4TJXA

Crystal structure of protease-associated domain of arabidopsis vsr1 in complex with aleurain peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
153
Chain Sequence
b'VEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPDYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting receptor 1
publication title How vacuolar sorting receptor proteins interact with their cargo proteins: crystal structures of apo and cargo-bound forms of the protease-associated domain from an Arabidopsis vacuolar sorting receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein transport
total genus 44
structure length 153
sequence length 160
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4tjxA00
4TJVA 4C9EA 3D7DA 4NGQA 4JYWA 4NGRA 3BXMA 3KASA 3D7GA 1XF1A 2EK8A 4OMEA 4OC0A 4C99A 4MCPA 3VTAA 3RBUA 2OR4A 2XEJA 4C9RA 2C6GA 4LQGA 2PVWA 2JBJA 4C8CA 5IB9A 3SJFA 4MCSA 4C8AA 2XEIA 4C9UA 4C8FA 4OC2A 3BI0A 2XEFA 4C85A 3ICUA 4MCQA 3SJGA 1WVMA 4P4BA 3S9MA 3FF3A 4C8TA 4P4EA 4CDKA 4MCRA 4NGSA 1CX8A 3BI1A 4C8UA 5F09A 4C9AA 3EIFA 3SJEA 4P4FA 1Z8LA 2C6PA 4OC5A 3BHXA 3S9LA 3D7HA 3IWWA 4NGTA 4P4IA 4P4JA 4NGMA 3IIBA 4KNGE 2OOTA 4C9VA 4P45A 4CDJA 2C6CA 1DE4C 4C84A 2XEGA 2EK9A 4TWEA 4P44A 1V6CA 2PVVA 4OC1A 5D29A 4NGPA 3I74A 3I6SA 5ELYA 4W9YA 4C8PA 4C86A 2CIJA 4JZ0A 3FEDA 4TJXA 3SJXA 3FECA 1Y9ZA 4NGNA 3FEEA 2JBKA 4P4DA 4OC3A 3D7FA 3S9NA 4X3RA 4OC4A 4YN3A
chains in the Genus database with same CATH superfamily
4H1HA 3NOJA 3TYXA 4INJA 1ZL0A 2AUNA 4TJVA 4CO9A 4C9RA 4MI1A 4C9EA 1VI4A 3D7DA 4NGQA 4JYWA 4NGRA 3BXMA 2X0SA 3KASA 3D7GA 1CS0B 1XF1A 2D0PA 2EK8A 4OMEA 5F1YA 4OC0A 4C99A 5JVLA 2HWGA 1KC7A 4MCPA 3VTAA 2C5QA 3RBUA 2OR4A 2XEJA 3KRVA 3GJZA 2C6GA 3TLBA 4LQGA 1C30B 2PVWA 2EZBA 2JBJA 1ZYMA 3T0TA 4C8CA 2D0OA 5IB9A 4COGA 3SJFA 4MCSA 5F5XA 4C8AA 2XEIA 4C9UA 1KBLA 1CE8B 2HI6A 4C8FA 4OC2A 2GP4A 3BI0A 2EZAA 2XEFA 4C85A 3ICUA 3EZEA 1NBWA 4MCQA 3SJGA 1WVMA 1BXRB 4P4BA 5IR2A 3S9MA 4J0NA 3FF3A 4C8TA 4P4EA 4CDKA 4MCRA 4NGSA 3T05A 1CX8A 3BI1A 5F9MA 3U1BA 2R82A 1J3LA 4C8UA 1EZAA 5F09A 4C9AA 1VBGA 3EIFA 3SJEA 4P4FA 1Z8LA 2C6PA 1JDEA 3T07A 1A9XB 4OC5A 3BHXA 3S9LA 3D7HA 3IWWA 3K9TA 3TLGB 4NGTA 1JDBC 2B0AA 4MJXA 4P4IA 4E94A 1EZBA 4P4JA 3TLCA 4NGMA 3IIBA 2YJTA 4KNGE 2OOTA 4C9VA 4P45A 4CDJA 2YJVA 2C6CA 4CZ1A 1DE4C 4C84A 2XEGA 3C8OA 4JVOA 4E5SA 5K99A 2EK9A 3TLEA 1NXJA 1VBHA 2DIKA 4P44A 4TWEA 1V6CA 2EZCA 2PVVA 4OC1A 3T5MA 1DIKA 5D29A 1ZRSA 4NGPA 3SR3A 3EZBA 2OLSA 3G23A 3I74A 5FD8A 3TLZA 3I6SA 5ELYA 4W9YA 4C8PA 1Q5XA 1KEEB 4C86A 2CIJA 4JZ0A 4IIYA 3TLAA 3TLYA 3FEDA 3EZAA 4TJXA 2FM4A 3SJXA 3FECA 1GGOA 4IIXA 2HROA 1Y9ZA 4NGNA 3FEEA 2JBKA 4P4DA 2AUMA 3TLGA 4OC3A 3D7FA 3S9NA 5JYBA 1T36B 2E28A 4EYSA 4X3RA 4COBA 1C3OB 2MP0A 3K4IA 1M6VB 4M8DA 1R61A 2PCNA 4OC4A 4YN3A
chains in the Genus database with same CATH topology
4TJVA 4C9EA 3D7DA 4NGQA 4JYWA 4NGRA 3BXMA 3KASA 3D7GA 1XF1A 2EK8A 4OMEA 4OC0A 4C99A 4MCPA 3VTAA 2C5QA 3RBUA 2OR4A 2XEJA 4C9RA 2C6GA 4LQGA 2PVWA 2JBJA 4C8CA 5IB9A 3SJFA 4MCSA 4C8AA 2XEIA 4C9UA 4C8FA 4OC2A 2GP4A 3BI0A 2XEFA 4C85A 3ICUA 4MCQA 3SJGA 1WVMA 4P4BA 5IR2A 3S9MA 3FF3A 4C8TA 4P4EA 4CDKA 4MCRA 4NGSA 1CX8A 3BI1A 4C8UA 5F09A 4C9AA 3EIFA 3SJEA 4P4FA 1Z8LA 2C6PA 4OC5A 3BHXA 3S9LA 3D7HA 3IWWA 3K9TA 4NGTA 4P4IA 4P4JA 4NGMA 3IIBA 4KNGE 2OOTA 4C9VA 4P45A 4CDJA 2C6CA 1DE4C 4C84A 2XEGA 2EK9A 4TWEA 4P44A 1V6CA 2PVVA 4OC1A 5D29A 4NGPA 3I74A 3I6SA 5ELYA 4W9YA 4C8PA 4C86A 2CIJA 4JZ0A 3FEDA 4TJXA 3SJXA 3FECA 1Y9ZA 4NGNA 3FEEA 2JBKA 4P4DA 4OC3A 3D7FA 3S9NA 4X3RA 4OC4A 4YN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TJV A;  4C9E A;  3D7D A;  4NGQ A;  4JYW A;  4NGR A;  3BXM A;  3KAS A;  3D7G A;  1XF1 A;  2EK8 A;  4OME A;  4OC0 A;  4C99 A;  4MCP A;  3VTA A;  3RBU A;  2OR4 A;  2XEJ A;  4C9R A;  2C6G A;  4LQG A;  2PVW A;  2JBJ A;  4C8C A;  5IB9 A;  3SJF A;  4MCS A;  4C8A A;  2XEI A;  4C9U A;  4C8F A;  4OC2 A;  3BI0 A;  2XEF A;  4C85 A;  3ICU A;  4MCQ A;  3SJG A;  1WVM A;  4P4B A;  3S9M A;  3FF3 A;  4C8T A;  4P4E A;  4CDK A;  4MCR A;  4NGS A;  1CX8 A;  3BI1 A;  4C8U A;  5F09 A;  4C9A A;  3EIF A;  3SJE A;  4P4F A;  1Z8L A;  2C6P A;  4OC5 A;  3BHX A;  3S9L A;  3D7H A;  3IWW A;  4NGT A;  4P4I A;  4P4J A;  4NGM A;  3IIB A;  4KNG E;  2OOT A;  4C9V A;  4P45 A;  4CDJ A;  2C6C A;  1DE4 C;  4C84 A;  2XEG A;  2EK9 A;  4TWE A;  4P44 A;  1V6C A;  2PVV A;  4OC1 A;  5D29 A;  4NGP A;  3I74 A;  3I6S A;  5ELY A;  4W9Y A;  4C8P A;  4C86 A;  2CIJ A;  4JZ0 A;  3FED A;  4TJX A;  3SJX A;  3FEC A;  1Y9Z A;  4NGN A;  3FEE A;  2JBK A;  4P4D A;  4OC3 A;  3D7F A;  3S9N A;  4X3R A;  4OC4 A;  4YN3 A; 
#chains in the Genus database with same CATH topology
 4H1H A;  3NOJ A;  3TYX A;  4INJ A;  1ZL0 A;  2AUN A;  4TJV A;  4CO9 A;  4C9R A;  4MI1 A;  4C9E A;  1VI4 A;  3D7D A;  4NGQ A;  4JYW A;  4NGR A;  3BXM A;  2X0S A;  3KAS A;  3D7G A;  1CS0 B;  1XF1 A;  2D0P A;  2EK8 A;  4OME A;  5F1Y A;  4OC0 A;  4C99 A;  5JVL A;  2HWG A;  1KC7 A;  4MCP A;  3VTA A;  2C5Q A;  3RBU A;  2OR4 A;  2XEJ A;  3KRV A;  3GJZ A;  2C6G A;  3TLB A;  4LQG A;  1C30 B;  2PVW A;  2EZB A;  2JBJ A;  1ZYM A;  3T0T A;  4C8C A;  2D0O A;  5IB9 A;  4COG A;  3SJF A;  4MCS A;  5F5X A;  4C8A A;  2XEI A;  4C9U A;  1KBL A;  1CE8 B;  2HI6 A;  4C8F A;  4OC2 A;  2GP4 A;  3BI0 A;  2EZA A;  2XEF A;  4C85 A;  3ICU A;  3EZE A;  1NBW A;  4MCQ A;  3SJG A;  1WVM A;  1BXR B;  4P4B A;  5IR2 A;  3S9M A;  4J0N A;  3FF3 A;  4C8T A;  4P4E A;  4CDK A;  4MCR A;  4NGS A;  3T05 A;  1CX8 A;  3BI1 A;  5F9M A;  3U1B A;  2R82 A;  1J3L A;  4C8U A;  1EZA A;  5F09 A;  4C9A A;  1VBG A;  3EIF A;  3SJE A;  4P4F A;  1Z8L A;  2C6P A;  1JDE A;  3T07 A;  1A9X B;  4OC5 A;  3BHX A;  3S9L A;  3D7H A;  3IWW A;  3K9T A;  3TLG B;  4NGT A;  1JDB C;  2B0A A;  4MJX A;  4P4I A;  4E94 A;  1EZB A;  4P4J A;  3TLC A;  4NGM A;  3IIB A;  2YJT A;  4KNG E;  2OOT A;  4C9V A;  4P45 A;  4CDJ A;  2YJV A;  2C6C A;  4CZ1 A;  1DE4 C;  4C84 A;  2XEG A;  3C8O A;  4JVO A;  4E5S A;  5K99 A;  2EK9 A;  3TLE A;  1NXJ A;  1VBH A;  2DIK A;  4P44 A;  4TWE A;  1V6C A;  2EZC A;  2PVV A;  4OC1 A;  3T5M A;  1DIK A;  5D29 A;  1ZRS A;  4NGP A;  3SR3 A;  3EZB A;  2OLS A;  3G23 A;  3I74 A;  5FD8 A;  3TLZ A;  3I6S A;  5ELY A;  4W9Y A;  4C8P A;  1Q5X A;  1KEE B;  4C86 A;  2CIJ A;  4JZ0 A;  4IIY A;  3TLA A;  3TLY A;  3FED A;  3EZA A;  4TJX A;  2FM4 A;  3SJX A;  3FEC A;  1GGO A;  4IIX A;  2HRO A;  1Y9Z A;  4NGN A;  3FEE A;  2JBK A;  4P4D A;  2AUM A;  3TLG A;  4OC3 A;  3D7F A;  3S9N A;  5JYB A;  1T36 B;  2E28 A;  4EYS A;  4X3R A;  4COB A;  1C3O B;  2MP0 A;  3K4I A;  1M6V B;  4M8D A;  1R61 A;  2PCN A;  4OC4 A;  4YN3 A; 
#chains in the Genus database with same CATH homology
 4TJV A;  4C9E A;  3D7D A;  4NGQ A;  4JYW A;  4NGR A;  3BXM A;  3KAS A;  3D7G A;  1XF1 A;  2EK8 A;  4OME A;  4OC0 A;  4C99 A;  4MCP A;  3VTA A;  2C5Q A;  3RBU A;  2OR4 A;  2XEJ A;  4C9R A;  2C6G A;  4LQG A;  2PVW A;  2JBJ A;  4C8C A;  5IB9 A;  3SJF A;  4MCS A;  4C8A A;  2XEI A;  4C9U A;  4C8F A;  4OC2 A;  2GP4 A;  3BI0 A;  2XEF A;  4C85 A;  3ICU A;  4MCQ A;  3SJG A;  1WVM A;  4P4B A;  5IR2 A;  3S9M A;  3FF3 A;  4C8T A;  4P4E A;  4CDK A;  4MCR A;  4NGS A;  1CX8 A;  3BI1 A;  4C8U A;  5F09 A;  4C9A A;  3EIF A;  3SJE A;  4P4F A;  1Z8L A;  2C6P A;  4OC5 A;  3BHX A;  3S9L A;  3D7H A;  3IWW A;  3K9T A;  4NGT A;  4P4I A;  4P4J A;  4NGM A;  3IIB A;  4KNG E;  2OOT A;  4C9V A;  4P45 A;  4CDJ A;  2C6C A;  1DE4 C;  4C84 A;  2XEG A;  2EK9 A;  4TWE A;  4P44 A;  1V6C A;  2PVV A;  4OC1 A;  5D29 A;  4NGP A;  3I74 A;  3I6S A;  5ELY A;  4W9Y A;  4C8P A;  4C86 A;  2CIJ A;  4JZ0 A;  3FED A;  4TJX A;  3SJX A;  3FEC A;  1Y9Z A;  4NGN A;  3FEE A;  2JBK A;  4P4D A;  4OC3 A;  3D7F A;  3S9N A;  4X3R A;  4OC4 A;  4YN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...