4STDA

High resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological ph
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
b'GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalone dehydratase
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
total genus 46
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4stdA00
3KKGA 4IIAA 3FF2A 3GZYB 2Z77A 2CHCA 3EN8A 3Q90A 4XBYA 4HM1B 3FLJA 4X2HA 5BVBA 5AEWB 4XDWA 5KP1A 1CQSA 3UNLA 5IF6A 5G2GA 2XR8B 3ROBA 2GBXB 3EBTA 2HMMB 3GZBA 3T8UA 1JN5A 1GS3A 5BXQA 3EX9A 2GBWB 5IENA 4H3UA 3CU3A 3VSYA 3DZLA 2XSOB 4L8PA 2Z7AA 4L8OA 3STDA 5AIIA 1GY6A 2XRXB 1DMQA 5DRVA 3T8NA 2QIYA 3JUOA 4XM4A 2B24B 3H3HA 5CF1A 2RFRA 3JUMA 3NUVA 3KE7A 4U13A 5D81A 3NXJA 2QGUA 4HM6B 3EJVA 3F9SA 1OCVA 2PZVA 3K0ZA 3F8HA 1E3RA 5AIGA 1EG9B 2HMKB 3RGRA 5JPUA 3GZXB 3G0KA 1NWWA 3G8ZA 1O7WB 1JKGA 4K1UA 3ER7A 2HMLB 3HX8A 2F86B 3JUNA 1O7HB 1JB2A 3FGYA 4Q53A 5IEOA 6STDA 1OUNA 1O7NB 3FH1A 2YFJB 4L7KA 4J8TA 3FKAA 4HZ9B 1OHSA 1ISKA 2A15A 5IEPA 1A2KA 3M8CA 2RGQA 7STDA 3NV0B 4RZMA 2OWPA 3NM2A 3CNMA 3WMDA 1W02A 4OUQA 3H51A 1IDPA 2UX0A 3MG2A 1ASKA 2F98A 4CDLA 4WP5A 3OV4A 4N3VA 2BMRB 1OGZA 4HM4B 1Q40B 4WYKA 3KSPA 1EA2A 2BMOB 3EQQB 5CF2A 3I0YA 3NBRA 4MJDA 4K1VA 1UUWB 1ULIB 3E99A 1STDA 3ECFA 3SEDA 4HZBB 1VZZA 1DMNA 2JQ5A 3B4PA 4LGQA 5CXOA 4ORLA 3GZRA 4HM8B 1OF5B 4R9KA 3D9RA 1ULJB 1UUVB 1O7GB 2GEYA 5D82A 5TGNA 3MYTA 3F40A 2IMJA 3NV0A 4LMIA 4GB5A 1BUQA 1O7PB 3F7XA 5AI1A 1QJGA 5KP4A 3OXAA 5AIFA 1E97A 4XDVA 3G16A 3SOYA 2GXFA 2INXA 4X2OA 3B8LA 5CK6A 4OVMA 3EF8A 1GYBA 5D83A 3OWYA 3B7CA 4PEJA 1W01A 2W2CA 3JUQA 1NDOB 3B4OA 3OX9A 1QMAA 3MHEA 3HK4A 3FF0A 3VGNA 3K7CA 3CNXA 5EVHA 5CLKA 1U5OA 5JPPA 3EN1B 3DUKA 5AEUB 2BMQB 2Z76A 3MSOA 1JB4A 3EHCA 1TP6A 3FSDA 4LEHA 1ZX2A 3FZWA 4FCMA 5IG0A 4HM0B 4WWUC 4R1KA 3NHXA 1DMMA 5KP3A 2YFLB 1GY5A 1OGXA 2F99A 1E3VA 5STDA 1Z1SA 1JKGB 3SOAA 3MG1A 3LYGA 2BNGA 1OPYA 1JB5A 4XB5A 3KZTA 3S5CA 5IERA 4HKVB 1W00A 5IG3A 3EC9A 4HM2B 4XBXA 3DMCA 4HM3B 1AR0A 3F8XA 2B1XB 2YFIB 4STDA 1O7MB 1S5AA 5AIHA 2HMNB 2K54A 1C7HA 1TUHA 3IPTA 3F14A 1OHOA 2R4IA 2CKFB 1K41A 1OH0A 3HZPA 3GRDA 4HVNA 4J9AA 4R9LA 3F7SA 4KVHA 3GWRA 2RCDA 2I9WA 2STDA 1JN5B 4WYKB 1WQLB 1GY7A 4HM7B 5FW5A 1NU3A 5DREA 1SJWA 3DXOA 3RGAA 3BLZA 4HM5B 3LZAA 1Q40A 1OHPA 3CPOA 5IG5A 8CHOA 4HJLB 1ZO2A 2GEXA 5HGRA 2HMOB 4FCJA 3MG3A 3DM8A 3MKIA 4I4KA 1HKXA 3UJMA 1Q42A 3BB9A 3OWSA 3EBYA 1W6YA 2HMJB 4XBTA 3OWUA 3JUPA 3A76A 2XSHB 5IG4A 1OF5A
chains in the Genus database with same CATH superfamily
2M7OA 1RLSA 1CH0A 3KKGA 1MWRA 1HU9A 4KFFA 1YI23 1BNEA 1JV2B 2Z6BA 4IIAA 3LMLA 1BNIA 3FF2A 1ROAA 1RRHA 2IA7A 3GZYB 2Z77A 1UI7A 2BO9B 2KCDA 2KF4A 1LOYA 2CHCA 2V1LA 1U8CB 3EN8A 3O8YA 3Q90A 2UUGC 3DGMA 3DH2A 4HM1B 2BIRA 1BU4A 4XBYA 3FLJA 4X2HA 3U1WA 1BNRA 3EE1A 2IUJA 5BVBA 1I2FA 1MOLA 2C4BA 2CC3A 4EBGA 1BNSA 5AEWB 2IUKA 1RNTA 1BSCA 5M18A 4XDWA 1VQN3 5KP1A 1I3FA 4N6V0 2Y74A 3Q3FA 1UCLA 1CQSA 2ZDJA 4MMXB 5G2GA 3UNLA 5IF6A 1CEWI 3SYUA 2XR8B 3ROBA 4N6UA 1RTUA 4LZIA 2GBXB 2GU3A 3EBTA 4KFEA 2HMMB 1ROVA 3GZBA 3T8UA 1JN5A 1CYVA 1YNVX 1GS3A 3MWZA 4G1MB 4H61A 3EX9A 1YGWA 3QRDA 5BXQA 1VQ83 2GBWB 5IENA 4H3UA 1IU7A 3CU3A 3VSYA 3DZLA 3N8BA 3V98A 2OQEC 4KZ1A 2CFDA 7GSPA 1FGRA 4HAAA 2XSOB 4FCZA 3NBJA 4L8PA 2CW9A 1N9EA 2Z7AA 4L8OA 3STDA 2RNTA 1T5YA 5AIIA 1RDSA 2KF3A 1GY6A 2XFTA 2XRXB 1BSEA 1DMQA 1VQK3 1Q814 3BU4A 5DRVA 1IVUA 1GSPA 2BU4A 3T8NA 1WTHA 2CX1A 3D4AA 2QIYA 5RNTA 4N6LA 3D79A 3CCR3 3JUOA 2F4YA 1DE3A 4EW5A 3FG4A 4XM4A 1IV9A 1ZGXA 4O3VA 2WGQA 2B24B 2YX9A 3CMA3 2CFWA 6GSPA 1G96A 1Q864 3H3HA 5CF1A 3PCRA 1FA3A 2RFRA 3JUMA 3NUVA 1IK3A 1I3IA 3KE7A 4U13A 1S723 3PYJA 2Y73A 1JNQA 5D81A 1I0VA 2QGUA 3NXJA 1BVIA 4HM6B 3IMAB 3EJVA 4K61A 1VQL3 3F9SA 3MPHA 1OCVA 2PZVA 1TFKA 4NHFA 3G6E3 2KF5A 3K0ZA 2C11A 3F8HA 1E3RA 1KD14 5AIGA 1IV7A 1EG9B 2HMKB 1PYLA 4EXRA 5ELUA 2C10A 3RGRA 1YHQ3 5JPUA 1PU4A 1LNIA 1LOVA 3GZXB 3Q1CA 3ALAA 4FR9A 1K28A 3G0KA 1M904 1NWWA 1N5PA 3G8ZA 1R4YA 1B2MA 1FUSA 1O7WB 3NQYA 5LC7A 4ZM8A 1JKGA 1N5HA 4K1UA 3ER7A 3CME3 3KFQC 3FG1A 3SX1A 4EC6A 2HMLB 3HX8A 2F86B 3JUNA 1O7HB 2W56B 1X1XA 4HYZA 3ZG5A 1JB2A 1RRLA 2P0MA 3FGYA 4Q53A 3WHOA 3OW22 5IEOA 6STDA 1K8A4 1GOYA 3SXXA 1JBTA 1OUNA 1O7NB 3FH1A 1PFPA 1W6CA 1W2ZA 2ZA4A 1IVWA 2YFJB 4L7KA 1IQYA 1X1WA 4J8TA 1AVKA 2P05A 3CCM3 3FKAA 4HZ9B 1W4NA 1FW7A 1B2ZA 1OHSA 4O02B 1ISKA 1RGEA 3HI7A 2A15A 1TU5A 1IT8A 1SIIA 5IEPA 1B21A 1YJW3 1A2KA 2W04A 3GAXA 3M8CA 4MMYB 3TDGA 2RGQA 1I0XA 2WO0A 3LTCA 1EUIC 7STDA 1AVLA 1W5ZA 3PZWA 2SARA 2XH9A 3NV0B 4RZMA 3L0RA 2OWPA 3PGBA 2CG0A 3CC23 2WOHA 3AMOB 4RNYA 3NM2A 3KCHA 3CNMA 4KFDA 1LVNA 3WMDA 1A2VA 1STFI 5G1KA 1IVVA 1D6ZA 3N9HA 1BUJA 2GU1A 2BT3A 1JBSA 1W02A 2CFKA 3DGLA 2E2VA 3NQZA 4OUQA 3G4S3 1BRKA 1J2BA 1LRAA 2CFLA 1BSAA 3WA2X 2QA43 1QAFA 3H51A 1IDPA 2D42A 4CPKA 1NO3A 1VQP3 2UX0A 1NJI4 3MG2A 4TX4A 1ASKA 2F98A 3X3XA 4IPBA 4CDLA 4WP5A 3OV4A 2AADA 3NX0A 1TRPA 4GHOA 4N3VA 5G1LA 1BNGA 3J7Yd 1JBRA 1M9GA 2BMRB 4BTYA 2GSPA 3UL5A 3AHSA 1V74A 1OGZA 3A5EA 3JVCA 3PCSA 2CG1A 1CYUA 1RGHA 2QEX3 2E2TA 1D6YA 1GMRA 4HM4B 1RMSA 1HZ1A 1UCJA 1BSBA 2KF6A 4BTWA 2JDIH 4WFOA 1Q40B 1Q7Y4 3CCU3 4WYKA 1A67A 1BNFA 1BRGA 1AY7A 2PNCA 3WODG 4JF8A 2XGNA 3KSPA 3X40A 1US1A 4LSOA 4MEIA 1EA2A 1JZDA 1R4CA 1NB3I 2BMOB 2F5MA 2WOFA 1RN1A 2XF3A 3EQQB 3PXMA 1BRHA 4J5GA 3WOFB 3I0YA 3NBRA 1C54A 1UCKA 4K1VA 4MJDA 1RGFA 3K9MC 3DY5A 2D1WA 4FMAA 4AEQA 1B27A 1UUWB 3CPW2 1ULIB 1K9M4 5M1AA 1FGOA 2F56A 3E99A 1STDA 2O9UX 1D6UA 3ECFA 3X3ZA 6RNTA 3CXC2 1DVCA 1W2B2 2IYJA 3SEDA 4HZBB 1VZZA 5ELJA 1DMNA 1A2PA 2JQ5A 3B4PA 4LGQA 5CXOA 5LC6A 1JZOA 5GSPA 4ORLA 3GZRA 1IVXA 2OQEA 4MMZB 4HBRA 2OTJ3 3RDEA 3WA3A 4HM8B 3T0UA 1OF5B 4R9KA 1LOWA 3D9RA 1QVG2 2L4VA 1ULJB 1UUVB 3N54B 1Y4KA 5BIRA 1O7GB 1FYSA 3SVAA 2OCTA 2GEYA 3LXUX 1DYUA 4KT3B 1N9JA 2W9QA 3ZG0A 3LT8A 3DGYA 1SARA 3WR2A 5D82A 1FGQA 5EEOA 9RNTA 5TGNA 3MYTA 3F40A 2XFSA 4R4KA 2IMJA 4WHAA 2H0GA 1GOVA 2CK3H 4O8SA 3NV0A 1RGKA 1I2GA 1UI8A 1BRSA 2OTL3 2KXGA 4LMIA 4GB5A 2P38A 1UW1A 1BUQA 3LTBA 4K90B 1O7PB 1RGCA 1BRIA 3WDGB 3F7XA 2BHMA 2XGLA 2E2UA 1BRJA 2MC8A 5AI1A 3S29A 1QJGA 5KP4A 3BNEA 4HOHA 1X1YA 2RSXA 3OXAA 5AIFA 3SLUA 1E97A 1ZS7A 4EV5A 1W6GA 4XDVA 1NNVA 1FUTA 1VQM3 1K734 1TFOA 3G16A 1B2XA 3CD63 3SOYA 3ZFZA 3HIGA 4BIRA 1T3BA 2GXFA 5EQLA 2K3DA 2INXA 1I70A 5I97A 1IYYA 1UUGB 2OOVC 1A90A 2P09A 2O3OA 1BOXA 4X2OA 1IT7A 1VQ53 1T2HA 3Q2PA 3B8LA 3BNCA 5CK6A 4FMCA 3RNTA 4OVMA 3NBBA 3EF8A 1KSIA 7RNTA 1BGSA 3BNDA 1GYBA 3LOYA 5D83A 3OWYA 3LH4A 3B7CA 4PEJA 5IW9A 1YIJ3 1W01A 2K0MA 3FG3A 3V92A 1VQ43 1TIJA 1VQO3 2W2CA 3JUQA 2CX0A 1NDOB 3B4OA 1X1UA 1RN7A 3V99A 1W7CA 1GMPA 3OX9A 2CH9A 1QMAA 3MHEA 3HK4A 4N6TA 2WGOA 3QK9A 2LYXA 3FF0A 3VGNA 3K7CA 1QALA 2ZHXB 3CNXA 4GL6A 5EVHA 5JBSA 4CJNA 3GSPA 3K5TA 1U5OA 4RNZA 2H0IA 2J8XB 4R80A 5CLKA 5JPPA 1VQQA 3EN1B 3DUKA 5AEUB 1UDII 2BMQB 2Z76A 2SBLA 2CWTA 3IJEB 3MSOA 1JB4A 3D5GA 1IQ8A 1WMOA 3EHCA 1TP6A 3FSDA 1FZUA 4LEHA 1ZX2A 1N8R4 3FZWA 4FCMA 1UGIA 4GSPA 5IG0A 1BNJA 3AGNA 4HM0B 4LYLB 4WWUC 3UL6A 3I553 4N6MA 3WOEB 4R1KA 3NHXA 1DMMA 5M19A 5KP3A 2YFLB 1GY5A 1KC84 1OGXA 1V57A 2F99A 1MWUA 4N6NB 1RGLA 1E3VA 1UGHI 1QAKA 2ZL8A 5STDA 8RNTA 1Z1SA 1JKGB 2CWVA 3KIIA 3SOAA 4EYCA 1RGAA 1UCIA 1YVBI 2HOHA 3LYGA 1SPUA 3MG1A 1L5GB 3CC73 1KWIA 1V58A 2BNGA 1OPYA 3AGOA 1Q9EA 2FNQA 2Q07A 2ML6A 2W03A 1B3SA 1JB5A 4XB5A 1I2EA 2R41A 3KZTA 1TTOA 5FGOA 1QVF2 3S5CA 5IERA 4HKVB 1MGWA 1RKYA 1W00A 1RNBA 5IG3A 3EC9A 3DGOA 1WMNA 4HM2B 3CCV3 3HIIA 4AKZA 1I8VA 2RBIA 1FUWA 4XBXA 3S28A 3DMCA 1DVDA 4HM3B 1AR0A 3F8XA 1FGTA 2B1XB 2YFIB 3S67A 1BSDA 3LTAA 4STDA 1O7MB 5AYSC 1VQ63 1S5AA 2XEPA 1LQMB 2AAEA 4OK0A 5AIHA 1GMQA 2W56A 1RSNA 2HMNB 3X3YA 2P0XA 1F8NA 1B2UA 2K54A 1C7HA 5CF2A 1RCKA 1TUHA 3BIRA 4IT7A 3IPTA 4RBNA 1VQ73 3CC43 1RHLA 4CCVA 3CCS3 1EKMA 3F14A 1OHOA 1RCLA 2KRTA 2ML5A 1SIHA 1KQS2 2R4IA 3CCL3 3U97A 2CFGA 1YIT3 1LOXA 3KSED 2IY2A 2CKFB 4EV2A 1VQ93 1K41A 1GOUA 3LTDA 1OH0A 2H0HA 3X41A 3HZPA 3GRDA 3NM7A 1LNHA 4HVNA 1PY3A 1YGEA 3AMOA 4J9AA 4BL2A 2L1SA 2W6JH 4R9LA 3VF1A 3F7SA 4KVHA 3GWRA 2RCDA 1RGGA 3PS8A 1NB5I 5A0OB 1WMPA 2I9WA 2MF7A 2STDA 1JN5B 1FGMA 1N8QA 1EQKA 4NREA 4WYKB 3FCSB 1OACA 1Q7HA 1WQLB 3HOHA 4FMBA 1GY7A 3X42A 1B20A 4HM7B 3DGNA 1EEJA 4QWTA 4N6OB 1G02A 5FW5A 4BL3A 3LT9A 1IQXA 3EB8A 1M1K4 3UB1A 2KAAA 3URPA 4JRFA 1NU3A 4NPBA 5DREA 1WNHA 4DKIA 1SJWA 1MWSA 3D3LA 3CCE3 3CCJ3 1DETA 1HYFA 3DXOA 4ILFA 3S27A 3RGAA 3BLZA 4I5QA 3D5IA 1BRNL 1JJ22 4HM5B 3LZAA 1Q40A 1OHPA 1YVSA 3CPOA 5IG5A 1SQWA 1Q824 1MGRA 5HOHA 3G713 2CIUA 8CHOA 2FGTA 1BIRA 4HJLB 1ZO2A 2OOVA 1BAOA 1GD4A 5BU4A 1JRQA 3AHWA 2GEXA 5HGRA 1RN4A 2CWUA 4O2HA 2HMOB 4FCJA 3MG3A 1T2IA 1RJOA 2W9PA 3DM8A 4FMDA 1LQGC 3BNBA 5AYRB 4AKYA 1TJDA 1AV4A 2F5WA 3MKIA 1AQZA 2W0QA 4I4KA 1TRQA 1HKXA 3UJMA 1G0TA 1MNLA 1Q42A 2FXTA 1MWTA 4BU4A 3BB9A 4RNTA 1M1XB 3KN4A 3OWSA 1YJ93 3EBYA 1W6YA 3K63A 2HMJB 4XBTA 1YJN3 3OWUA 3JUPA 2LQVA 1GD3A 2UGIA 4J5KA 1B2SA 1BANA 2XSHB 3A76A 1LXEA 3CCQ3 5IG4A 3I563 4BTXA 1OF5A
chains in the Genus database with same CATH topology
2M7OA 1YI23 3KKGA 1HU9A 4KFFA 1JV2B 2Z6BA 4IIAA 3LMLA 3FF2A 1ROAA 1RRHA 2IA7A 3GZYB 2Z77A 1UI7A 2BO9B 2KCDA 2CHCA 2V1LA 1U8CB 3EN8A 3O8YA 3Q90A 4XBYA 3DGMA 4HM1B 3FLJA 4X2HA 3U1WA 3EE1A 2IUJA 5BVBA 1MOLA 2CC3A 4EBGA 5AEWB 2IUKA 4XDWA 1VQN3 5KP1A 4N6V0 2Y74A 1CQSA 2ZDJA 4MMXB 5G2GA 3UNLA 5IF6A 1CEWI 2XR8B 3ROBA 4N6UA 4LZIA 2GBXB 2GU3A 3EBTA 4KFEA 2HMMB 1ROVA 3GZBA 3T8UA 1JN5A 1CYVA 3MWZA 1GS3A 4G1MB 5BXQA 4H61A 3EX9A 3QRDA 1VQ83 2GBWB 5IENA 4H3UA 1IU7A 3CU3A 3VSYA 3DZLA 3N8BA 3V98A 2OQEC 4KZ1A 2CFDA 1FGRA 2XSOB 4FCZA 3NBJA 4L8PA 2CW9A 1N9EA 2Z7AA 4L8OA 3STDA 1T5YA 5AIIA 1GY6A 2XFTA 2XRXB 1DMQA 1VQK3 1Q814 5DRVA 1IVUA 3T8NA 1WTHA 2QIYA 4N6LA 3CCR3 3JUOA 3FG4A 4XM4A 1IV9A 4O3VA 2WGQA 2B24B 2YX9A 3CMA3 2CFWA 1G96A 1Q864 3H3HA 5CF1A 3PCRA 1FA3A 2RFRA 3JUMA 3NUVA 1IK3A 3KE7A 4U13A 1S723 3PYJA 2Y73A 1JNQA 5D81A 2QGUA 3NXJA 4HM6B 1VQL3 3IMAB 3EJVA 4K61A 3F9SA 3MPHA 1OCVA 2PZVA 1TFKA 4NHFA 3G6E3 3K0ZA 2C11A 3F8HA 1E3RA 1KD14 5AIGA 1IV7A 1EG9B 2HMKB 4EXRA 5ELUA 2C10A 3RGRA 1YHQ3 5JPUA 1PU4A 3GZXB 3Q1CA 3ALAA 4FR9A 1K28A 3G0KA 1M904 1NWWA 1N5PA 3G8ZA 1O7WB 3NQYA 5LC7A 4ZM8A 1JKGA 1N5HA 4K1UA 3ER7A 3CME3 3KFQC 3FG1A 3SX1A 4EC6A 2HMLB 3HX8A 2F86B 3JUNA 1O7HB 2W56B 4HYZA 1JB2A 1RRLA 2P0MA 3FGYA 4Q53A 3OW22 5IEOA 6STDA 1K8A4 3SXXA 1OUNA 1O7NB 3FH1A 1PFPA 1W6CA 1W2ZA 1IVWA 2YFJB 4L7KA 1IQYA 4J8TA 1AVKA 2P05A 3CCM3 3FKAA 4HZ9B 1W4NA 1OHSA 4O02B 1ISKA 3HI7A 2A15A 1TU5A 1IT8A 1SIIA 5IEPA 1YJW3 1A2KA 2W04A 3GAXA 3M8CA 4MMYB 3TDGA 2RGQA 2WO0A 3LTCA 7STDA 1AVLA 1W5ZA 3PZWA 2XH9A 3NV0B 4RZMA 3L0RA 2OWPA 3PGBA 2CG0A 3CC23 2WOHA 3AMOB 4RNYA 3NM2A 3CNMA 4KFDA 1LVNA 3WMDA 1A2VA 1STFI 1IVVA 1D6ZA 3N9HA 2GU1A 2BT3A 1W02A 2CFKA 3DGLA 2E2VA 3NQZA 4OUQA 3G4S3 1J2BA 2CFLA 3WA2X 2QA43 1QAFA 3H51A 1IDPA 2D42A 1NJI4 1NO3A 1VQP3 2UX0A 3MG2A 4TX4A 1ASKA 2F98A 3X3XA 4IPBA 4CDLA 4WP5A 3OV4A 3NX0A 3J7Yd 4N3VA 1M9GA 2BMRB 4BTYA 3UL5A 3PCSA 1V74A 1OGZA 3JVCA 2CG1A 1CYUA 2QEX3 2E2TA 1D6YA 4HM4B 4BTWA 2JDIH 4WFOA 1Q40B 1Q7Y4 3CCU3 4WYKA 1A67A 2PNCA 3WODG 4JF8A 2XGNA 3KSPA 3X40A 1US1A 4LSOA 4MEIA 1EA2A 2BMOB 1R4CA 1NB3I 2XF3A 2WOFA 3EQQB 3PXMA 5CF2A 3WOFB 3I0YA 3NBRA 4MJDA 4K1VA 3K9MC 3DY5A 2D1WA 4FMAA 4AEQA 1UUWB 3CPW2 1ULIB 1K9M4 1FGOA 3E99A 1STDA 2O9UX 1D6UA 3ECFA 3X3ZA 3CXC2 1DVCA 1W2B2 3SEDA 4HZBB 1VZZA 5ELJA 1DMNA 2JQ5A 3B4PA 5LC6A 4LGQA 5CXOA 4ORLA 3GZRA 1IVXA 2OQEA 4MMZB 4HBRA 2OTJ3 3RDEA 3WA3A 4HM8B 3T0UA 1OF5B 4R9KA 3D9RA 1QVG2 2L4VA 1ULJB 1UUVB 3N54B 1Y4KA 1O7GB 3SVAA 2OCTA 2GEYA 3LXUX 1DYUA 1N9JA 2W9QA 3LT8A 5D82A 1FGQA 5EEOA 5TGNA 3MYTA 3F40A 2XFSA 4R4KA 2IMJA 4WHAA 2CK3H 4O8SA 3NV0A 1UI8A 2OTL3 2KXGA 4LMIA 4GB5A 2P38A 1UW1A 1BUQA 3LTBA 4K90B 1O7PB 3WDGB 3F7XA 2BHMA 2XGLA 2E2UA 2MC8A 5AI1A 3S29A 1QJGA 5KP4A 3BNEA 3SLUA 2RSXA 3OXAA 5AIFA 4EV5A 1E97A 1W6GA 4XDVA 1VQM3 1K734 1TFOA 3G16A 3CD63 3SOYA 3HIGA 2GXFA 5EQLA 2INXA 5I97A 2OOVC 1A90A 2P09A 2O3OA 4X2OA 1VQ53 1IT7A 3Q2PA 3B8LA 3BNCA 5CK6A 4FMCA 4OVMA 3NBBA 3EF8A 1KSIA 3BNDA 1GYBA 3LOYA 5D83A 3OWYA 3LH4A 3B7CA 4PEJA 5IW9A 1YIJ3 1W01A 2K0MA 3FG3A 3V92A 1VQ43 1TIJA 1VQO3 2W2CA 3JUQA 1NDOB 3B4OA 1RN7A 3V99A 1W7CA 3OX9A 2CH9A 1QMAA 3MHEA 3HK4A 4N6TA 2WGOA 3QK9A 2LYXA 3FF0A 3VGNA 3K7CA 1QALA 3CNXA 4GL6A 5EVHA 5JBSA 4RNZA 3K5TA 1U5OA 5CLKA 4R80A 5JPPA 3EN1B 3DUKA 5AEUB 2BMQB 2Z76A 2SBLA 2CWTA 3IJEB 3MSOA 1JB4A 1IQ8A 1WMOA 3EHCA 1TP6A 3FSDA 4LEHA 1ZX2A 1N8R4 3FZWA 4FCMA 5IG0A 4HM0B 4WWUC 3UL6A 3I553 4N6MA 3WOEB 4R1KA 3NHXA 1DMMA 5KP3A 2YFLB 1GY5A 1KC84 1OGXA 2F99A 4N6NB 1E3VA 1QAKA 2ZL8A 5STDA 1Z1SA 1JKGB 2CWVA 3KIIA 3SOAA 4EYCA 1L5GB 1YVBI 3MG1A 3LYGA 1SPUA 3CC73 1KWIA 2BNGA 1OPYA 2FNQA 2Q07A 2ML6A 2W03A 1JB5A 4XB5A 3KZTA 5FGOA 1QVF2 3S5CA 5IERA 4HKVB 1RKYA 1W00A 5IG3A 3EC9A 3DGOA 1WMNA 4HM2B 3CCV3 3HIIA 4AKZA 1FUWA 4XBXA 3S28A 3DMCA 1DVDA 4HM3B 1AR0A 3F8XA 1FGTA 2B1XB 2YFIB 3S67A 3LTAA 4STDA 1O7MB 5AYSC 1VQ63 1S5AA 2XEPA 4OK0A 5AIHA 2W56A 2HMNB 3X3YA 2P0XA 1F8NA 2K54A 1C7HA 1TUHA 4IT7A 3IPTA 4RBNA 1VQ73 3CC43 4CCVA 3CCS3 1EKMA 3F14A 1OHOA 2KRTA 2ML5A 1SIHA 1KQS2 2R4IA 3CCL3 3U97A 2CFGA 1YIT3 1LOXA 3KSED 2CKFB 4EV2A 1VQ93 1K41A 3LTDA 1OH0A 3X41A 3HZPA 3GRDA 3NM7A 1LNHA 4HVNA 1YGEA 3AMOA 4J9AA 2W6JH 4R9LA 3VF1A 3F7SA 4KVHA 3GWRA 2RCDA 3PS8A 5A0OB 1WMPA 2I9WA 2MF7A 2STDA 1JN5B 1FGMA 1N8QA 1EQKA 4NREA 4WYKB 3FCSB 1OACA 1WQLB 1NB5I 4FMBA 1GY7A 3X42A 4HM7B 4QWTA 3DGNA 4N6OB 5FW5A 3LT9A 1IQXA 3EB8A 1M1K4 3UB1A 4JRFA 1NU3A 5DREA 1WNHA 1SJWA 3D3LA 3CCE3 3CCJ3 3DXOA 3S27A 3RGAA 3BLZA 1JJ22 4HM5B 3LZAA 1Q40A 1OHPA 3CPOA 5IG5A 1SQWA 1Q824 3G713 2CIUA 8CHOA 2FGTA 2OOVA 4HJLB 1ZO2A 1GD4A 1JRQA 2GEXA 5HGRA 2CWUA 4O2HA 2HMOB 4FCJA 3MG3A 2W9PA 1RJOA 3DM8A 4FMDA 4AKYA 3BNBA 5AYRB 1AV4A 3MKIA 2W0QA 4I4KA 1HKXA 3UJMA 1MNLA 1Q42A 2FXTA 3BB9A 1M1XB 3KN4A 3OWSA 1YJ93 3EBYA 1W6YA 3K63A 2HMJB 4XBTA 1YJN3 3OWUA 3JUPA 2LQVA 1GD3A 3CCQ3 3A76A 2XSHB 1LXEA 5IG4A 3I563 4BTXA 1OF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKG A;  4IIA A;  3FF2 A;  3GZY B;  2Z77 A;  2CHC A;  3EN8 A;  3Q90 A;  4XBY A;  4HM1 B;  3FLJ A;  4X2H A;  5BVB A;  5AEW B;  4XDW A;  5KP1 A;  1CQS A;  3UNL A;  5IF6 A;  5G2G A;  2XR8 B;  3ROB A;  2GBX B;  3EBT A;  2HMM B;  3GZB A;  3T8U A;  1JN5 A;  1GS3 A;  5BXQ A;  3EX9 A;  2GBW B;  5IEN A;  4H3U A;  3CU3 A;  3VSY A;  3DZL A;  2XSO B;  4L8P A;  2Z7A A;  4L8O A;  3STD A;  5AII A;  1GY6 A;  2XRX B;  1DMQ A;  5DRV A;  3T8N A;  2QIY A;  3JUO A;  4XM4 A;  2B24 B;  3H3H A;  5CF1 A;  2RFR A;  3JUM A;  3NUV A;  3KE7 A;  4U13 A;  5D81 A;  3NXJ A;  2QGU A;  4HM6 B;  3EJV A;  3F9S A;  1OCV A;  2PZV A;  3K0Z A;  3F8H A;  1E3R A;  5AIG A;  1EG9 B;  2HMK B;  3RGR A;  5JPU A;  3GZX B;  3G0K A;  1NWW A;  3G8Z A;  1O7W B;  1JKG A;  4K1U A;  3ER7 A;  2HML B;  3HX8 A;  2F86 B;  3JUN A;  1O7H B;  1JB2 A;  3FGY A;  4Q53 A;  5IEO A;  6STD A;  1OUN A;  1O7N B;  3FH1 A;  2YFJ B;  4L7K A;  4J8T A;  3FKA A;  4HZ9 B;  1OHS A;  1ISK A;  2A15 A;  5IEP A;  1A2K A;  3M8C A;  2RGQ A;  7STD A;  3NV0 B;  4RZM A;  2OWP A;  3NM2 A;  3CNM A;  3WMD A;  1W02 A;  4OUQ A;  3H51 A;  1IDP A;  2UX0 A;  3MG2 A;  1ASK A;  2F98 A;  4CDL A;  4WP5 A;  3OV4 A;  4N3V A;  2BMR B;  1OGZ A;  4HM4 B;  1Q40 B;  4WYK A;  3KSP A;  1EA2 A;  2BMO B;  3EQQ B;  5CF2 A;  3I0Y A;  3NBR A;  4MJD A;  4K1V A;  1UUW B;  1ULI B;  3E99 A;  1STD A;  3ECF A;  3SED A;  4HZB B;  1VZZ A;  1DMN A;  2JQ5 A;  3B4P A;  4LGQ A;  5CXO A;  4ORL A;  3GZR A;  4HM8 B;  1OF5 B;  4R9K A;  3D9R A;  1ULJ B;  1UUV B;  1O7G B;  2GEY A;  5D82 A;  5TGN A;  3MYT A;  3F40 A;  2IMJ A;  3NV0 A;  4LMI A;  4GB5 A;  1BUQ A;  1O7P B;  3F7X A;  5AI1 A;  1QJG A;  5KP4 A;  3OXA A;  5AIF A;  1E97 A;  4XDV A;  3G16 A;  3SOY A;  2GXF A;  2INX A;  4X2O A;  3B8L A;  5CK6 A;  4OVM A;  3EF8 A;  1GYB A;  5D83 A;  3OWY A;  3B7C A;  4PEJ A;  1W01 A;  2W2C A;  3JUQ A;  1NDO B;  3B4O A;  3OX9 A;  1QMA A;  3MHE A;  3HK4 A;  3FF0 A;  3VGN A;  3K7C A;  3CNX A;  5EVH A;  5CLK A;  1U5O A;  5JPP A;  3EN1 B;  3DUK A;  5AEU B;  2BMQ B;  2Z76 A;  3MSO A;  1JB4 A;  3EHC A;  1TP6 A;  3FSD A;  4LEH A;  1ZX2 A;  3FZW A;  4FCM A;  5IG0 A;  4HM0 B;  4WWU C;  4R1K A;  3NHX A;  1DMM A;  5KP3 A;  2YFL B;  1GY5 A;  1OGX A;  2F99 A;  1E3V A;  5STD A;  1Z1S A;  1JKG B;  3SOA A;  3MG1 A;  3LYG A;  2BNG A;  1OPY A;  1JB5 A;  4XB5 A;  3KZT A;  3S5C A;  5IER A;  4HKV B;  1W00 A;  5IG3 A;  3EC9 A;  4HM2 B;  4XBX A;  3DMC A;  4HM3 B;  1AR0 A;  3F8X A;  2B1X B;  2YFI B;  4STD A;  1O7M B;  1S5A A;  5AIH A;  2HMN B;  2K54 A;  1C7H A;  1TUH A;  3IPT A;  3F14 A;  1OHO A;  2R4I A;  2CKF B;  1K41 A;  1OH0 A;  3HZP A;  3GRD A;  4HVN A;  4J9A A;  4R9L A;  3F7S A;  4KVH A;  3GWR A;  2RCD A;  2I9W A;  2STD A;  1JN5 B;  4WYK B;  1WQL B;  1GY7 A;  4HM7 B;  5FW5 A;  1NU3 A;  5DRE A;  1SJW A;  3DXO A;  3RGA A;  3BLZ A;  4HM5 B;  3LZA A;  1Q40 A;  1OHP A;  3CPO A;  5IG5 A;  8CHO A;  4HJL B;  1ZO2 A;  2GEX A;  5HGR A;  2HMO B;  4FCJ A;  3MG3 A;  3DM8 A;  3MKI A;  4I4K A;  1HKX A;  3UJM A;  1Q42 A;  3BB9 A;  3OWS A;  3EBY A;  1W6Y A;  2HMJ B;  4XBT A;  3OWU A;  3JUP A;  3A76 A;  2XSH B;  5IG4 A;  1OF5 A; 
#chains in the Genus database with same CATH topology
 2M7O A;  1RLS A;  1CH0 A;  3KKG A;  1MWR A;  1HU9 A;  4KFF A;  1YI2 3;  1BNE A;  1JV2 B;  2Z6B A;  4IIA A;  3LML A;  1BNI A;  3FF2 A;  1ROA A;  1RRH A;  2IA7 A;  3GZY B;  2Z77 A;  1UI7 A;  2BO9 B;  2KCD A;  2KF4 A;  1LOY A;  2CHC A;  2V1L A;  1U8C B;  3EN8 A;  3O8Y A;  3Q90 A;  2UUG C;  3DGM A;  3DH2 A;  4HM1 B;  2BIR A;  1BU4 A;  4XBY A;  3FLJ A;  4X2H A;  3U1W A;  1BNR A;  3EE1 A;  2IUJ A;  5BVB A;  1I2F A;  1MOL A;  2C4B A;  2CC3 A;  4EBG A;  1BNS A;  5AEW B;  2IUK A;  1RNT A;  1BSC A;  5M18 A;  4XDW A;  1VQN 3;  5KP1 A;  1I3F A;  4N6V 0;  2Y74 A;  3Q3F A;  1UCL A;  1CQS A;  2ZDJ A;  4MMX B;  5G2G A;  3UNL A;  5IF6 A;  1CEW I;  3SYU A;  2XR8 B;  3ROB A;  4N6U A;  1RTU A;  4LZI A;  2GBX B;  2GU3 A;  3EBT A;  4KFE A;  2HMM B;  1ROV A;  3GZB A;  3T8U A;  1JN5 A;  1CYV A;  1YNV X;  1GS3 A;  3MWZ A;  4G1M B;  4H61 A;  3EX9 A;  1YGW A;  3QRD A;  5BXQ A;  1VQ8 3;  2GBW B;  5IEN A;  4H3U A;  1IU7 A;  3CU3 A;  3VSY A;  3DZL A;  3N8B A;  3V98 A;  2OQE C;  4KZ1 A;  2CFD A;  7GSP A;  1FGR A;  4HAA A;  2XSO B;  4FCZ A;  3NBJ A;  4L8P A;  2CW9 A;  1N9E A;  2Z7A A;  4L8O A;  3STD A;  2RNT A;  1T5Y A;  5AII A;  1RDS A;  2KF3 A;  1GY6 A;  2XFT A;  2XRX B;  1BSE A;  1DMQ A;  1VQK 3;  1Q81 4;  3BU4 A;  5DRV A;  1IVU A;  1GSP A;  2BU4 A;  3T8N A;  1WTH A;  2CX1 A;  3D4A A;  2QIY A;  5RNT A;  4N6L A;  3D79 A;  3CCR 3;  3JUO A;  2F4Y A;  1DE3 A;  4EW5 A;  3FG4 A;  4XM4 A;  1IV9 A;  1ZGX A;  4O3V A;  2WGQ A;  2B24 B;  2YX9 A;  3CMA 3;  2CFW A;  6GSP A;  1G96 A;  1Q86 4;  3H3H A;  5CF1 A;  3PCR A;  1FA3 A;  2RFR A;  3JUM A;  3NUV A;  1IK3 A;  1I3I A;  3KE7 A;  4U13 A;  1S72 3;  3PYJ A;  2Y73 A;  1JNQ A;  5D81 A;  1I0V A;  2QGU A;  3NXJ A;  1BVI A;  4HM6 B;  3IMA B;  3EJV A;  4K61 A;  1VQL 3;  3F9S A;  3MPH A;  1OCV A;  2PZV A;  1TFK A;  4NHF A;  3G6E 3;  2KF5 A;  3K0Z A;  2C11 A;  3F8H A;  1E3R A;  1KD1 4;  5AIG A;  1IV7 A;  1EG9 B;  2HMK B;  1PYL A;  4EXR A;  5ELU A;  2C10 A;  3RGR A;  1YHQ 3;  5JPU A;  1PU4 A;  1LNI A;  1LOV A;  3GZX B;  3Q1C A;  3ALA A;  4FR9 A;  1K28 A;  3G0K A;  1M90 4;  1NWW A;  1N5P A;  3G8Z A;  1R4Y A;  1B2M A;  1FUS A;  1O7W B;  3NQY A;  5LC7 A;  4ZM8 A;  1JKG A;  1N5H A;  4K1U A;  3ER7 A;  3CME 3;  3KFQ C;  3FG1 A;  3SX1 A;  4EC6 A;  2HML B;  3HX8 A;  2F86 B;  3JUN A;  1O7H B;  2W56 B;  1X1X A;  4HYZ A;  3ZG5 A;  1JB2 A;  1RRL A;  2P0M A;  3FGY A;  4Q53 A;  3WHO A;  3OW2 2;  5IEO A;  6STD A;  1K8A 4;  1GOY A;  3SXX A;  1JBT A;  1OUN A;  1O7N B;  3FH1 A;  1PFP A;  1W6C A;  1W2Z A;  2ZA4 A;  1IVW A;  2YFJ B;  4L7K A;  1IQY A;  1X1W A;  4J8T A;  1AVK A;  2P05 A;  3CCM 3;  3FKA A;  4HZ9 B;  1W4N A;  1FW7 A;  1B2Z A;  1OHS A;  4O02 B;  1ISK A;  1RGE A;  3HI7 A;  2A15 A;  1TU5 A;  1IT8 A;  1SII A;  5IEP A;  1B21 A;  1YJW 3;  1A2K A;  2W04 A;  3GAX A;  3M8C A;  4MMY B;  3TDG A;  2RGQ A;  1I0X A;  2WO0 A;  3LTC A;  1EUI C;  7STD A;  1AVL A;  1W5Z A;  3PZW A;  2SAR A;  2XH9 A;  3NV0 B;  4RZM A;  3L0R A;  2OWP A;  3PGB A;  2CG0 A;  3CC2 3;  2WOH A;  3AMO B;  4RNY A;  3NM2 A;  3KCH A;  3CNM A;  4KFD A;  1LVN A;  3WMD A;  1A2V A;  1STF I;  5G1K A;  1IVV A;  1D6Z A;  3N9H A;  1BUJ A;  2GU1 A;  2BT3 A;  1JBS A;  1W02 A;  2CFK A;  3DGL A;  2E2V A;  3NQZ A;  4OUQ A;  3G4S 3;  1BRK A;  1J2B A;  1LRA A;  2CFL A;  1BSA A;  3WA2 X;  2QA4 3;  1QAF A;  3H51 A;  1IDP A;  2D42 A;  4CPK A;  1NO3 A;  1VQP 3;  2UX0 A;  1NJI 4;  3MG2 A;  4TX4 A;  1ASK A;  2F98 A;  3X3X A;  4IPB A;  4CDL A;  4WP5 A;  3OV4 A;  2AAD A;  3NX0 A;  1TRP A;  4GHO A;  4N3V A;  5G1L A;  1BNG A;  3J7Y d;  1JBR A;  1M9G A;  2BMR B;  4BTY A;  2GSP A;  3UL5 A;  3AHS A;  1V74 A;  1OGZ A;  3A5E A;  3JVC A;  3PCS A;  2CG1 A;  1CYU A;  1RGH A;  2QEX 3;  2E2T A;  1D6Y A;  1GMR A;  4HM4 B;  1RMS A;  1HZ1 A;  1UCJ A;  1BSB A;  2KF6 A;  4BTW A;  2JDI H;  4WFO A;  1Q40 B;  1Q7Y 4;  3CCU 3;  4WYK A;  1A67 A;  1BNF A;  1BRG A;  1AY7 A;  2PNC A;  3WOD G;  4JF8 A;  2XGN A;  3KSP A;  3X40 A;  1US1 A;  4LSO A;  4MEI A;  1EA2 A;  1JZD A;  1R4C A;  1NB3 I;  2BMO B;  2F5M A;  2WOF A;  1RN1 A;  2XF3 A;  3EQQ B;  3PXM A;  1BRH A;  4J5G A;  3WOF B;  3I0Y A;  3NBR A;  1C54 A;  1UCK A;  4K1V A;  4MJD A;  1RGF A;  3K9M C;  3DY5 A;  2D1W A;  4FMA A;  4AEQ A;  1B27 A;  1UUW B;  3CPW 2;  1ULI B;  1K9M 4;  5M1A A;  1FGO A;  2F56 A;  3E99 A;  1STD A;  2O9U X;  1D6U A;  3ECF A;  3X3Z A;  6RNT A;  3CXC 2;  1DVC A;  1W2B 2;  2IYJ A;  3SED A;  4HZB B;  1VZZ A;  5ELJ A;  1DMN A;  1A2P A;  2JQ5 A;  3B4P A;  4LGQ A;  5CXO A;  5LC6 A;  1JZO A;  5GSP A;  4ORL A;  3GZR A;  1IVX A;  2OQE A;  4MMZ B;  4HBR A;  2OTJ 3;  3RDE A;  3WA3 A;  4HM8 B;  3T0U A;  1OF5 B;  4R9K A;  1LOW A;  3D9R A;  1QVG 2;  2L4V A;  1ULJ B;  1UUV B;  3N54 B;  1Y4K A;  5BIR A;  1O7G B;  1FYS A;  3SVA A;  2OCT A;  2GEY A;  3LXU X;  1DYU A;  4KT3 B;  1N9J A;  2W9Q A;  3ZG0 A;  3LT8 A;  3DGY A;  1SAR A;  3WR2 A;  5D82 A;  1FGQ A;  5EEO A;  9RNT A;  5TGN A;  3MYT A;  3F40 A;  2XFS A;  4R4K A;  2IMJ A;  4WHA A;  2H0G A;  1GOV A;  2CK3 H;  4O8S A;  3NV0 A;  1RGK A;  1I2G A;  1UI8 A;  1BRS A;  2OTL 3;  2KXG A;  4LMI A;  4GB5 A;  2P38 A;  1UW1 A;  1BUQ A;  3LTB A;  4K90 B;  1O7P B;  1RGC A;  1BRI A;  3WDG B;  3F7X A;  2BHM A;  2XGL A;  2E2U A;  1BRJ A;  2MC8 A;  5AI1 A;  3S29 A;  1QJG A;  5KP4 A;  3BNE A;  4HOH A;  1X1Y A;  2RSX A;  3OXA A;  5AIF A;  3SLU A;  1E97 A;  1ZS7 A;  4EV5 A;  1W6G A;  4XDV A;  1NNV A;  1FUT A;  1VQM 3;  1K73 4;  1TFO A;  3G16 A;  1B2X A;  3CD6 3;  3SOY A;  3ZFZ A;  3HIG A;  4BIR A;  1T3B A;  2GXF A;  5EQL A;  2K3D A;  2INX A;  1I70 A;  5I97 A;  1IYY A;  1UUG B;  2OOV C;  1A90 A;  2P09 A;  2O3O A;  1BOX A;  4X2O A;  1IT7 A;  1VQ5 3;  1T2H A;  3Q2P A;  3B8L A;  3BNC A;  5CK6 A;  4FMC A;  3RNT A;  4OVM A;  3NBB A;  3EF8 A;  1KSI A;  7RNT A;  1BGS A;  3BND A;  1GYB A;  3LOY A;  5D83 A;  3OWY A;  3LH4 A;  3B7C A;  4PEJ A;  5IW9 A;  1YIJ 3;  1W01 A;  2K0M A;  3FG3 A;  3V92 A;  1VQ4 3;  1TIJ A;  1VQO 3;  2W2C A;  3JUQ A;  2CX0 A;  1NDO B;  3B4O A;  1X1U A;  1RN7 A;  3V99 A;  1W7C A;  1GMP A;  3OX9 A;  2CH9 A;  1QMA A;  3MHE A;  3HK4 A;  4N6T A;  2WGO A;  3QK9 A;  2LYX A;  3FF0 A;  3VGN A;  3K7C A;  1QAL A;  2ZHX B;  3CNX A;  4GL6 A;  5EVH A;  5JBS A;  4CJN A;  3GSP A;  3K5T A;  1U5O A;  4RNZ A;  2H0I A;  2J8X B;  4R80 A;  5CLK A;  5JPP A;  1VQQ A;  3EN1 B;  3DUK A;  5AEU B;  1UDI I;  2BMQ B;  2Z76 A;  2SBL A;  2CWT A;  3IJE B;  3MSO A;  1JB4 A;  3D5G A;  1IQ8 A;  1WMO A;  3EHC A;  1TP6 A;  3FSD A;  1FZU A;  4LEH A;  1ZX2 A;  1N8R 4;  3FZW A;  4FCM A;  1UGI A;  4GSP A;  5IG0 A;  1BNJ A;  3AGN A;  4HM0 B;  4LYL B;  4WWU C;  3UL6 A;  3I55 3;  4N6M A;  3WOE B;  4R1K A;  3NHX A;  1DMM A;  5M19 A;  5KP3 A;  2YFL B;  1GY5 A;  1KC8 4;  1OGX A;  1V57 A;  2F99 A;  1MWU A;  4N6N B;  1RGL A;  1E3V A;  1UGH I;  1QAK A;  2ZL8 A;  5STD A;  8RNT A;  1Z1S A;  1JKG B;  2CWV A;  3KII A;  3SOA A;  4EYC A;  1RGA A;  1UCI A;  1YVB I;  2HOH A;  3LYG A;  1SPU A;  3MG1 A;  1L5G B;  3CC7 3;  1KWI A;  1V58 A;  2BNG A;  1OPY A;  3AGO A;  1Q9E A;  2FNQ A;  2Q07 A;  2ML6 A;  2W03 A;  1B3S A;  1JB5 A;  4XB5 A;  1I2E A;  2R41 A;  3KZT A;  1TTO A;  5FGO A;  1QVF 2;  3S5C A;  5IER A;  4HKV B;  1MGW A;  1RKY A;  1W00 A;  1RNB A;  5IG3 A;  3EC9 A;  3DGO A;  1WMN A;  4HM2 B;  3CCV 3;  3HII A;  4AKZ A;  1I8V A;  2RBI A;  1FUW A;  4XBX A;  3S28 A;  3DMC A;  1DVD A;  4HM3 B;  1AR0 A;  3F8X A;  1FGT A;  2B1X B;  2YFI B;  3S67 A;  1BSD A;  3LTA A;  4STD A;  1O7M B;  5AYS C;  1VQ6 3;  1S5A A;  2XEP A;  1LQM B;  2AAE A;  4OK0 A;  5AIH A;  1GMQ A;  2W56 A;  1RSN A;  2HMN B;  3X3Y A;  2P0X A;  1F8N A;  1B2U A;  2K54 A;  1C7H A;  5CF2 A;  1RCK A;  1TUH A;  3BIR A;  4IT7 A;  3IPT A;  4RBN A;  1VQ7 3;  3CC4 3;  1RHL A;  4CCV A;  3CCS 3;  1EKM A;  3F14 A;  1OHO A;  1RCL A;  2KRT A;  2ML5 A;  1SIH A;  1KQS 2;  2R4I A;  3CCL 3;  3U97 A;  2CFG A;  1YIT 3;  1LOX A;  3KSE D;  2IY2 A;  2CKF B;  4EV2 A;  1VQ9 3;  1K41 A;  1GOU A;  3LTD A;  1OH0 A;  2H0H A;  3X41 A;  3HZP A;  3GRD A;  3NM7 A;  1LNH A;  4HVN A;  1PY3 A;  1YGE A;  3AMO A;  4J9A A;  4BL2 A;  2L1S A;  2W6J H;  4R9L A;  3VF1 A;  3F7S A;  4KVH A;  3GWR A;  2RCD A;  1RGG A;  3PS8 A;  1NB5 I;  5A0O B;  1WMP A;  2I9W A;  2MF7 A;  2STD A;  1JN5 B;  1FGM A;  1N8Q A;  1EQK A;  4NRE A;  4WYK B;  3FCS B;  1OAC A;  1Q7H A;  1WQL B;  3HOH A;  4FMB A;  1GY7 A;  3X42 A;  1B20 A;  4HM7 B;  3DGN A;  1EEJ A;  4QWT A;  4N6O B;  1G02 A;  5FW5 A;  4BL3 A;  3LT9 A;  1IQX A;  3EB8 A;  1M1K 4;  3UB1 A;  2KAA A;  3URP A;  4JRF A;  1NU3 A;  4NPB A;  5DRE A;  1WNH A;  4DKI A;  1SJW A;  1MWS A;  3D3L A;  3CCE 3;  3CCJ 3;  1DET A;  1HYF A;  3DXO A;  4ILF A;  3S27 A;  3RGA A;  3BLZ A;  4I5Q A;  3D5I A;  1BRN L;  1JJ2 2;  4HM5 B;  3LZA A;  1Q40 A;  1OHP A;  1YVS A;  3CPO A;  5IG5 A;  1SQW A;  1Q82 4;  1MGR A;  5HOH A;  3G71 3;  2CIU A;  8CHO A;  2FGT A;  1BIR A;  4HJL B;  1ZO2 A;  2OOV A;  1BAO A;  1GD4 A;  5BU4 A;  1JRQ A;  3AHW A;  2GEX A;  5HGR A;  1RN4 A;  2CWU A;  4O2H A;  2HMO B;  4FCJ A;  3MG3 A;  1T2I A;  1RJO A;  2W9P A;  3DM8 A;  4FMD A;  1LQG C;  3BNB A;  5AYR B;  4AKY A;  1TJD A;  1AV4 A;  2F5W A;  3MKI A;  1AQZ A;  2W0Q A;  4I4K A;  1TRQ A;  1HKX A;  3UJM A;  1G0T A;  1MNL A;  1Q42 A;  2FXT A;  1MWT A;  4BU4 A;  3BB9 A;  4RNT A;  1M1X B;  3KN4 A;  3OWS A;  1YJ9 3;  3EBY A;  1W6Y A;  3K63 A;  2HMJ B;  4XBT A;  1YJN 3;  3OWU A;  3JUP A;  2LQV A;  1GD3 A;  2UGI A;  4J5K A;  1B2S A;  1BAN A;  2XSH B;  3A76 A;  1LXE A;  3CCQ 3;  5IG4 A;  3I56 3;  4BTX A;  1OF5 A; 
#chains in the Genus database with same CATH homology
 2M7O A;  1YI2 3;  3KKG A;  1HU9 A;  4KFF A;  1JV2 B;  2Z6B A;  4IIA A;  3LML A;  3FF2 A;  1ROA A;  1RRH A;  2IA7 A;  3GZY B;  2Z77 A;  1UI7 A;  2BO9 B;  2KCD A;  2CHC A;  2V1L A;  1U8C B;  3EN8 A;  3O8Y A;  3Q90 A;  4XBY A;  3DGM A;  4HM1 B;  3FLJ A;  4X2H A;  3U1W A;  3EE1 A;  2IUJ A;  5BVB A;  1MOL A;  2CC3 A;  4EBG A;  5AEW B;  2IUK A;  4XDW A;  1VQN 3;  5KP1 A;  4N6V 0;  2Y74 A;  1CQS A;  2ZDJ A;  4MMX B;  5G2G A;  3UNL A;  5IF6 A;  1CEW I;  2XR8 B;  3ROB A;  4N6U A;  4LZI A;  2GBX B;  2GU3 A;  3EBT A;  4KFE A;  2HMM B;  1ROV A;  3GZB A;  3T8U A;  1JN5 A;  1CYV A;  3MWZ A;  1GS3 A;  4G1M B;  5BXQ A;  4H61 A;  3EX9 A;  3QRD A;  1VQ8 3;  2GBW B;  5IEN A;  4H3U A;  1IU7 A;  3CU3 A;  3VSY A;  3DZL A;  3N8B A;  3V98 A;  2OQE C;  4KZ1 A;  2CFD A;  1FGR A;  2XSO B;  4FCZ A;  3NBJ A;  4L8P A;  2CW9 A;  1N9E A;  2Z7A A;  4L8O A;  3STD A;  1T5Y A;  5AII A;  1GY6 A;  2XFT A;  2XRX B;  1DMQ A;  1VQK 3;  1Q81 4;  5DRV A;  1IVU A;  3T8N A;  1WTH A;  2QIY A;  4N6L A;  3CCR 3;  3JUO A;  3FG4 A;  4XM4 A;  1IV9 A;  4O3V A;  2WGQ A;  2B24 B;  2YX9 A;  3CMA 3;  2CFW A;  1G96 A;  1Q86 4;  3H3H A;  5CF1 A;  3PCR A;  1FA3 A;  2RFR A;  3JUM A;  3NUV A;  1IK3 A;  3KE7 A;  4U13 A;  1S72 3;  3PYJ A;  2Y73 A;  1JNQ A;  5D81 A;  2QGU A;  3NXJ A;  4HM6 B;  1VQL 3;  3IMA B;  3EJV A;  4K61 A;  3F9S A;  3MPH A;  1OCV A;  2PZV A;  1TFK A;  4NHF A;  3G6E 3;  3K0Z A;  2C11 A;  3F8H A;  1E3R A;  1KD1 4;  5AIG A;  1IV7 A;  1EG9 B;  2HMK B;  4EXR A;  5ELU A;  2C10 A;  3RGR A;  1YHQ 3;  5JPU A;  1PU4 A;  3GZX B;  3Q1C A;  3ALA A;  4FR9 A;  1K28 A;  3G0K A;  1M90 4;  1NWW A;  1N5P A;  3G8Z A;  1O7W B;  3NQY A;  5LC7 A;  4ZM8 A;  1JKG A;  1N5H A;  4K1U A;  3ER7 A;  3CME 3;  3KFQ C;  3FG1 A;  3SX1 A;  4EC6 A;  2HML B;  3HX8 A;  2F86 B;  3JUN A;  1O7H B;  2W56 B;  4HYZ A;  1JB2 A;  1RRL A;  2P0M A;  3FGY A;  4Q53 A;  3OW2 2;  5IEO A;  6STD A;  1K8A 4;  3SXX A;  1OUN A;  1O7N B;  3FH1 A;  1PFP A;  1W6C A;  1W2Z A;  1IVW A;  2YFJ B;  4L7K A;  1IQY A;  4J8T A;  1AVK A;  2P05 A;  3CCM 3;  3FKA A;  4HZ9 B;  1W4N A;  1OHS A;  4O02 B;  1ISK A;  3HI7 A;  2A15 A;  1TU5 A;  1IT8 A;  1SII A;  5IEP A;  1YJW 3;  1A2K A;  2W04 A;  3GAX A;  3M8C A;  4MMY B;  3TDG A;  2RGQ A;  2WO0 A;  3LTC A;  7STD A;  1AVL A;  1W5Z A;  3PZW A;  2XH9 A;  3NV0 B;  4RZM A;  3L0R A;  2OWP A;  3PGB A;  2CG0 A;  3CC2 3;  2WOH A;  3AMO B;  4RNY A;  3NM2 A;  3CNM A;  4KFD A;  1LVN A;  3WMD A;  1A2V A;  1STF I;  1IVV A;  1D6Z A;  3N9H A;  2GU1 A;  2BT3 A;  1W02 A;  2CFK A;  3DGL A;  2E2V A;  3NQZ A;  4OUQ A;  3G4S 3;  1J2B A;  2CFL A;  3WA2 X;  2QA4 3;  1QAF A;  3H51 A;  1IDP A;  2D42 A;  1NJI 4;  1NO3 A;  1VQP 3;  2UX0 A;  3MG2 A;  4TX4 A;  1ASK A;  2F98 A;  3X3X A;  4IPB A;  4CDL A;  4WP5 A;  3OV4 A;  3NX0 A;  3J7Y d;  4N3V A;  1M9G A;  2BMR B;  4BTY A;  3UL5 A;  3PCS A;  1V74 A;  1OGZ A;  3JVC A;  2CG1 A;  1CYU A;  2QEX 3;  2E2T A;  1D6Y A;  4HM4 B;  4BTW A;  2JDI H;  4WFO A;  1Q40 B;  1Q7Y 4;  3CCU 3;  4WYK A;  1A67 A;  2PNC A;  3WOD G;  4JF8 A;  2XGN A;  3KSP A;  3X40 A;  1US1 A;  4LSO A;  4MEI A;  1EA2 A;  2BMO B;  1R4C A;  1NB3 I;  2XF3 A;  2WOF A;  3EQQ B;  3PXM A;  5CF2 A;  3WOF B;  3I0Y A;  3NBR A;  4MJD A;  4K1V A;  3K9M C;  3DY5 A;  2D1W A;  4FMA A;  4AEQ A;  1UUW B;  3CPW 2;  1ULI B;  1K9M 4;  1FGO A;  3E99 A;  1STD A;  2O9U X;  1D6U A;  3ECF A;  3X3Z A;  3CXC 2;  1DVC A;  1W2B 2;  3SED A;  4HZB B;  1VZZ A;  5ELJ A;  1DMN A;  2JQ5 A;  3B4P A;  5LC6 A;  4LGQ A;  5CXO A;  4ORL A;  3GZR A;  1IVX A;  2OQE A;  4MMZ B;  4HBR A;  2OTJ 3;  3RDE A;  3WA3 A;  4HM8 B;  3T0U A;  1OF5 B;  4R9K A;  3D9R A;  1QVG 2;  2L4V A;  1ULJ B;  1UUV B;  3N54 B;  1Y4K A;  1O7G B;  3SVA A;  2OCT A;  2GEY A;  3LXU X;  1DYU A;  1N9J A;  2W9Q A;  3LT8 A;  5D82 A;  1FGQ A;  5EEO A;  5TGN A;  3MYT A;  3F40 A;  2XFS A;  4R4K A;  2IMJ A;  4WHA A;  2CK3 H;  4O8S A;  3NV0 A;  1UI8 A;  2OTL 3;  2KXG A;  4LMI A;  4GB5 A;  2P38 A;  1UW1 A;  1BUQ A;  3LTB A;  4K90 B;  1O7P B;  3WDG B;  3F7X A;  2BHM A;  2XGL A;  2E2U A;  2MC8 A;  5AI1 A;  3S29 A;  1QJG A;  5KP4 A;  3BNE A;  3SLU A;  2RSX A;  3OXA A;  5AIF A;  4EV5 A;  1E97 A;  1W6G A;  4XDV A;  1VQM 3;  1K73 4;  1TFO A;  3G16 A;  3CD6 3;  3SOY A;  3HIG A;  2GXF A;  5EQL A;  2INX A;  5I97 A;  2OOV C;  1A90 A;  2P09 A;  2O3O A;  4X2O A;  1VQ5 3;  1IT7 A;  3Q2P A;  3B8L A;  3BNC A;  5CK6 A;  4FMC A;  4OVM A;  3NBB A;  3EF8 A;  1KSI A;  3BND A;  1GYB A;  3LOY A;  5D83 A;  3OWY A;  3LH4 A;  3B7C A;  4PEJ A;  5IW9 A;  1YIJ 3;  1W01 A;  2K0M A;  3FG3 A;  3V92 A;  1VQ4 3;  1TIJ A;  1VQO 3;  2W2C A;  3JUQ A;  1NDO B;  3B4O A;  1RN7 A;  3V99 A;  1W7C A;  3OX9 A;  2CH9 A;  1QMA A;  3MHE A;  3HK4 A;  4N6T A;  2WGO A;  3QK9 A;  2LYX A;  3FF0 A;  3VGN A;  3K7C A;  1QAL A;  3CNX A;  4GL6 A;  5EVH A;  5JBS A;  4RNZ A;  3K5T A;  1U5O A;  5CLK A;  4R80 A;  5JPP A;  3EN1 B;  3DUK A;  5AEU B;  2BMQ B;  2Z76 A;  2SBL A;  2CWT A;  3IJE B;  3MSO A;  1JB4 A;  1IQ8 A;  1WMO A;  3EHC A;  1TP6 A;  3FSD A;  4LEH A;  1ZX2 A;  1N8R 4;  3FZW A;  4FCM A;  5IG0 A;  4HM0 B;  4WWU C;  3UL6 A;  3I55 3;  4N6M A;  3WOE B;  4R1K A;  3NHX A;  1DMM A;  5KP3 A;  2YFL B;  1GY5 A;  1KC8 4;  1OGX A;  2F99 A;  4N6N B;  1E3V A;  1QAK A;  2ZL8 A;  5STD A;  1Z1S A;  1JKG B;  2CWV A;  3KII A;  3SOA A;  4EYC A;  1L5G B;  1YVB I;  3MG1 A;  3LYG A;  1SPU A;  3CC7 3;  1KWI A;  2BNG A;  1OPY A;  2FNQ A;  2Q07 A;  2ML6 A;  2W03 A;  1JB5 A;  4XB5 A;  3KZT A;  5FGO A;  1QVF 2;  3S5C A;  5IER A;  4HKV B;  1RKY A;  1W00 A;  5IG3 A;  3EC9 A;  3DGO A;  1WMN A;  4HM2 B;  3CCV 3;  3HII A;  4AKZ A;  1FUW A;  4XBX A;  3S28 A;  3DMC A;  1DVD A;  4HM3 B;  1AR0 A;  3F8X A;  1FGT A;  2B1X B;  2YFI B;  3S67 A;  3LTA A;  4STD A;  1O7M B;  5AYS C;  1VQ6 3;  1S5A A;  2XEP A;  4OK0 A;  5AIH A;  2W56 A;  2HMN B;  3X3Y A;  2P0X A;  1F8N A;  2K54 A;  1C7H A;  1TUH A;  4IT7 A;  3IPT A;  4RBN A;  1VQ7 3;  3CC4 3;  4CCV A;  3CCS 3;  1EKM A;  3F14 A;  1OHO A;  2KRT A;  2ML5 A;  1SIH A;  1KQS 2;  2R4I A;  3CCL 3;  3U97 A;  2CFG A;  1YIT 3;  1LOX A;  3KSE D;  2CKF B;  4EV2 A;  1VQ9 3;  1K41 A;  3LTD A;  1OH0 A;  3X41 A;  3HZP A;  3GRD A;  3NM7 A;  1LNH A;  4HVN A;  1YGE A;  3AMO A;  4J9A A;  2W6J H;  4R9L A;  3VF1 A;  3F7S A;  4KVH A;  3GWR A;  2RCD A;  3PS8 A;  5A0O B;  1WMP A;  2I9W A;  2MF7 A;  2STD A;  1JN5 B;  1FGM A;  1N8Q A;  1EQK A;  4NRE A;  4WYK B;  3FCS B;  1OAC A;  1WQL B;  1NB5 I;  4FMB A;  1GY7 A;  3X42 A;  4HM7 B;  4QWT A;  3DGN A;  4N6O B;  5FW5 A;  3LT9 A;  1IQX A;  3EB8 A;  1M1K 4;  3UB1 A;  4JRF A;  1NU3 A;  5DRE A;  1WNH A;  1SJW A;  3D3L A;  3CCE 3;  3CCJ 3;  3DXO A;  3S27 A;  3RGA A;  3BLZ A;  1JJ2 2;  4HM5 B;  3LZA A;  1Q40 A;  1OHP A;  3CPO A;  5IG5 A;  1SQW A;  1Q82 4;  3G71 3;  2CIU A;  8CHO A;  2FGT A;  2OOV A;  4HJL B;  1ZO2 A;  1GD4 A;  1JRQ A;  2GEX A;  5HGR A;  2CWU A;  4O2H A;  2HMO B;  4FCJ A;  3MG3 A;  2W9P A;  1RJO A;  3DM8 A;  4FMD A;  4AKY A;  3BNB A;  5AYR B;  1AV4 A;  3MKI A;  2W0Q A;  4I4K A;  1HKX A;  3UJM A;  1MNL A;  1Q42 A;  2FXT A;  3BB9 A;  1M1X B;  3KN4 A;  3OWS A;  1YJ9 3;  3EBY A;  1W6Y A;  3K63 A;  2HMJ B;  4XBT A;  1YJN 3;  3OWU A;  3JUP A;  2LQV A;  1GD3 A;  3CCQ 3;  3A76 A;  2XSH B;  1LXE A;  5IG4 A;  3I56 3;  4BTX A;  1OF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...