4TL7A

Crystal structure of n-terminal c1 domain of kaic
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
234
structure length
225
Chain Sequence
QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus (strain pcc 7942)
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 81
structure length 225
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl7A00
1A7JA 2BM1A 4A4DA 2J9RA 2ZPTX 3BORA 4KVGA 1SVWA 3HPQA 2CXXA 1G7SA 2VQSA 4JKYA 2ZJAA 2EFDB 2QTVB 1HT1E 1TUIA 4I99A 5DHFA 1DARA 2IF2A 2QMEA 2WBLC 2XTZA 3ETLA 1FP7A 2QRZA 2OV2A 1UEJA 2ONJA 3EPJA 4TMVA 5G53C 3A1VA 3QKRA 1JPJA 1JR3A 4KJZA 3AKYA 2HV8A 3WYAA 3R7WA 1ZM7A 4RD6A 3WNDA 2JLSA 3TK1A 1BKDR 3DZDA 4FIDA 1HTWA 1N6NA 4DBLC 1KI4A 1R5OA 3PUYA 1XJ0A 1N5IA 4O2LA 3MWYW 1N2CE 2BJVA 4JJKA 4E03A 3EAQA 3I5XA 3CF2A 4UNRA 1COWD 2BCGY 1Y3AA 2OEPA 2WKQA 1JQLB 2FGKA 4Q9KA 4B76A 3BB1A 1KJYA 2WWGA 4QFMA 4D81A 4DUGD 4AYXA 2YINC 4KI0A 1SULA 3R7WB 3D7MA 1FW6A 3ZLJA 1LF0A 4TLBA 3IBGA 3CLVA 4OYHA 4OI4A 2JDID 4ASUD 1JBKA 1FQJA 2PX3A 2RGAA 3FFAA 1M7HA 2FSIA 2JIZD 5E3HA 2FMXA 2ONKA 4FN5A 2BVNA 1HUQA 3D8BA 3GJ6A 5JWHA 3L0PA 4DZZA 4IRUB 5EE9A 4DJTA 3RRNA 5IHPA 2VF8A 1QVAA 3M4YA 2B92A 4O3MA 3QKUA 5LPNA 4WZ6A 2WKPA 2XX3A 4FMDF 1WQ1R 3W6OA 2ZSEA 2BDTA 2Q6TA 1IJFA 1VCMA 3ZQ6A 2LKCA 4IJMA 1Z47A 4IDNA 1HE8B 4CT4B 3Q7PA 1Z07A 2NQ2C 3RLFA 1R0ZA 1DPFA 2JLUA 1N5LA 1ZW6A 5TY0A 1KSGA 3SQXA 2DFLA 2ZAOA 4L4UA 3SYKA 2REOA 1Q20A 1E9EA 1P3JA 2HLDD 3NDPA 2GJKA 3OFNA 4BQSA 3OE7D 3GFOA 2G1JA 3W6PA 4I4LA 2BC9A 4OJQA 2N46A 3FKQA 3NIBA 1AQUA 3M0EA 4WXPA 4G5QA 2W6IA 4R71A 2ZRKA 1ZP6A 3MJRA 3KJHA 1YZUA 3LO5A 5JRZA 4HATA 2J7KA 2QPOA 3LA6A 1JECA 3GCGA 2F7SA 3K9HA 3PV0A 2EYQA 1QBKC 2WJIA 2QBYA 1X8LA 1KI2A 2AFIE 3ICEA 3KXLA 3NKVA 3ZIAA 3K0SA 3QF7A 3DKPA 1RZ3A 4GMXA 4X8HA 1L8QA 1FX0B 1IXZA 2WICA 4B2PA 3SJBA 1NI3A 2VTKA 4IDOA 1QVRA 1OE0A 4JMPA 3L8YA 3PUWA 3EA0A 2ERXA 3P32A 4JLOA 1P2SA 3KQUA 4DLXA 3K70C 4EUNA 4XIGS 2PEZA 4JKIA 1T8UA 2F9MA 2QL6A 3ADCA 4V0NA 3VNUA 3EZ7A 2IW3A 1KI7A 2X2FA 1QG4A 4URXR 4PPFA 4BASA 2Z43A 1EFRD 4HAUA 4M1KA 5EE3A 1EFHA 3CUEF 2XSZA 3RC8A 1CJUC 1ELOA 2GVDC 1GDDA 3K09A 4DWJA 4QM6A 2Q3HA 2REXB 3MJHA 3B82A 4Q1FA 3U7EB 5C2JB 3PVSA 4CT5A 2FEOA 3B13B 1XZPA 4NCJA 4C2TA 4LI0A 4DLVA 3DMNA 1PLKA 2WWXA 3MG9A 4ZI3A 1ZUHA 2C78A 3PIRA 3PITA 1KKLA 5CM8B 1S96A 1W36B 1KNXA 3MCAA 3B9QA 3VR5A 5FBVB 5KPJA 3ZS8A 2GXSA 4D2IA 4LZZA 1L4UA 1W47A 2WWWA 1W46A 4B34A 1CJVC 2GA8A 4DCUA 1KO1A 4V02A 2EVWX 1E9AA 1U94A 5CIQA 3A4MA 1EWQA 1Q22A 1E2IA 2EU8A 3R20A 4ZPXA 2E87A 5E7MA 4V03A 4AKIA 3LQRA 3KTAB 4F91B 4GP7A 2AD5A 2ZUDA 1OH5A 1KJZA 5A0FA 2XZOA 3PEWA 2IS6A 1GNRA 3B85A 4IOKA 1YU9A 5JBQA 4ON9A 4TL9A 3RS3A 3T61A 1ZNWA 3HP1A 2NO6A 3BE4A 1UBCA 4L9SA 2JGNA 3ND8A 3VU9A 1EFUA 1CTQA 2CNWA 2L0XA 4QNRA 1Z6GA 3IBYA 4ZDJA 1W36D 3VR6A 3AF0A 5K8IA 5AJVB 1FNMA 2A78A 1OB2A 1CXZA 1P72A 3EA5A 3U7FB 1KGDA 2GZAA 2BM0A 3QBTA 3SI7A 4LYHA 1KZ7B 4UXIA 2BBOA 2OBLA 2J59A 3PR1A 4Y0AA 3THOA 1NF3A 3CKLA 4IOJA 2XXAA 4ZCLA 3TVDA 1BMFD 1WCV1 2GK7A 4HZUB 2ZRMA 2D3WA 3AB3A 5FPSA 4NP6A 2FH5B 2PZEA 4IFEA 3N70A 3NH9A 4KYIB 4Q4JA 4US0R 4A82A 5JEEA 1AS2A 4G3XA 3LX8A 2OT3B 3FKSA 2NZJA 5JHGB 4TQAA 3KUCA 2ZTSA 1VPLA 1CIPA 2IYTA 3A58B 3UK6A 2QBYB 4GNKA 2ZRHA 5AUPB 2P6RA 1M8PA 3B78A 2XEXA 3H86A 3OEHD 4BLTA 4DB4A 1R5BA 1TX4B 1MO5A 1KDTA 1NVWQ 2C99A 1UBFA 5FTNA 5GJVC 2DB3A 1R2QA 2QTFA 3MWJA 5JZVA 1G7TA 1MOZA 2IHYA 4PC6A 4HDCA 3ICQB 2R6CA 1ZCBA 2ZS8A 4LBYA 1NBMD 1XEXB 4U00A 1CR2A 3IHWA 4OHVA 2JJ8A 5B58C 2R6DA 3PEVA 4LYAA 2ZE7A 4QM7A 3LW8A 1E32A 3JZAA 5KSZA 1YZLA 1XPUA 2HT6A 2J45A 3B1YA 4MKHA 2R44A 2WJVA 2NPFA 2WIBA 4MYCA 1D2MA 3I61A 1KI3A 5C4MA 5HR5A 5FTMA 2OXRA 4QRHA 4HLDA 1U98A 5DE3A 4XSHA 1NSTA 2BKUA 3LLUA 2IS4A 4NKRA 2DWQA 2HYIC 3GFPA 2J0UB 1OV4A 2JA1A 4LYJA 1P6XA 4M1OA 2ODEA 4W5JA 5C4GB 4Q9IA 1LY1A 2PCLA 2OAQ1 1NVUQ 3NTUA 5FPYA 3R9IA 2WWIA 1UBGA 3LX5A 2WPDD 4WOPA 1JR3D 1XFAA 4KHZA 3QKSA 5SZKB 4LHVA 1TEXA 4N0DA 3EC2A 2CE2X 1NN5A 2B8WA 3HWSA 2X1VA 2OZEA 2V54A 3K0FB 3I72A 5CITA 3U4QA 2J46A 3A1UA 2RGBA 1ZM9A 3RS4A 3KJGA 4MITA 4JLJA 1IY2A 2ZJ5A 2ZRFA 4E5UA 3X1WA 4LYFA 2FA9A 1OFTA 1S3GA 2W58A 1F5NA 3TSZA 1RFLA 3VX3A 4A8JA 1F3OA 2OILA 3DHWC 3HPRA 2GBLC 4NU0A 1IN5A 1VIYA 5FTJA 2J0QA 3LBHA 2CK3D 4ACAA 2O8BA 1UF9A 3TJZA 4TMTA 1P7CA 4NZYA 3RSOA 1LV7A 2FG5A 3CRW1 3BD9A 4DLRA 1IAQA 4LOAA 1VYTA 3LD9A 4M9QA 1ZC4A 2VP2A 3NHAA 1OXVA 3U6KA 2WVJA 3KZ1E 5JCZA 4C0LA 4MGYR 4EPXA 1DAGA 1Z6TA 2AHOA 2WWFA 4URZR 5CYPA 2QEQA 5DYGA 5EE5B 3RHFA 2O8FB 3W6NA 3AVTA 5M04A 2JJ2A 4RD4A 1NNEA 3B5JA 5JRJA 3ZD7A 3G82C 3AKEA 4KO8A 2F3RA 1KYIA 2FDCA 3QG5A 5IRCD 1IN6A 1DADA 3SHWA 4S35A 5F2EA 2BMEA 4UXJA 3NEJA 1T0HB 3U3RA 3TGPA 1VYVA 2JLWA 2WOJA 3K0AA 2PBRA 2UZIR 2G0TA 3B1WA 3K53A 4ARZB 2V55B 3OFND 4OI2A 3I4LA 1OH8A 1GSIA 3NVAA 3K70D 1T91A 4DDTA 1M7BA 3VR1A 5IT5A 3U60B 3N2EA 1N25A 3RNLA 3OAAD 2Z4SA 3AVUA 3DVLA 4ESHA 1JALA 3ZJYA 1Z22A 1KDRA 3KFXA 3CX6A 2CL7X 1J2JA 2LCFA 2YWHA 3EWSA 4IXMA 3KUDA 4PO8A 1A4RA 2VP5A 3QEJA 1YR7A 3TW8B 5CJ2A 5G40A 1HE1C 3GJ0A 2H57A 2W2VA 3FHCB 3RSLA 3UPUA 1Z06A 3HJNA 3CW2A 2PMDA 4BEJA 3B1XA 3KB1A 4ZIRA 3LV8A 1DG3A 3TQCA 4EFMA 4LC0A 4KBFA 1A82A 4M1YA 1UKVY 2CJWB 2IX3A 5TARA 1EG7A 2GNOA 4L9WA 1IN7A 1P61B 3KJEA 3SR0A 4X8LA 1RPZA 3IKJA 2NPIA 2ZI6A 2X8AA 4DSTA 1UDWA 2GZDA 2JJ1A 2X2EA 3B1ZA 1WBDA 4P4TA 4JVNA 4RY2A 1X8KA 5FUXA 1UDXA 5AK0A 3QENA 3TSOA 3VMFA 1UFQA 4CF7A 2J87A 3AF1A 4TT3A 5JJKA 1NMXA 2UZ3A 1N6PA 4QGHA 1BOFA 3R9XA 1QDEA 4DCSA 1ESMA 1PV4A 1G3MA 4D0GA 1NKSA 1X86B 2QM8A 3CR7A 3OEHA 3GLGA 4LDJA 4C0HA 5FOSA 3FHOA 2XITA 1XPOA 4CDGA 2IWHA 4ERNA 4IOLA 1FP6A 3ND9A 3GPLA 3IEVA 4ZDIA 2F9LA 3MUFA 1CBUA 5EP1A 4DXAA 2NIPA 2E9SA 2KBFA 4GZMA 4UQOA 4URUR 1B23P 2GESA 1BS1A 3I92A 2ANCA 2AK3A 4TYNA 1U0JA 4QGAA 2GJ8A 3BIFA 1RYFA 3CH5A 5DHAA 5DI9A 2V3CC 4OI1A 3KX2A 4KFTA 1UKZA 3E1SA 4P33A 1RVDA 3V00A 2OUKA 4DEXA 1TQ2A 5KDOA 1IN8A 4B2LA 2CCGA 3WXMA 4BFZA 5FBRB 1N6HA 2ZRPA 1QHHB 1TF2A 4C2UA 1C4OA 3QG1A 2YKGA 3OIWA 4AG5A 2CVHA 4B6FA 4Q7LA 1KDOA 1G5TA 2GK6A 4FI3C 1SVMA 2IUTA 4UKDA 5EP4A 4TZ6A 4DLYA 1XJCA 2GF9A 4ASUA 4M53A 2EYUA 2C5LA 3QE0A 4TYQA 1TEVA 1Z0FA 1T8TA 1G8PA 4TSFD 3OEEA 3GLHB 4PANA 4ZKEA 3PFIA 2FV8A 2VH5R 2G9NA 2CEAA 4G5OA 3DDCA 3FWYA 3TUZC 1SKYE 4KBGA 4DEYA 3Q7QA 1ONBA 5EJEA 3CPJB 2C77A 3QI2A 4MRVA 1MKYA 1QHSA 4N1AA 2QORA 2D2FA 1PUJA 1KHTA 3THYB 2NTYC 3S1AA 2ZSFA 2WSSD 2DCUA 4MYTA 4IVRA 3TAUA 3VX4A 5JWRA 1KZGB 4JIMA 3ZVMA 3AKCA 3LAWA 4MDEA 5FUWA 3L82B 3K9LA 2GEDA 1EGAA 2EFHB 4B44A 2IBMA 1Q0UA 2F43B 3QPWA 4U5XA 1XF9A 2ZJ2A 4CEIB 2AWNA 3RANA 4EQ6A 1E9BA 4PPQA 2ZR7A 3BB3A 521PA 3PUZA 4FMDB 2BIFA 1R6BX 1ANKA 4DT1A 1KIMA 5LD2C 2VHCA 3QF4A 2UKDA 2YNMA 3WYFA 1VCOA 4FXPA 3RVBA 3UG7A 5CLLA 4DC9A 4F93B 3T34A 1GL6A 3CH4B 3QVUA 2Q9BA 2VHQA 1CKEA 2AX4A 1RC8A 5JS8A 1GM5A 2JJ2D 1SVKA 4O2RA 1P4SA 4NYJQ 5AJXA 2ZUCA 4CEJA 4KYUA 4CEHB 1N6RA 1G19A 3T12A 1WP9A 3CONA 1E96A 2PT5A 4JLDA 3L8ZA 2CL6X 1XD2A 3A4LA 2BWJA 1CP2A 1U8ZA 2H18A 2X77A 3IO5A 5IK2D 1R7RA 2WV9A 1T3SA 1OFUX 2CK3A 3G0HA 4JL8A 1OLOA 3THWB 1FTNA 1AZSC 1ZVQA 2GWHA 4PX9A 1GILA 5CLQA 5FUYA 3TSWA 3UMSA 2VIIA 3WBKA 3AVWA 4DDUA 2FFHA 3AVYA 1US8B 2OBNA 3AV0B 3BC1A 4NYMQ 5B64A 2FF7A 3X1DA 1J8YF 2OFOA 3LW7A 4MRNA 2PLRA 2R6FA 2ODNA 4OHYA 4KLNA 5HE9A 4H9GA 5L3SA 4A9AA 4JT4A 4BEBA 4TYYA 2JLXA 4QXAA 1U90A 2HCJB 1O87A 4NCHA 4AKEA 4UXHA 4YQFA 5L3QB 1ZJ6A 2RMKA 5KNBA 4Q03A 5EXPA 1E9SA 1G5PA 2REBA 3U5ZB 3T1VA 1YR8A 2ZRNA 4MUAA 5FI1B 1AKEA 1J7KA 1K6MA 2RB4A 2ZYWX 3J81k 1VG1A 1KNQA 1ZYUA 5AUQA 3H0KA 4C0KA 1G6HA 4D4KA 5H8WA 1OH7A 4B32A 3K09C 4CEHA 3EZ9A 1Z2AA 1Z8FA 4KXFB 4PR0A 2C96A 4OQFA 1KJWA 3NG1A 1NL3A 1ESNA 2WWYA 1D5CA 3Q3JB 2CLDX 4ZIRB 3KKPA 3A37A 4B75A 4KAXA 1YZQA 1JXMA 3NBFA 4UNSA 5FPTA 3JVVA 4MQBA 1H8ED 3QBVA 1E3MA 1G4UR 1Z0IA 4TWZA 5L3RA 1OJLA 2GCOA 2IUSA 3E70C 2IF0A 3C16C 1PUIA 5HKKA 4PPGA 3EIHA 4RJLA 1KMHB 3LH5A 2Q0HA 2FSFA 1EX7A 3SJCA 3AGPA 3HU1A 1GWNA 3T15A 3LBNA 3DM9B 5ANRB 4EAQA 2FWRA 1FUKA 4W5WA 1HT2E 4XTRA 4URWR 2W0SA 1PJRA 1KI9A 3MD0A 4YMUA 4LJ8A 3EIEA 4OI0A 2XNSA 1E2EA 5KPDA 2VP0A 4PSAA 2D06A 3U3MA 4A0FA 1UADA 2FPMA 4OQNA 621PA 4MRPA 4OQMA 3IDQA 2B7CA 4TN1A 1Q1BA 2GBLA 4GOXA 1OT3A 5F9FA 5K8TA 3LLMA 3LDAA 1P2TA 4RFSA 4Q9LA 2H92A 4JLNA 4JLBA 2GHIA 2HJVA 3L43A 4QBFA 4EDHA 3VHXA 1HA3A 1OIXA 2IYYA 5KSPA 2FU5C 3O8CA 2ECKA 3AKDA 2IEYA 4IDHA 3OAAA 4QL3A 5GJWC 4W9MC 5FBQB 4Q02A 1M34E 1J70A 2IS2A 1T5IA 1AQYA 3GJ7A 3KQHA 4LBZA 3EARA 1RRCA 1NSFA 3U4QB 1FX0A 3CNLA 1Z2CA 3QF4B 4PO9A 4JVSB 4QC2A 3WMGA 4AY2A 3BOSA 4JBXA 4I1OA 2WAXA 4Q9JA 3CPHA 3RWMB 2RKOA 1DAEA 3R8CA 3CF0A 1G3RA 3C8UA 2GJ9A 1JQJC 3LVRE 3GJ5A 4NYIQ 4AWXA 3A1WA 1Z08A 1QHXA 4ZDWA 3NC1C 4PSVA 4AYWA 5B30A 4OHWA 1G3QA 4NL4H 1EFTA 5KOYA 3TUJC 3IPXA 1UBEA 4ZKDA 2JLRA 4N3NA 3DM5A 2BMFA 2CMKA 1KY2A 3I8XA 3FE2A 4TL6A 1AIPA 1IQPA 2EFEB 1LS1A 3IILA 4LSGA 5SZHB 1FL9A 4FCTA 5E7JA 4WZBE 2RGEA 4HI0E 3NH6A 2B7BA 5H70A 5CDFE 2P5SA 4JYCA 2F43A 1LS6A 4IDPA 4BLSA 3I5YA 3SS8A 5FFMA 2CVFA 2A5YB 2UVQA 5JWOA 4LJ5A 3VR2A 1P2UA 1P2VA 2WZQA 5HZKA 3I73A 3N2IA 4OBEA 3W9YA 5TVKA 5BWMA 2ZI7A 3BRWD 2AKAB 3RWOA 3SOPA 4BECA 4R2IA 3CRMA 4PTLA 4XD7A 4KLZA 2C03A 1KTVA 1GG2A 1BO6A 3CF6R 3SE0A 4HB0A 5JCPA 5JSZB 2O8DB 1CU1A 2AFHE 3X1YA 4M8NE 1I2MA 3TKLA 2Q3MA 2EWVA 5FTLA 1A2KC 1CJMA 1IJEA 2BMJA 4MGIR 3KQLA 2HDNB 2XZPA 3EXAA 3K1JA 4GOJA 5HTKA 5DLQC 4JL6A 3PG5A 4V0MA 2XTMA 3SYNA 3FGNA 2K5UA 1EK0A 3DMDA 1RJ9B 1HV8A 3U7GA 5BYKA 3GLFA 5AUNB 2XSZD 4RFVA 4NPHA 5J4KA 2ZM5A 2WAYA 3BFXA 1F60A 4DSUA 3B8HA 4QKQA 3W3AA 1W4CA 4R9UC 4WZAE 2J1LA 3ZVRA 4PC7A 4F7WA 2QP3A 1IXRC 3AEZA 4Q66C 2YC4C 1T0JB 2C9CA 2O8CA 1Z5ZA 4OHXA 2OLJA 3GLFB 1E0SA 3EPHA 1G21E 1WRBA 1MRNA 1W4RA 4HSEA 2YOHA 2ZEJA 3UXMA 3EPKA 2XXAB 2MMCA 4NDZA 1NRJB 4LPSA 5FUVA 4YXWD 3RYTC 2W6ID 3K9NA 4C3ZA 2YHSA 3KB2A 3NBYC 4M9ZA 3WMEA 1Z63A 1VHLA 2CDNA 1II8B 3CBQA 3FFBA 4LJAA 4TYWA 4Z1MD 4M1MA 1PVOA 3KXKA 1W44A 1Y63A 5EQTA 1YZGA 4F38A 4FW9A 1E94E 3FYHA 4I1SA 1F6BA 1W7AA 1DAHA 2QQ0A 3CRQA 2KJQA 5AWFC 4AKGA 5EUQB 1NMZA 2QM7A 1MR3F 4P4SB 4F4IA 1E1QA 2G88A 4IKEA 2GAAA 4JL5A 1ZD8A 4X8MA 1I4LD 5DO9A 4KSCA 5DISB 1YZTA 5E4FA 2DHRA 5EE1A 2GCPA 4B3CA 1MV5A 1CLUA 2GTPA 1EXMA 5D3MA 3TVTA 2ODWA 5KTYA 4HUQA 4A0GA 2RGDA 1DAFA 1JI0A 1OYYA 2A9KA 4MKIA 3TLXA 1XXHB 4DKXA 4JLAA 3BK7A 4FMBB 4JT2A 4A0HA 2ZQ5A 2FN4A 4UJ5A 2O8EB 4GDFA 4IFBA 4RD1A 2V8OA 4GBMA 5AJWA 2JLVA 1KO7A 3NXSA 3C14C 5FR2A 3WNCA 1LVGA 2GKSA 5EZ6B 4JJZA 2ZSBA 5K8UA 2CBZA 3U7HB 4MYUA 4RD2A 1D8TA 2JJ1D 2IT1A 4ESVA 3Q5DA 2HJGA 4IW3B 3THYA 1G16A 2J5XA 2NO0A 1E9RA 1KI8A 2AL7A 4B47A 4DUGA 2V7QA 2IK8A 3VKWA 2J0SA 4OQLA 4A2PA 1E9DA 5FI0B 3U2QA 1VHTA 3RABA 4I81A 2N1BA 2ZE8A 3Q5EA 3TBKA 3W90A 4ZDKA 1G3IA 4A6XA 1MABB 1ZC3A 1CR0A 3T5DA 1FZQA 3GMTA 3GEEA 3GFTA 1FPMA 3HR8A 3I3SR 1CR1A 2QE7D 1RRGA 4FCWA 1N0VC 4LJ6A 2XGJA 2OFXA 1ZRHA 1KAOA 1N0WA 1WMSA 1DAKA 3P20A 3UWKA 1HYQA 4LHXA 1N6KA 2QZ4A 2F3TA 1R8QA 1MO3A 2HYDA 2QSZA 1DOAA 1U9IC 4IXNA 3ECCA 1S0UA 3A4NA 3E5HA 4M1TA 2DWOA 5AJZA 1GRRA 2F6RA 4LV5B 2O8BB 3DPUA 1I4DD 1G20E 2QAGA 1H65A 3WNBA 4TQ9A 4FMCB 1S3SA 1KMHA 1OSNA 3WBJA 3OESA 421PA 2WOOA 2Q9AA 1ODFA 3K70B 2CHVA 1S9HA 1NG1A 2IYWA 2JAQA 4Q9HA 1W4AA 4KFSA 4M22A 1JB1A 4HAVA 1DO0A 2RAPA 3LFUA 2KI5A 4YMSA 2AWOA 4PHFA 4TTRA 2FSGA 4TZ0A 2DFTA 3IIJA 1BYUA 4UNQA 1QHYA 3ZGXA 2ZROA 1CF4A 2Q3FA 2VL7A 3UG6A 1P9WA 4A8JB 5CJPA 3ADBA 1CULC 3A8TA 5FPHA 4A8JC 2F1IA 4TSFA 3KXIA 4A6PA 3REFA 4MGKR 4A36A 1KK1A 1DBSA 2HF9A 2ODBA 3M6AA 4CVNA 3B9PA 1Q44A 4ARZA 5EXTA 2DY1A 4Q00A 5J4YA 4D0NA 4TYPA 2VSFA 3NBXX 1LFDB 5DYIA 4QHTA 1N6LA 3ZH9B 4LJ4A 2QP4A 3U44A 4MDFA 1QHGA 3PQCA 1WA5A 3C41J 1XD9A 3HU3A 5FR1A 2QGNA 3C7KA 2C8VA 3VU9B 4DLSA 2BBTA 6Q21A 4LUCA 3TH5A 4DIDA 4HDOB 2CLCX 2NZ8A 3SJZA 3AM1A 2GETA 2PJZA 2ZRCA 3F0TA 1OHHA 2ZVQX 4DIEA 1BIFA 1Z0DA 4XSGA 2CCJA 1D6JA 4DCTA 5KUTA 1T9HA 4Q4AA 2ZREA 5GJCA 1R0WA 2WSSA 3F5FA 2VHTA 1HQCA 3MRSA 5G41A 4ABYA 1XU4A 2AR7A 2PL3A 5EP3A 1NIJA 4Q4JB 5C1BA 2QNRA 3GLIA 1XD2B 1XNJA 2GRJA 3ZZ0A 2IUUA 4NH0A 5SZIA 3AF4A 2W6JA 1OKKD 3OIUA 4G5RA 3CZQA 3OEED 1XCGB 3CWZA 1DAIA 2QN6A 1S9DA 5EUMA 4BLPA 3QXCA 4Q1DA 4P32A 2YWGA 4O25A 4A0RA 1XMJA 2GJSA 2JDIA 3QEOA 4TMKA 5FBLB 3GLFE 2VPPA 1ZM4A 3MAAC 1XPRA 3PUVA 1CS4C 3K0FA 4A15A 2BHRA 1U2RA 2JEOA 4AG6A 3SQWA 1XMIA 1GITA 5GVSA 1S4QA 4E09A 4Q1AA 2ATVA 3HDTA 5G3YA 3BJIC 2BCJQ 1PZNA 4LHWA 1TQ4A 1VTKA 2IYSA 1NG9A 4R98A 2OG2A 3BWDD 4S2EA 3F8TA 2ZS9A 5EP2A 5LB4A 3VTKA 2Z5FA 3I1FA 3RS0A 1Q3HA 5KO2A 1GP2A 1K8RA 1TADA 4L8GA 3QSYA 5FL7A 2GJAA 4PQFA 3FDIA 3SFVA 4LHYA 1W5SA 3OZXA 1L2TA 3RC3A 2VA8A 3U3KA 3WHKA 1OH6A 1P73A 1GRQA 5AUOB 1SKQA 2F55A 2QA5A 4M21A 1S8FA 3TNFA 2G1KA 3D31A 4A92A 3W5IA 2NO1A 2YC2C 4DDWA 5D3QA 3FMIA 4C7OA 1XEWY 1WBBA 4D4LA 1G4AE 2OXCA 1XEXA 2ERYA 1JAHA 1SXJB 3TIFA 2VYFA 3X1XA 4CGZA 3JVUA 4KU4A 1NN3A 1DG1G 1A2BA 1XCPA 4NCKA 5TXGA 4US1R 2ZITA 1U0HC 1QF9A 1QZXA 5GVRA 1E6CA 5GADl 1Z0JA 3H2YA 1ZD9A 4PXAA 5ELXA 1YQTA 2BOVA 1UKEA 3PUXA 3UWOA 2D4HA 4MA4A 4Q4AB 1KMQA 3CX7A 2PMKA 4JVMA 4QNMA 1J99A 5CYOA 3T1QA 2V9PA 4JSYA 1JPNA 1IOZA 1W0KD 2VLIA 3LWNA 3QOFA 4YMWA 8OHMA 3FMPB 2XB2A 2JASA 1JJVA 4M1WA 4URVR 4K8OA 3SYLA 4QJ3A 2ZRBA 3G5UA 5HKKD 1T3LA 1YVDA 3KKOA 2G3YA 2N42A 3SHFA 4H1VA 4PC2A 3ASYA 2D2EA 3FTQA 1XX6A 1O3YA 3DOFA 4QGFA 4Q1BA 3BH0A 2H7VA 4LV6A 2I4IA 5L3SB 1SVSA 2ZI9A 5LD2B 2V6JA 2NO9A 5FTKA 1KOFA 1E1RD 4Q7JB 4NONA 2PH1A 3BFVA 3IQXA 4MYHA 4DLZA 3O47A 5BYJA 4PZYA 4ACBA 4DHEA 1E79D 2FGJA 2NMVA 1W36C 3GP8A 1U99A 4NYIR 5DI3A 2GZHA 2FFQA 1GUAA 4HLQB 5HCIA 3V4RA 5C18A 4XD7D 3QVVA 4OQXA 3TMKA 1MH1A 4BE7B 1CRPA 3Q9LA 5J4VA 1G6OA 3WP0A 1KY3A 3N5CA 3BGWA 4QBGB 1KSJA 3GD7A 3SFZA 2P65A 1Z0KA 1S1CA 2XTNA 2WMNB 2R9VA 1DELA 3AF3A 4NTZA 4EIWA 4XVUA 2RGCA 1E4YA 3W8RA 1F2TB 1AGPA 1GZSA 2ZJBA 1Z6XA 5JI3E 2HUPA 4PC1A 1NBME 3TR0A 1C1YA 1MT0A 3LBIA 3ZD6A 4L15A 1GL9B 1G3UA 2KSQA 2VHUA 4PHHA 4XWOA 4ZCIA 1M6NA 2NG1A 2OLKA 2O5VA 3T1TA 2QMUA 3FPAA 3KQKA 1XEFA 3MGCA 2IA5A 2DWPA 2VEDA 3EWAA 1SHZA 4ZV4A 3L2OB 3GLIE 3EC1A 2TMKA 4CW7A 2ZXUA 4IDQA 1II9A 1XTQA 1KI6A 3K8YA 1R0YA 4G1UC 3A36A 4AKHA 4ZO4A 3HU2A 3ZIAD 1WXQA 3FVQA 1IXSB 4D4JA 4TMXA 1P9RA 2R6GA 4JLPA 4BPBA 1GNPA 1YR6A 2Q21A 1TQ6A 3ADKA 3SZRA 1G64A 1PLLA 1UPTA 1NKTA 3MFYA 1M74A 2FE4A 1ZINA 2ZR0A 4JBYA 2W2TA 1OB5A 1ZUNB 2O8FA 5FH9A 3UANA 4F4CA 2JLQA 2V1UA 3FHTA 1NN0A 4B3GA 3ONWA 2IYRA 3GLGB 2ZVPX 1UAAA 2FX3A 1E1QD 1OYWA 3FKSD 4DCVA 1Z29A 2CHQA 1YHNA 5FBWB 5J4HA 3PCRB 5FL3A 1G17A 3GJXC 3L0SA 1L4YA 3IQWA 1E2FA 4IVQA 3DZ8A 1CRQA 2G6BA 2C98A 2RCNA 3K9GA 1X1SA 2HCBA 1RE0A 4HB3A 2GF0A 4ZCMA 1D9ZA 4PSKA 4CEIA 3FMFA 2ZSDA 1TUEA 2GCNA 1XXHE 2H1LA 3IUYA 5FL7D 4XWKA 3RRMA 3AVVA 4B74A 3AP2A 2I1QA 4RD3A 2R8RA 5B2ZA 4EFLA 1LW7A 2GXQA 2VBCA 2XNDD 3HYTA 4Z8YA 1JXOA 3QKRB 1M7GA 4M2LA 2YZ2A 4RD0A 1VMAA 3AVOA 1FQKA 1W48A 1ZMXA 3GJ3A 5TDHA 2FJUA 2GXAA 2JIZA 5JMTA 1GTVA 1F2TA 4HLUC 2QY9A 5JI2E 1FMJA 1T3HA 5D3MB 1JEEA 1H8HD 4WXRA 1G5RA 1KKMA 4BLRA 2WSMA 1ETUA 2ZI5A 3LRPA 5TV2A 4C0QC 2MSCB 2XNDA 3NC0C 4B3BA 1ZIPA 2QPTA 3WY9A 1HEIA 2QGZA 4Q7MB 1R10A 2ZRGA 4RVCA 4QOSA 4OK5A 1ZM2A 2R6AA 4Q18A 3MWKA 5EZ5A 4PPNA 3D6TB 4POAA 1ZNZA 4L16A 2ZYUX 2WM9B 4Q5IA 1KI6B 1OXXK 1GL7A 2KE5A 2QG6A 2BBSA 5JLJA 4LBWA 3BS4A 1OHHD 1TAGA 4Q4HB 1T5LA 2ZJYA 3VKHA 4HAXA 4WAUA 3DOEA 4EKDA 1OPXA 3PXGA 1K5DA 4CIDA 4BUJA 3ZDQA 2QROA 1KK0A 1X8JA 2CJWA 3LNCA 1E2JA 1M2OB 2OCPA 3MWLA 2CL0X 2B6HA 4TLDA 1XP8A 1FMLA 4BFTA 2O8EA 1TNDA 2OCBA 3TR5A 2A30A 1EFRA 3DKVA 2ZETA 1QRAA 2W00A 2O8CB 1G291 1N5JA 3ZS9A 4P3YA 4BZPA 2NO7A 2QAGB 4IVPA 2HEIA 3AGQA 1U0LA 4Q19A 2IXFA 5J5CA 4C30A 3TQFA 4W5HA 2C2HA 2PX0A 4DSOA 1ZAKA 1G41A 4OK6A 4XWAA 5DNYB 1EFCA 3QIAA 4ILEA 2ZRLA 1T4GA 1MO4A 2FNAA 3EX7C 4PZLA 3GJ8A 1ZUIA 3IPYA 4GRAA 4K46A 4BFSA 4FWTA 1OIVA 2VRWA 2YYZA 3PEYA 4BFYA 2E1RA 2WJGA 2V1XA 3A1TA 821PA 1OFHA 1XWIA 2WJHA 1AK2A 1XDBA 2ZRIA 4PHGA 5TMPA 4MGZR 3CNOA 4M9XA 1OF1A 3P4YA 2P2LA 4UNPA 3B2EA 2GDJA 3GQBA 1YJ5A 2IYZA 4NBSA 3SU8A 3DO6A 2PZFA 2KBEA 4LC1A 2IWRA 5KNCA 4GZLA 3ADDA 4GT1A 4FCVA 2MMGA 4C0SA 4KITB 4OJKA 3AUXA 1XBTA 2IEZA 1XRJA 5JEDA 1KO4A 4R2HA 1XTRA 1HQYE 2B21A 3ZZTA 2C9OA 2P6NA 1ZIOA 1IY0A 2VO1A 2D7DA 221PA 1ZU4A 4BFVA 2R2AA 1E2QA 3PEUA 5IDVA 1JJ7A 1TF5A 1II0A 2VP6A 4B2IA 2DR3A 2G0NA 4DB2A 1UKYA 2VSXA 1SZPA 4Z54A 3U3OA 2DPXA 2V7QD 1XMVA 4XH9B 3VQTA 1AS0A 1CR4A 4Q48A 1E2HA 1I2DA 1V43A 4JBWA 1TL7C 4NYMR 1W0JD 4TLEA 1XCMA 3LY5A 3W3ZB 1XZQA 2D62A 2QMHA 1AJEA 4LBVA 1XTIA 2ZSAA 5AR1A 3UIEA 4JLKA 1R0XA 1GFIA 4F92B 3K0CA 2R65A 4AD8A 2IYVA 1QHIA 1WE2A 3GEHA 4DLUA 3C5HA 2QQEA 3QUSA 3GLIB 1ZCAA 1NJFA 1E69A 4W7SA 4EJSA 2XJ4A 3P4XA 3ZZUA 1DVRA 5FOTA 5DI3B 5FOUA 4JLMA 1OKKA 2X19A 1A1VA 2VP9A 4TMZA 3U44B 1YZKA 2ZJ8A 1VECA 1X3SA 1IHUA 2YV5A 2YVUA 3DL0A 4HZUA 1DS6A 3BFKA 2ZR9A 1W5TA 1QG2A 4NYJR 5KDLA 4HB4A 2A7QA 2CE7A 4PAOA 1IY1A 3P1JA 4UNNA 3W8NA 2HXSA 2QPAA 4DVGA 2WJYA 2A2ZA 3Q72A 2I3BA 4V0OA 2O0JA 2KWIA 2F1JA 2RGNA 3FOZA 3CZPA 2QAJA 1Z0AA 3QPUA 2QU8A 4R7ZA 4Y0VA 5DGXA 2EFCB 1XMSA 2QTHA 4PFSA 2QI9C 5E95A 3P27A 1W2HA 3FB4A 2BBWA 1F2UA 4UJ3A 4CEJB 1SXJE 2GEUA 4NE2A 2BEJA 2BEKA 4V0KA 3VFDA 1E4VA 1N0UA 3HR7A 4G01B 4OHZA 1W2GA 4XJXA 2YJTD 4CRWB 2LWIA 3ZVNA 5A4JA 4MUBA 1JR6A 2P6UA 3CRRA 5HPYB 3WP1B 3WRYC 2Z4RA 2J7PA 1SQ5A 1VCIA 1TU3A 2DFNA 3GJ4A 2AK2A 3V4FA 4LPKA 1RRFA 3AP1A 4HEJA 4IOMA 2CNWD 2ZE6A 2VF7A 3T06B 4TTPA 3KJIA 1ZD1A 2PT7A 2FEMA 4TLAA 3VR3A 1GAJA 2XAUA 5FOXA 3QNUA 1UEIA 5DN6D 4K81B 2OHFA 2ZANA 1MABA 1ZNXA 2O0HA 3H1TA 1RW4A 1NMYA 4CYMA 3SJAA 1R4AA 3NHBA 1RRPA 4OKSA 5LB2A 2ZJOA 3IEUA 1NLYA 3RRYA 2OFWA 3EPLA 1P5ZB 2QENA 5K8LA 1YZNA 1W0JA 2QSYA 2ZE5A 2OO7A 3BXZA 4WVFA 3RS5A 3B60A 3OF5A 1TU4A 2JLZA 1XJQA 4G5GA 2WTUA 4PAQA 1E2LA 1NVVR 1W1WA 4HB2A 4TLCA 1Q12A 3VR4A 3I32A 4JS0A 1V5WA 4HAZA 1RIFA 3QY0A 1W4BA 4P0TA 4D4MA 4BZQA 3D3QA 4Q1CA 4WA7A 2XZLA 3O8BA 1Z6YA 3BH7A 1NLFA 1JNYA 2GAOA 5H1YA 4GP6A 3NDBB 2QP9X 2ZRAA 4M0LA 4MKFA 1LB1B 1BH2A 1I4TD 1E0KA 3VHLB 3QXHA 3I8SA 1EX6A 2Z6VA 4PAMA 1VG0B 3Q85A 1SHKA 5F3WB 1TF7A 1XEWX 2WIAA 2GILA 3CO5A 4EFNA 4D82A 3KFVA 3TE6A 1Z28A 2OAP1 1YR9A 1VKJA 1TMKA 3QQ5A 5DN6A 4DSNA 1VIAA 2D7CA 4J0QA 2XOKA 1SVLA 2GEVA 4LJ9A 5FOVA 4HUQB 4A2WA 4PO1A 4U02A 1J90A 1GOTA 4HYYA 1LNZA 1D2NA 3NBZC 1GKIA 1AM4D 1G7CA 4YC7A 1E2NA 1DE0A 3T5GA 3UKDA 4XVRA 1K5GA 2J7PD 1E98A 4LHZA 5A5GA 1G8HA 2FPKA 1P75A 1L7VC 3EZ2A 4P4SA 5JS7A 4HDQB 2QAGC 3X1ZA 3TW4A 1FOEB 4AC9A 2BJWA 3BAFA 4NCNA 4YDHB 4LV8B 2FFBA 1XTJA 1AS3A 4B3DA 5UKDA 3THXB 1SXJC 4M9SA 4XTCS 3SDZA 4HUTA 4QHYA 2MSDB 1KK2A 2Y8EA 5TB5A 3K0EA 1NJGA 4U7DA 2H8KA 2FPLA 2ZAMA 3X2SA 4C0JA 3H84A 3LXRA 3GLGE 4BRWA 5F98A 1E2MA 2IYLD 4JYBA 2HLDA 5BXQC 3WYGA 1Z3IX 1CJKC 1IBRA 4AYTA 4D80A 2GCOB 2R62A 4F4JA 4YMVA 4RZXA 4DDVA 3KQNA 4D25A 4BLQA 3DEFA 4KFUA 3AVPA 1HH4A 1E9CA 2V4ZA 4EQ6B 4NCIA 4MRSA 1GVNB 1NP6A 2J41A 3IHLA 3IIMA 4EPVA 5BN5A 5EXSA 2H16A 3EIQA 3QPVA 2OESA 1XD8A 4QGGA 2BV3A 2FFAA 3KKNA 3OHMA 2IYQA 3ZYCA 4YLGA 3AF2A 5CB8A 1H8HA 1CEEA 4NMMA 3B7GA 3PJRA 1XTSA 2CLSA 5CIWA 1VDZA 1U9IA 2WJJA 1GKYA 4DT1B 4WBSA 5EE0A 2ZU6A 4HAYA 3I62A 3VAAA 5GJBA 4LGMA 4P4UA 4QG7A 2CCKA 3NWJA 2PZGA 2P5TB 4D26A 3R9WA 2W6JD 1H8EA 1RKBA 2J0VA 4XVQA 5BN4A 4URYR 1SXJD 4Q7KA 3SNHA 1E0AA 1E0JA 3CIOA 4EPWA 3C4JA 1TPZA 4YDSA 1E2DA 2FOLA 1E2KA 5JSZA 2O8DA 1NLZA 2HT1A 3B6EA 4EPTA 2A3RA 1KI1A 3LQQA 4FD2A 4M1SA 4MRRA 5F9HA 5BN3A 4B33A 1ZBDA 4GMDA 2O0KA 4GFDA 4A2QA 1D2EA 1HY3A 4N0EA 1NVVQ 3AH8A 1AGRA 3CPEA 3GEIA 2CHGA 2EW1A 2YWFA 3KDSE 2BKEA 3K0CC 3AQ4A 4ITRC 4B43A 1II8A 1VG8A 2KB0A 2WHXA 3U6BA 5JJLA 1BYIA 5P21A 1RJ9A 4NHOA 4MH0R 3VKGA 4Z8XA 2EQBA 4BZXA 1ZM3A 1M1YE 4AURA 5AJYA 4AK9A 3E2IA 5LBIA 1JEDA 2NGRA 1GIAA 1XXHA 1CJTC 4DLWA 2IL1A 1KDPA 2D74A 3ZVLA 4BFWA 1AA9A 2WKRA 1KSHA 3CWQA 2SHKA 4E22A 2OCYC 5DIFA 2P67A 3H4MA 3EW9A 4HAWA 3OIVA 4IEIA 4TT3D 4YXWA 5CB6A 1J8MF 1DO2A 3CX8A 1SVOA 4BWYA 1Q1EA 5J4LA 3EZ6A 5G3ZA 3CB4A 1YRAA 1E99A 2IC5A 3M1IA 2Z83A 4RFSB 4PQRA 2OBMA 3HYRA 5J47A 2PEYA 5L8VA 3KL4A 2BMDA 5LDDC 1G8YA 2VHJA 5JJIA 5HZHA 4D0LB 2A5FA 2A5GA 2IXGA 2ZYVX 2AXNA 4KCGA 1NIPA 4QBIA 3C5CA 5E7IA 3L0OA 1SKYB 1KAGA 1OFIA 1FNNA 4LJYA 2G77B 5J40A 1G8GA 2C04A 2WMOB 4TTQA 4RKEA 5FPKA 4HLUA 1DTSA 2OCAA 1SGWA 4RZUA 2AXPA 4BRUA 5L3VA 5KDDA 2VSOA 3AUYA 4XOIA 3JZMA 3OE7A 4GPTA 2B8TA 1E2PA 1MRSA 5EXXA 3QXJA 3LVQE 3CR8A 4BFXA 4QJ4A 4JSTA 4Q47A 2C9YA 4Q01A 4G5SA 2HXYA 5FOWA 1Z6AA 3F3YA 5KSOA 3ASZA 1FUUA 4RCZA 3CRVA 2QUZA 1N6IA 1U8AA 1X6VA 5CDFA 1S1MA 2ORVA 1GKUB 3BERA 3NEYA 4CZ2A 5DSZA 4YONB 1E1RA 3RDPA 2QE7A 1GNQA 1WB9A 1UM8A 1DEKA 4Q1EA 4GL2A 2ORIA 3R8FA 1NY5A 5KNDA 1G9XA 2FSHA 1FFHA 1OIWA 1P9NA 3IIKA 3OIYA 4KODA 4QHSA 1ZU5A 4RZ2A 4C0BA 4I1VA 1OXUA 2ZIAA 4PC3A 4O0MA 1SXJA 1AN0A 3RRZA 4EPRA 1OW3B 3RS7A 1W0KA 1RYHA 3CM0A 4A1FA 4FMCF 1R8SA 2RHDA 4RSGA 4ZI2A 4B3XA 1Q1ZA 4WIAA 5HE8A 5KYKA 1KO5A 2J0UA 2W83A 1Z83A 2OSBA 4PQYA 3EZFA 4Q21A 3UATA 1P60A 5JHHB 1PLJA 3S1AB 1YE8A 3WHLA 4QBHA 1TQDA 4TQUS 2IYUA 1Q21A 1XTKA 2JCSA 3IO3A 1E9FA 3K0AB 4BGDA 3REGA 3VNVA 4M4SA 3THXA 2IXEA 2V6IA 4B48A 1N5KA 3CNNA 5KSYA 1WDTA 1COWA 4EJSB 4L5BA 2JLYA 4LJ7A 2ATXA 2RGXA 4IEEA 2IYXA 4HZIA 3RS2A 3MMPA 2GVZC 4II7A 5L3QA 1ZNYA 3U3JA 4LRWA 4IHQA 1C9KA 3WRXC 4LK2A 2A5JA 3UMFA 3L0IB 4I1UA 4HLCA 1VG9B 2XB4A 3EASA 1Q3TA 1WF3A 4TL7A 3SBDA 3T1OA 1T6NA 1G1MA 4KVAA 4B3FX 1BMFA 2A5DA 4X8OA 4OK3A 4EJSC 4WW0A 2QRNA 2F1HA 3KKMA 4Z51A 2W0MA 2ANBA 4AIIA 1QHHA 4B71A 1IM2A 2WPDA 1TTTA 1X1RA 4B73A 4EPYA 1VYUA 4GI7A 4D6PA 2ZS7A 3SEAA 3U61B 1SVIA 4DLTA 1Q57A 3QXSA 2XJ9A 2P0EA 4Q4LA 3A6PC 4Z1MA 2EFGA 4RCYA 2NOAA 2HF8A 2ZJZA 3O8DA 3B1VA 1AKYA 1F48A 4JZKA 3TAHA 4V0ME 1MO6A 3SC3A 2LKDA 1JAIA 2RGGA 1NBMA 1F2UB 5H68A 2WWHA 4TL8A 2YOGA 2G83A 2I1VB 2YOFA 4LCBA 4RKFA 2DFKB 3AVQA 1R5NA 4OL0A 1VCNA 3O8RA 4B6EA 1YKSA 3A1SA 4KV9A 2J3EA 2PJRA 1IONA 3ZQJA 3GLHE 4JLVA 1B0UA 1NN1A 4RZ3A 2ZI3A 1U81A 1NY6A 4G0NA 2ORWA 3QKSB 3FMOB 3P26A 2AKYA 5B57C 2ZYTX 1IN4A 5BQ5A 2AN9A 2IHBA 3SBEA 3W34A 4AI6A 3RAPR 4BFUA 1EESA 1Q1QA 2PCJA 3TRFA 5DH9A 3BB4A 3GLHA 3AP3A 1G7RA 1HURA 1N3BA 3KTAA 3AVXA 3LXXA 4DCNA 5HCNA 1OXSC 3T35A 2W2XA 1KSFX 4FINA 4TMWA 2GXUA 2YWEA 4DRZA 2RHMA 3THWA 2OE2A 2QT1A 3SN6A 2IS1A 1DAMA 4YMTA 4KFRA 4QJ5A 3BBPA 121PA 1AZTA 1US8A 2C95A 4V0LA 3V9PA 1P62B 2H17A 3PENA 4B35A 5CK5A 3QJYA 3QXXA 1E79A 1KK3A 3IGFA 1U8YA 4C7OB 3TUIC 2VP4A 5IF9A 5KHOC 3WMFA 2RGNC 721PA 2FZ4A 2ZRDA 4C4PA 5KU1A 4E07A 2PLFA 2Z0MA 4P31A 1G18A 1NVXQ 1UJ2A 2Q9CA 2F1RA 4C9BA 1LF5A 1XB2A 1EWRA 1N6OA 1D9XA 4MKGA 3C15C 4US2R 3EG5A 5JECA 1G8FA 3KKQA 2ZI4A 1OXTA 3Q8XB 2XOKD 2AD1A 2ZUBA 1W49A 3MLEA 2DYKA 2ZU0C 1YRBA 4KSBA 2O52A 1JR3E 2JATA 2P3SA 1KO8A 2ASEA 2RH5A 2DBYA 4PZZA 4C0AC 5IK2A 4LY6A 4BLOA 5CK4A 4GSYA 3BH6A 1A5TA 1FTSA 4H1UA 4GOKA 5C46F 2FZLA 1E2GA 1LTQA 4PHTA 1GRNA 2QT0A 2ZRJA 5JFGA 2MSEB 4JVLA 2QMOA 4LX0A 5BW8A 4LWZA 1S2MA 5CM9C 1QHNA 3QKTA 4FWIB 5SZJA 2OM2A 3MSXA 3W5JA 3UMRA 2EWWA 4Q4HA 2H5EA
chains in the Genus database with same CATH superfamily
2V98A 3QWAA 2FW9A 1K3FA 4DR6B 1EGHA 3UCXA 1UPUA 3HPQA 1T26A 2CXXA 4R40A 1SC3A 4JKYA 4C07A 2R96A 3KZVA 3ZLTA 4KYVA 1OFUA 2WBLC 2WIDA 3EGOA 3AG5A 3ZQ4A 1D7AA 1BVUA 1FP7A 3NUZA 3R3ZA 4MQLA 3KC2A 1W4ZA 2ONJA 4N03A 1DNPA 5AKXA 3A1VA 5G53C 4V1CB 4GZ6A 3ER9A 2NSHA 5BWMA 3NWPA 2SKEA 2R79A 3AKYA 1OD6A 2X9QA 4FT4A 3R7WA 1ZM7A 1UZAA 1ZJYA 4RD6A 4G8DA 1VMKA 2I7VA 2JLSA 1SKAA 3DZDA 3F9IA 3FIUA 1N6NA 1A9TA 3G59A 4FIDA 4WSOA 4BIIA 1RCFA 3AIKA 3ACDA 1PZMA 1A8IA 4Z99A 3PRHA 2YW2A 3HWX1 4F04A 3WI7A 1SOMA 1K1EA 2ZYRA 3F49S 2XW6A 4JJKA 1L7EA 1LJLA 3ZE1B 5INTA 1P1HA 3K15A 4KX3A 3R5SA 1IZ8A 3CF2A 4UNRA 1YS6A 3GFVA 2C5AA 4BU1A 2FGKA 2QR2A 2ZTUA 4X91A 4BIMA 2AHRA 2QZSA 3CKKA 1QVVA 1KJYA 4QFMA 4TKUB 3ZH2A 4RFLA 1FFAA 4AYXA 2JIDA 2NYUA 4KQFA 1MG0A 1RBQA 1MQ8B 2MHCA 2B4KA 2O2HA 3PWZA 2JDID 3IVRA 4ASUD 4EWLA 1FQJA 3CKMA 4HGOA 3DZKA 3JD4A 4Z7QB 1QC5B 4CQMB 1UEXC 2FMXA 2ONKA 3KQTA 4IP0A 1HUQA 3D8BA 3GJ6A 4OYRA 5C1IA 4OSPA 1MTZA 5DRTA 4DZZA 1W88A 3IP6A 5C31A 5EE9A 3W2TA 3CVXA 1N77A 1JTVA 1PW5A 2O3TA 2VF8A 4GI1A 2HZ7A 2QLJA 2WNIA 3QKUA 1EFLA 2JAUA 4Y2VA 3S5UA 4O3MA 4JYPA 4CGYA 1UJMA 3AF5A 2IZZA 3O93A 2PR2A 2ZSEA 4BNDB 1QONA 1Q2UA 4MIEA 1YJXA 2BDTA 1IJFA 4RF2A 3LDGA 2P2YA 1ZEMA 3RVQA 4RIIA 1D2HA 1HE8B 4M6WA 1E5XA 4CT4B 3HMKA 3Q7PA 3SKVA 2NQ2C 1R18A 4GYKA 3OE4A 4WN3A 4BTVA 5IVDA 1Y4UA 1N5LA 3WYDA 5EERA 4KGDA 3BD7A 5TY0A 1KSGA 2DFLA 2ZAOA 1TZKA 3SYKA 4L9AA 1YS9A 1OASA 4HWTA 4PSCA 5HJ2A 4EMUA 2HD4A 2HLDD 2OB2A 4BQSA 1U6IA 3EXHB 3MBOA 3OH8A 4CMIA 1IE3A 1E3WA 2JFWA 2PL1A 1FBTA 4CNQA 1QH1B 5KIAA 3QV1A 4OJQA 3UCEA 5HOEA 3IJEB 3NIBA 1AQUA 4RSMA 4FLMA 4WXPA 1ZK4A 2EGHA 5ILOA 1NC1A 2CXHA 3HBFA 2OGTA 1A9SA 2ZP1A 1YZUA 3KJHA 4HATA 1FVOA 1EXNA 1KZHA 1JECA 3GCGA 2F7SA 3MS4A 3DA8A 3PV0A 3C87A 3V3KA 5JAIA 3PE4A 4JEIA 1KI2A 1TJ3A 1B1AA 2BCEA 3I5AA 3QJ5A 3ZIAA 4BWVA 1HX7A 2WYOA 1RZ3A 2HBRA 4GMXA 4N39A 1IXZA 2WICA 3TPFA 1G8SA 5D2CA 1NI3A 5E4YA 3F5DA 1F7VA 1OE0A 3EDQA 3O38A 5JMOA 3T1YB 3PUWA 1SUAA 3EA0A 5DPMA 5AESA 2AJLI 2JARA 3B20A 1P17A 3K70C 2VHVA 2ZTLA 3W05A 2PEZA 3H7AA 1U28C 3U56A 2VKQA 1BWPA 1JPVA 3PL5A 3K9FC 4IUYA 2IW3A 3OWOA 2JG3A 1Y6RA 3BJMA 4PBSA 2DJ5A 1QG4A 5FRDA 3NANA 4F5DA 4HX9A 1TM2A 4BASA 3NT2A 5ELMA 4WZZA 3II6X 3KKLA 5JADA 4CQLA 1EA5A 4QQNA 2PXCA 4UDXX 2PZJA 2XSZA 4U7HA 4DWJA 1GDDA 1J09A 3U7EB 1DMRA 4PEVA 3W0LB 5C2JB 5IJWA 1CRLA 3N2KA 1M2JA 1P2DA 4CT5A 2FQWA 5IDXA 1ISPA 5EQFA 3C0KA 1J24A 5FA6A 3KTOA 3UJPA 1QV7A 2FOIA 3OQIB 3IUBA 1EU1A 1PLKA 2FW8A 4LI0A 4B6SA 1YBFA 4MQEA 3PIRA 1A72A 1H22A 1TYEB 2X8LA 1T6BY 1FJXA 1EI9A 2Q5LA 1U2QA 1ZWLA 1S96A 1UXOA 1KNXA 2GPYA 3LZ6A 3L06A 4H7DA 4RVGA 2IHNA 1NUTA 3B1FA 5MFZA 1HMPA 4X1YA 3S2YA 1MA0A 5A04A 1H2XA 1DCMA 1Y1PA 3D8SA 2XUFA 4YCDA 4UARA 2GXSA 3ZS8A 3HXOA 4DV1B 2C4HA 4LECA 1V3TA 1XZ8A 5D1HA 3RASA 1RQ7A 3U4CA 4B34A 3FI9A 3MRVA 4IDDA 3RSFA 1KO1A 3VVCA 4DCUA 1WXWA 1VGRA 2ONCA 4FDMA 1JYSA 1XA0A 2OZPA 2NZXA 5FNVA 2B4QA 2XB9A 5CIQA 5F1YA 1EWQA 3Q5GA 3PHGA 2BFCA 3R20A 1QOQB 1GQYA 1V35A 4V03A 1A9QA 5KYNA 1B0AA 4DMHA 2PFSA 2AXQA 2C5GA 2H2GA 2VDQB 2Y1GA 2QE6A 1C3VA 2HHAA 2OUIA 3LQRA 3P0JA 5DZSA 1QOZA 1D4ZA 1KJZA 1Z18A 2DERA 2P2DA 1GCOA 2IS6A 5AVWA 1C9YA 3USES 1DRVA 2VK1A 3AWDA 4KK3A 4ON9A 4L3VA 4TL9A 1E18A 1ZNWA 1SCIA 2Q5JA 3HP1A 2NO6A 5KKCA 4L9SA 4Q3NA 3IE1A 1T5SA 2XGSA 4IF4A 4J7UA 4J16C 1U3DA 1ZHHA 4GZ3A 5CT5A 3OIFA 3RTBA 4BVJA 3LQFA 4QNRA 2NYVA 5IXSA 1YTUA 3DMHA 1MXFA 5AJVB 2PMCA 2R00A 5CD1A 3ZD9A 4D3YA 3A3YA 4EHJA 4ZMRA 1J9EA 2Q0QA 3PFWO 1KGDA 4DM3A 5K0FA 4E5MA 5KYTA 1L5VA 4WD3A 3V8BA 4LGVA 1EB8A 1FFGA 1WAMA 3VDRA 4UMFA 1BW9B 5K0ZA 2CLEB 3KQOA 2WAAA 2H9IA 3BMNA 2NUPB 3L8EA 2EBUA 4GOLD 1DBIA 4IOJA 2XXAA 4R8SA 1BMFD 2Y67A 2GK7A 3H9CA 3BD6A 3HUFA 4IWYA 3SC2A 4RC9A 2C7BA 4BV9A 3OCJA 3ABQB 3OJLA 1WEHA 1WMEA 3I6IA 1BFUA 4G3XA 4ARIA 3IUPA 2GHQA 5HRAA 1IZ0A 2NZJA 3JATB 3TEJA 2W2QA 3K6SA 3KUCA 2OD9A 2ZTSA 4QEZA 2PZAA 1CUZA 1EUDA 4FBGA 1YIDA 4KPFC 5JS1A 2XEXA 1FLVA 2QN9A 1YA4A 2WF6A 3KHTA 3OEHD 4L85A 1KDTA 4E70A 1V1MB 2CUKA 3MMZA 1R2QA 4UMDA 1GTL1 4A91A 3R0XA 3WGLA 1B3RA 5EYPA 3HDVA 1MOZA 1OBOA 4I5DA 5LIRA 2A14A 2AN4A 3C45A 2X8JA 4LRYA 1LQUA 2EGGA 1ZCBA 4OLFA 4PWYA 2ZS8A 4LZNA 5AXCA 5TIIA 1XN4A 4ZEOA 1QH0A 2PRKA 3FCEA 1ZPDA 2K87A 4HQOA 4OHVA 2XGOA 5B58C 4NI5A 3VUEA 2ZE7A 1IRXA 1S3IA 1ZD5A 2A33A 3KQWA 4HTAA 3LW8A 3JZAA 5H59A 1FS5A 1VSBA 2HT6A 4MKHA 5ALRA 2NT4A 4CG3A 4WCDA 5G0WA 1UKCA 1KYVA 1ODLA 2WIBA 1BC5A 3GCDA 4JGBA 4EH1A 5AI0A 4KBYA 4ZHQA 5AVKA 1IDOA 2BZ1A 3V7NA 4P84A 1WBJB 2Q1TA 4DV0B 1TM7E 4YA6A 1EVKA 3DD1A 1ORRA 3NYQA 3NOVA 4DBZA 2DWQA 2VXBA 3WOHA 2Q3DA 2JA1A 2VUSA 5GM1A 4WN9A 1P3DA 1P6XA 2EZ9A 5TS3A 3RARA 2ODEA 2WZDA 4YRIA 3DPSA 1LY1A 1PFQA 1GZ3A 1QK5A 3KE9A 4JX8A 4WKBA 4CLHA 1HKUA 4N3BA 3ZQUA 3G2LA 4DR7B 2WPDD 1XLVA 5TT1A 4UFNA 1XFAA 4NEHB 2ODPA 1C9EA 1QCDA 3DO5A 3HJTA 1JHRA 1YQEA 3RQSA 2Y3IA 1CS0A 2V54A 2X1VA 3K0FB 3QVJA 5JAQA 7AT1A 5LQKA 1CHNA 1DRJA 4XZ3A 2PUFA 2DCMA 3B6ZA 1BCSB 1PHRA 4RMGA 3W04A 2UUCB 1YAJA 1FYXA 1A7AA 1ZSNA 2Z9CA 1QFMA 3A0UA 4MITA 2QR3A 4Z2YA 3ESDA 4TMYA 2C94A 1IY2A 4JLJA 1AUPA 1GZ7A 1JWBB 2GS9A 3GUYA 1WHTA 3NPAA 4LQCA 1SA0A 2PZBA 4RJJA 3X1WA 1CQJB 3WGUA 1XZDA 4BVLA 5BV7A 1HXHA 3P52A 1F5NA 4K2AA 4OHKA 2AEJA 5AO9A 1CLEA 4RTNA 5A3VA 4CM8B 1SZDA 1VIYA 1PS9A 1H1LA 5LQSA 1P1KA 1JHZA 1XZNA 3LPNA 1UF9A 1P7CA 2FB9A 3WLTA 4B3IA 3LDUA 3CRW1 2XMQA 3ABIA 1L1QA 3OCXA 5J5VA 4I4TF 4LOAA 1VYTA 3LD9A 4L76A 4CM4A 4DLRA 1ZC4A 4HF7A 4D1YA 3A9WA 1OXVA 4RHFA 3RC7A 3UN1A 1NULA 4GD3Q 3KZ1E 2JFUA 4C0LA 2OXTA 1FFEA 4K9QA 2X86A 3ZV7A 1G5HA 5TMEA 5FI5A 4BV3A 1HYEA 2AG1A 4IH4A 4HWRA 4CI9A 4OQQA 4I7EA 2A1TS 3W6NA 1Q15A 2O54A 3Q1LA 3N2KB 3IEKA 4XQ0A 5D00A 5T67A 1NNEA 1Q6ZA 3BMQB 3ZIDA 4C1BA 4COOA 1Z7YA 3C39A 4TQGA 2PWYA 3AKEA 2F3RA 5ETJA 4RJTA 3HM9A 3SNKA 3IMEA 3IS3A 3QG5A 5HOQA 3VRHA 3PQ5A 2C3PA 1RM4A 3FPJA 5HF8A 2J5BA 4MS4A 4ZCSA 5FA5A 2OMKA 2VNHA 5F2EA 1SC6A 2BMEA 3NTXA 3NEJA 4UXJA 3TGPA 1VYVA 4N6OA 2UYHA 5JG7A 2G0TA 2XMZA 5LWHA 2V55B 1I6WA 2GN4A 2H85A 3BWYA 2HWXA 1OH8A 2I4OA 3EXFB 4C4RA 1GSIA 1SXIA 2V65A 1P7VA 2JZCA 3H1GA 4TRMA 4UHCA 4RKWA 3WFIA 4CMGA 5KTKA 2JC3A 1Y7PA 2UU9B 3O8QB 2HRDA 4DY4A 1BX0A 3CB2A 3VR1A 1N7HA 3U60B 3RNLA 3UJ9A 3OAAD 4YJGB 4GPZA 4ESHA 1WPRA 2BRUC 1DAOA 1RFGE 4LVOA 1Z22A 5KYUA 3ZJYA 4AXBA 4ISBA 3CX6A 3IAM1 1LPAB 3I64A 2LCFA 2YWHA 4FILA 4G23A 1JR2A 1CIVA 3FBWA 4LJLA 2VP5A 3KZCA 1YR7A 3F9CA 3QEJA 3E15A 5ALXA 5J9FA 3TW8B 5F7XA 1HE1C 1HL3A 1WEKA 3FHCB 3GLQA 3GWGA 3RSLA 4JDUA 3WGTA 5DNVA 4FYWA 3KKEA 3PWTA 5E4TA 3TSAA 1ZGGA 2MINB 1A82A 1BXRB 4M1YA 4NOLA 5AXDA 3A6GA 1SIOA 2FJPA 3BA6A 1IJBA 2CLKB 3KJEA 1DC3A 1EFKA 4X8LA 1RPZA 2NPIA 4FCCA 2H1IA 4UUPA 3I6QA 5FAXA 4WJLA 1UIRA 2X2EA 2GZ3A 1WBDA 2HHHB 1T6ZA 3WVNA 3PLAE 1R12A 1QZ3A 1YB7A 1HDOA 2FKNA 1DC6A 1R88A 1UDXA 1AQIA 3I83A 5JXGA 3I2YX 5BV8A 4CF7A 4OLBA 4TT3A 2ZIWB 2B3TA 4KQEA 4X85A 2UYCA 4QGHA 4LGYA 2H07A 1BOFA 1A50B 2HQOA 2WA1A 4KQWA 2XCTB 3R2JA 4XIJA 1C8KA 4D0GA 1G63A 2BD0A 1NKSA 2QM8A 3CLUD 3CR7A 1XYGA 3GJZA 3GELA 4LDJA 4XDYA 4WADA 5GMOA 1Y42X 5IJ9A 4JELA 3RSGA 1Z37A 1X42A 3D3WA 3MYYA 4HP8A 2Z6UA 4UOQA 1DGQA 4IOLA 1ZZEA 5I7VA 5EOVA 3P9IA 2H5IA 3TFOA 4DXAA 2Z5VA 2KBFA 2F8SA 4DMGA 4U1RA 2ON6A 2ZIEA 1IQUA 3KQSA 4I08A 1U0JA 2ECFA 4Z9AA 4LWOA 4O4HA 3VH2A 3NNSA 4JU8A 2GJ8A 5DGHA 1RYFA 4CKZA 3CH5A 4IYRA 3RFXA 3SXUA 2V3CC 5U1PA 1UJ5A 1VGQA 2AOXA 4CIBA 3QZUA 3OETA 4YMLA 4KFTA 1GARA 1R50A 4EY3A 3C5VA 1M1YB 2V8BA 3IPRA 2IITA 4IX9A 4P33A 2OUKA 4DEXA 2YBDA 1QRDA 2WZCA 2V3VA 3OZIA 4H0FA 5JNRA 3DMGA 2CCGA 3WXMA 4R69A 1U2PA 1HRDA 1E4EB 2H4JA 2NM0A 3A9UA 3AOGA 2GPJA 2QTNA 4QUGA 4B3JA 2WJ4A 2M32A 3FCUB 4NBUA 2BKVA 4HZGA 3QEBZ 3FLBA 4RS4A 1XP5A 3BZWA 2JCXA 1E3WB 1U0EA 1E1YA 2PYIA 3L05A 3OHPA 2WD7B 4RS3A 1JTFA 1DKLA 1QHHB 3EYWA 3F7NA 4MPJA 3EDCA 5KYUB 3QG1A 3O8LA 4RPHA 1FLNA 4GLBA 4AG5A 4F12A 2YKGA 4OIMA 1GLNA 2Q7DA 4BGEA 2GK6A 4FI3C 4IDCA 2JAXA 4CIVA 3PDHA 1EUCB 4LCJA 3JD2A 1ENOA 2VAPA 1X19A 2IEDA 5K3FA 1ODCA 3S29A 4DLYA 1D2GA 4EY6A 3TEFA 4TYQA 1QDUA 2VAWA 1Y4SA 2G5CA 4JH0A 3A25A 1IFXA 3DGFC 4ZKEA 1Q77A 1GTJ1 1T1SA 1H0RA 2G9NA 2H8GA 3H42B 3KFLA 4GEGA 4J3FA 1S5PA 5F2NA 4G5OA 3D3EA 3KR1A 5JCOC 5I4IA 1BE0A 1K06A 3CPJB 1NYRA 3QI2A 4N1AA 1YDMA 1MJNA 2QORA 1WZNA 1FDSA 5TLSA 1FW6A 1KHTA 4FOOA 4WESB 5FNVF 2RHOA 3VX4A 5JWRA 1N92A 4CF6A 4YB8A 2OK7A 2J9GA 1AXEA 2C9MA 1YD7A 3LAWA 3NHMA 3GPDG 3K9LA 1H3NA 2EFHB 1LI4A 2IBMA 1RQRA 1KAMA 2IYOA 3NOOA 3O3NB 3QPWA 1PGJA 4J4TA 5ESRA 2AWNA 4G2TA 4C03A 4HDSA 1E9BA 1MHPA 3DLHA 3VO9A 2AZXA 4LOLA 3GRAA 3GLKA 2OBYA 3PKIA 1GNVA 3QVXA 3FWKA 4BBAA 4REQB 5ED4A 1K9SA 4L72A 3SG0A 2XQVA 2MDTA 3HHEA 5DHRA 5H9VA 2XGGA 1EE1A 2BFFB 4YJHB 4R9SA 4C6TB 1R27A 1K6IA 4M0CA 1QVZA 3QMPA 3D0RA 5LA6F 4K9LA 2XYHA 4HN4B 5CLLA 3UUGA 3H6HA 3DB1A 3ER6A 4J16A 3ZNNA 1RPJA 4YJ3A 2Q9BA 2ZCUA 3WHPA 1M67A 1U2TA 2PD6A 1PR2A 3RUHA 1JLHA 3UXEA 4E31A 1RC8A 1GM5A 4R8KA 4RK0A 4JB2A 4D3FA 1N6RA 4KZPA 4AUMA 1DKMA 1WP9A 2XAAA 1E96A 1WY7A 2PT5A 2GTHA 3CONA 1XD2A 2AE1A 3PA8A 5FP0A 3A4LA 1DCFA 4UMVA 4W5QA 3UK7A 1EDOA 1CP2A 2BWJA 3IO5A 1XDWA 4JENA 4RVUA 5EVCA 2WV9A 1OFUX 5FIUA 4JL8A 1SD5A 4LC9A 4FZ3A 4JC5A 3THWB 2P9CA 3TSWA 3T9DA 1UT6A 1XWWA 4EYOA 3D8UA 2O6LA 3SEZA 2FFHA 2JBAB 3MUNA 5B64A 4NYMQ 1S8NA 4CTJA 1CQPA 4NMHA 4DY6A 3JY6A 3ORRA 3X1DA 1GPKA 4QNNA 4CV2A 1A88A 5C1PA 3WKAA 3LW7A 3C1UA 1POXA 1V1RA 2PLRA 3EW7A 3FMVA 3KRTA 2R6FA 4MRNA 4NS4A 4OHYA 3HDHA 3LG2A 4OYYA 2DE0X 3ILVA 2RDMA 5F73A 4H9GA 3UJDA 4RTSA 3OTIA 1B4DA 1MNQA 2JLXA 5KTRA 2A9QA 1NMSA 4YCLA 2WDZA 2HCJB 1ZBQA 4AKEA 3QLUC 4G1BA 4E1AA 1WU8A 3DWGA 5J2TB 2RMKA 3R7BA 4IIEA 1GTMA 1DX4A 2IUEA 4ECAA 5GIPE 4EB0A 2SKDA 3MZ0A 1NQXA 4MYDA 1F1JA 5LDGA 5HP4A 3RT7A 3U13A 4FGLA 1AKEA 2CYCA 1E6EA 1X7XB 2ZYWX 3HVUA 4L1KA 1R6DA 2BEVB 4PW0A 2XT9A 4UCFA 4ETIA 1S89A 1JDBB 2QN8A 1VL6A 1YQDA 3AEKB 4N8SA 4CEHA 3EZ9A 3WS7A 3E8MA 3WLAA 2DXIA 3GEMA 2C96A 2HMVA 3ETGA 2KW5A 3ELWA 3F4LA 5AHRA 5CXXA 3AYXB 3VAYA 5C8YB 3HACA 3NG1A 4E2FA 5LQNA 2WG1A 2WWYA 3FWHA 3INNA 5B3JA 4QZVA 2CLDX 3A37A 3R5FA 3B8EA 1IJKA 4UQLA 5FADA 1L5RA 3JVVA 3U4HA 1GCIA 1ZQ9A 5CX1B 5FQOA 3SYMA 1ZSVA 3C3JA 4QPPA 2OMEA 4NNPA 3GJQA 3V7WA 1PUIA 3QUTA 4Y1RB 2CD9A 3W7VA 1EVZA 4ZCTA 1T8RA 1ZSYA 3LH5A 2JLBA 2VXCA 3PUHA 3SJCA 2Y9PB 3NJ8A 4LZOA 3AGPA 1NM5A 2ZUSA 4OLJA 4QOGA 4EG1A 3FDZA 1M5RA 3LBNA 2F8MA 1PBTA 2OSVA 1M6HA 1L5GB 1FUKA 3VYUB 4W5WA 1EDZA 5EZYB 5SYMA 5JW6A 1GA6A 4YV0A 1KI9A 2F59A 2JZNA 3X44A 4LJ8A 5IAAA 2Q3JA 3VZSA 2MR6A 1E2EA 4AF7A 1LC0A 4BNWA 1UADA 3OMXA 3QX3A 2B7CA 2JB9A 5HIKA 5JCXA 3BXEA 2IYPA 3ZDBA 1QQ6A 1YA8A 4CM3A 1L5HB 4F11A 4ETNA 2WHRA 2GHIA 3MWDA 4LKRA 3OKPA 1WABA 5I9BA 3ZBTA 1IMOA 2XNHA 3O8CA 3AEUB 3G7NA 5GJWC 3ZJVA 2IEYA 4N48A 1YMUA 1J5XA 1DJNA 3MCTA 4Q02A 2F90A 3VDMA 4ZI5A 1S3FA 1T5IA 3KD2A 2X2OA 4J0DA 5A4KA 2OORA 1ORWA 3PC7A 2W22A 2AE2A 4CQMD 5TEWA 5K0EA 3MF4A 2YZKA 1GT91 4H1TA 4S1WA 3U4QB 4BGVA 3WZ2A 3WJ2A 3CNLA 4S04A 1Z2CA 3R3XA 3LY9A 3VV3A 3AUKA 5LQCA 1O95D 3QF4B 4J2HA 4JOCA 4JVSB 4PO9A 3FYTA 3VUFA 1L4BA 1VE6A 2A0KA 4F72A 3EUWA 4RJKA 4B81A 4F9GA 1Z2DA 3OQBA 3OD1A 2RKOA 1DAEA 3AFGA 4ZU1X 3R8CA 1WHTB 2GJ9A 1JQJC 5IBQA 2X9LA 1RM3A 1FDOA 2XWPA 3MJDA 3PX3A 4UVGA 5JV5A 2LVBA 2BE7A 3RTCA 4INOA 1EFTA 4UOEA 3GQBB 4Q93A 3TUJC 4CM9A 2YWXA 3KOYA 1U7PA 4WQMA 3I8XA 4IJVA 1AIPA 4M49A 4RZIA 3G2KA 2EFEB 3NOQA 5F7OA 1QYXA 5BQXA 4IVNA 1JX6A 2YZ7A 2B7BA 1NFFA 1UWKA 5CDFE 4DDHA 1WPGA 4NBLA 2QS9A 4FZ5A 3RJ9A 5LZ5A 2EIXA 4IDPA 4XIFA 1NW3A 4QATA 3DKKA 3LCUA 4HAOA 5FFMA 3DVAA 2CVFA 4JHXA 4BMXA 1VHWA 1ESDA 2B8JA 2UVQA 4D8WA 4X66B 1E3SA 4O2BF 3DH0A 3TLMA 1EINA 1P2UA 2FP4A 5KTPA 4W8HA 3ZHUA 1YBMA 3F46A 3UCFA 4F6CA 3G6WA 3NC4A 4K6FA 3BRWD 3MVEA 3RWOA 3SOPA 1XZCA 5HGXA 5JDIC 3UMMA 1T1JA 4KMOA 4PTLA 2HCTA 3NCHA 3PXAA 3R7AA 2IKQA 3HJRA 2XOEA 4IMRA 2HMWA 4EA8A 4JJ6A 1AD2A 4DJAA 1L9KA 4HB0A 3RKRA 1GUFA 1XNHA 4KAFA 3H5AA 1NXWA 3EZNA 2EWVA 1A2KC 2ZZNA 3KQLA 4MICA 3K1JA 2TSYB 2P6PA 5A2QA 4GOJA 5DLQC 4EUEA 7MHTA 5AM3A 5HFNA 2V6BA 3SYNA 3ELBA 4GC9A 4GXNA 4J29A 4X6XA 1RJ9B 5I7OA 1NXSA 1QGOA 4RM3A 5KYWB 2IP2A 2P2ZA 1X7GA 4P35A 4PXYA 3L7MA 2RBEA 4RFVA 3TX6A 3T7CA 1PTJC 5K3AA 1QQTA 4U39A 4P0PB 2GPTA 2JAWA 3JQCA 4L07A 2FFRA 1PV2A 3EXEB 3PFHA 4WZAE 7REQA 1A95A 2J1LA 1C1HA 4OMDA 4LTDA 4HAIA 1GFWA 4OLHA 1MVNA 2DQSA 2G9QA 1H0SA 2P1ZA 2YS7A 3JV7A 1G5QA 2QP3A 2YC4C 3LBFA 4ZRNA 5HMLA 1T0JB 2JFFA 3TIGA 4DPMA 5JZBA 2O8CA 1Z5ZA 4AJLA 3GLFB 4X62B 1NUPA 2Z57A 3EPHA 5JAPA 1MRNA 2AC2A 4YQEA 3UXMA 3EPKA 1C1DB 2MMCA 4E51A 4C7KA 2C9ZA 1UPFA 3ROXA 2W6ID 1T24A 3K9NA 2YHSA 2X7JA 1T0PA 1SXGA 2QM0A 3KB2A 2PRJA 3NBYC 3OT1A 3W4JA 5K3FB 2XUIA 3OUUA 5JJBA 1RKQA 1II8B 3VNAA 5JATA 3TJRA 5IS2A 3F5MA 1KVUA 3PSAA 4F5ZA 4F3KA 1VOTA 5CB4B 3ORSA 3SM9A 2RH4A 4M1MA 1KQNA 4Z1MD 1GG8A 5HKAA 5FWYA 4QDOA 1Y7IA 4FZVA 4RCVA 1Y63A 1LW6E 5EQTA 4F38A 2OK8A 1A9XB 4FW9A 3NEAA 5B1EA 1TLFA 5JS6A 1FSZA 1DAHA 2QQ0A 3O73A 5AWFC 5CR9A 4KR9A 4AKGA 2X14A 2FMFA 5DASA 1ZFNA 4ENUA 1Z2NX 1U0BB 1MR3F 3MK31 5HUHA 1FVHA 1XCBA 4LFBB 3R7LA 4EA9A 3NDIA 2G88A 4MI3A 2GAAA 2E1PA 1ZD8A 3KYBA 4WZAA 1P8AA 5DO9A 4KSCA 5T41A 3RR2A 2FW0A 3WWEA 3ZHYA 4CLOA 1Q92A 1YZTA 3O4IA 2DHRA 4O2AB 3EVZA 4YASA 5E4FA 4P8RA 3HCPA 5EE1A 3TRHA 4B3CA 2G9RA 5LQUA 1A9ZA 3OQOA 3TVTA 3ANTA 5KTYA 3OM8A 4HUQA 4NK4A 4GL4A 4D74A 1DAFA 2W2OA 3TLXA 1HNZB 2P69A 2LDBA 2QDKA 1XXHB 1ZK3A 2YDYA 2FPXA 3BK7A 4B6PA 1WXHA 2XA2A 1X77A 2FN4A 3GAZA 4UJ5A 1Z33A 4A0HA 2O8EB 5EKSA 1BHO1 3ZUGA 1YL5A 5DXFA 2V8OA 2XB8A 3NHRA 3OPMA 3PD0A 1LVUA 4GBMA 2O2CA 1TO1E 3B3QA 5AJWA 4GX5A 4NARA 2RCYA 2XF2A 4TLLB 3FJYA 3C14C 2BGRA 1VSVA 1XVUA 4GH5A 3VDNB 2X1MA 3UJBA 5D8DA 1KJIA 3U7HB 1D8TA 2XD4A 2IT1A 4O33A 4HDMA 4TXNA 1RHQA 3OQ1A 3FSGD 3G8CA 4PZ0A 3DNPA 2XI4A 4X45A 1AA6A 3EEIA 4Q3EA 1PVVA 3IVAA 4IRMA 4PBTA 2AL7A 4B47A 2DBZA 4TUYB 2HA7A 4E3WA 2PUAA 1V6CA 4FYIA 4N3AA 2ODAA 3E23A 4WY5A 1TW3A 2PJDA 4OQLA 6NULA 1JU3A 1E9DA 2XQKA 5FI0B 3WGKA 4ZJPA 5EZYA 3RABA 4C04A 1VKHA 3FY4A 3TBKA 1G3IA 5EPOA 1HE5A 1ZC3A 1RHKA 3BCRA 1FZQA 3FZQA 2AMVA 3PQ2A 5JDCC 3HR8A 4XOUA 3RUDA 4HQ6A 2ISSD 1DV1A 2WILA 2OQIA 5HGJA 5JQWA 3L04A 5G1PA 4MS4B 1W5FA 4MJ3A 4LHXA 1AUOA 1N6KA 1SCAA 2QVXX 1EJ6A 1JKJB 1R8QA 2F3TA 1QG0A 2QZ4A 3HI6A 4QJIA 5DXAA 1M2NA 2I9KA 2VSNA 4FYHA 5DB4A 3PK0A 3ECCA 3W4IA 3ZBPA 2XYQA 3NDJA 4ENSA 1MC8A 1HKHA 1E7MA 2DWOA 4XQCA 3T41A 3WDSA 5C8VA 1Y0BA 3CVJA 2QAGA 1HL7A 1ODTC 2NWQA 2QGFA 4I1IA 3PI7A 5CT9A 9MHTA 1XRQA 4AICA 3FRHA 1GPAA 4H3VA 2K7FA 1K4YA 1SCUA 2DHEA 421PA 4ER6A 3SXPA 4RA9A 1ZJWA 4WUTA 2I03A 1DKQA 1CIJA 3CUYA 1DXYA 1VLZA 4M22A 2L18A 1DDIA 1I4OA 1TIKA 5LP6F 4MR7B 5LXTA 1UOOA 1KC1A 2R5NA 4Y2SA 4E5PA 2BISA 1OOEA 3D1JA 3C6MA 5CFRA 2FSGA 4D3SA 1JSZA 2FUNB 3O1HB 2ZSIA 1BYUA 4UNQA 4XJTA 1M0WA 3BMXA 3ZWCA 4Z53A 4R51A 1C7EA 5D85A 2WTAA 1AZLA 5J2TA 4GI2A 1CULC 3A8TA 5H7XA 4FN4A 5DT2A 4A6PA 5BOVA 1RKVA 3L8FA 3V34A 1YB4A 2Q5HA 3G9XA 2B1GA 1KK1A 1U80A 4GWGA 1E3QA 3M6AA 2YJ4A 1PWHA 1M6VB 3ED5A 2ZCVA 4JLSA 5ED0A 3PQ4A 2DY1A 3TTWA 3DVAB 4ARZA 4IV5A 2D1QA 4EO9A 1M2VB 3L6OO 2V6FA 1U8CB 2GKGA 4Q15A 4WI1A 4YFYA 2PL5A 5B5SA 4HNTA 5LLTA 1UBJS 2B7LA 3VR4H 1N6LA 3GO4A 1G98A 3U1BA 3N0WA 4LJ4A 2GM5A 1LGYA 1ZAYA 1WA5A 4DLSA 4BE4A 2QGNA 6Q21A 4CLRA 4NFHA 3TH5A 4DIDA 4HDOB 3MM4A 2CLCX 3T9EA 3SJZA 1YJCA 4QEKA 4AMZA 2PJZA 1H2WA 2ZVQX 4QX6A 5JNSA 4DCTA 2WG0A 1UC8A 4GR5A 3T95A 1K89A 1P4RA 1ZD4A 1E6UA 3OOWA 4ZVSA 1UR5A 3V6MA 4CKEB 1IM8A 4JJEA 2VDWB 1NVGA 1R0WA 2HR1A 4YJ2B 3WLRA 4CIAA 1TM1E 3M89A 2VT6A 4EHKA 2NAPA 1XU4A 1GV0A 1MF7A 2AR7A 1B1CA 1AHNA 4K88A 4W9NA 3WL8A 4DPLA 1QZZA 1FJ2A 4YJ3F 1GG9A 1XAJA 2YFHA 1XNJA 1TTHA 3ESZA 5EJMA 4DN6A 2JRCA 1UXHA 1KU6A 5LMNB 1IAVA 4M0EA 4NH0A 3MWFA 1CRWG 8AT1A 5CM2Z 4J8PA 3VH4A 4AUNA 2Q4DA 4Y9RA 1XCGB 1EFVB 1DAIA 4QU5A 3A2KA 1OXMA 3ENQA 3JQ6A 4BLPA 4Q82A 4CL0A 4OHRA 4P32A 5E8JA 2YWGA 5FT9A 2OXIA 1XMJA 3VR3D 2V7TA 3ODGA 4NG5A 1JEYB 3MWDB 4EX7A 4BB9A 1NTOA 1ZM4A 3EOBI 3MAAC 3PUVA 1G42A 2IXTA 1U2RA 2H0AA 3ABSB 4KE9A 4RHEA 1YK0A 4BVEA 1GG5A 1PJ8A 1Q0QA 1RBZA 2DPMA 1VZ3A 3H3JA 1M75A 5CBPB 2IYSA 2Q3CA 1BXGA 5LB4A 3IBFA 5EP2A 1J07A 5JAZA 1T35A 3UV3A 3I1FA 1K8RA 1PGNA 1HBJA 2EZ4A 1ZN8A 2GJAA 4PQFA 1OWPA 1TB4A 3FDIA 3RHSA 3RSHA 3SFVA 2GN6A 1NOKA 2IPXA 3GV0A 4OMFG 4WKGA 3IFSA 3JARA 3OURA 3A70A 1UANA 3U3KA 3WO1A 1QCCA 4DA9A 3U4DA 3RRJA 1SKQA 5AUOB 2JANA 3BQ9A 4BFCA 3BIWA 3C97A 3V1NA 2AZDA 3OU6A 2WFLA 4DDWA 4REMA 4Q4CA 2E6UX 4I5IA 5LLDA 5ES4B 2IZ1A 2CLMB 2VYQA 5K0GA 4QOEA 4YRTA 2OXCA 5DKFA 3BDAA 2V7EA 4CF5A 3MRXA 3X1XA 3ZHCA 3VPFA 1X1BA 2MYUA 4CIWA 1JQ3A 2Y2UA 4CGZA 2VH2A 2ZXFA 1DG1G 1WUYA 4G9EA 5CA0F 3O92A 5FXMA 1R8XA 2W6PA 1U9CA 2C88A 3ER8A 3BE8A 4LTMA 1ML3A 2CYAA 1MAUA 5FV7A 3TOVA 5AW0A 3KEMA 4O1MA 3TK1A 4J1QA 3D0KA 5GVRA 2PH3A 4U8GA 1Z0JA 4LY0A 5ELXA 3PZBA 4ILKA 1WXEA 1S01A 4MAFA 4DUZB 5T3YA 4JVMA 2BFNA 4HVTA 4P08A 4PSUA 1AKMA 4JSYA 3T1QA 2X5OA 4JY7A 4KOAA 3AMVA 4BKRA 3OKFA 5E6SA 5IJXA 3QOFA 2VLIA 5LA6B 4OG2A 3BXPA 3FMPB 1C9NA 1JJVA 4RHCA 5HKKD 1WB4A 3G5UA 2HWWA 3KKOA 3NP9A 4NWIA 4O4HF 2N42A 1ZLXA 3BZBA 1QLJA 5DP2A 3EFEA 5KKNB 2XCUA 5LOVB 4PC2A 3IUJA 1WB5A 2D2EA 2OGSA 2VTBB 1O3YA 3HVJA 4A5OA 1PSDA 1SVSA 2ZI9A 4G1MB 5FTKA 2HIAA 4F4UA 2BL4A 1V48A 1ZJZA 1V5IA 1LI5A 4NONA 3DFUA 3OOHA 4M7RA 4ZO8A 4EITA 3V8EA 4MYHA 4R68A 5I47A 5IULC 3D6HA 2XIJA 4AJJA 1TA4A 5C8DA 2I8LA 4D7AA 4UBOA 1TVKB 4Q3DA 4IDBA 2I62A 2ZUTA 4CDMA 1E79D 5FA8A 1FB5A 4NNOA 1W36C 2ZT6A 4HLQB 2AUMA 2AJ8A 2AR9A 3W7BA 1KA9H 4FOLA 4XD7D 2HPAA 1KR2A 5LMZA 3TMKA 5ALWA 3VHQA 4UTNA 1KERA 1G6OA 4GHWA 3WP0A 1KY3A 3F6EX 3QYAA 5HDBB 3GLTA 4DNFA 3DAOA 3DAHA 1KSJA 3GD7A 3QTTA 5DBFA 3SFZA 3TE7A 1M8KA 1T25A 2O4UX 5KCMA 4Q3LA 2EG9A 1A71A 1AKWA 2EWMA 1RZVA 1G20B 1U3UA 2HOQA 4ZICA 3N05A 1HLDA 3SC4A 3ORHA 2LDXA 1WOMA 3EUAA 1N78A 1GNTA 2LP4Y 2CXNA 2FXVA 2BEVA 4RVFA 2HUPA 3TO5A 3TR0A 5BPFA 1C1YA 3GBVA 4MVXA 4JCCA 3HA2A 2VHUA 2XA1A 4PHHA 4ZCIA 3QMVA 3UNXA 1JFFA 1FFYA 2OLKA 2VDJA 3T1TA 2R7LA 3KQKA 1F14A 4IS2A 1XEFA