3UJM A;  4LEH A;  1STD A;  2OOV C;  3F8H A;  3NQZ A;  1BSC A;  2HMM B;  1ULI B;  2XR8 B;  1ISK A;  4HM2 B;  2OWP A;  2STD A;  1WMN A;  2V1L A;  2INX A;  4BL3 A;  1EKM A;  1GMR A;  1EEJ A;  4BL2 A;  2CFD A;  4HM7 B;  3G71 3;  4PEJ A;  3BU4 A;  1ZGX A;  3V98 A;  4MMZ B;  1MWS A;  3EE1 A;  1CEW I;  1W2Z A;  4GHO A;  1UUV B;  2MF7 A;  4J5G A;  1MGW A;  2IYJ A;  3A5E A;  1JB2 A;  2CFG A;  4QWT A;  3FH1 A;  3RDE A;  3PGB A;  4LSO A;  5M19 A;  5DRE A;  1IQ8 A;  1IK3 A;  1TFK A;  2OQE A;  4BTY A;  3CME 3;  3LOY A;  4R9K A;  1I0X A;  3JUO A;  3N9H A;  4BU4 A;  3WA3 A;  3BND A;  1JZD A;  3DGY A;  4JF8 A;  1YGE A;  4HOH A;  3EBT A;  3NHX A;  1I3I A;  1I3F A;  1ASK A;  2YFL B;  2W03 A;  3KSE D;  1R4Y A;  1GS3 A;  3HOH A;  3E99 A;  3URP A;  5CK6 A;  3CNM A;  4GL6 A;  4H61 A;  1IT7 A;  1QAL A;  5I97 A;  1LQG C;  2M7O A;  2SAR A;  3L0R A;  2GU3 A;  3PCR A;  5AIF A;  1VQ8 3;  1G0T A;  3CC2 3;  2BMR B;  4HM5 B;  3IJE B;  3LT9 A;  1X1W A;  1IV9 A;  4WWU C;  3PZW A;  3F8X A;  2CWV A;  3ZG5 A;  2PNC A;  4AKY A;  3EB8 A;  3WOF B;  2CC3 A;  1GOU A;  1JZO A;  1UGI A;  4WFO A;  2P09 A;  4RBN A;  1UUG B;  4L8O A;  1BNJ A;  4RNY A;  4NRE A;  4XBY A;  1Q82 4;  1TRQ A;  1TRP A;  1JKG A;  2HMO B;  3I56 3;  1O7M B;  2C11 A;  2RFR A;  1YIJ 3;  1K9M 4;  1PFP A;  4HZB B;  1NB5 I;  1T2I A;  2W56 B;  4KFF A;  1JKG B;  3D9R A;  2GSP A;  5KP1 A;  1EUI C;  3WDG B;  1V74 A;  2ZA4 A;  3JUM A;  2QEX 3;  2CIU A;  5KP3 A;  1FGO A;  1FW7 A;  1NWW A;  1RCL A;  1BGS A;  2W0Q A;  3H51 A;  4WP5 A;  1YHQ 3;  1RGF A;  1LOW A;  3SOA A;  1G02 A;  3AMO B;  1IVX A;  1LRA A;  2Z6B A;  1BNS A;  3AMO A;  1A90 A;  1YJN 3;  1N9E A;  5IG0 A;  2CG1 A;  3CCQ 3;  3D79 A;  3PS8 A;  1HU9 A;  3AHS A;  1KD1 4;  2BO9 B;  1JB5 A;  4N6O B;  3FSD A;  1RTU A;  1RNT A;  3SED A;  3D3L A;  3FF0 A;  5G1L A;  1Q86 4;  1K73 4;  2OTJ 3;  1O7P B;  2P0X A;  4HAA A;  1C7H A;  3DGL A;  3DGN A;  3PYJ A;  1DMN A;  1RGA A;  1U8C B;  1SAR A;  1DMM A;  4MMX B;  5G1K A;  1W00 A;  6GSP A;  3CCV 3;  1X1Y A;  1IQY A;  3CU3 A;  1FYS A;  1BNI A;  3U1W A;  3GRD A;  3U97 A;  2O9U X;  2KAA A;  1HKX A;  2A15 A;  1N8R 4;  1DVC A;  1E3R A;  1Z1S A;  3HI7 A;  4HM3 B;  1A67 A;  3T8N A;  3KE7 A;  4RZM A;  4N6T A;  2ML5 A;  2GXF A;  1STF I;  1RDS A;  4FR9 A; 
#chains in the Genus database with same CATH homology
 3MPH A;  4L7K A;  5AIH A;  2B24 B;  4FMA A;  1VQK 3;  3FCS B;  2CFL A;  1SIH A;  1GYB A;  2IUK A;  3NXJ A;  4I4K A;  4IT7 A;  1RKY A;  1Q42 A;  1QAK A;  2W04 A;  3DZL A;  1IVU A;  1R4C A;  5AYS C;  1AR0 A;  3EC9 A;  3MYT A;  3X41 A;  4X2O A;  1GD3 A;  5KP4 A;  1CQS A;  3HII A;  5HGR A;  3S67 A;  1K41 A;  3F9S A;  3ALA A;  3FKA A;  3KN4 A;  3H3H A;  4X2H A;  1W7C A;  4L8P A;  1DMQ A;  1KQS 2;  3HX8 A;  1VQO 3;  3T0U A;  4FCM A;  1RJO A;  3LYG A;  3SXX A;  3KSP A;  3LTC A;  4N6U A;  3DUK A;  1OF5 B;  3QRD A;  1GD4 A;  2XSO B;  2D42 A;  3VGN A;  1WTH A;  3MWZ A;  4HVN A;  3CCU 3;  5AEU B;  2GEX A;  2QGU A;  2XFT A;  1KSI A;  2OCT A;  4G1M B;  1FGQ A;  1CYU A;  4XB5 A;  3Q1C A;  1AVK A;  1OHP A;  3FGY A;  1IVW A;  1MOL A;  5EQL A;  4EBG A;  2Z76 A;  2P38 A;  3HZP A;  1IQX A;  2GEY A;  1SII A;  3DY5 A;  3WMD A;  3UNL A;  1VQ5 3;  1IDP A;  3NQY A;  3LML A;  3N54 B;  3CCJ 3;  3V99 A;  2W6J H;  5ELJ A;  4N6N B;  4EYC A;  1M90 4;  2Z7A A;  5IF6 A;  3BB9 A;  3EBY A;  1TIJ A;  3JUP A;  4KZ1 A;  1Q81 4;  4HBR A;  3NBJ A;  2HMJ B;  3QK9 A;  1MNL A;  2HMN B;  3Q2P A;  4Q53 A;  4NHF A;  5D81 A;  3CPW 2;  1M9G A;  4N3V A;  3S29 A;  1FA3 A;  1YJ9 3;  2CWU A;  4OVM A;  1G96 A;  3CC7 3;  1Q40 B;  3S5C A;  1Y4K A;  3IPT A;  1GY5 A;  3N8B A;  5IG5 A;  3CCL 3;  2CH9 A;  1UUW B;  2YX9 A;  3PCS A;  1QVF 2;  3EF8 A;  3F7S A;  4K1U A;  3RGR A;  1ROV A;  2XEP A;  2KXG A;  1IV7 A;  1TUH A;  3MG1 A;  5IEO A;  4XDW A;  2ZL8 A;  1F8N A;  4STD A;  2E2T A;  4RNZ A;  1OGZ A;  4EV5 A;  1VQM 3;  1O7G B;  4TX4 A;  3S27 A;  4JRF A;  2KRT A;  3CCR 3;  4IIA A;  5AII A;  1W6Y A;  5A0O B;  1IT8 A;  2MC8 A;  3SLU A;  3CPO A;  1PU4 A;  1WQL B;  3X3Y A;  1WMP A;  5IEP A;  4AEQ A;  3B4O A;  4OUQ A;  3KFQ C;  3G8Z A;  2RCD A;  3F40 A;  5IER A;  1M1X B;  4CDL A;  1QJG A;  3CMA 3;  1CYV A;  1JJ2 2;  3CCM 3;  1Q7Y 4;  3UL6 A;  2IMJ A;  4MEI A;  1RRL A;  2FNQ A;  5D82 A;  3GAX A;  3MG2 A;  3KZT A;  3X42 A;  4WYK A;  5ELU A;  4XBX A;  2FXT A;  1DVD A;  3G4S 3;  3NX0 A;  1EQK A;  4ORL A;  3I55 3;  5TGN A;  3G16 A;  4HM6 B;  2O3O A;  3LTB A;  4U13 A;  5AEW B;  2P05 A;  2BT3 A;  3NBB A;  3NM7 A;  5EEO A;  2IUJ A;  3V92 A;  4N6L A;  1W6C A;  3GWR A;  2QA4 3;  1K8A 4;  2D1W A;  5CXO A;  1QMA A;  1D6U A;  1FGR A;  1ZO2 A;  2FGT A;  2Z77 A;  1IU7 A;  2W9P A;  3HIG A;  2XH9 A;  5AI1 A;  1J2B A;  1OHS A;  4HKV B;  4AKZ A;  4XDV A;  3JVC A;  2BNG A;  3M8C A;  3BNC A;  1TFO A;  3MKI A;  4ZM8 A;  1N5H A;  3EX9 A;  3WOE B;  4FCJ A;  2I9W A;  2XGL A;  1US1 A;  4HZ9 B;  2E2U A;  3FG3 A;  3LTD A;  1W2B 2;  3OWY A;  1TU5 A;  2L4V A;  2SBL A;  1QAF A;  1N9J A;  4FMB A;  4LZI A;  2KCD A;  2HMK B;  2P0M A;  2K54 A;  1NO3 A;  3LH4 A;  1OHO A;  1U5O A;  3UL5 A;  2GU1 A;  3I0Y A;  4XM4 A;  1D6Y A;  3GZR A;  3OX9 A;  5FW5 A;  1O7H B;  3WA2 X;  3KKG A;  4O2H A;  1ROA A;  1SQW A;  1UW1 A;  1E97 A;  3PXM A;  4FMC A;  2CWT A;  2GBX B;  4WHA A;  3CCE 3;  3NBR A;  1A2K A;  2XF3 A;  3S28 A;  1TP6 A;  2XRX B;  3MSO A;  1JV2 B;  3LXU X;  5JBS A;  3LTA A;  2GBW B;  1LOX A;  1LNH A;  2CW9 A;  3GZY B;  4MMY B;  3NV0 A;  2C10 A;  3MHE A;  1GY7 A;  4K61 A;  1EA2 A;  3OWS A;  2WGQ A;  3K9M C;  1OF5 A;  1VQ6 3;  1W01 A;  4K1V A;  4KVH A;  3JUQ A;  4BTW A;  3RGA A;  3X40 A;  4EXR A;  3F14 A;  4LGQ A;  4N6M A;  8CHO A;  1JRQ A;  4HM8 B;  1WMO A;  4KFD A;  2PZV A;  3VSY A;  4HM4 B;  3FLJ A;  1OH0 A;  1JN5 B;  1ULJ B;  3CXC 2;  2WGO A;  1FGM A;  1VQ7 3;  2E2V A;  5CF1 A;  3OW2 2;  1NU3 A;  3ROB A;  1VQN 3;  5FGO A;  5JPU A;  2RGQ A;  2CG0 A;  7STD A;  4J9A A;  4XBT A;  3K63 A;  5LC7 A;  4KFE A;  1AV4 A;  3WOD G;  2BMO B;  1W6G A;  5CF2 A;  2W56 A;  1OUN A;  3X3X A;  3EN8 A;  1LVN A;  3BNE A;  1JB4 A;  1AVL A;  1S5A A;  2OQE C;  4WYK B;  1OPY A;  3MG3 A;  5STD A;  3HK4 A;  3FG1 A;  2F86 B;  1YJW 3;  1JNQ A;  1K28 A;  2W9Q A;  1KWI A;  1VQL 3;  1ZX2 A;  3B8L A;  2Q07 A;  3JUN A;  1OCV A;  1W02 A;  5DRV A;  1UI8 A;  2YFI B;  2OOV A;  5BXQ A;  2OTL 3;  4EC6 A;  4R4K A;  5AYR B;  4HM1 B;  4IPB A;  3J7Y d;  2YFJ B;  2XFS A;  2QIY A;  1KC8 4;  1Q40 A;  2Y74 A;  3T8U A;  1VZZ A;  4CCV A;  2XGN A;  2IA7 A;  3FF2 A;  3OWU A;  1EG9 B;  4R80 A;  1GY6 A;  3EJV A;  1RRH A;  1VQP 3;  5G2G A;  3NUV A;  1QVG 2;  2JDI H;  4EV2 A;  3STD A;  3NV0 B;  5BVB A;  1NB3 I;  3BLZ A;  3GZX B;  3EN1 B;  1O7N B;  2JQ5 A;  3G6E 3;  5IW9 A;  1BUQ A;  1D6Z A;  5AIG A;  1A2V A;  1YIT 3;  1N8Q A;  1S72 3;  2UX0 A;  2XSH B;  3ER7 A;  1RN7 A;  1O7W B;  2WOH A;  2F99 A;  3SVA A;  5JPP A;  3CC4 3;  3VF1 A;  3CD6 3;  3LZA A;  2K0M A;  5CLK A;  3K0Z A;  3SX1 A;  1JN5 A;  3K5T A;  4K90 B;  4HJL B;  3ECF A;  3SOY A;  2ML6 A;  2R4I A;  3F7X A;  5D83 A;  1FUW A;  2W2C A;  1SPU A;  2RSX A;  3TDG A;  3G0K A;  4GB5 A;  3DMC A;  3KII A;  1N5P A;  3B7C A;  3DGM A;  4HM0 B;  3CCS 3;  5IG4 A;  3CNX A;  2WO0 A;  4FMD A;  3A76 A;  4R9L A;  3UB1 A;  2CFK A;  1VQ9 3;  2HML B;  2WOF A;  1FGT A;  1YVB I;  5IG3 A;  1WNH A;  1VQ4 3;  1W5Z A;  4HYZ A;  5LC6 A;  3NM2 A;  2Y73 A;  2F98 A;  1L5G B;  5IEN A;  2LYX A;  6STD A;  3DXO A;  2ZDJ A;  4MJD A;  4N6V 0;  3FG4 A;  1UI7 A;  2BHM A;  1LXE A;  1E3V A;  2CHC A;  4O3V A;  2CK3 H;  4J8T A;  3LT8 A;  4O02 B;  1DYU A;  3EHC A;  1SJW A;  2CKF B;  3X3Z A;  2LQV A;  3IMA B;  4H3U A;  1W4N A;  4BTX A;  1IVV A;  3GZB A;  3K7C A;  1OAC A;  3BNB A;  1NJI 4;  1M1K 4;  3DM8 A;  2BMQ B;  4OK0 A;  1NDO B;  3B4P A;  1T5Y A;  1OGX A;  2B1X B;  3OXA A;  4FCZ A;  3EQQ B;  3DGO A;  3FZW A;  3Q90 A;  4LMI A;  4R1K A;  1YI2 3;  2CFW A;  3OV4 A;  4O8S A;  5EVH A;  3UJM A;  4LEH A;  1STD A;  2OOV C;  3F8H A;  3NQZ A;  1ISK A;  2HMM B;  1ULI B;  2XR8 B;  4HM2 B;  2OWP A;  2STD A;  1WMN A;  2V1L A;  2INX A;  1EKM A;  2CFD A;  4HM7 B;  3G71 3;  4PEJ A;  3V98 A;  4MMZ B;  3EE1 A;  1CEW I;  1W2Z A;  1UUV B;  2MF7 A;  1JB2 A;  2CFG A;  4QWT A;  3FH1 A;  3RDE A;  3PGB A;  4LSO A;  5DRE A;  1IQ8 A;  1IK3 A;  1TFK A;  2OQE A;  4BTY A;  3CME 3;  3LOY A;  4R9K A;  3JUO A;  3N9H A;  3WA3 A;  3BND A;  4JF8 A;  1YGE A;  3EBT A;  3NHX A;  1ASK A;  2YFL B;  2W03 A;  3KSE D;  1GS3 A;  3E99 A;  5CK6 A;  3CNM A;  4GL6 A;  4H61 A;  1IT7 A;  1QAL A;  5I97 A;  3L0R A;  2M7O A;  3PCR A;  1VQ8 3;  2GU3 A;  5AIF A;  3CC2 3;  2BMR B;  4HM5 B;  3IJE B;  3LT9 A;  1IV9 A;  4WWU C;  3PZW A;  3F8X A;  2CWV A;  4AKY A;  2PNC A;  3EB8 A;  3WOF B;  2CC3 A;  4WFO A;  2P09 A;  4RBN A;  4RNY A;  4L8O A;  4NRE A;  4XBY A;  1Q82 4;  1JKG A;  2HMO B;  3I56 3;  1O7M B;  2C11 A;  2RFR A;  1YIJ 3;  1K9M 4;  1PFP A;  4HZB B;  1NB5 I;  2W56 B;  4KFF A;  1JKG B;  3D9R A;  5KP1 A;  3WDG B;  1V74 A;  3JUM A;  2QEX 3;  2CIU A;  5KP3 A;  1FGO A;  1NWW A;  2W0Q A;  3H51 A;  4WP5 A;  1YHQ 3;  3SOA A;  3AMO B;  1IVX A;  2Z6B A;  3AMO A;  1A90 A;  1YJN 3;  1N9E A;  5IG0 A;  2CG1 A;  3CCQ 3;  3PS8 A;  1HU9 A;  1KD1 4;  2BO9 B;  1JB5 A;  4N6O B;  3FSD A;  3SED A;  3D3L A;  3FF0 A;  1Q86 4;  1K73 4;  2OTJ 3;  1O7P B;  2P0X A;  1C7H A;  3DGL A;  3DGN A;  3PYJ A;  1DMN A;  1U8C B;  3CCV 3;  1DMM A;  4MMX B;  1W00 A;  1IQY A;  3CU3 A;  3U1W A;  3GRD A;  3U97 A;  2O9U X;  1HKX A;  2A15 A;  1N8R 4;  1DVC A;  1E3R A;  1Z1S A;  3HI7 A;  4HM3 B;  1A67 A;  3T8N A;  3KE7 A;  4RZM A;  4N6T A;  2ML5 A;  2GXF A;  1STF I;  3O8Y A;  4FR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...