4STDA

High resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological ph
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalone dehydratase
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
total genus 46
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4stdA00
4IIAA 1W01A 3GRDA 3OWYA 1CQSA 3NM2A 3JUMA 4FCJA 5IG0A 3MG1A 1DMQA 3KKGA 3FGYA 2B24B 5CF1A 1Q40B 3JUPA 2RCDA 1A2KA 1IDPA 2PZVA 2A15A 2BMRB 2HMLB 3G0KA 3CNMA 2GBWB 3MG3A 3EQQB 3BB9A 3EX9A 3K0ZA 3SOYA 4U13A 5AIIA 4HM3B 5FW5A 5IENA 1OPYA 4HM5B 2R4IA 3BLZA 3A76A 3EN1B 3CPOA 1QJGA 1O7PB 3NXJA 3GWRA 1TUHA 1AR0A 2JQ5A 1WQLB 3F7SA 1Q40A 2IMJA 1OHOA 1UUVB 2HMOB 5KP4A 1OHPA 2STDA 5AIFA 2F86B 1U5OA 1O7MB 1OHSA 3EBTA 2F98A 3SEDA 1E3VA 4K1UA 5EVHA 4MJDA 2YFJB 1O7GB 1JB2A 3JUNA 1Z1SA 4X2OA 4WYKB 4HKVB 3T8UA 4XM4A 3WMDA 3NBRA 3DZLA 3EHCA 4K1VA 3GZRA 4HZBB 5CXOA 1JN5A 2K54A 4OVMA 1JB5A 5D82A 2GEXA 5G2GA 4H3UA 4HM4B 3F9SA 4XBTA 3HK4A 4HVNA 3ECFA 5IEOA 3G16A 3EBYA 3IPTA 3H3HA 3B4OA 4XDVA 2HMJB 3FSDA 3OV4A 2YFLB 2QGUA 3STDA 2CKFB 3FLJA 3OXAA 4HM1B 2OWPA 1S5AA 5AEWB 2HMMB 3LYGA 4R9KA 4WYKA 4LGQA 4HM2B 4J8TA 5HGRA 4LMIA 2Z77A 4KVHA 3MSOA 1OGZA 5CLKA 4R9LA 3D9RA 3NV0B 5DRVA 3EN8A 1OCVA 2W2CA 1O7NB 4RZMA 2RFRA 3MKIA 5CK6A 3KZTA 1DMNA 3DM8A 4ORLA 3FH1A 3CNXA 3S5CA 1JN5B 1SJWA 1DMMA 1Q42A 1OH0A 3UNLA 3KSPA 3DUKA 4XDWA 3JUQA 1O7HB 2BMOB 2XSOB 4HJLB 4R1KA 3FKAA 1GY7A 4HZ9B 3B7CA 1E97A 3GZYB 2I9WA 3DMCA 4HM0B 4PEJA 1JKGB 1JB4A 1W00A 3RGAA 3FF2A 4I4KA 4OUQA 3UJMA 4J9AA 5CF2A 3NV0A 5IEPA 1OUNA 4N3VA 5JPUA 3G8ZA 1ZO2A 2XSHB 4GB5A 7STDA 3F40A 1OF5B 3HX8A 3GZXB 3I0YA 2QIYA 3VSYA 3OWSA 3E99A 3SOAA 4FCMA 5DREA 1ZX2A 1BUQA 1VZZA 3GZBA 1EG9B 5KP3A 3OWUA 4WP5A 3B4PA 3MG2A 3RGRA 1GY5A 5AEUB 1JKGA 3M8CA 1C7HA 3K7CA 4WWUC 2YFIB 1QMAA 1OF5A 3H51A 4STDA 4CDLA 5JPPA 3T8NA 4L7KA 3ROBA 1W6YA 3CU3A 1ULIB 5IG5A 3F7XA 1NU3A 1NDOB 3F14A 3LZAA 1ULJB 5STDA 5D83A 1GY6A 1OGXA 5TGNA 1STDA 1O7WB 3OX9A 2XR8B 3JUOA 3EF8A 1UUWB 4L8OA 2Z7AA 2RGQA 5IERA 2HMKB 2INXA 4XBYA 4XB5A 5D81A 2GEYA 2B1XB 1TP6A 4L8PA 2F99A 4LEHA 1EA2A 3NUVA 2XRXB 4HM7B 5IG4A 1HKXA 3Q90A 5IG3A 3DXOA 2Z76A 3B8LA 5AIHA 5IF6A 3MYTA 3NHXA 5BVBA 3EC9A 3KE7A 4X2HA 8CHOA 2UX0A 1ISKA 2CHCA 2BMQB 5KP1A 1ASKA 3EJVA 4HM8B 3FZWA 3HZPA 3F8XA 2GXFA 5AIGA 2BNGA 3ER7A 3MHEA 6STDA 4XBXA 1NWWA 1E3RA 4HM6B 2HMNB 5BXQA 5AI1A 3FF0A 1GYBA 2GBXB 3VGNA 1GS3A 3F8HA 1K41A 1W02A 4Q53A
chains in the Genus database with same CATH superfamily
1RGHA 3FG3A 1SIHA 1W01A 3GAXA 4IIAA 3GRDA 3UL5A 3OWYA 2Z6BA 5AYRB 1CQSA 3NM2A 4I5QA 2RBIA 1LRAA 3JUMA 3RDEA 2CW9A 1EQKA 1V74A 4FCJA 4N6OB 1A2VA 1RKYA 3CCM3 2KF6A 4EXRA 5IG0A 2CFDA 1VQL3 3MG1A 1JBSA 1DMQA 1PFPA 3KKGA 1EUIC 1GSPA 3FGYA 3K63A 3LTBA 1T2HA 1WMOA 3HIIA 3SX1A 3CCQ3 1BSEA 2B24B 5CF1A 1Q40B 1RGLA 3PXMA 3JUPA 1HYFA 2CX0A 2RCDA 2H0HA 3S28A 2XGLA 2QEX3 1S723 4R4KA 1A2KA 2W04A 3HI7A 1IDPA 1BRIA 4HOHA 2PZVA 1RJOA 2CWUA 2A15A 2BMRB 3JVCA 2HMLB 3G0KA 1ROAA 2C11A 2LQVA 3DH2A 3CNMA 3DY5A 2OQEA 2GBWB 2CH9A 3MG3A 3EQQB 1SPUA 1FW7A 3BB9A 3EX9A 1I2EA 3K0ZA 2CWVA 2IUKA 2YX9A 1RTUA 4U13A 1AQZA 5AIIA 3SOYA 5LC7A 3AGNA 4FMBA 4HM3B 5FW5A 5IENA 4HAAA 1GMPA 1IVWA 1M9GA 1OPYA 3CXC2 1I8VA 1DVCA 1RMSA 4HM5B 4JF8A 1A67A 1KC84 1WMNA 2R4IA 1VQM3 1Q7HA 3BLZA 1RGGA 5ELUA 1BAOA 2KXGA 2ML6A 3ZG5A 3A76A 3EN1B 1Q824 3CPOA 5I97A 1W4NA 1X1WA 1QJGA 1UGIA 4FMCA 1O7PB 1B2UA 1FGTA 1TRPA 3DGNA 4IPBA 2AADA 4H61A 2D1WA 3NXJA 1NNVA 2CIUA 3GWRA 3LTAA 5HOHA 2L4VA 1TUHA 1AR0A 3RNTA 2JQ5A 1FUTA 1N5HA 1N5PA 1K28A 1WQLB 1BANA 1TRQA 1Q40A 3F7SA 2SBLA 3HIGA 3SXXA 1VQ63 4CCVA 2IMJA 1TJDA 1OHOA 1A90A 1UUVB 1FUSA 2F5WA 1I2FA 3BNCA 3IJEB 2HMOB 3WOFB 2BU4A 1OHPA 5KP4A 3ZFZA 1Q9EA 2STDA 1U8CB 2CFLA 2F86B 5AIFA 1BNIA 1U5OA 9RNTA 1JRQA 3X3ZA 1AY7A 1R4CA 1O7MB 3DGLA 1VQ43 1BNGA 1OHSA 1FGOA 3LH4A 3EBTA 2F98A 1BNJA 1E3VA 3PYJA 4K1UA 3BNDA 1W6CA 3SEDA 5EVHA 3CMA3 2AAEA 1GD3A 4Q53A 1LVNA 4MJDA 2YFJB 1VQQA 5EEOA 1O7GB 2P38A 3SLUA 1JB2A 2W6JH 3JUNA 1IV7A 4FR9A 2C10A 2ML5A 3D3LA 1Z1SA 4X2OA 1W2ZA 4WYKB 1I70A 1FGRA 4HKVB 4XM4A 1FGQA 3T8UA 3WMDA 2KF5A 3NBRA 3DZLA 3EHCA 4K1VA 4BTYA 1UI7A 3CC73 1BNRA 3GZRA 2W56B 1IT7A 3S29A 1RDSA 2ZHXB 1K734 1DVDA 5IW9A 4HZBB 1I3FA 4MEIA 5CXOA 3NX0A 1JN5A 2K54A 2W0QA 3K5TA 4OVMA 1MGRA 1JB5A 3SYUA 1R4YA 1BU4A 2CFKA 1KSIA 2GEXA 5D82A 5G2GA 4H3UA 3T0UA 2FNQA 3UL6A 3U1WA 4EC6A 2KF4A 1EEJA 2F5MA 3ALAA 4G1MB 4CJNA 2XGNA 4HM4B 3F9SA 4XBTA 2GU3A 1TFKA 4BL3A 4ZM8A 1MWUA 1ROVA 3IMAB 3HK4A 5BIRA 4HVNA 1RGAA 4LSOA 1WMPA 1HU9A 2CG0A 3ECFA 3G16A 5IEOA 2W03A 1BRGA 2CG1A 3EBYA 1RNBA 2OOVC 4LYLB 4RNTA 1K9M4 1KQS2 3IPTA 1AV4A 2CK3H 3WOEB 1CEWI 3H3HA 1LNIA 2WOFA 3B4OA 4XDVA 2HMJB 2UUGC 3FSDA 3OV4A 2YFLB 1PY3A 2QGUA 3STDA 2CKFB 4J5KA 3FLJA 3Q3FA 1AVKA 3OXAA 4HM1B 1VQ83 1UUGB 2OWPA 5M18A 1S5AA 1M904 1LOXA 2XFSA 5AEWB 3CCS3 2HMMB 4JRFA 4N6UA 1VQP3 3LYGA 4R9KA 1GOYA 1UW1A 4WYKA 4LGQA 2IUJA 1I0XA 3CCU3 4HM2B 2BHMA 3NM7A 4J8TA 5HGRA 4LMIA 2Q07A 1RHLA 2W56A 1Q864 1QAKA 2Z77A 2MC8A 3V98A 4KVHA 1N8QA 3MSOA 1OGZA 5CLKA 4N6MA 4R9LA 1B2XA 3D9RA 3NV0B 4RNYA 5DRVA 1N8R4 1KD14 3EN8A 1G02A 1LOWA 2C4BA 3BNEA 4TX4A 3D79A 3KIIA 1JZDA 1UGHI 4NPBA 3BNBA 1OCVA 1QALA 2P0XA 8RNTA 2W2CA 1O7NB 5ELJA 1W7CA 3KSED 4RZMA 2P09A 1LOYA 2D42A 2RFRA 3PS8A 1L5GB 1Y4KA 2ZL8A 1K8A4 2OQEC 3MKIA 3S27A 5CK6A 1VQO3 4GSPA 1ZGXA 2E2VA 2IA7A 2KAAA 3KZTA 1IQYA 1QVG2 1DMNA 3DM8A 1V57A 4IT7A 4ORLA 1BRKA 3FH1A 1IK3A 3CPW2 2WO0A 3CNXA 2M7OA 4AKZA 7GSPA 4BTXA 3K9MC 3AGOA 3S5CA 1JN5B 1IU7A 3ZG0A 1SJWA 1DMMA 1T3BA 1Q42A 1UCJA 1OH0A 2K3DA 1TTOA 3KSPA 4FMAA 3UNLA 4AKYA 4EW5A 3DUKA 4XDWA 3PCRA 3JUQA 1G96A 1O7HB 3LOYA 2BMOB 3DGYA 2XSOB 4HJLB 4R1KA 3D4AA 3FKAA 5RNTA 2RSXA 3OW22 1C54A 1GY7A 1BIRA 3MWZA 4HZ9B 2CX1A 3B7CA 1BRHA 2WGQA 3J7Yd 1E97A 3FG1A 3GZYB 2I9WA 1LQMB 3DMCA 4K90B 4HM0B 4PEJA 1F8NA 1MGWA 2RNTA 1EKMA 1JKGB 2WOHA 1JB4A 3X3XA 4KZ1A 1W00A 3RGAA 1KWIA 3FF2A 3QK9A 4N6NB 1TU5A 4I4KA 2IYJA 4OUQA 3UJMA 3N8BA 4KT3B 4J9AA 4KFDA 2QA43 5CF2A 1RGEA 2J8XB 2P05A 2FXTA 3EE1A 3NV0A 1IVVA 4ILFA 4R80A 2Y74A 1D6UA 5IEPA 1RSNA 3CCL3 1OUNA 1SIIA 4N3VA 5JPUA 1BRSA 5A0OB 3G8ZA 2Y73A 1ZO2A 2GSPA 3FG4A 1WNHA 3PGBA 2XSHB 4GB5A 7STDA 3F40A 2MF7A 1OF5B 1UDII 3HX8A 3GZXB 1RCLA 3I0YA 1QAFA 4O2HA 1MWTA 2H0GA 2QIYA 1FZUA 3VSYA 2GU1A 4BTWA 4OK0A 3OWSA 1BRNL 3E99A 3S67A 3SOAA 3BIRA 4FCMA 3EB8A 6RNTA 2L1SA 3G6E3 5DREA 1ZX2A 2E2UA 1BUQA 1RNTA 3UB1A 1STFI 1IQ8A 2CWTA 4N6V0 1FYSA 1VZZA 2CC3A 3GSPA 4LZIA 1BNFA 2BO9B 2ZA4A 3GZBA 1EG9B 1HZ1A 1X1UA 4MMYB 5KP3A 3TDGA 1J2BA 4QWTA 1UI8A 2P0MA 3LMLA 3CC43 3OWUA 3N54B 1T5YA 1YJN3 1YGEA 3AMOA 5JBSA 1TIJA 1YJW3 4WP5A 1JBRA 3L0RA 3B4PA 3MG2A 1BUJA 2KRTA 3RGRA 1BSAA 4EYCA 3WR2A 1GY5A 4CPKA 5AEUB 4O02B 1JKGA 2CFWA 3M8CA 3WODG 1NO3A 1C7HA 2BT3A 3K7CA 3A5EA 1BSBA 1FA3A 2SARA 4HBRA 4WWUC 1N9EA 1MWRA 2E2TA 4FMDA 3Q2PA 2CFGA 1LNHA 3U97A 1MOLA 3CC23 3O8YA 3AHSA 1BSDA 1FGMA 2F56A 3KFQC 4RBNA 1IVXA 4MMXB 1D6ZA 1JJ22 2HOHA 1VQ93 1GMQA 1OACA 2YFIB 1BOXA 1IQXA 1GOVA 1OF5A 1QMAA 1UCIA 1RN7A 1W02A 3H51A 4STDA 1RRLA 5GSPA 4CDLA 3FCSB 5JPPA 5M19A 3LXUX 1IVUA 3I553 4FCZA 3CCE3 1M1K4 1YVBI 4L7KA 4WFOA 3T8NA 1CYVA 4NHFA 2OTL3 3I563 3WA2X 3BU4A 4DKIA 1I3IA 2PNCA 3ROBA 1IV9A 3WHOA 1LXEA 1W6YA 5G1LA 3CU3A 1ULIB 1VQ73 2K0MA 4KFEA 3CCV3 4K61A 1Q814 4EV5A 3F7XA 4O8SA 5IG5A 1B20A 1W6GA 3G4S3 1MWSA 1I2GA 2XEPA 3CD63 1VQN3 1NU3A 3D5GA 1T2IA 3V99A 1NDOB 1AVLA 3F14A 5G1KA 1PU4A 3LZAA 3NBJA 3QRDA 1ULJB 5STDA 5D83A 1GY6A 3PCSA 1IYYA 3NQZA 1DYUA 1LOVA 1CH0A 1LQGC 1OGXA 5AYSC 5TGNA 3CCJ3 3LT8A 1STDA 2XF3A 6GSPA 1O7WB 3OX9A 1CYUA 1B2MA 2XR8B 3JUOA 1N9JA 3N9HA 1I0VA 3EF8A 1UUWB 4L8OA 2Z7AA 2BIRA 4J5GA 3X40A 3NQYA 4AEQA 2RGQA 2XH9A 2R41A 3Q1CA 5IERA 1NJI4 2JDIH 3PZWA 4NREA 1SQWA 2HMKB 2INXA 3D5IA 4BU4A 3AMOB 1DETA 2W9PA 1JZOA 3NBBA 4XBYA 7RNTA 3KN4A 4XB5A 5D81A 3VF1A 3CME3 3URPA 4MMZB 2GEYA 2B1XB 5M1AA 1B2ZA 5LC6A 1TFOA 1TP6A 2V1LA 4L8PA 2LYXA 4O3VA 4KFFA 1YI23 2F99A 1B3SA 4LEHA 1V58A 1EA2A 1YIJ3 3NUVA 1YJ93 2XRXB 3HOHA 4HM7B 3AHWA 1W5ZA 1RN4A 1YHQ3 3CCR3 3LTDA 1GOUA 5IG4A 3G713 4N6LA 2OTJ3 1HKXA 1SARA 1RN1A 1B21A 3Q90A 4EBGA 5IG3A 3DXOA 1A2PA 1WTHA 2Z76A 1JNQA 3B8LA 2FGTA 5AIHA 2UGIA 1GD4A 5FGOA 4GL6A 3DGMA 2H0IA 4GHOA 5EQLA 5IF6A 3MYTA 3NHXA 1G0TA 3EC9A 1RRHA 5BVBA 4WHAA 1VQK3 1BGSA 1RLSA 2KCDA 3LTCA 2O9UX 3KCHA 1BNEA 1RGFA 3KE7A 4X2HA 8CHOA 1MNLA 4EV2A 1RCKA 1NB5I 4BL2A 2UX0A 1ISKA 2CHCA 3V92A 1ZS7A 3X42A 2IY2A 2BMQB 5KP1A 1UCLA 1ASKA 1PYLA 1YVSA 1M1XB 1B2SA 3EJVA 1US1A 4RNZA 4HM8B 3FZWA 3HZPA 1VQ53 3F8XA 1BRJA 2GXFA 2O3OA 5AIGA 2BNGA 1YGWA 1B27A 4BIRA 3WDGB 1JBTA 3ER7A 4N6TA 3MHEA 6STDA 1Q7Y4 4XBXA 2ZDJA 1GMRA 2KF3A 1NWWA 2WGOA 3LT9A 1E3RA 3DGOA 1UCKA 1RGKA 1BNSA 1W2B2 1FUWA 3X41A 4HM6B 1YIT3 2HMNB 2F4YA 2OCTA 5AI1A 5BXQA 1QVF2 3FF0A 1DE3A 4HYZA 3SVAA 2XFTA 1GYBA 1NB3I 2GBXB 1IT8A 2W9QA 1JV2B 3VGNA 5BU4A 1GS3A 1YNVX 3F8HA 3X3YA 1BSCA 1BVIA 2OOVA 3WA3A 1D6YA 3MPHA 1RGCA 1K41A 1X1YA 1X1XA
chains in the Genus database with same CATH topology
3FG3A 4IIAA 1SIHA 1W01A 3GAXA 3GRDA 3UL5A 3OWYA 2Z6BA 5AYRB 1CQSA 3NM2A 3JUMA 3RDEA 2CW9A 1EQKA 1V74A 4FCJA 4N6OB 1A2VA 1RKYA 3CCM3 4EXRA 5IG0A 2CFDA 1VQL3 3MG1A 1DMQA 1PFPA 3KKGA 3FGYA 3K63A 3LTBA 1WMOA 3HIIA 3SX1A 3CCQ3 2B24B 5CF1A 1Q40B 3PXMA 3JUPA 2RCDA 3S28A 2XGLA 2QEX3 1S723 4R4KA 1A2KA 2W04A 3HI7A 1IDPA 2PZVA 1RJOA 2CWUA 2A15A 2BMRB 3JVCA 2HMLB 3G0KA 1ROAA 2C11A 2LQVA 3DY5A 3CNMA 2OQEA 2GBWB 2CH9A 3MG3A 3EQQB 1SPUA 3BB9A 3EX9A 3K0ZA 2CWVA 2IUKA 2YX9A 4U13A 5AIIA 3SOYA 5LC7A 4HM3B 4FMBA 5FW5A 5IENA 1IVWA 1M9GA 1OPYA 3CXC2 1DVCA 4HM5B 4JF8A 1A67A 1KC84 1WMNA 2R4IA 1VQM3 3BLZA 5ELUA 2KXGA 2ML6A 3A76A 3EN1B 1Q824 3CPOA 5I97A 1W4NA 1QJGA 4FMCA 1O7PB 1FGTA 3DGNA 4IPBA 4H61A 2D1WA 3NXJA 2CIUA 3GWRA 3LTAA 2L4VA 1TUHA 1AR0A 2JQ5A 1N5HA 1N5PA 1K28A 1WQLB 3F7SA 1Q40A 2SBLA 3HIGA 3SXXA 1VQ63 4CCVA 2IMJA 1OHOA 1A90A 1UUVB 3BNCA 3IJEB 2HMOB 3WOFB 5KP4A 1OHPA 2STDA 1U8CB 2CFLA 2F86B 5AIFA 1U5OA 1JRQA 3X3ZA 1R4CA 1O7MB 3DGLA 1VQ43 1OHSA 3PYJA 1FGOA 3LH4A 3EBTA 2F98A 1E3VA 4K1UA 3SEDA 1Q864 3BNDA 1W6CA 3CMA3 5EVHA 1GD3A 4Q53A 1LVNA 4MJDA 2YFJB 5EEOA 1O7GB 2P38A 3SLUA 1JB2A 2W6JH 3JUNA 1IV7A 4FR9A 2C10A 2ML5A 3D3LA 1Z1SA 4X2OA 1W2ZA 4WYKB 1FGRA 4HKVB 4XM4A 1FGQA 3T8UA 3WMDA 3NBRA 3DZLA 3EHCA 4K1VA 4BTYA 1UI7A 3CC73 3GZRA 2W56B 1IT7A 3S29A 1K734 1DVDA 5IW9A 4HZBB 4MEIA 5CXOA 3NX0A 1JN5A 2K54A 2W0QA 3K5TA 4OVMA 1JB5A 2CFKA 1KSIA 2GEXA 5D82A 5G2GA 4H3UA 3T0UA 2FNQA 3UL6A 3U1WA 4EC6A 3ALAA 4G1MB 2XGNA 4HM4B 3F9SA 4XBTA 2GU3A 1TFKA 4ZM8A 3IMAB 1ROVA 3HK4A 4HVNA 4LSOA 1WMPA 1HU9A 2CG0A 3ECFA 3G16A 5IEOA 2W03A 2CG1A 3EBYA 2OOVC 1K9M4 1KQS2 3IPTA 1AV4A 2CK3H 3WOEB 1CEWI 3H3HA 2WOFA 3B4OA 4XDVA 2HMJB 3FSDA 3OV4A 2YFLB 2QGUA 3STDA 2CKFB 3FLJA 1AVKA 3OXAA 4HM1B 1VQ83 2OWPA 1S5AA 1M904 1LOXA 2XFSA 5AEWB 3CCS3 2HMMB 4JRFA 4N6UA 1VQP3 3LYGA 4R9KA 1UW1A 4WYKA 4LGQA 2IUJA 3CCU3 4HM2B 2BHMA 3NM7A 4J8TA 5HGRA 4LMIA 2Q07A 2W56A 1QAKA 2Z77A 2MC8A 3V98A 4KVHA 1N8QA 3MSOA 1OGZA 5CLKA 4N6MA 4R9LA 4RNYA 3D9RA 3NV0B 5DRVA 1N8R4 1KD14 3EN8A 3BNEA 4TX4A 3KIIA 3BNBA 1OCVA 1QALA 2P0XA 2W2CA 1O7NB 5ELJA 1W7CA 3KSED 4RZMA 2P09A 2D42A 2RFRA 3PS8A 1L5GB 1Y4KA 2ZL8A 1K8A4 2OQEC 3MKIA 3S27A 5CK6A 1VQO3 3KZTA 2E2VA 2IA7A 1IQYA 1QVG2 1DMNA 3DM8A 4IT7A 4ORLA 3FH1A 3CPW2 1IK3A 2WO0A 3CNXA 2M7OA 4AKZA 4BTXA 3K9MC 3S5CA 1JN5B 1IU7A 1SJWA 1DMMA 1Q42A 4AKYA 1OH0A 3UNLA 3KSPA 4FMAA 3DUKA 4XDWA 3PCRA 3JUQA 1G96A 1O7HB 3LOYA 2BMOB 2XSOB 4HJLB 4R1KA 3FKAA 3OW22 2RSXA 1GY7A 3MWZA 4HZ9B 3B7CA 2WGQA 3J7Yd 1E97A 3FG1A 3GZYB 2I9WA 3DMCA 4K90B 4HM0B 4PEJA 1F8NA 1EKMA 1JKGB 2WOHA 1JB4A 3X3XA 4KZ1A 1W00A 3RGAA 1KWIA 3FF2A 3QK9A 4N6NB 1TU5A 4I4KA 4OUQA 3UJMA 3N8BA 4J9AA 4KFDA 2QA43 5CF2A 2P05A 3EE1A 3NV0A 2FXTA 4R80A 3CME3 1IVVA 2Y74A 1D6UA 5IEPA 3CCL3 1OUNA 1SIIA 4N3VA 5JPUA 5A0OB 3G8ZA 2Y73A 1ZO2A 3FG4A 1WNHA 3PGBA 2XSHB 4GB5A 7STDA 3F40A 2MF7A 1OF5B 3HX8A 3GZXB 3I0YA 1QAFA 4O2HA 2QIYA 3VSYA 2GU1A 4BTWA 4OK0A 3OWSA 3E99A 3S67A 3SOAA 4FCMA 3EB8A 3G6E3 5DREA 1ZX2A 2E2UA 1BUQA 3UB1A 1STFI 1IQ8A 2CWTA 4N6V0 2CC3A 1VZZA 4LZIA 2BO9B 3GZBA 1EG9B 4MMYB 5KP3A 3TDGA 1J2BA 4QWTA 1UI8A 2P0MA 3LMLA 3CC43 3OWUA 3N54B 1T5YA 1YJN3 1YGEA 3AMOA 5JBSA 1TIJA 1YJW3 4WP5A 3L0RA 3B4PA 3MG2A 2KRTA 3RGRA 4EYCA 1GY5A 5AEUB 4O02B 1JKGA 2CFWA 3M8CA 3WODG 1NO3A 1C7HA 2BT3A 3K7CA 1FA3A 4HBRA 4WWUC 1N9EA 2E2TA 4FMDA 3Q2PA 2CFGA 1LNHA 3U97A 1MOLA 3CC23 3O8YA 1FGMA 3KFQC 4RBNA 1IVXA 4MMXB 1D6ZA 1JJ22 1VQ93 1OACA 2YFIB 1QMAA 1IQXA 1OF5A 3H51A 1RN7A 4STDA 4CDLA 3I553 1RRLA 5JPPA 3FCSB 3CCE3 1M1K4 3LXUX 1IVUA 4FCZA 1YVBI 4L7KA 4WFOA 3T8NA 1CYVA 4NHFA 2OTL3 3I563 3WA2X 3ROBA 2PNCA 1IV9A 1LXEA 1W6YA 3CU3A 1ULIB 1VQ73 2K0MA 4KFEA 3CCV3 4K61A 1Q814 4EV5A 3F7XA 4O8SA 5IG5A 1W6GA 3G4S3 3CD63 2XEPA 1VQN3 1NU3A 3V99A 1NDOB 1AVLA 3F14A 1PU4A 3LZAA 3NBJA 3QRDA 1ULJB 5STDA 5D83A 1GY6A 3PCSA 3NQZA 1DYUA 1OGXA 5AYSC 5TGNA 3CCJ3 3LT8A 1STDA 2XF3A 1O7WB 3OX9A 1CYUA 2XR8B 3JUOA 1N9JA 3N9HA 3EF8A 1UUWB 4L8OA 2Z7AA 3X40A 3NQYA 4AEQA 2RGQA 2XH9A 3Q1CA 5IERA 1NJI4 2JDIH 3PZWA 4NREA 1SQWA 2HMKB 2INXA 3AMOB 2W9PA 4XBYA 3NBBA 3KN4A 4XB5A 5D81A 3VF1A 4MMZB 2GEYA 2B1XB 5LC6A 1TFOA 1TP6A 2V1LA 4L8PA 2LYXA 4O3VA 4KFFA 1YI23 2F99A 4LEHA 1EA2A 1YIJ3 3NUVA 1YJ93 2XRXB 4HM7B 1W5ZA 1YHQ3 3CCR3 3LTDA 5IG4A 3G713 4N6LA 2OTJ3 1HKXA 3Q90A 4EBGA 5IG3A 3DXOA 1WTHA 2Z76A 1JNQA 3B8LA 2FGTA 5AIHA 1GD4A 5FGOA 4GL6A 3DGMA 5EQLA 5IF6A 3MYTA 3NHXA 5BVBA 3EC9A 1RRHA 4WHAA 1VQK3 2KCDA 3LTCA 2O9UX 3KE7A 4X2HA 8CHOA 1MNLA 4EV2A 1NB5I 2UX0A 1ISKA 2CHCA 3V92A 3X42A 2BMQB 5KP1A 1ASKA 1M1XB 3EJVA 1US1A 4RNZA 4HM8B 3FZWA 3HZPA 1VQ53 3F8XA 2GXFA 2O3OA 5AIGA 2BNGA 3WDGB 3ER7A 4N6TA 3MHEA 6STDA 1Q7Y4 4XBXA 2ZDJA 2WGOA 1NWWA 3LT9A 1E3RA 3DGOA 1W2B2 1FUWA 3X41A 4HM6B 1YIT3 2HMNB 2OCTA 5BXQA 5AI1A 1QVF2 3FF0A 4HYZA 3SVAA 2XFTA 1GYBA 2GBXB 2W9QA 1IT8A 1NB3I 1JV2B 3VGNA 1GS3A 3F8HA 3X3YA 2OOVA 3WA3A 1D6YA 3MPHA 1W02A 1K41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIA A;  1W01 A;  3GRD A;  3OWY A;  1CQS A;  3NM2 A;  3JUM A;  4FCJ A;  5IG0 A;  3MG1 A;  1DMQ A;  3KKG A;  3FGY A;  2B24 B;  5CF1 A;  1Q40 B;  3JUP A;  2RCD A;  1A2K A;  1IDP A;  2PZV A;  2A15 A;  2BMR B;  2HML B;  3G0K A;  3CNM A;  2GBW B;  3MG3 A;  3EQQ B;  3BB9 A;  3EX9 A;  3K0Z A;  3SOY A;  4U13 A;  5AII A;  4HM3 B;  5FW5 A;  5IEN A;  1OPY A;  4HM5 B;  2R4I A;  3BLZ A;  3A76 A;  3EN1 B;  3CPO A;  1QJG A;  1O7P B;  3NXJ A;  3GWR A;  1TUH A;  1AR0 A;  2JQ5 A;  1WQL B;  3F7S A;  1Q40 A;  2IMJ A;  1OHO A;  1UUV B;  2HMO B;  5KP4 A;  1OHP A;  2STD A;  5AIF A;  2F86 B;  1U5O A;  1O7M B;  1OHS A;  3EBT A;  2F98 A;  3SED A;  1E3V A;  4K1U A;  5EVH A;  4MJD A;  2YFJ B;  1O7G B;  1JB2 A;  3JUN A;  1Z1S A;  4X2O A;  4WYK B;  4HKV B;  3T8U A;  4XM4 A;  3WMD A;  3NBR A;  3DZL A;  3EHC A;  4K1V A;  3GZR A;  4HZB B;  5CXO A;  1JN5 A;  2K54 A;  4OVM A;  1JB5 A;  5D82 A;  2GEX A;  5G2G A;  4H3U A;  4HM4 B;  3F9S A;  4XBT A;  3HK4 A;  4HVN A;  3ECF A;  5IEO A;  3G16 A;  3EBY A;  3IPT A;  3H3H A;  3B4O A;  4XDV A;  2HMJ B;  3FSD A;  3OV4 A;  2YFL B;  2QGU A;  3STD A;  2CKF B;  3FLJ A;  3OXA A;  4HM1 B;  2OWP A;  1S5A A;  5AEW B;  2HMM B;  3LYG A;  4R9K A;  4WYK A;  4LGQ A;  4HM2 B;  4J8T A;  5HGR A;  4LMI A;  2Z77 A;  4KVH A;  3MSO A;  1OGZ A;  5CLK A;  4R9L A;  3D9R A;  3NV0 B;  5DRV A;  3EN8 A;  1OCV A;  2W2C A;  1O7N B;  4RZM A;  2RFR A;  3MKI A;  5CK6 A;  3KZT A;  1DMN A;  3DM8 A;  4ORL A;  3FH1 A;  3CNX A;  3S5C A;  1JN5 B;  1SJW A;  1DMM A;  1Q42 A;  1OH0 A;  3UNL A;  3KSP A;  3DUK A;  4XDW A;  3JUQ A;  1O7H B;  2BMO B;  2XSO B;  4HJL B;  4R1K A;  3FKA A;  1GY7 A;  4HZ9 B;  3B7C A;  1E97 A;  3GZY B;  2I9W A;  3DMC A;  4HM0 B;  4PEJ A;  1JKG B;  1JB4 A;  1W00 A;  3RGA A;  3FF2 A;  4I4K A;  4OUQ A;  3UJM A;  4J9A A;  5CF2 A;  3NV0 A;  5IEP A;  1OUN A;  4N3V A;  5JPU A;  3G8Z A;  1ZO2 A;  2XSH B;  4GB5 A;  7STD A;  3F40 A;  1OF5 B;  3HX8 A;  3GZX B;  3I0Y A;  2QIY A;  3VSY A;  3OWS A;  3E99 A;  3SOA A;  4FCM A;  5DRE A;  1ZX2 A;  1BUQ A;  1VZZ A;  3GZB A;  1EG9 B;  5KP3 A;  3OWU A;  4WP5 A;  3B4P A;  3MG2 A;  3RGR A;  1GY5 A;  5AEU B;  1JKG A;  3M8C A;  1C7H A;  3K7C A;  4WWU C;  2YFI B;  1QMA A;  1OF5 A;  3H51 A;  4STD A;  4CDL A;  5JPP A;  3T8N A;  4L7K A;  3ROB A;  1W6Y A;  3CU3 A;  1ULI B;  5IG5 A;  3F7X A;  1NU3 A;  1NDO B;  3F14 A;  3LZA A;  1ULJ B;  5STD A;  5D83 A;  1GY6 A;  1OGX A;  5TGN A;  1STD A;  1O7W B;  3OX9 A;  2XR8 B;  3JUO A;  3EF8 A;  1UUW B;  4L8O A;  2Z7A A;  2RGQ A;  5IER A;  2HMK B;  2INX A;  4XBY A;  4XB5 A;  5D81 A;  2GEY A;  2B1X B;  1TP6 A;  4L8P A;  2F99 A;  4LEH A;  1EA2 A;  3NUV A;  2XRX B;  4HM7 B;  5IG4 A;  1HKX A;  3Q90 A;  5IG3 A;  3DXO A;  2Z76 A;  3B8L A;  5AIH A;  5IF6 A;  3MYT A;  3NHX A;  5BVB A;  3EC9 A;  3KE7 A;  4X2H A;  8CHO A;  2UX0 A;  1ISK A;  2CHC A;  2BMQ B;  5KP1 A;  1ASK A;  3EJV A;  4HM8 B;  3FZW A;  3HZP A;  3F8X A;  2GXF A;  5AIG A;  2BNG A;  3ER7 A;  3MHE A;  6STD A;  4XBX A;  1NWW A;  1E3R A;  4HM6 B;  2HMN B;  5BXQ A;  5AI1 A;  3FF0 A;  1GYB A;  2GBX B;  3VGN A;  1GS3 A;  3F8H A;  1K41 A;  1W02 A;  4Q53 A; 
#chains in the Genus database with same CATH topology
 1RGH A;  3FG3 A;  1SIH A;  1W01 A;  3GAX A;  4IIA A;  3GRD A;  3UL5 A;  3OWY A;  2Z6B A;  5AYR B;  1CQS A;  3NM2 A;  4I5Q A;  2RBI A;  1LRA A;  3JUM A;  3RDE A;  2CW9 A;  1EQK A;  1V74 A;  4FCJ A;  4N6O B;  1A2V A;  1RKY A;  3CCM 3;  2KF6 A;  4EXR A;  5IG0 A;  2CFD A;  1VQL 3;  3MG1 A;  1JBS A;  1DMQ A;  1PFP A;  3KKG A;  1EUI C;  1GSP A;  3FGY A;  3K63 A;  3LTB A;  1T2H A;  1WMO A;  3HII A;  3SX1 A;  3CCQ 3;  1BSE A;  2B24 B;  5CF1 A;  1Q40 B;  1RGL A;  3PXM A;  3JUP A;  1HYF A;  2CX0 A;  2RCD A;  2H0H A;  3S28 A;  2XGL A;  2QEX 3;  1S72 3;  4R4K A;  1A2K A;  2W04 A;  3HI7 A;  1IDP A;  1BRI A;  4HOH A;  2PZV A;  1RJO A;  2CWU A;  2A15 A;  2BMR B;  3JVC A;  2HML B;  3G0K A;  1ROA A;  2C11 A;  2LQV A;  3DH2 A;  3CNM A;  3DY5 A;  2OQE A;  2GBW B;  2CH9 A;  3MG3 A;  3EQQ B;  1SPU A;  1FW7 A;  3BB9 A;  3EX9 A;  1I2E A;  3K0Z A;  2CWV A;  2IUK A;  2YX9 A;  1RTU A;  4U13 A;  1AQZ A;  5AII A;  3SOY A;  5LC7 A;  3AGN A;  4FMB A;  4HM3 B;  5FW5 A;  5IEN A;  4HAA A;  1GMP A;  1IVW A;  1M9G A;  1OPY A;  3CXC 2;  1I8V A;  1DVC A;  1RMS A;  4HM5 B;  4JF8 A;  1A67 A;  1KC8 4;  1WMN A;  2R4I A;  1VQM 3;  1Q7H A;  3BLZ A;  1RGG A;  5ELU A;  1BAO A;  2KXG A;  2ML6 A;  3ZG5 A;  3A76 A;  3EN1 B;  1Q82 4;  3CPO A;  5I97 A;  1W4N A;  1X1W A;  1QJG A;  1UGI A;  4FMC A;  1O7P B;  1B2U A;  1FGT A;  1TRP A;  3DGN A;  4IPB A;  2AAD A;  4H61 A;  2D1W A;  3NXJ A;  1NNV A;  2CIU A;  3GWR A;  3LTA A;  5HOH A;  2L4V A;  1TUH A;  1AR0 A;  3RNT A;  2JQ5 A;  1FUT A;  1N5H A;  1N5P A;  1K28 A;  1WQL B;  1BAN A;  1TRQ A;  1Q40 A;  3F7S A;  2SBL A;  3HIG A;  3SXX A;  1VQ6 3;  4CCV A;  2IMJ A;  1TJD A;  1OHO A;  1A90 A;  1UUV B;  1FUS A;  2F5W A;  1I2F A;  3BNC A;  3IJE B;  2HMO B;  3WOF B;  2BU4 A;  1OHP A;  5KP4 A;  3ZFZ A;  1Q9E A;  2STD A;  1U8C B;  2CFL A;  2F86 B;  5AIF A;  1BNI A;  1U5O A;  9RNT A;  1JRQ A;  3X3Z A;  1AY7 A;  1R4C A;  1O7M B;  3DGL A;  1VQ4 3;  1BNG A;  1OHS A;  1FGO A;  3LH4 A;  3EBT A;  2F98 A;  1BNJ A;  1E3V A;  3PYJ A;  4K1U A;  3BND A;  1W6C A;  3SED A;  5EVH A;  3CMA 3;  2AAE A;  1GD3 A;  4Q53 A;  1LVN A;  4MJD A;  2YFJ B;  1VQQ A;  5EEO A;  1O7G B;  2P38 A;  3SLU A;  1JB2 A;  2W6J H;  3JUN A;  1IV7 A;  4FR9 A;  2C10 A;  2ML5 A;  3D3L A;  1Z1S A;  4X2O A;  1W2Z A;  4WYK B;  1I70 A;  1FGR A;  4HKV B;  4XM4 A;  1FGQ A;  3T8U A;  3WMD A;  2KF5 A;  3NBR A;  3DZL A;  3EHC A;  4K1V A;  4BTY A;  1UI7 A;  3CC7 3;  1BNR A;  3GZR A;  2W56 B;  1IT7 A;  3S29 A;  1RDS A;  2ZHX B;  1K73 4;  1DVD A;  5IW9 A;  4HZB B;  1I3F A;  4MEI A;  5CXO A;  3NX0 A;  1JN5 A;  2K54 A;  2W0Q A;  3K5T A;  4OVM A;  1MGR A;  1JB5 A;  3SYU A;  1R4Y A;  1BU4 A;  2CFK A;  1KSI A;  2GEX A;  5D82 A;  5G2G A;  4H3U A;  3T0U A;  2FNQ A;  3UL6 A;  3U1W A;  4EC6 A;  2KF4 A;  1EEJ A;  2F5M A;  3ALA A;  4G1M B;  4CJN A;  2XGN A;  4HM4 B;  3F9S A;  4XBT A;  2GU3 A;  1TFK A;  4BL3 A;  4ZM8 A;  1MWU A;  1ROV A;  3IMA B;  3HK4 A;  5BIR A;  4HVN A;  1RGA A;  4LSO A;  1WMP A;  1HU9 A;  2CG0 A;  3ECF A;  3G16 A;  5IEO A;  2W03 A;  1BRG A;  2CG1 A;  3EBY A;  1RNB A;  2OOV C;  4LYL B;  4RNT A;  1K9M 4;  1KQS 2;  3IPT A;  1AV4 A;  2CK3 H;  3WOE B;  1CEW I;  3H3H A;  1LNI A;  2WOF A;  3B4O A;  4XDV A;  2HMJ B;  2UUG C;  3FSD A;  3OV4 A;  2YFL B;  1PY3 A;  2QGU A;  3STD A;  2CKF B;  4J5K A;  3FLJ A;  3Q3F A;  1AVK A;  3OXA A;  4HM1 B;  1VQ8 3;  1UUG B;  2OWP A;  5M18 A;  1S5A A;  1M90 4;  1LOX A;  2XFS A;  5AEW B;  3CCS 3;  2HMM B;  4JRF A;  4N6U A;  1VQP 3;  3LYG A;  4R9K A;  1GOY A;  1UW1 A;  4WYK A;  4LGQ A;  2IUJ A;  1I0X A;  3CCU 3;  4HM2 B;  2BHM A;  3NM7 A;  4J8T A;  5HGR A;  4LMI A;  2Q07 A;  1RHL A;  2W56 A;  1Q86 4;  1QAK A;  2Z77 A;  2MC8 A;  3V98 A;  4KVH A;  1N8Q A;  3MSO A;  1OGZ A;  5CLK A;  4N6M A;  4R9L A;  1B2X A;  3D9R A;  3NV0 B;  4RNY A;  5DRV A;  1N8R 4;  1KD1 4;  3EN8 A;  1G02 A;  1LOW A;  2C4B A;  3BNE A;  4TX4 A;  3D79 A;  3KII A;  1JZD A;  1UGH I;  4NPB A;  3BNB A;  1OCV A;  1QAL A;  2P0X A;  8RNT A;  2W2C A;  1O7N B;  5ELJ A;  1W7C A;  3KSE D;  4RZM A;  2P09 A;  1LOY A;  2D42 A;  2RFR A;  3PS8 A;  1L5G B;  1Y4K A;  2ZL8 A;  1K8A 4;  2OQE C;  3MKI A;  3S27 A;  5CK6 A;  1VQO 3;  4GSP A;  1ZGX A;  2E2V A;  2IA7 A;  2KAA A;  3KZT A;  1IQY A;  1QVG 2;  1DMN A;  3DM8 A;  1V57 A;  4IT7 A;  4ORL A;  1BRK A;  3FH1 A;  1IK3 A;  3CPW 2;  2WO0 A;  3CNX A;  2M7O A;  4AKZ A;  7GSP A;  4BTX A;  3K9M C;  3AGO A;  3S5C A;  1JN5 B;  1IU7 A;  3ZG0 A;  1SJW A;  1DMM A;  1T3B A;  1Q42 A;  1UCJ A;  1OH0 A;  2K3D A;  1TTO A;  3KSP A;  4FMA A;  3UNL A;  4AKY A;  4EW5 A;  3DUK A;  4XDW A;  3PCR A;  3JUQ A;  1G96 A;  1O7H B;  3LOY A;  2BMO B;  3DGY A;  2XSO B;  4HJL B;  4R1K A;  3D4A A;  3FKA A;  5RNT A;  2RSX A;  3OW2 2;  1C54 A;  1GY7 A;  1BIR A;  3MWZ A;  4HZ9 B;  2CX1 A;  3B7C A;  1BRH A;  2WGQ A;  3J7Y d;  1E97 A;  3FG1 A;  3GZY B;  2I9W A;  1LQM B;  3DMC A;  4K90 B;  4HM0 B;  4PEJ A;  1F8N A;  1MGW A;  2RNT A;  1EKM A;  1JKG B;  2WOH A;  1JB4 A;  3X3X A;  4KZ1 A;  1W00 A;  3RGA A;  1KWI A;  3FF2 A;  3QK9 A;  4N6N B;  1TU5 A;  4I4K A;  2IYJ A;  4OUQ A;  3UJM A;  3N8B A;  4KT3 B;  4J9A A;  4KFD A;  2QA4 3;  5CF2 A;  1RGE A;  2J8X B;  2P05 A;  2FXT A;  3EE1 A;  3NV0 A;  1IVV A;  4ILF A;  4R80 A;  2Y74 A;  1D6U A;  5IEP A;  1RSN A;  3CCL 3;  1OUN A;  1SII A;  4N3V A;  5JPU A;  1BRS A;  5A0O B;  3G8Z A;  2Y73 A;  1ZO2 A;  2GSP A;  3FG4 A;  1WNH A;  3PGB A;  2XSH B;  4GB5 A;  7STD A;  3F40 A;  2MF7 A;  1OF5 B;  1UDI I;  3HX8 A;  3GZX B;  1RCL A;  3I0Y A;  1QAF A;  4O2H A;  1MWT A;  2H0G A;  2QIY A;  1FZU A;  3VSY A;  2GU1 A;  4BTW A;  4OK0 A;  3OWS A;  1BRN L;  3E99 A;  3S67 A;  3SOA A;  3BIR A;  4FCM A;  3EB8 A;  6RNT A;  2L1S A;  3G6E 3;  5DRE A;  1ZX2 A;  2E2U A;  1BUQ A;  1RNT A;  3UB1 A;  1STF I;  1IQ8 A;  2CWT A;  4N6V 0;  1FYS A;  1VZZ A;  2CC3 A;  3GSP A;  4LZI A;  1BNF A;  2BO9 B;  2ZA4 A;  3GZB A;  1EG9 B;  1HZ1 A;  1X1U A;  4MMY B;  5KP3 A;  3TDG A;  1J2B A;  4QWT A;  1UI8 A;  2P0M A;  3LML A;  3CC4 3;  3OWU A;  3N54 B;  1T5Y A;  1YJN 3;  1YGE A;  3AMO A;  5JBS A;  1TIJ A;  1YJW 3;  4WP5 A;  1JBR A;  3L0R A;  3B4P A;  3MG2 A;  1BUJ A;  2KRT A;  3RGR A;  1BSA A;  4EYC A;  3WR2 A;  1GY5 A;  4CPK A;  5AEU B;  4O02 B;  1JKG A;  2CFW A;  3M8C A;  3WOD G;  1NO3 A;  1C7H A;  2BT3 A;  3K7C A;  3A5E A;  1BSB A;  1FA3 A;  2SAR A;  4HBR A;  4WWU C;  1N9E A;  1MWR A;  2E2T A;  4FMD A;  3Q2P A;  2CFG A;  1LNH A;  3U97 A;  1MOL A;  3CC2 3;  3O8Y A;  3AHS A;  1BSD A;  1FGM A;  2F56 A;  3KFQ C;  4RBN A;  1IVX A;  4MMX B;  1D6Z A;  1JJ2 2;  2HOH A;  1VQ9 3;  1GMQ A;  1OAC A;  2YFI B;  1BOX A;  1IQX A;  1GOV A;  1OF5 A;  1QMA A;  1UCI A;  1RN7 A;  1W02 A;  3H51 A;  4STD A;  1RRL A;  5GSP A;  4CDL A;  3FCS B;  5JPP A;  5M19 A;  3LXU X;  1IVU A;  3I55 3;  4FCZ A;  3CCE 3;  1M1K 4;  1YVB I;  4L7K A;  4WFO A;  3T8N A;  1CYV A;  4NHF A;  2OTL 3;  3I56 3;  3WA2 X;  3BU4 A;  4DKI A;  1I3I A;  2PNC A;  3ROB A;  1IV9 A;  3WHO A;  1LXE A;  1W6Y A;  5G1L A;  3CU3 A;  1ULI B;  1VQ7 3;  2K0M A;  4KFE A;  3CCV 3;  4K61 A;  1Q81 4;  4EV5 A;  3F7X A;  4O8S A;  5IG5 A;  1B20 A;  1W6G A;  3G4S 3;  1MWS A;  1I2G A;  2XEP A;  3CD6 3;  1VQN 3;  1NU3 A;  3D5G A;  1T2I A;  3V99 A;  1NDO B;  1AVL A;  3F14 A;  5G1K A;  1PU4 A;  3LZA A;  3NBJ A;  3QRD A;  1ULJ B;  5STD A;  5D83 A;  1GY6 A;  3PCS A;  1IYY A;  3NQZ A;  1DYU A;  1LOV A;  1CH0 A;  1LQG C;  1OGX A;  5AYS C;  5TGN A;  3CCJ 3;  3LT8 A;  1STD A;  2XF3 A;  6GSP A;  1O7W B;  3OX9 A;  1CYU A;  1B2M A;  2XR8 B;  3JUO A;  1N9J A;  3N9H A;  1I0V A;  3EF8 A;  1UUW B;  4L8O A;  2Z7A A;  2BIR A;  4J5G A;  3X40 A;  3NQY A;  4AEQ A;  2RGQ A;  2XH9 A;  2R41 A;  3Q1C A;  5IER A;  1NJI 4;  2JDI H;  3PZW A;  4NRE A;  1SQW A;  2HMK B;  2INX A;  3D5I A;  4BU4 A;  3AMO B;  1DET A;  2W9P A;  1JZO A;  3NBB A;  4XBY A;  7RNT A;  3KN4 A;  4XB5 A;  5D81 A;  3VF1 A;  3CME 3;  3URP A;  4MMZ B;  2GEY A;  2B1X B;  5M1A A;  1B2Z A;  5LC6 A;  1TFO A;  1TP6 A;  2V1L A;  4L8P A;  2LYX A;  4O3V A;  4KFF A;  1YI2 3;  2F99 A;  1B3S A;  4LEH A;  1V58 A;  1EA2 A;  1YIJ 3;  3NUV A;  1YJ9 3;  2XRX B;  3HOH A;  4HM7 B;  3AHW A;  1W5Z A;  1RN4 A;  1YHQ 3;  3CCR 3;  3LTD A;  1GOU A;  5IG4 A;  3G71 3;  4N6L A;  2OTJ 3;  1HKX A;  1SAR A;  1RN1 A;  1B21 A;  3Q90 A;  4EBG A;  5IG3 A;  3DXO A;  1A2P A;  1WTH A;  2Z76 A;  1JNQ A;  3B8L A;  2FGT A;  5AIH A;  2UGI A;  1GD4 A;  5FGO A;  4GL6 A;  3DGM A;  2H0I A;  4GHO A;  5EQL A;  5IF6 A;  3MYT A;  3NHX A;  1G0T A;  3EC9 A;  1RRH A;  5BVB A;  4WHA A;  1VQK 3;  1BGS A;  1RLS A;  2KCD A;  3LTC A;  2O9U X;  3KCH A;  1BNE A;  1RGF A;  3KE7 A;  4X2H A;  8CHO A;  1MNL A;  4EV2 A;  1RCK A;  1NB5 I;  4BL2 A;  2UX0 A;  1ISK A;  2CHC A;  3V92 A;  1ZS7 A;  3X42 A;  2IY2 A;  2BMQ B;  5KP1 A;  1UCL A;  1ASK A;  1PYL A;  1YVS A;  1M1X B;  1B2S A;  3EJV A;  1US1 A;  4RNZ A;  4HM8 B;  3FZW A;  3HZP A;  1VQ5 3;  3F8X A;  1BRJ A;  2GXF A;  2O3O A;  5AIG A;  2BNG A;  1YGW A;  1B27 A;  4BIR A;  3WDG B;  1JBT A;  3ER7 A;  4N6T A;  3MHE A;  6STD A;  1Q7Y 4;  4XBX A;  2ZDJ A;  1GMR A;  2KF3 A;  1NWW A;  2WGO A;  3LT9 A;  1E3R A;  3DGO A;  1UCK A;  1RGK A;  1BNS A;  1W2B 2;  1FUW A;  3X41 A;  4HM6 B;  1YIT 3;  2HMN B;  2F4Y A;  2OCT A;  5AI1 A;  5BXQ A;  1QVF 2;  3FF0 A;  1DE3 A;  4HYZ A;  3SVA A;  2XFT A;  1GYB A;  1NB3 I;  2GBX B;  1IT8 A;  2W9Q A;  1JV2 B;  3VGN A;  5BU4 A;  1GS3 A;  1YNV X;  3F8H A;  3X3Y A;  1BSC A;  1BVI A;  2OOV A;  3WA3 A;  1D6Y A;  3MPH A;  1RGC A;  1K41 A;  1X1Y A;  1X1X A; 
#chains in the Genus database with same CATH homology
 3FG3 A;  4IIA A;  1SIH A;  1W01 A;  3GAX A;  3GRD A;  3UL5 A;  3OWY A;  2Z6B A;  5AYR B;  1CQS A;  3NM2 A;  3JUM A;  3RDE A;  2CW9 A;  1EQK A;  1V74 A;  4FCJ A;  4N6O B;  1A2V A;  1RKY A;  3CCM 3;  4EXR A;  5IG0 A;  2CFD A;  1VQL 3;  3MG1 A;  1DMQ A;  1PFP A;  3KKG A;  3FGY A;  3K63 A;  3LTB A;  1WMO A;  3HII A;  3SX1 A;  3CCQ 3;  2B24 B;  5CF1 A;  1Q40 B;  3PXM A;  3JUP A;  2RCD A;  3S28 A;  2XGL A;  2QEX 3;  1S72 3;  4R4K A;  1A2K A;  2W04 A;  3HI7 A;  1IDP A;  2PZV A;  1RJO A;  2CWU A;  2A15 A;  2BMR B;  3JVC A;  2HML B;  3G0K A;  1ROA A;  2C11 A;  2LQV A;  3DY5 A;  3CNM A;  2OQE A;  2GBW B;  2CH9 A;  3MG3 A;  3EQQ B;  1SPU A;  3BB9 A;  3EX9 A;  3K0Z A;  2CWV A;  2IUK A;  2YX9 A;  4U13 A;  5AII A;  3SOY A;  5LC7 A;  4HM3 B;  4FMB A;  5FW5 A;  5IEN A;  1IVW A;  1M9G A;  1OPY A;  3CXC 2;  1DVC A;  4HM5 B;  4JF8 A;  1A67 A;  1KC8 4;  1WMN A;  2R4I A;  1VQM 3;  3BLZ A;  5ELU A;  2KXG A;  2ML6 A;  3A76 A;  3EN1 B;  1Q82 4;  3CPO A;  5I97 A;  1W4N A;  1QJG A;  4FMC A;  1O7P B;  1FGT A;  3DGN A;  4IPB A;  4H61 A;  2D1W A;  3NXJ A;  2CIU A;  3GWR A;  3LTA A;  2L4V A;  1TUH A;  1AR0 A;  2JQ5 A;  1N5H A;  1N5P A;  1K28 A;  1WQL B;  3F7S A;  1Q40 A;  2SBL A;  3HIG A;  3SXX A;  1VQ6 3;  4CCV A;  2IMJ A;  1OHO A;  1A90 A;  1UUV B;  3BNC A;  3IJE B;  2HMO B;  3WOF B;  5KP4 A;  1OHP A;  2STD A;  1U8C B;  2CFL A;  2F86 B;  5AIF A;  1U5O A;  1JRQ A;  3X3Z A;  1R4C A;  1O7M B;  3DGL A;  1VQ4 3;  1OHS A;  3PYJ A;  1FGO A;  3LH4 A;  3EBT A;  2F98 A;  1E3V A;  4K1U A;  3SED A;  1Q86 4;  3BND A;  1W6C A;  3CMA 3;  5EVH A;  1GD3 A;  4Q53 A;  1LVN A;  4MJD A;  2YFJ B;  5EEO A;  1O7G B;  2P38 A;  3SLU A;  1JB2 A;  2W6J H;  3JUN A;  1IV7 A;  4FR9 A;  2C10 A;  2ML5 A;  3D3L A;  1Z1S A;  4X2O A;  1W2Z A;  4WYK B;  1FGR A;  4HKV B;  4XM4 A;  1FGQ A;  3T8U A;  3WMD A;  3NBR A;  3DZL A;  3EHC A;  4K1V A;  4BTY A;  1UI7 A;  3CC7 3;  3GZR A;  2W56 B;  1IT7 A;  3S29 A;  1K73 4;  1DVD A;  5IW9 A;  4HZB B;  4MEI A;  5CXO A;  3NX0 A;  1JN5 A;  2K54 A;  2W0Q A;  3K5T A;  4OVM A;  1JB5 A;  2CFK A;  1KSI A;  2GEX A;  5D82 A;  5G2G A;  4H3U A;  3T0U A;  2FNQ A;  3UL6 A;  3U1W A;  4EC6 A;  3ALA A;  4G1M B;  2XGN A;  4HM4 B;  3F9S A;  4XBT A;  2GU3 A;  1TFK A;  4ZM8 A;  3IMA B;  1ROV A;  3HK4 A;  4HVN A;  4LSO A;  1WMP A;  1HU9 A;  2CG0 A;  3ECF A;  3G16 A;  5IEO A;  2W03 A;  2CG1 A;  3EBY A;  2OOV C;  1K9M 4;  1KQS 2;  3IPT A;  1AV4 A;  2CK3 H;  3WOE B;  1CEW I;  3H3H A;  2WOF A;  3B4O A;  4XDV A;  2HMJ B;  3FSD A;  3OV4 A;  2YFL B;  2QGU A;  3STD A;  2CKF B;  3FLJ A;  1AVK A;  3OXA A;  4HM1 B;  1VQ8 3;  2OWP A;  1S5A A;  1M90 4;  1LOX A;  2XFS A;  5AEW B;  3CCS 3;  2HMM B;  4JRF A;  4N6U A;  1VQP 3;  3LYG A;  4R9K A;  1UW1 A;  4WYK A;  4LGQ A;  2IUJ A;  3CCU 3;  4HM2 B;  2BHM A;  3NM7 A;  4J8T A;  5HGR A;  4LMI A;  2Q07 A;  2W56 A;  1QAK A;  2Z77 A;  2MC8 A;  3V98 A;  4KVH A;  1N8Q A;  3MSO A;  1OGZ A;  5CLK A;  4N6M A;  4R9L A;  4RNY A;  3D9R A;  3NV0 B;  5DRV A;  1N8R 4;  1KD1 4;  3EN8 A;  3BNE A;  4TX4 A;  3KII A;  3BNB A;  1OCV A;  1QAL A;  2P0X A;  2W2C A;  1O7N B;  5ELJ A;  1W7C A;  3KSE D;  4RZM A;  2P09 A;  2D42 A;  2RFR A;  3PS8 A;  1L5G B;  1Y4K A;  2ZL8 A;  1K8A 4;  2OQE C;  3MKI A;  3S27 A;  5CK6 A;  1VQO 3;  3KZT A;  2E2V A;  2IA7 A;  1IQY A;  1QVG 2;  1DMN A;  3DM8 A;  4IT7 A;  4ORL A;  3FH1 A;  3CPW 2;  1IK3 A;  2WO0 A;  3CNX A;  2M7O A;  4AKZ A;  4BTX A;  3K9M C;  3S5C A;  1JN5 B;  1IU7 A;  1SJW A;  1DMM A;  1Q42 A;  4AKY A;  1OH0 A;  3UNL A;  3KSP A;  4FMA A;  3DUK A;  4XDW A;  3PCR A;  3JUQ A;  1G96 A;  1O7H B;  3LOY A;  2BMO B;  2XSO B;  4HJL B;  4R1K A;  3FKA A;  3OW2 2;  2RSX A;  1GY7 A;  3MWZ A;  4HZ9 B;  3B7C A;  2WGQ A;  3J7Y d;  1E97 A;  3FG1 A;  3GZY B;  2I9W A;  3DMC A;  4K90 B;  4HM0 B;  4PEJ A;  1F8N A;  1EKM A;  1JKG B;  2WOH A;  1JB4 A;  3X3X A;  4KZ1 A;  1W00 A;  3RGA A;  1KWI A;  3FF2 A;  3QK9 A;  4N6N B;  1TU5 A;  4I4K A;  4OUQ A;  3UJM A;  3N8B A;  4J9A A;  4KFD A;  2QA4 3;  5CF2 A;  2P05 A;  3EE1 A;  3NV0 A;  2FXT A;  4R80 A;  3CME 3;  1IVV A;  2Y74 A;  1D6U A;  5IEP A;  3CCL 3;  1OUN A;  1SII A;  4N3V A;  5JPU A;  5A0O B;  3G8Z A;  2Y73 A;  1ZO2 A;  3FG4 A;  1WNH A;  3PGB A;  2XSH B;  4GB5 A;  7STD A;  3F40 A;  2MF7 A;  1OF5 B;  3HX8 A;  3GZX B;  3I0Y A;  1QAF A;  4O2H A;  2QIY A;  3VSY A;  2GU1 A;  4BTW A;  4OK0 A;  3OWS A;  3E99 A;  3S67 A;  3SOA A;  4FCM A;  3EB8 A;  3G6E 3;  5DRE A;  1ZX2 A;  2E2U A;  1BUQ A;  3UB1 A;  1STF I;  1IQ8 A;  2CWT A;  4N6V 0;  2CC3 A;  1VZZ A;  4LZI A;  2BO9 B;  3GZB A;  1EG9 B;  4MMY B;  5KP3 A;  3TDG A;  1J2B A;  4QWT A;  1UI8 A;  2P0M A;  3LML A;  3CC4 3;  3OWU A;  3N54 B;  1T5Y A;  1YJN 3;  1YGE A;  3AMO A;  5JBS A;  1TIJ A;  1YJW 3;  4WP5 A;  3L0R A;  3B4P A;  3MG2 A;  2KRT A;  3RGR A;  4EYC A;  1GY5 A;  5AEU B;  4O02 B;  1JKG A;  2CFW A;  3M8C A;  3WOD G;  1NO3 A;  1C7H A;  2BT3 A;  3K7C A;  1FA3 A;  4HBR A;  4WWU C;  1N9E A;  2E2T A;  4FMD A;  3Q2P A;  2CFG A;  1LNH A;  3U97 A;  1MOL A;  3CC2 3;  3O8Y A;  1FGM A;  3KFQ C;  4RBN A;  1IVX A;  4MMX B;  1D6Z A;  1JJ2 2;  1VQ9 3;  1OAC A;  2YFI B;  1QMA A;  1IQX A;  1OF5 A;  3H51 A;  1RN7 A;  4STD A;  4CDL A;  3I55 3;  1RRL A;  5JPP A;  3FCS B;  3CCE 3;  1M1K 4;  3LXU X;  1IVU A;  4FCZ A;  1YVB I;  4L7K A;  4WFO A;  3T8N A;  1CYV A;  4NHF A;  2OTL 3;  3I56 3;  3WA2 X;  3ROB A;  2PNC A;  1IV9 A;  1LXE A;  1W6Y A;  3CU3 A;  1ULI B;  1VQ7 3;  2K0M A;  4KFE A;  3CCV 3;  4K61 A;  1Q81 4;  4EV5 A;  3F7X A;  4O8S A;  5IG5 A;  1W6G A;  3G4S 3;  3CD6 3;  2XEP A;  1VQN 3;  1NU3 A;  3V99 A;  1NDO B;  1AVL A;  3F14 A;  1PU4 A;  3LZA A;  3NBJ A;  3QRD A;  1ULJ B;  5STD A;  5D83 A;  1GY6 A;  3PCS A;  3NQZ A;  1DYU A;  1OGX A;  5AYS C;  5TGN A;  3CCJ 3;  3LT8 A;  1STD A;  2XF3 A;  1O7W B;  3OX9 A;  1CYU A;  2XR8 B;  3JUO A;  1N9J A;  3N9H A;  3EF8 A;  1UUW B;  4L8O A;  2Z7A A;  3X40 A;  3NQY A;  4AEQ A;  2RGQ A;  2XH9 A;  3Q1C A;  5IER A;  1NJI 4;  2JDI H;  3PZW A;  4NRE A;  1SQW A;  2HMK B;  2INX A;  3AMO B;  2W9P A;  4XBY A;  3NBB A;  3KN4 A;  4XB5 A;  5D81 A;  3VF1 A;  4MMZ B;  2GEY A;  2B1X B;  5LC6 A;  1TFO A;  1TP6 A;  2V1L A;  4L8P A;  2LYX A;  4O3V A;  4KFF A;  1YI2 3;  2F99 A;  4LEH A;  1EA2 A;  1YIJ 3;  3NUV A;  1YJ9 3;  2XRX B;  4HM7 B;  1W5Z A;  1YHQ 3;  3CCR 3;  3LTD A;  5IG4 A;  3G71 3;  4N6L A;  2OTJ 3;  1HKX A;  3Q90 A;  4EBG A;  5IG3 A;  3DXO A;  1WTH A;  2Z76 A;  1JNQ A;  3B8L A;  2FGT A;  5AIH A;  1GD4 A;  5FGO A;  4GL6 A;  3DGM A;  5EQL A;  5IF6 A;  3MYT A;  3NHX A;  5BVB A;  3EC9 A;  1RRH A;  4WHA A;  1VQK 3;  2KCD A;  3LTC A;  2O9U X;  3KE7 A;  4X2H A;  8CHO A;  1MNL A;  4EV2 A;  1NB5 I;  2UX0 A;  1ISK A;  2CHC A;  3V92 A;  3X42 A;  2BMQ B;  5KP1 A;  1ASK A;  1M1X B;  3EJV A;  1US1 A;  4RNZ A;  4HM8 B;  3FZW A;  3HZP A;  1VQ5 3;  3F8X A;  2GXF A;  2O3O A;  5AIG A;  2BNG A;  3WDG B;  3ER7 A;  4N6T A;  3MHE A;  6STD A;  1Q7Y 4;  4XBX A;  2ZDJ A;  2WGO A;  1NWW A;  3LT9 A;  1E3R A;  3DGO A;  1W2B 2;  1FUW A;  3X41 A;  4HM6 B;  1YIT 3;  2HMN B;  2OCT A;  5BXQ A;  5AI1 A;  1QVF 2;  3FF0 A;  4HYZ A;  3SVA A;  2XFT A;  1GYB A;  2GBX B;  2W9Q A;  1IT8 A;  1NB3 I;  1JV2 B;  3VGN A;  1GS3 A;  3F8H A;  3X3Y A;  2OOV A;  3WA3 A;  1D6Y A;  3MPH A;  1W02 A;  1K41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...