4TJXA

Crystal structure of protease-associated domain of arabidopsis vsr1 in complex with aleurain peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
153
Chain Sequence
VEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPDYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein transport
molecule keywords Vacuolar-sorting receptor 1
total genus 44
structure length 153
sequence length 160
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4tjxA00
1CX8A 3KASA 4P4EA 1DE4C 2XEGA 5IB9A 4C8CA 4MCPA 2OR4A 1XF1A 4C9RA 3SJEA 5ELYA 4C9UA 4NGQA 3BI1A 2EK8A 3IIBA 3SJFA 4NGSA 4LQGA 4W9YA 4C9VA 4MCRA 2JBKA 2OOTA 4NGTA 4C9EA 2C6GA 3FEDA 4P44A 3D7HA 4KNGE 5D29A 1Z8LA 4P4IA 4OMEA 3BXMA 3FEEA 3FF3A 3D7GA 2C6PA 4C8UA 2C6CA 4MCQA 4NGPA 3S9MA 3FECA 3SJGA 4C9AA 4C8PA 4C86A 3VTAA 3D7DA 4OC0A 4NGRA 4P4JA 4C85A 5F09A 4TJVA 1Y9ZA 4TJXA 4OC3A 2CIJA 2EK9A 4C99A 3IWWA 3RBUA 4OC2A 4OC4A 2JBJA 4P45A 1V6CA 3S9NA 3EIFA 4X3RA 4MCSA 3BHXA 4CDJA 3SJXA 3D7FA 2PVVA 2XEFA 4P4DA 3I6SA 4C8TA 4JYWA 4NGNA 4C84A 4P4FA 2XEIA 3I74A 3S9LA 4YN3A 3ICUA 4C8AA 4OC1A 4NGMA 4OC5A 4P4BA 1WVMA 4C8FA 2PVWA 2XEJA 4JZ0A 4CDKA 3BI0A 4TWEA
chains in the Genus database with same CATH superfamily
1CE8B 3KRVA 1CX8A 2YJVA 3K9TA 2FM4A 3KASA 2D0PA 3GJZA 4P4EA 1DE4C 1C30B 2XEGA 3EZBA 5IB9A 5K99A 4C8CA 4MCPA 2OR4A 1VI4A 1XF1A 4C9RA 2DIKA 1JDBC 3SR3A 1C3OB 3SJEA 2MP0A 5ELYA 4C9UA 4NGQA 5JVLA 3BI1A 2EK8A 3IIBA 3SJFA 4NGSA 1VBGA 4LQGA 2B0AA 2HROA 4W9YA 3T07A 4C9VA 5FD8A 4MCRA 1BXRB 2JBKA 4CZ1A 2OOTA 2EZAA 4NGTA 3K4IA 4C9EA 4MJXA 5IR2A 1NXJA 2C6GA 3FEDA 3EZAA 4P44A 3D7HA 4KNGE 5F5XA 3TLAA 5D29A 1GGOA 1ZL0A 1KC7A 4P4IA 4OMEA 3BXMA 3FEEA 3FF3A 3G23A 2X0SA 3D7GA 2C6PA 4INJA 4C8UA 2C6CA 2E28A 4MCQA 4NGPA 3S9MA 3T5MA 3TLGB 1M6VB 1VBHA 3FECA 3SJGA 4C9AA 4C8PA 3T0TA 3VTAA 3D7DA 4C86A 4OC0A 4NGRA 4P4JA 3T05A 4C85A 1ZYMA 2YJTA 5F09A 1Y9ZA 4TJVA 4E94A 4TJXA 1KBLA 4OC3A 4COGA 4COBA 2HWGA 2CIJA 2EK9A 3TYXA 4CO9A 4E5SA 4H1HA 1EZBA 4C99A 3IWWA 2HI6A 5F9MA 3RBUA 4OC2A 1CS0B 2D0OA 4OC4A 2JBJA 4P45A 1V6CA 2PCNA 3S9NA 3EIFA 4X3RA 4MCSA 3BHXA 4CDJA 3SJXA 2EZBA 4M8DA 3D7FA 1JDEA 2PVVA 4MI1A 1NBWA 4TWEA 2EZCA 4IIYA 2XEFA 4P4DA 3I6SA 4C8TA 2R82A 4JVOA 4JYWA 4NGNA 4C84A 4P4FA 2XEIA 1R61A 3U1BA 4EYSA 3TLYA 3I74A 3S9LA 1J3LA 2AUNA 2GP4A 4YN3A 3NOJA 3ICUA 1A9XB 4C8AA 4IIXA 4OC1A 1EZAA 3TLGA 1ZRSA 4NGMA 5JYBA 1T36B 2C5QA 1DIKA 1Q5XA 4OC5A 2AUMA 1WVMA 4P4BA 3C8OA 5F1YA 2PVWA 2XEJA 3TLZA 4C8FA 4JZ0A 4J0NA 3TLBA 4CDKA 1KEEB 3BI0A 2OLSA 1Z8LA 3TLCA 3EZEA 3TLEA
chains in the Genus database with same CATH topology
1CX8A 3K9TA 3KASA 4P4EA 1DE4C 2XEGA 5IB9A 4C8CA 4MCPA 2OR4A 1XF1A 4C9RA 3SJEA 5ELYA 4C9UA 4NGQA 3BI1A 2EK8A 3IIBA 3SJFA 4NGSA 4LQGA 4W9YA 4C9VA 4MCRA 2JBKA 2OOTA 4NGTA 4C9EA 5IR2A 2C6GA 3FEDA 4P44A 3D7HA 4KNGE 5D29A 1Z8LA 4P4IA 4OMEA 3BXMA 3FEEA 3FF3A 3D7GA 2C6PA 4C8UA 2C6CA 4MCQA 4NGPA 3S9MA 3FECA 3SJGA 4C9AA 4C8PA 4C86A 3VTAA 3D7DA 4OC0A 4NGRA 4P4JA 4C85A 5F09A 4TJVA 1Y9ZA 4TJXA 4OC3A 2CIJA 2EK9A 4C99A 3IWWA 3RBUA 4OC2A 4OC4A 2JBJA 4P45A 1V6CA 3S9NA 3EIFA 4X3RA 4MCSA 3BHXA 4CDJA 3SJXA 3D7FA 2PVVA 2XEFA 4P4DA 3I6SA 4C8TA 4JYWA 4NGNA 4C84A 4P4FA 2XEIA 3I74A 3S9LA 4YN3A 2GP4A 3ICUA 4C8AA 4OC1A 4NGMA 2C5QA 4OC5A 4P4BA 1WVMA 4C8FA 2PVWA 2XEJA 4JZ0A 4CDKA 3BI0A 4TWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CX8 A;  3KAS A;  4P4E A;  1DE4 C;  2XEG A;  5IB9 A;  4C8C A;  4MCP A;  2OR4 A;  1XF1 A;  4C9R A;  3SJE A;  5ELY A;  4C9U A;  4NGQ A;  3BI1 A;  2EK8 A;  3IIB A;  3SJF A;  4NGS A;  4LQG A;  4W9Y A;  4C9V A;  4MCR A;  2JBK A;  2OOT A;  4NGT A;  4C9E A;  2C6G A;  3FED A;  4P44 A;  3D7H A;  4KNG E;  5D29 A;  1Z8L A;  4P4I A;  4OME A;  3BXM A;  3FEE A;  3FF3 A;  3D7G A;  2C6P A;  4C8U A;  2C6C A;  4MCQ A;  4NGP A;  3S9M A;  3FEC A;  3SJG A;  4C9A A;  4C8P A;  4C86 A;  3VTA A;  3D7D A;  4OC0 A;  4NGR A;  4P4J A;  4C85 A;  5F09 A;  4TJV A;  1Y9Z A;  4TJX A;  4OC3 A;  2CIJ A;  2EK9 A;  4C99 A;  3IWW A;  3RBU A;  4OC2 A;  4OC4 A;  2JBJ A;  4P45 A;  1V6C A;  3S9N A;  3EIF A;  4X3R A;  4MCS A;  3BHX A;  4CDJ A;  3SJX A;  3D7F A;  2PVV A;  2XEF A;  4P4D A;  3I6S A;  4C8T A;  4JYW A;  4NGN A;  4C84 A;  4P4F A;  2XEI A;  3I74 A;  3S9L A;  4YN3 A;  3ICU A;  4C8A A;  4OC1 A;  4NGM A;  4OC5 A;  4P4B A;  1WVM A;  4C8F A;  2PVW A;  2XEJ A;  4JZ0 A;  4CDK A;  3BI0 A;  4TWE A; 
#chains in the Genus database with same CATH topology
 1CE8 B;  3KRV A;  1CX8 A;  2YJV A;  3K9T A;  2FM4 A;  3KAS A;  2D0P A;  3GJZ A;  4P4E A;  1DE4 C;  1C30 B;  2XEG A;  3EZB A;  5IB9 A;  5K99 A;  4C8C A;  4MCP A;  2OR4 A;  1VI4 A;  1XF1 A;  4C9R A;  2DIK A;  1JDB C;  3SR3 A;  1C3O B;  3SJE A;  2MP0 A;  5ELY A;  4C9U A;  4NGQ A;  5JVL A;  3BI1 A;  2EK8 A;  3IIB A;  3SJF A;  4NGS A;  1VBG A;  4LQG A;  2B0A A;  2HRO A;  4W9Y A;  3T07 A;  4C9V A;  5FD8 A;  4MCR A;  1BXR B;  2JBK A;  4CZ1 A;  2OOT A;  2EZA A;  4NGT A;  3K4I A;  4C9E A;  4MJX A;  5IR2 A;  1NXJ A;  2C6G A;  3FED A;  3EZA A;  4P44 A;  3D7H A;  4KNG E;  5F5X A;  3TLA A;  5D29 A;  1GGO A;  1ZL0 A;  1KC7 A;  4P4I A;  4OME A;  3BXM A;  3FEE A;  3FF3 A;  3G23 A;  2X0S A;  3D7G A;  2C6P A;  4INJ A;  4C8U A;  2C6C A;  2E28 A;  4MCQ A;  4NGP A;  3S9M A;  3T5M A;  3TLG B;  1M6V B;  1VBH A;  3FEC A;  3SJG A;  4C9A A;  4C8P A;  3T0T A;  3VTA A;  3D7D A;  4C86 A;  4OC0 A;  4NGR A;  4P4J A;  3T05 A;  4C85 A;  1ZYM A;  2YJT A;  5F09 A;  1Y9Z A;  4TJV A;  4E94 A;  4TJX A;  1KBL A;  4OC3 A;  4COG A;  4COB A;  2HWG A;  2CIJ A;  2EK9 A;  3TYX A;  4CO9 A;  4E5S A;  4H1H A;  1EZB A;  4C99 A;  3IWW A;  2HI6 A;  5F9M A;  3RBU A;  4OC2 A;  1CS0 B;  2D0O A;  4OC4 A;  2JBJ A;  4P45 A;  1V6C A;  2PCN A;  3S9N A;  3EIF A;  4X3R A;  4MCS A;  3BHX A;  4CDJ A;  3SJX A;  2EZB A;  4M8D A;  3D7F A;  1JDE A;  2PVV A;  4MI1 A;  1NBW A;  4TWE A;  2EZC A;  4IIY A;  2XEF A;  4P4D A;  3I6S A;  4C8T A;  2R82 A;  4JVO A;  4JYW A;  4NGN A;  4C84 A;  4P4F A;  2XEI A;  1R61 A;  3U1B A;  4EYS A;  3TLY A;  3I74 A;  3S9L A;  1J3L A;  2AUN A;  2GP4 A;  4YN3 A;  3NOJ A;  3ICU A;  1A9X B;  4C8A A;  4IIX A;  4OC1 A;  1EZA A;  3TLG A;  1ZRS A;  4NGM A;  5JYB A;  1T36 B;  2C5Q A;  1DIK A;  1Q5X A;  4OC5 A;  2AUM A;  1WVM A;  4P4B A;  3C8O A;  5F1Y A;  2PVW A;  2XEJ A;  3TLZ A;  4C8F A;  4JZ0 A;  4J0N A;  3TLB A;  4CDK A;  1KEE B;  3BI0 A;  2OLS A;  1Z8L A;  3TLC A;  3EZE A;  3TLE A; 
#chains in the Genus database with same CATH homology
 1CX8 A;  3K9T A;  3KAS A;  4P4E A;  1DE4 C;  2XEG A;  5IB9 A;  4C8C A;  4MCP A;  2OR4 A;  1XF1 A;  4C9R A;  3SJE A;  5ELY A;  4C9U A;  4NGQ A;  3BI1 A;  2EK8 A;  3IIB A;  3SJF A;  4NGS A;  4LQG A;  4W9Y A;  4C9V A;  4MCR A;  2JBK A;  2OOT A;  4NGT A;  4C9E A;  5IR2 A;  2C6G A;  3FED A;  4P44 A;  3D7H A;  4KNG E;  5D29 A;  1Z8L A;  4P4I A;  4OME A;  3BXM A;  3FEE A;  3FF3 A;  3D7G A;  2C6P A;  4C8U A;  2C6C A;  4MCQ A;  4NGP A;  3S9M A;  3FEC A;  3SJG A;  4C9A A;  4C8P A;  4C86 A;  3VTA A;  3D7D A;  4OC0 A;  4NGR A;  4P4J A;  4C85 A;  5F09 A;  4TJV A;  1Y9Z A;  4TJX A;  4OC3 A;  2CIJ A;  2EK9 A;  4C99 A;  3IWW A;  3RBU A;  4OC2 A;  4OC4 A;  2JBJ A;  4P45 A;  1V6C A;  3S9N A;  3EIF A;  4X3R A;  4MCS A;  3BHX A;  4CDJ A;  3SJX A;  3D7F A;  2PVV A;  2XEF A;  4P4D A;  3I6S A;  4C8T A;  4JYW A;  4NGN A;  4C84 A;  4P4F A;  2XEI A;  3I74 A;  3S9L A;  4YN3 A;  2GP4 A;  3ICU A;  4C8A A;  4OC1 A;  4NGM A;  2C5Q A;  4OC5 A;  4P4B A;  1WVM A;  4C8F A;  2PVW A;  2XEJ A;  4JZ0 A;  4CDK A;  3BI0 A;  4TWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...