4TJXA

Crystal structure of protease-associated domain of arabidopsis vsr1 in complex with aleurain peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
153
Chain Sequence
VEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPDYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting receptor 1
publication title How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein transport
total genus 44
structure length 153
sequence length 160
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4tjxA00
4TJVA 4P44A 3S9LA 2JBKA 4YN3A 4P4FA 5IB9A 1CX8A 5ELYA 2PVVA 3SJGA 3SJEA 4C9UA 3IIBA 2EK8A 4C84A 4C8TA 4TJXA 4NGQA 4X3RA 2XEGA 2XEFA 3S9NA 4NGRA 3KASA 3SJFA 4JYWA 4C8FA 2OR4A 3D7GA 3D7FA 4C8UA 4C99A 4JZ0A 2JBJA 3BHXA 4OC5A 2XEIA 4OC2A 4P45A 4P4BA 4C8PA 4CDJA 4C86A 4MCSA 4OMEA 4OC4A 3EIFA 1V6CA 5F09A 4OC0A 4CDKA 1WVMA 3D7HA 2OOTA 4C9VA 4MCRA 4MCPA 2CIJA 3I74A 4C9RA 2PVWA 4C85A 3BI0A 3FF3A 4C8CA 3D7DA 3RBUA 4NGNA 4NGMA 4C8AA 4OC3A 3VTAA 4C9EA 3BXMA 3SJXA 3ICUA 1Z8LA 4NGSA 4LQGA 4NGTA 4TWEA 5D29A 4P4JA 3I6SA 2C6GA 2C6PA 4C9AA 3BI1A 2C6CA 4OC1A 3FECA 3FEEA 4P4DA 3IWWA 4P4IA 4NGPA 4P4EA 2EK9A 4W9YA 4MCQA 3FEDA 1Y9ZA 1XF1A 1DE4C 3S9MA 2XEJA 4KNGE
chains in the Genus database with same CATH superfamily
4TJVA 4P44A 3S9LA 2JBKA 4YN3A 4P4FA 5IB9A 4EYSA 1DIKA 1CX8A 5ELYA 2PVVA 3SJGA 2MP0A 3G23A 3SJEA 2EZBA 4C9UA 3EZEA 2PCNA 1NXJA 3IIBA 2EK8A 1C30B 4C84A 2EZAA 4C8TA 3U1BA 4TJXA 4NGQA 1ZL0A 2AUNA 2XEGA 2XEFA 4X3RA 3S9NA 1EZBA 4NGRA 3KASA 4E94A 3T5MA 1T36B 1R61A 4JYWA 3SJFA 4IIYA 3T07A 2YJVA 1KC7A 4INJA 4C8FA 2E28A 5F1YA 2B0AA 3NOJA 2GP4A 2OR4A 3D7GA 1EZAA 4IIXA 3D7FA 2X0SA 4C8UA 3GJZA 1GGOA 2DIKA 4C99A 4JZ0A 4M8DA 2D0PA 3SR3A 5F9MA 1J3LA 2JBJA 3BHXA 2HWGA 2AUMA 4OC5A 2XEIA 4OC2A 4P45A 4P4BA 4C8PA 4CDJA 4C86A 1CS0B 4MCSA 4OMEA 2C5QA 4MJXA 4OC4A 4E5SA 1C3OB 3EIFA 3TLEA 1V6CA 3K4IA 3TLZA 5F09A 4OC0A 4CDKA 5FD8A 1WVMA 1JDBC 3D7HA 5JYBA 2OOTA 1ZYMA 5K99A 4C9VA 4MCRA 2OLSA 4MCPA 2CIJA 4J0NA 3TLGB 3I74A 4C9RA 2PVWA 4C85A 1Q5XA 2D0OA 4COBA 3BI0A 5IR2A 3FF3A 2HI6A 3EZAA 4JVOA 4C8CA 3D7DA 3RBUA 4NGNA 2FM4A 4NGMA 3TLAA 3TYXA 4C8AA 4OC3A 1VI4A 3VTAA 2HROA 5JVLA 4C9EA 1KEEB 3BXMA 1KBLA 3SJXA 3ICUA 1Z8LA 4NGSA 5F5XA 1ZRSA 1CE8B 1A9XB 4LQGA 4NGTA 4TWEA 5D29A 4CZ1A 2YJTA 4COGA 3TLGA 3C8OA 4P4JA 3T05A 3I6SA 2C6GA 1M6VB 2C6PA 3TLYA 3BI1A 1BXRB 4C9AA 3TLBA 3TLCA 2C6CA 4OC1A 3FECA 3FEEA 1VBGA 4P4DA 3IWWA 1NBWA 4P4IA 4NGPA 4P4EA 3T0TA 2EK9A 4MI1A 4W9YA 3K9TA 2R82A 3FEDA 4MCQA 3KRVA 1JDEA 1XF1A 1DE4C 1Y9ZA 3EZBA 4H1HA 3S9MA 2EZCA 2XEJA 4CO9A 4KNGE 1VBHA
chains in the Genus database with same CATH topology
4TJVA 4P44A 3S9LA 2JBKA 4YN3A 4P4FA 5IB9A 1CX8A 5ELYA 2PVVA 3SJGA 3SJEA 4C9UA 3IIBA 2EK8A 4C84A 4C8TA 4TJXA 4NGQA 4X3RA 2XEGA 2XEFA 3S9NA 4NGRA 3KASA 3SJFA 4JYWA 4C8FA 2GP4A 2OR4A 3D7GA 3D7FA 4C8UA 4C99A 4JZ0A 2JBJA 3BHXA 4OC5A 2XEIA 4OC2A 4P45A 4P4BA 4C8PA 4CDJA 4C86A 4MCSA 4OMEA 2C5QA 4OC4A 3EIFA 1V6CA 5F09A 4OC0A 4CDKA 1WVMA 3D7HA 2OOTA 4C9VA 4MCRA 4MCPA 2CIJA 3I74A 4C9RA 2PVWA 4C85A 3BI0A 5IR2A 3FF3A 4C8CA 3D7DA 3RBUA 4NGNA 4NGMA 4C8AA 4OC3A 3VTAA 4C9EA 3BXMA 3SJXA 3ICUA 1Z8LA 4NGSA 4LQGA 4NGTA 4TWEA 5D29A 4P4JA 3I6SA 2C6GA 2C6PA 4C9AA 3BI1A 2C6CA 4OC1A 3FECA 3FEEA 4P4DA 3IWWA 4P4IA 4NGPA 4P4EA 2EK9A 4W9YA 3K9TA 4MCQA 3FEDA 1Y9ZA 1XF1A 1DE4C 3S9MA 2XEJA 4KNGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TJV A;  4P44 A;  3S9L A;  2JBK A;  4YN3 A;  4P4F A;  5IB9 A;  1CX8 A;  5ELY A;  2PVV A;  3SJG A;  3SJE A;  4C9U A;  3IIB A;  2EK8 A;  4C84 A;  4C8T A;  4TJX A;  4NGQ A;  4X3R A;  2XEG A;  2XEF A;  3S9N A;  4NGR A;  3KAS A;  3SJF A;  4JYW A;  4C8F A;  2OR4 A;  3D7G A;  3D7F A;  4C8U A;  4C99 A;  4JZ0 A;  2JBJ A;  3BHX A;  4OC5 A;  2XEI A;  4OC2 A;  4P45 A;  4P4B A;  4C8P A;  4CDJ A;  4C86 A;  4MCS A;  4OME A;  4OC4 A;  3EIF A;  1V6C A;  5F09 A;  4OC0 A;  4CDK A;  1WVM A;  3D7H A;  2OOT A;  4C9V A;  4MCR A;  4MCP A;  2CIJ A;  3I74 A;  4C9R A;  2PVW A;  4C85 A;  3BI0 A;  3FF3 A;  4C8C A;  3D7D A;  3RBU A;  4NGN A;  4NGM A;  4C8A A;  4OC3 A;  3VTA A;  4C9E A;  3BXM A;  3SJX A;  3ICU A;  1Z8L A;  4NGS A;  4LQG A;  4NGT A;  4TWE A;  5D29 A;  4P4J A;  3I6S A;  2C6G A;  2C6P A;  4C9A A;  3BI1 A;  2C6C A;  4OC1 A;  3FEC A;  3FEE A;  4P4D A;  3IWW A;  4P4I A;  4NGP A;  4P4E A;  2EK9 A;  4W9Y A;  4MCQ A;  3FED A;  1Y9Z A;  1XF1 A;  1DE4 C;  3S9M A;  2XEJ A;  4KNG E; 
#chains in the Genus database with same CATH topology
 4TJV A;  4P44 A;  3S9L A;  2JBK A;  4YN3 A;  4P4F A;  5IB9 A;  4EYS A;  1DIK A;  1CX8 A;  5ELY A;  2PVV A;  3SJG A;  2MP0 A;  3G23 A;  3SJE A;  2EZB A;  4C9U A;  3EZE A;  2PCN A;  1NXJ A;  3IIB A;  2EK8 A;  1C30 B;  4C84 A;  2EZA A;  4C8T A;  3U1B A;  4TJX A;  4NGQ A;  1ZL0 A;  2AUN A;  2XEG A;  2XEF A;  4X3R A;  3S9N A;  1EZB A;  4NGR A;  3KAS A;  4E94 A;  3T5M A;  1T36 B;  1R61 A;  4JYW A;  3SJF A;  4IIY A;  3T07 A;  2YJV A;  1KC7 A;  4INJ A;  4C8F A;  2E28 A;  5F1Y A;  2B0A A;  3NOJ A;  2GP4 A;  2OR4 A;  3D7G A;  1EZA A;  4IIX A;  3D7F A;  2X0S A;  4C8U A;  3GJZ A;  1GGO A;  2DIK A;  4C99 A;  4JZ0 A;  4M8D A;  2D0P A;  3SR3 A;  5F9M A;  1J3L A;  2JBJ A;  3BHX A;  2HWG A;  2AUM A;  4OC5 A;  2XEI A;  4OC2 A;  4P45 A;  4P4B A;  4C8P A;  4CDJ A;  4C86 A;  1CS0 B;  4MCS A;  4OME A;  2C5Q A;  4MJX A;  4OC4 A;  4E5S A;  1C3O B;  3EIF A;  3TLE A;  1V6C A;  3K4I A;  3TLZ A;  5F09 A;  4OC0 A;  4CDK A;  5FD8 A;  1WVM A;  1JDB C;  3D7H A;  5JYB A;  2OOT A;  1ZYM A;  5K99 A;  4C9V A;  4MCR A;  2OLS A;  4MCP A;  2CIJ A;  4J0N A;  3TLG B;  3I74 A;  4C9R A;  2PVW A;  4C85 A;  1Q5X A;  2D0O A;  4COB A;  3BI0 A;  5IR2 A;  3FF3 A;  2HI6 A;  3EZA A;  4JVO A;  4C8C A;  3D7D A;  3RBU A;  4NGN A;  2FM4 A;  4NGM A;  3TLA A;  3TYX A;  4C8A A;  4OC3 A;  1VI4 A;  3VTA A;  2HRO A;  5JVL A;  4C9E A;  1KEE B;  3BXM A;  1KBL A;  3SJX A;  3ICU A;  1Z8L A;  4NGS A;  5F5X A;  1ZRS A;  1CE8 B;  1A9X B;  4LQG A;  4NGT A;  4TWE A;  5D29 A;  4CZ1 A;  2YJT A;  4COG A;  3TLG A;  3C8O A;  4P4J A;  3T05 A;  3I6S A;  2C6G A;  1M6V B;  2C6P A;  3TLY A;  3BI1 A;  1BXR B;  4C9A A;  3TLB A;  3TLC A;  2C6C A;  4OC1 A;  3FEC A;  3FEE A;  1VBG A;  4P4D A;  3IWW A;  1NBW A;  4P4I A;  4NGP A;  4P4E A;  3T0T A;  2EK9 A;  4MI1 A;  4W9Y A;  3K9T A;  2R82 A;  3FED A;  4MCQ A;  3KRV A;  1JDE A;  1XF1 A;  1DE4 C;  1Y9Z A;  3EZB A;  4H1H A;  3S9M A;  2EZC A;  2XEJ A;  4CO9 A;  4KNG E;  1VBH A; 
#chains in the Genus database with same CATH homology
 4TJV A;  4P44 A;  3S9L A;  2JBK A;  4YN3 A;  4P4F A;  5IB9 A;  1CX8 A;  5ELY A;  2PVV A;  3SJG A;  3SJE A;  4C9U A;  3IIB A;  2EK8 A;  4C84 A;  4C8T A;  4TJX A;  4NGQ A;  4X3R A;  2XEG A;  2XEF A;  3S9N A;  4NGR A;  3KAS A;  3SJF A;  4JYW A;  4C8F A;  2GP4 A;  2OR4 A;  3D7G A;  3D7F A;  4C8U A;  4C99 A;  4JZ0 A;  2JBJ A;  3BHX A;  4OC5 A;  2XEI A;  4OC2 A;  4P45 A;  4P4B A;  4C8P A;  4CDJ A;  4C86 A;  4MCS A;  4OME A;  2C5Q A;  4OC4 A;  3EIF A;  1V6C A;  5F09 A;  4OC0 A;  4CDK A;  1WVM A;  3D7H A;  2OOT A;  4C9V A;  4MCR A;  4MCP A;  2CIJ A;  3I74 A;  4C9R A;  2PVW A;  4C85 A;  3BI0 A;  5IR2 A;  3FF3 A;  4C8C A;  3D7D A;  3RBU A;  4NGN A;  4NGM A;  4C8A A;  4OC3 A;  3VTA A;  4C9E A;  3BXM A;  3SJX A;  3ICU A;  1Z8L A;  4NGS A;  4LQG A;  4NGT A;  4TWE A;  5D29 A;  4P4J A;  3I6S A;  2C6G A;  2C6P A;  4C9A A;  3BI1 A;  2C6C A;  4OC1 A;  3FEC A;  3FEE A;  4P4D A;  3IWW A;  4P4I A;  4NGP A;  4P4E A;  2EK9 A;  4W9Y A;  3K9T A;  4MCQ A;  3FED A;  1Y9Z A;  1XF1 A;  1DE4 C;  3S9M A;  2XEJ A;  4KNG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...