4TL7A

Crystal structure of n-terminal c1 domain of kaic
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
234
structure length
225
Chain Sequence
QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus (strain pcc 7942)
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 81
structure length 225
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl7A00
1IN8A 1E2PA 1Q3TA 1NJGA 4O2RA 1Z6GA 4A1FA 2JLYA 2OAP1 5KSPA 5FPKA 1H8EA 1ZC4A 1ZYUA 2P0EA 3KZ1E 2YJTD 2ZUDA 1DS6A 4MGZR 1E4VA 2ZAOA 4IOLA 1SVLA 2O8DB 3SC3A 4ARZB 4DIDA 1EFRD 4CZ2A 1FQJA 3K9GA 2WWXA 2NIPA 5KO2A 1KNXA 1Z06A 2C78A 4HAXA 3CO5A 5CDFA 1Q1QA 4YMWA 3W90A 1WB9A 4HLUC 2FFHA 3D7MA 2F9MA 3BORA 2C2HA 1YZGA 1UAAA 2IS2A 4X8MA 4LRWA 3DOFA 1Q57A 5FBWB 3U7EB 4BLRA 2BMFA 2R6FA 4WZ6A 4M9XA 1VIYA 4V0MA 3IEUA 1IN4A 3C4JA 5JFGA 1T8TA 1DE0A 3EA5A 2IYTA 4D0GA 2YWEA 1VYUA 1X3SA 4KFTA 4RD1A 1MKYA 3OIUA 2AX4A 5J4VA 3U7FB 1SVKA 4EJSB 1XEXA 4KFSA 1YRAA 2REXB 2VHUA 2QM7A 4QKQA 1FUUA 1KGDA 4R2HA 1P9WA 4DSNA 4BQSA 1KI1A 1OXTA 2O8DA 3CR7A 4LPSA 1RZ3A 3EX7C 2AKYA 2HJVA 3RS4A 5BW8A 4LV6A 2WWIA 2CK3A 2ZI4A 2VP5A 3LRPA 3GJ7A 1WMSA 1NBMD 4DIEA 2DFTA 5A0FA 4ESHA 3UMSA 1XD9A 1SVMA 4Q7MB 3QY0A 1II8A 1ZJ6A 2VP9A 2UVQA 4LV8B 2ZRFA 1OKKD 2H8KA 3K0CA 5J4KA 3CH4B 3SDZA 2AXPA 3ASYA 4HDOB 4N0EA 4V02A 1WE2A 4URWR 1I4DD 2CLDX 1EESA 3MJHA 3IUYA 2F3TA 2C04A 1ZIPA 2IWRA 4HLDA 2CDNA 5G53C 4PC2A 5CB8A 3A8TA 4KVAA 4C7OB 1RVDA 3NHAA 1IONA 3OESA 4LHYA 4CEHA 1M7BA 4C0SA 3B5JA 4EPVA 5DN6D 1OJLA 4UNRA 3P27A 1JAHA 2QMEA 1DTSA 2W2VA 1HQCA 2PX3A 2WAYA 3K53A 1MO6A 4A8JC 3CRRA 1Q44A 2XOKA 4F4CA 4X8OA 5DHFA 5GJVC 1FPMA 1UEIA 1NMYA 1Z07A 1D5CA 2K5UA 1OXXK 2FFBA 2ZI6A 3CF6R 3GJ5A 4H9GA 1P60A 5DI9A 2FGKA 5IDVA 1XPRA 4EIWA 1W4CA 2GRJA 1IY1A 1YRBA 4HUQA 1GNRA 1KY3A 3GJ8A 5B57C 1G17A 2YWHA 1KY2A 2CNWA 3FVQA 1PUJA 3WRYC 2ZETA 2CJWB 2EQBA 4G01B 2IUSA 3N2IA 3K0AA 5FTLA 3J81k 4I1VA 1IXSB 1Z6XA 2WJIA 1EFHA 1KI6B 1Z29A 2H16A 5BYKA 5GVRA 1KSJA 3I8XA 5IRCD 1DBSA 2GEUA 1DPFA 4MKGA 3I5XA 1D6JA 4DCTA 2F1HA 4ZIRB 1OXUA 5FTNA 1I2MA 1YR7A 1L8QA 3CZQA 1AK2A 1OW3B 5EXTA 4U7DA 3GLIE 2IS4A 1NVUQ 1SVOA 1W0KD 2B8WA 5EE1A 2PT7A 2OLJA 5CJPA 1ZD1A 1JAIA 2X2EA 2RGGA 3TKLA 4V03A 1ZRHA 1BYUA 4NYJR 3WMGA 4BPBA 1RE0A 1KZGB 3TAHA 3I61A 2IYXA 2IBMA 1TEXA 2OSBA 2GVDC 4PFSA 4FN5A 2Z5FA 3Q72A 1Z22A 2ZRJA 2BKEA 2L0XA 3H1TA 3ICQB 1Z0AA 4PPGA 1WF3A 2J0SA 4RZUA 1WP9A 2RB4A 4IEEA 5TDHA 4PHHA 2J45A 2QE7A 5FOVA 4HI0E 5F3WB 1OT3A 1G5TA 1US8A 4Q9HA 4GOXA 3DVLA 2D4HA 2VL7A 2BCGY 3LBNA 2QZ4A 4EUNA 1P61B 5JECA 4RFSB 3QKRA 4I1UA 3KKOA 4LJ4A 3BH0A 2FPLA 1G7SA 4PPQA 2DFNA 2JJ2D 3EASA 1QZXA 1EGAA 1R0YA 3QUSA 1GL6A 2GJSA 4EPTA 4M4SA 1SHZA 4C4PA 5EE0A 4AIIA 4D4LA 3IQXA 2BM1A 2W2TA 5AUOB 5DE3A 2JLXA 1UBCA 1UEJA 1T0JB 4Q7JB 1IQPA 3RWOA 5LPNA 5L3VA 3LLUA 1OFIA 1OLOA 4MUAA 3AKCA 4US0R 3V4RA 3CNNA 3AKYA 3RVBA 1QHHA 4V0OA 1W47A 2DHRA 1VPLA 2BCJQ 1US8B 3AVQA 1P62B 3THYA 3L82B 4L5BA 5FTMA 4LSGA 4PSKA 2ZSEA 1G3IA 3I3SR 2D2EA 1CR0A 4TMKA 5EQTA 1IXRC 4D4KA 4HB0A 4Q1FA 1SGWA 2ORWA 5B2ZA 1D8TA 1CLUA 3EPKA 1N0UA 1JXOA 2RGAA 4D25A 1QF9A 2JLSA 2YC4C 3AUYA 1RPZA 2RKOA 5FL7A 1OV4A 3AVWA 1Z0DA 3OIWA 2YOFA 2ZS9A 2QNRA 4TTQA 4X8HA 5K8UA 4EAQA 3I5YA 1IXZA 1SXJB 4WXRA 1S3SA 2FSHA 2QTVB 4WOPA 1KNQA 3WNDA 3U6BA 3CWQA 3AF4A 2OAQ1 2OUKA 2WMOB 1X1SA 3QPWA 1KDTA 1FMLA 3IO3A 4IJMA 4B6FA 4BFUA 1XJCA 2HXYA 3THYB 1UKEA 4OHYA 1E2QA 2ZRBA 3B1YA 4OK5A 2OCBA 4OK3A 1XBTA 5AUPB 2CE7A 3O8RA 1GIAA 5C4MA 4PQYA 4Q1EA 3KDSE 4V0ME 4HAUA 3TSWA 2DY1A 4V0LA 1OFUX 3GEEA 4A2QA 2VLIA 3VR2A 1QDEA 3ZS8A 4HATA 4O2LA 1GRNA 1KO4A 5EXSA 4QBHA 1G19A 3UATA 1VIAA 4XSHA 1R8SA 1SZPA 4JJKA 3KFVA 4IVQA 4C0QC 1CEEA 1G8HA 3SYKA 3H2YA 4UNNA 3WP1B 3OHMA 3QEJA 2BBWA 3AKEA 3K0FA 4R71A 1SXJA 5DLQC 4AKHA 1FZQA 4JIMA 3HJNA 2BM0A 4LYFA 2FSGA 4TL6A 3P20A 1G8GA 2W6IA 3AVYA 1LV7A 1JPNA 4G5SA 3LD9A 5FPHA 3W6OA 4GRAA 4R9UC 3DEFA 4B2PA 3SJZA 4HB2A 1MRNA 2J7PA 3GMTA 4AC9A 4QGFA 1CXZA 1IOZA 1GAJA 3CH5A 3D3QA 4HZUB 4PSVA 5D3QA 4BRWA 4NYMQ 2C99A 4UNSA 3UANA 2QMOA 3UMRA 1DO0A 2BJWA 4HAVA 4TLAA 4DLZA 2JDIA 4BECA 1E0AA 2NZJA 5JJLA 2IYYA 3TJZA 1VG8A 3LH5A 4JZKA 3SHWA 2HLDA 3MD0A 2WIAA 2ZI3A 4JLOA 3C8UA 3FMOB 2X8AA 3NHBA 2EWVA 3SHFA 2IW3A 2EWWA 4OQFA 1IM2A 2ZJ2A 1K5DA 1JR3E 2OV2A 2EFHB 1VYVA 4LWZA 3CX8A 2YYZA 2QPTA 1XMSA 2WJHA 3BFXA 4EDHA 2J46A 5FUVA 4ZDWA 2J3EA 3PVSA 5L3RA 2O8FA 4Q1BA 3P32A 3N70A 1JJ7A 5KSYA 3EC1A 1VCMA 1G291 4H1VA 1Z08A 4D4JA 2ZXUA 4A15A 1HY3A 3AF0A 3Q7QA 4LHZA 1P2SA 3K09A 3ADKA 1ELOA 2V54A 2O8EB 3ZVMA 3LX5A 1W0JA 4DT1B 1I4TD 4ERNA 1M7HA 3AF3A 4TMZA 5HE9A 4NTZA 3WMFA 2ZJ5A 1JB1A 2ZJ8A 4Q18A 4M1WA 3I62A 4DSTA 1OIXA 1E1QD 4UXHA 5C2JB 3FKQA 3DPUA 1MO3A 3V00A 1Z83A 3I1FA 4RJLA 1V43A 1S8FA 1Z0FA 3TNFA 4JLAA 2ZRAA 2QRZA 3PCRB 5FPSA 2J41A 4BRUA 3QPUA 4GPTA 5H1YA 1DAFA 1G6HA 4URYR 3AP2A 4PHTA 2Z4SA 1MABA 1JEEA 2AXNA 1DG3A 4DDUA 5TARA 3MSXA 2KE5A 1IY2A 1GP2A 4MDFA 2FZLA 3NDPA 1P4SA 2AKAB 5C18A 2O8EA 3U3OA 2GCNA 4L8GA 5GJWC 2IYZA 2GNOA 4N3NA 2OFXA 4D4MA 2WIBA 2ZJOA 3ZVRA 3AH8A 4S35A 4JSYA 4A0FA 3ZD6A 2A7QA 1K6MA 1VKJA 1JQJC 3QKTA 1Q21A 3LW7A 3IHLA 4M0LA 2Q9AA 2J0VA 2GEVA 4WBSA 1LVGA 4I81A 4Z1MD 3Q85A 3AVVA 4WZBE 2IEZA 2R6CA 3BIFA 4ZI2A 4ASUD 5BXQC 1E9SA 2RHDA 5AR1A 1OFTA 2BJVA 1MT0A 1MABB 2ZANA 3QNUA 4A36A 2YHSA 3MCAA 3DZDA 4Z51A 1XXHA 1YKSA 2GKSA 3EC2A 4B43A 1V5WA 1DAEA 4FMDF 1EWRA 3RNLA 1WCV1 4PSAA 2HJGA 2ZSDA 4DLRA 1P75A 4DLSA 4C7OA 4YONB 1CP2A 3RRMA 1YVDA 4CEHB 1VCNA 1ANKA 2WJJA 1KO5A 3P4XA 1T3SA 3AP3A 4IOMA 3F8TA 5F98A 3R9XA 3E2IA 2QAJA 1P72A 2CXXA 2H18A 4RD2A 4EPWA 3GLFA 1VG0B 2WZQA 2A30A 2GHIA 3FB4A 3QBVA 3A4NA 4C0KA 2QORA 4X8LA 2D06A 2WKRA 5JJKA 4PAOA 1QG4A 1W4RA 1UF9A 3JZAA 4OQXA 2VF7A 2PZGA 3MMPA 2RGBA 4BZXA 3KTAA 4XVUA 2EFDB 2XB2A 2Q3HA 3K9HA 4HSEA 4OHZA 3FPAA 5CYPA 3K0AB 4TLCA 5FI0B 4DKXA 1UDXA 2W0SA 2WTUA 2Z6VA 2ZM5A 3VR3A 1DVRA 1NIJA 4ILEA 1SKYE 2G6BA 2QTHA 1S4QA 2BBOA 3CBQA 4UNQA 4XVRA 1IJFA 4BZQA 4DXAA 4DLYA 2GESA 3P26A 4KBFA 3PR1A 3PIRA 1KJZA 5BN4A 2O8CA 1N6PA 4PX9A 4Q9JA 2PH1A 4Q1CA 4TYWA 2GBLA 1CJTC 3HU3A 4I1OA 5JEDA 2DB3A 1T6NA 3WNCA 2FJUA 3JVVA 5AUNB 3TLXA 4US2R 4AKGA 1P6XA 3WHLA 1BO6A 2O0KA 4Q4JB 4B3GA 5CIQA 1Q1ZA 1G3MA 2ZRPA 2EFEB 2I4IA 3TVTA 3CF0A 1TX4B 5C4GB 1GRQA 2RCNA 4ZI3A 1PJRA 3THWA 4TYNA 1T3LA 3W34A 2FV8A 4RKEA 3QE0A 4JL6A 4L9SA 2R6GA 1N5LA 1VCIA 4LYJA 4Q66C 4QG7A 1S3GA 1ESNA 3E5HA 2IYUA 4FMCF 1YR9A 3GD7A 1RJ9A 2QY9A 3NVAA 4PXAA 2HLDD 1GFIA 3FKSA 4PO8A 4DCSA 1CTQA 2G83A 3KL4A 4YXWD 5H68A 4GOKA 2CNWD 5E4FA 2O8CB 2NQ2C 3NC0C 4RD0A 3R7WB 2JIZA 4LJ8A 5IF9A 2CMKA 4CW7A 4YC7A 4BLSA 3OE7A 1U94A 1COWD 2W2XA 1W44A 1DAKA 2BMJA 4LUCA 4OHXA 4XD7A 5AJYA 4ZKEA 5KUTA 4TL9A 1OB2A 4QJ5A 4PHGA 3REGA 2W6ID 4Q4HA 3R8CA 4QGGA 2VSXA 2ZVPX 3ZZTA 1E2IA 5A5GA 4NHOA 4B3CA 4KSBA 4LCBA 4GNKA 1JR3A 4JLDA 2XAUA 2EYQA 5FL7D 1QHHB 1W0JD 1MH1A 3GJ3A 2WWYA 4Q1AA 1E3MA 2IS1A 1RYFA 2AFHE 2XNDA 1NI3A 1GOTA 3MWLA 3ZVLA 4JLPA 2ATVA 4Z1MA 4OJKA 5DYIA 3DKVA 1HT2E 4ACBA 2RMKA 1KDOA 3ZIAA 1A5TA 3VU9B 2EFGA 2GJKA 3BH6A 4UKDA 3DZ8A 1NY5A 2KI5A 2V6JA 2LWIA 4QM7A 2QROA 2NGRA 4URVR 5KNCA 2O0JA 1W2HA 2R9VA 3EA0A 2QAGB 3IPYA 4LOAA 4FW9A 4NCHA 3TVDA 4YMVA 4RZXA 721PA 3NBYC 3BK7A 2AD5A 2V9PA 3LLMA 4M1KA 1Z0IA 2EU8A 1COWA 3KFXA 3A1WA 3B82A 3EZ2A 1N6IA 3LW8A 2CVHA 4NE2A 4D26A 2ZR7A 2G1JA 1Z28A 2JJ1A 4KITB 3PEUA 2JAQA 3VR6A 4ABYA 2ASEA 3QXJA 1ZM3A 2UZIR 4IVRA 1PLKA 1NLZA 3B78A 4JL5A 5FUWA 4AYTA 2JLZA 4MRNA 3QG5A 1N6NA 3TR5A 3W9YA 1AS0A 3ASZA 3RRYA 1G7CA 3VU9A 4HUTA 3VHXA 2B7BA 3L0PA 1ZNWA 4Q48A 4FMCB 4TSFA 4PZYA 2C8VA 4OL0A 1G64A 3BBPA 2PLRA 4PAMA 2PEYA 1GNQA 2CL7X 5FTJA 1N6HA 3K0FB 4IOJA 3LQRA 4BFXA 5B30A 1KKMA 4M9ZA 5EP2A 5H70A 2G3YA 5TVKA 3FGNA 4WVFA 5FTKA 2P5TB 4P31A 3CPEA 2F1JA 3CZPA 4H1UA 4KU4A 2FOLA 1E79D 3VFDA 4XWAA 3X2SA 1EWQA 1LNZA 5AJVB 1E0KA 1RRPA 2VSOA 2ZI9A 3KJHA 1GVNB 2G0NA 2R65A 5AJXA 2ZYUX 1SXJD 5F2EA 3U7GA 3CKLA 3K70B 4GFDA 2BV3A 4JLBA 4NKRA 3T34A 3HR8A 1FNNA 2GDJA 1E9AA 2CHVA 5P21A 1GTVA 3NXSA 2ZE7A 3O47A 4M1SA 1M6NA 1RC8A 3AVXA 4KFRA 4JS0A 1F5NA 3AF1A 2V7QD 2ZRDA 1Y63A 2HCBA 2W00A 1RIFA 5EP4A 3Q8XB 3X1ZA 4DSUA 1UBFA 1BYIA 2BWJA 3KKMA 4NP6A 1W1WA 3UKDA 5DI3B 2DWPA 2GTPA 2DBYA 2AFIE 4P33A 3BB3A 4PR0A 2YKGA 3P4YA 2GEDA 5FR2A 3U44A 1E9EA 4C3ZA 5GJBA 2N1BA 3IDQA 3RS2A 1DOAA 1W7AA 3TSOA 4QOSA 4AK9A 4NONA 4XTRA 3B9QA 1U0JA 4BFYA 3QF4A 4YMTA 3VNUA 3W5IA 4QNMA 2RGDA 3C41J 2XZPA 2RGXA 1L7VC 4OI0A 1ZM2A 5HZKA 2QSYA 3KB1A 4CGZA 1NIPA 4EJSA 3KXLA 4BUJA 4W9MC 3EZ7A 1BS1A 5BYJA 2AHOA 1G21E 2ODWA 1NVWQ 3RS5A 1GRRA 2XNDD 4PANA 3TSZA 4C0HA 4XH9B 2V3CC 5FR1A 2AR7A 3LV8A 5TXGA 4B3DA 1J99A 3QVUA 3KQHA 2ZRCA 5JJIA 2HXSA 521PA 2Y8EA 4NDZA 121PA 1KI4A 2QQ0A 1B23P 3A1VA 3CONA 5FL3A 3OAAA 4CDGA 2CEAA 4FMDB 5CM9C 1QHYA 2D7CA 4KO8A 5BQ5A 2BDTA 2OHFA 4F92B 2ZE6A 2BHRA 3U61B 4U5XA 3QF7A 4OHWA 3RDPA 3X1WA 2ATXA 2QPAA 2VHCA 3AGPA 2Q0HA 3DM9B 3BH7A 3KXKA 5JI2E 2OBMA 4DVGA 4TZ6A 1UKYA 2P67A 3W6PA 1XEWY 2YV5A 2R62A 2VSFA 4J0QA 3ZIAD 5JS7A 2NMVA 5L3QB 2ZU0C 1J2JA 1DADA 1ZINA 3AV0B 3FFBA 3PEYA 3GFPA 2ZAMA 1VYTA 1XF9A 5EE9A 4BASA 4W5JA 4IFEA 2OT3B 2QAGC 2Z83A 2R6DA 3QKSA 2VQSA 4JVMA 2O8BB 3SEAA 2QEQA 1J8MF 2QP3A 2FEOA 2QA5A 3LVQE 1QRAA 5J47A 3U3MA 1E2KA 2NO9A 2ZI5A 4JLKA 3GPLA 3U60B 1NVVQ 2ZRKA 4GMDA 2XSZD 2RGCA 3PQCA 1Y3AA 4K46A 1TQDA 3D8BA 3SR0A 3CPHA 3S1AB 2ZITA 2PJZA 5CK4A 1W48A 1OFHA 2I3BA 2V8OA 3B1VA 2J1LA 4RD6A 4JYCA 1CULC 4W7SA 2GBLC 5FBVB 2LKDA 4LJ9A 3KJGA 5GADl 2FFQA 1ZCAA 1AN0A 1KI6A 2WM9B 5F9FA 1WBDA 1DELA 3HPQA 5C46F 4QHSA 1TU4A 5FUXA 1AKEA 1VTKA 1XB2A 3C7KA 2O8BA 1TTTA 3T61A 2GA8A 1NF3A 1F48A 4ZIRA 2GXQA 4MKHA 4UXIA 4QHYA 2F9LA 2GETA 4FCTA 2J7KA 4IW3B 5CLQA 4D80A 1XDBA 4NCIA 1Q20A 2WAXA 5AUQA 4EPXA 2IA5A 1SULA 5JCZA 3DOEA 2UKDA 2DR3A 4LHWA 1Q0UA 4US1R 3DKPA 3K70C 1HURA 4IEIA 2AL7A 2ERYA 3GLHA 2QU8A 2BIFA 4JT4A 1G16A 2A9KA 4OQLA 1KI8A 1X6VA 1PV4A 2YZ2A 1XMVA 1F6BA 5EP1A 4GDFA 4ZV4A 5CYOA 2F43A 5BN5A 1SXJE 4GOJA 4NPHA 3RHFA 3H84A 4B3FX 3KX2A 1Q22A 2IC5A 3EW9A 1NP6A 2FSFA 4BZPA 3GLGB 2FNAA 4CEIA 4C0AC 4TMXA 3V4FA 1G18A 4DZZA 4GT1A 4R98A 4XTCS 4LGMA 1HEIA 4I4LA 1KIMA 1WBBA 5CLLA 2FSIA 2ONJA 2B8TA 3W3AA 4P4UA 1E2MA 4A2PA 1BKDR 1LS1A 2CCGA 4XOIA 5EP3A 3SQWA 1R0WA 3I73A 4Q4JA 2BOVA 3WP0A 3ZS9A 2ZSAA 1ZCBA 4C0BA 2IF0A 2CL6X 1Z6TA 3HR7A 3T1QA 1XJQA 4QBIA 3BS4A 1KAGA 4IDPA 3HYRA 1W5SA 2J0QA 2J87A 1S9DA 2WPDD 1LTQA 3B9PA 2FG5A 5KTYA 1OH7A 2H1LA 3VR1A 2F7SA 4OI1A 2JLVA 3HDTA 1XWIA 4MYTA 3NDBB 4N0DA 3OZXA 2VF8A 4YQFA 1NNEA 2F3RA 3HYTA 1BMFD 4A0HA 1XD2B 2QN6A 3LY5A 3RWMB 1F3OA 1KO8A 2JLQA 1Z47A 2W6JD 4Q00A 5FOWA 2O0HA 1ZW6A 3VKGA 3FFAA 1HT1E 2OCYC 4Q4HB 3OEED 3T5GA 2Q21A 5B58C 1FL9A 1G5PA 3IQWA 3GJ6A 5G3YA 3K0SA 2KJQA 1A1VA 1JPJA 4AI6A 2WHXA 4ZCLA 3H86A 3BE4A 4TMTA 1J90A 2V4ZA 1II0A 4L15A 2G9NA 4BLPA 1YHNA 4AY2A 3KJIA 3OEHD 1XD8A 4LYHA 5J4LA 3U7HB 1E2FA 2NO7A 5EUMA 3QEOA 2ZRNA 2ERXA 3I72A 2EFCB 1F2TA 3AGQA 4BFSA 1K8RA 4BFZA 4IKEA 1T5IA 3EIHA 4DSOA 4TMVA 3TRFA 4K81B 5HE8A 4A6XA 3CNOA 4AWXA 2WJVA 2ZREA 1U9IC 4MQBA 4Q7LA 5TMPA 6Q21A 1XEFA 2XSZA 5KU1A 4OKSA 3I32A 4F91B 3AB3A 3LNCA 3QXHA 4JLJA 3RS0A 1Z0KA 3ZJYA 3GJ0A 4A6PA 4E09A 5CITA 4M2LA 3OFND 3BERA 1RRCA 4L4UA 3U3RA 1G6OA 3A1UA 1GWNA 3AF2A 2QGNA 4JT2A 3UMFA 2QI9C 5EXPA 3T5DA 1M2OB 1XTJA 1ODFA 2DPXA 3ZQ6A 4DWJA 1XCMA 1E2NA 4B3BA 2P6UA 1JECA 1TF5A 3NWJA 1JNYA 1NMXA 2OZEA 1W49A 2GVZC 2QT0A 2Z43A 3BOSA 3QIAA 3SYNA 1XXHE 1FW6A 3OIYA 4QBFA 4DB2A 2QE7D 2V1XA 1DAIA 2FE4A 3M0EA 4ESVA 4N1AA 5L8VA 2A5DA 1E0JA 1ZAKA 3TW8B 1CF4A 3U6KA 4QL3A 2IXGA 1D9ZA 3QG1A 2IEYA 3SFVA 3OEHA 5HKKD 2IWHA 1N5JA 2ZPTX 4G3XA 2J7PD 3ND8A 4JLVA 2VO1A 2UZ3A 4B35A 1UBEA 4M22A 2G88A 3FE2A 2WWWA 1AS2A 2GAOA 3TK1A 4D81A 5DNYB 1KAOA 3GFOA 1Q12A 1MOZA 4GL2A 3H4MA 4MDEA 2PBRA 2H5EA 3QXXA 4AYXA 1GKUB 1UKZA 2WMNB 3OFNA 4CEJA 3C16C 4Q03A 1C9KA 3C5HA 4B47A 4LDJA 4DC9A 1XZPA 2O52A 1G4AE 3CX6A 3MFYA 1G3RA 3LA6A 2IYWA 1LS6A 3HPRA 3QQ5A 3LAWA 3T06B 1AM4D 1PLLA 3U4QB 1P2UA 2B6HA 3BD9A 1OH5A 1XEXB 4RCZA 3T15A 2CLSA 4B75A 3ADDA 2IK8A 3UG6A 1F2UA 1QG2A 5DI3A 4CT4B 1FX0B 2Q9BA 3F0TA 4B44A 2ZJZA 3U44B 2NO6A 2NTYC 5TV2A 3SBEA 1NLYA 3T1VA 3AVTA 2PCLA 4ZDJA 1ZIOA 3B85A 2FZ4A 2VP6A 3OEEA 3CLVA 1A2BA 3NC1C 2VRWA 4WZAE 1E32A 1S9HA 3T35A 1OXVA 1AKYA 5G41A 3FKSD 4KHZA 3TUZC 2ZRMA 4DCNA 1HE1C 1H8HA 2R44A 3GLHE 1HTWA 2CK3D 2YWFA 2ZS8A 4M9QA 4MH0R 4BEJA 1NN5A 3LFUA 3DMDA 4U02A 3CRW1 2N46A 4IDQA 1IJEA 4MRVA 2ZROA 4HZIA 4PZZA 5FBRB 3T1TA 4AKIA 3BB1A 4PQRA 3K09C 1EFCA 4G5RA 1E4YA 1FX0A 4POAA 2VHTA 2QT1A 3W3ZB 2H92A 5E7MA 4PPFA 4RY2A 4HAYA 4BLQA 3AM1A 4UQOA 1G8PA 1NKSA 1R0ZA 2J9RA 5JHGB 2ZTSA 2EYUA 3IPXA 3TR0A 4CF7A 2IXEA 4F93B 3TMKA 4LJ6A 1NBMA 3REFA 2NZ8A 1EK0A 1JEDA 2F55A 5JWRA 4G0NA 1SVIA 2NO0A 4F4IA 4PC6A 2QBYB 2ZJYA 1DAGA 4D0LB 4MYHA 1E9RA 1QBKC 1PLJA 3QJYA 2H17A 3K70D 3ZLJA 4YMUA 2JDID 1E69A 2YVUA 1TL7C 3LO5A 3O8BA 1H8ED 1C1YA 2VYFA 3QKSB 4LHVA 4XSGA 3PUXA 1P9RA 1U81A 5EZ5A 3CIOA 1E2EA 1ZVQA 1TQ2A 2DFKB 3KB2A 2A5GA 2BKUA 1M7GA 1HUQA 3JVUA 2JLWA 1P2VA 3RANA 4NCKA 3KQNA 3GQBA 4FCWA 3S1AA 2F6RA 4D0NA 1CRPA 2WKQA 3EPHA 5TB5A 2ZYTX 4HLCA 1P9NA 1VHTA 3X1YA 1QVRA 5K8IA 2RGNC 2QBYA 4GSYA 4XVQA 5E7IA 2OG2A 4MITA 4URUR 1XNJA 4ASUA 2BVNA 3CX7A 4LJAA 3VKWA 3QSYA 1X8LA 4OK6A 3OAAD 3BC1A 3CR8A 1AA9A 4TMWA 4A92A 3FDIA 4M1YA 4EFMA 2RHMA 1BOFA 5SZIA 2ANBA 3QKRB 5TY0A 1XMJA 3NTUA 1XTSA 3SS8A 3THOA 3U2QA 4KV9A 2OESA 1LF5A 4CVNA 1BH2A 2VP4A 2W6JA 2ZRIA 2A78A 4BEBA 4QJ3A 2ODEA 1VMAA 4M53A 1K5GA 1DARA 1E2JA 1ZUIA 2I1QA 2P3SA 2KBFA 4QM6A 2QP9X 2Z4RA 1G1MA 1UPTA 1LF0A 5KDLA 2WWFA 4QHTA 5CIWA 2HDNB 3M1IA 5JHHB 2Q9CA 4RVCA 3I92A 3VTKA 221PA 1W36C 2GK6A 4HB4A 5KPJA 1N5KA 4NL4H 4DLWA 3T1OA 1YZKA 2CJWA 4YXWA 3N5CA 4DEXA 2F43B 5SZHB 1FOEB 4JVNA 1DAMA 4QFMA 2HCJB 1JXMA 1SKQA 2Z0MA 5FOSA 2GZHA 3QI2A 2A5JA 5IK2A 4EQ6B 5KSZA 1MO5A 3EWAA 3GLGA 4D6PA 1IY0A 2F1RA 1R0XA 1KO1A 3GEIA 3HWSA 4Q21A 1WRBA 4Y0AA 2QSZA 3SJAA 2YWGA 3NG1A 1KI7A 3M4YA 4TTPA 3UG7A 1XTKA 2IL1A 1R10A 3SN6A 3K8YA 4KCGA 2R2AA 5KNBA 3FMPB 2ZS7A 3SBDA 2R8RA 4CIDA 1ZP6A 2D74A 3K9NA 4IRUB 4QC2A 2V55B 1IAQA 3IEVA 3B60A 3WY9A 2V6IA 3EPLA 4JLNA 4RCYA 1E96A 4S2EA 3SYLA 3ZQJA 4DUGA 2KSQA 3A58B 3QVVA 4BFWA 4DLTA 3CUEF 1AS3A 4F4JA 4LK2A 2WVJA 3GFTA 1FP6A 2ZJBA 4B2LA 4DDTA 3VMFA 4XWOA 4GZMA 1CIPA 2ZE8A 3PUVA 4CT5A 1E9DA 1TMKA 3DHWC 3L2OB 5E7JA 5F9HA 1VG1A 4O25A 5KYKA 4B33A 3LBIA 3G5UA 1FMJA 3KUDA 5EXXA 4Q5IA 5GJCA 4FWTA 4I1SA 1T9HA 2QM8A 4QRHA 3FYHA 4KBGA 3CB4A 3A4LA 4B71A 2P6NA 4Q02A 1TF2A 1TEVA 4Z8YA 2JEOA 3TH5A 2PMDA 1EFUA 3R9WA 4PQFA 2ORVA 4TLDA 421PA 1J7KA 1N6KA 3K1JA 3NH9A 4XWKA 5KSOA 2QAGA 2D62A 3AVPA 5HPYB 2GXAA 1FUKA 2SHKA 4IFBA 1Z2CA 1N3BA 1AGPA 1R5BA 4EJSC 1S0UA 3R9IA 1GL9B 3U3KA 3UK6A 4F38A 2XZOA 2OILA 3WNBA 4PO1A 3ZYCA 3NBZC 2FMXA 2X1VA 1YR6A 1F60A 1OIWA 1LB1B 3TAUA 1CJMA 3B13B 2HT6A 3NBXX 4HZUA 2CE2X 1WA5A 4B32A 3LXRA 4UJ5A 1F2TB 3MWYW 5FFMA 1SHKA 1II9A 1N2CE 3MWKA 1HQYE 2JASA 4NU0A 2IYQA 3GCGA 1VCOA 3GP8A 1DEKA 2C95A 5LB2A 4PC3A 3EIEA 4Z54A 2FFAA 5M04A 4M1TA 1I2DA 2GCPA 3Q7PA 1Z8FA 5BN3A 4TYYA 4JBXA 1U0HC 3E1SA 1ESMA 1P3JA 3EZ6A 4GBMA 3W8RA 1JJVA 2ZRLA 4QXAA 2O8FB 4KFUA 1JI0A 4ZCIA 3AQ4A 1RKBA 1ZNYA 4W5HA 3MWJA 5DHAA 2QGZA 3M6AA 4AURA 1YZLA 3TIFA 3ICEA 2FF7A 4FXPA 4A4DA 3RAPR 3W6NA 1KI3A 1KDRA 2IYVA 2GF9A 1X8JA 1Z6YA 2QUZA 1XMIA 8OHMA 4JVLA 2OCPA 4RSGA 2A5YB 4FCVA 4TYQA 4YMSA 4ITRC 2NO1A 3U3JA 1Z6AA 1OHHA 1JBKA 1XU4A 3IO5A 1G4UR 4A8JA 2OBLA 2XNSA 5DIFA 2ODNA 5K8TA 1LW7A 1E2LA 5JSZB 5IK2D 4FD2A 5KNDA 2JIZD 2MSEB 4QBGB 2GWHA 2ZRGA 1CKEA 1NL3A 1X8KA 1ZM4A 3IIKA 1NN3A 1VG9B 2ONKA 2N42A 4I99A 1ZNZA 1VDZA 2FN4A 4PC1A 2MSDB 4BLTA 4PTLA 3TUJC 3SFZA 1GNPA 1QHXA 1CS4C 1T3HA 5JLJA 4HLQB 4E03A 3N2EA 4MKIA 4JJZA 3VNVA 1B0UA 2ZQ5A 2VA8A 3QF4B 4HLUA 3SOPA 3UPUA 4L9WA 1FTSA 1E94E 2C9OA 2G77B 5JI3E 3X1DA 3RSOA 5SZJA 4OJQA 3VX3A 2YINC 2JJ2A 4A8JB 1G3QA 1HA3A 2W58A 4O3MA 2GCOA 4WA7A 3HP1A 4ON9A 2IF2A 4ARZA 1CJKC 1XTRA 1U8AA 4EFLA 4TT3D 3PUWA 1N25A 4RZ2A 3ADBA 1O3YA 2RGNA 1GKIA 2JLRA 2CHGA 4DBLC 5B64A 2OBNA 1EG7A 4LZZA 1VHLA 3EPJA 3SE0A 3ZDQA 3CRVA 2AWOA 5HZHA 3PFIA 4TT3A 2KBEA 1XXHB 2HYIC 2P6RA 1P5ZB 4D82A 1FTNA 2IXFA 4JKIA 1PZNA 1R6BX 4IDNA 1CRQA 1E6CA 3KKPA 3R8FA 1XEWX 1D9XA 2ORIA 3PITA 1GM5A 3QPVA 1C4OA 1QHIA 1ZU4A 1E9FA 2JATA 2QG6A 3IBGA 3MUFA 3OF5A 5JRZA 2GCOB 5L3QA 2BMDA 2QPOA 1G5RA 2HV8A 2QTFA 1XFAA 2WSSD 1UBGA 1U8ZA 4NMMA 4HAZA 1KO7A 4A0GA 3CPJB 4OI2A 1N6OA 1EX7A 3UWKA 5HKKA 3VR5A 3GLGE 3TBKA 4DDVA 1II8B 1AQYA 4Y0VA 1R7RA 4KLZA 4OHVA 3TGPA 1Q1BA 1QHNA 4C0JA 1NRJB 5JCPA 3RLFA 2JJ8A 4KAXA 1GG2A 1FNMA 1CR4A 1KMQA 1N0WA 2VH5R 1E98A 2VIIA 4IHQA 4JBWA 4P3YA 4B73A 1CR1A 1W46A 4K8OA 4EPRA 3KTAB 5FPYA 4MYUA 3B7GA 4FINA 1NSFA 4A0RA 3AKDA 3QENA 4CYMA 1E1RD 1D2MA 1ZM7A 2G0TA 4NYIQ 2CVFA 3NBFA 1XPUA 1AIPA 1OH8A 1OH6A 1MV5A 5JWHA 2X2FA 3MLEA 4WXPA 4EKDA 4RKFA 4RD3A 2RGEA 4GP7A 4UNPA 3D31A 1MR3F 4KI0A 4LY6A 4M21A 1T0HB 5FOTA 2OXCA 3RYTC 3FOZA 3AEZA 2XZLA 1YZUA 5KHOC 1AGRA 4KYIB 4HDQB 3TE6A 3WYFA 2ODBA 4HUQB 4Q19A 3CM0A 4DLXA 3MAAC 1ZNXA 3B6EA 3GLHB 3AVUA 2C9CA 3PUYA 3AUXA 1XRJA 3WHKA 3KQLA 3UWOA 1TADA 1TU3A 5E95A 4II7A 3BAFA 3K0EA 3EZ9A 1N6LA 4OI4A 1RYHA 5DSZA 5J4YA 2AK3A 3PEWA 1MO4A 4QNRA 2B92A 5EJEA 2O5VA 4NH0A 2EVWX 1E0SA 4JL8A 4P0TA 5CDFE 2B7CA 3HU1A 2AN9A 4A2WA 3RC8A 1SQ5A 3OE7D 2VHQA 1ZMXA 2A2ZA 4LBZA 4DB4A 1E99A 3EXAA 2GAAA 2P65A 3GLFB 3L43A 2LKCA 5BWMA 1PUIA 4P32A 1AZTA 3R7WA 2PLFA 4TLBA 4ZDKA 1E1RA 3C15C 1U98A 1KHTA 2REBA 1G8FA 1XJ0A 2WICA 1N6RA 2FX3A 2GZAA 1EX6A 3DM5A 1X86B 4Q9KA 2IHBA 4Z8XA 1CJVC 1YR8A 2FWRA 1Q3HA 3DL0A 4IXNA 3AVOA 2G1KA 3EIQA 4JMPA 4GMXA 1KDPA 2CCJA 1LFDB 2ZI7A 1BIFA 3FWYA 1RW4A 3ZVNA 3TW4A 4LJ5A 2FGJA 3ND9A 5K8LA 1HE8B 1UJ2A 4LBYA 3V9PA 1T4GA 2E9SA 4NCJA 2DCUA 3IGFA 4NCNA 4UXJA 4MYCA 5FOUA 4EPYA 1PVOA 5A4JA 2DYKA 4TL7A 2FPMA 3A6PC 3LWNA 1TQ6A 3VHLB 3IBYA 3PEVA 4MGIR 4EQ6A 4EFNA 3IIMA 3VR4A 1OHHD 1Z3IX 4G5GA 4JBYA 4L16A 4ZPXA 1IHUA 1OYYA 5JMTA 1QHSA 1SVSA 2OO7A 2OM2A 5KOYA 1UM8A 621PA 5JRJA 1NVXQ 4BLOA 5L3SB 2OEPA 3THXA 1XD2A 1ZUNB 2ZE5A 1G3UA 3SNHA 5JWOA 2RAPA 2NG1A 5AWFC 3WBKA 3O8CA 2JJ1D 3CNLA 1IN7A 3H0KA 2PCJA 5GVSA 5AJZA 2H57A 3THWB 1DAHA 4FIDA 3O8DA 1AQUA 1NVVR 1YE8A 2BMEA 4PO9A 3K9LA 4GI7A 4U00A 4HEJA 3SZRA 4ZDIA 1YQTA 2J59A 3ETLA 3NIBA 4RFVA 1L4UA 2PL3A 5CB6A 3GLIB 1NY6A 2XTMA 3F5FA 4YDHB 2MMCA 4C2UA 2AWNA 3PXGA 2J0UA 2HYDA 2IUTA 4B76A 1UKVY 1LY1A 3EZFA 1WDTA 4MRSA 4CRWB 2GILA 5L3SA 3THXB 4TYPA 4LJYA 3ZD7A 1D2EA 3WYGA 1U0LA 4MUBA 1W4AA 4IOKA 2CLCX 1ONBA 4LPKA 5KDOA 4NZYA 2WV9A 4MRRA 1OE0A 5FBLB 3Q3JB 2XXAA 3CW2A 2IYRA 2ZR0A 1NLFA 2QP4A 3SU8A 3EARA 4XIGS 3LX8A 1JR6A 1UFQA 1OF1A 1G41A 1VECA 2P2LA 4D2IA 3SJCA 1AJEA 2WSMA 4WW0A 5ELXA 2C98A 5DO9A 5KPDA 3GLIA 1TPZA 2ANCA 2ZU6A 1GITA 2J0UB 4LX0A 3LXXA 4TQAA 3ECCA 1NBME 1ZBDA 1OIVA 2DWQA 1U8YA 1KK3A 3BWDD 2I1VB 2VP2A 5IT5A 4KSCA 2XOKD 3C5CA 3HU2A 1UADA 1A2KC 3KXIA 5ANRB 2CL0X 2FEMA 2JGNA 4IVPA 4XJXA 4DHEA 3BB4A 1SXJC 3SJBA 2JA1A 4FI3C 2XXAB 3FHTA 2PEZA 1H8HD 2HUPA 5EE3A 5CK5A 1M8PA 1OPXA 1E1QA 4R7ZA 5E3HA 2WWHA 3QBTA 3RRNA 2PZEA 1S96A 2QMUA 3RS3A 1KMHB 4Q9IA 1DO2A 5D3MA 2C9YA 3X1XA 4WIAA 1M74A 4JYBA 2XJ9A 1XCPA 2NPIA 2IX3A 2X19A 2FDCA 5J4HA 2WOOA 2WBLC 4YDSA 3T12A 5DN6A 3CRQA 5AK0A 5LBIA 2XGJA 1Z0JA 3ZGXA 5JEEA 3U4QA 4BFVA 1U2RA 2BC9A 2GXUA 1KTVA 5JSZA 3G0HA 1M34E 3LBHA 1L4YA 2W0MA 5JZVA 1L2TA 1F2UB 3B1ZA 3B1WA 1YZTA 2ZIAA 3DDCA 5G40A 2IS6A 3RRZA 4PZLA 5CJ2A 5EUQB 4MRPA 4OYHA 2REOA 4AG6A 4Q4LA 1UDWA 2JLUA 3E70C 5FI1B 4DLVA 4KXFB 5DH9A 1KMHA 4PAQA 2AK2A 2OXRA 3B8HA 2Q6TA 5FBQB 2QMHA 1Z5ZA 2F1IA 1A4RA 2XB4A 1IN5A 2NOAA 2CBZA 2D2FA 2HEIA 1E79A 3CF2A 4DRZA 4GP6A 1J70A 1P2TA 4C2TA 4A82A 4E5UA 1XX6A 2VEDA 2D3WA 4DCVA 1E2GA 3A36A 4A9AA 3L0OA 3VQTA 2C96A 1O87A 3EWSA 1N5IA 2PJRA 1ZD9A 3NEJA 3L8YA 4DCUA 5DGXA 3GJXC 2FH5B 1YZNA 1XPOA 1KI2A 1R4AA 4O0MA 1Z63A 1T91A 4MGKR 2P5SA 4TSFD 3BGWA 3A37A 3BFVA 3EG5A 3L0SA 1XP8A 3PV0A 2VP0A 2OLKA 1T5LA 4AD8A 2C5LA 1BMFA 1KK0A 5CM8B 2PX0A 4DUGD 2JCSA 2OCAA 2WJGA 3DMNA 3W8NA 1YZQA 2IHYA 2D7DA 2E87A 2ZYWX 3WXMA 2PT5A 3NEYA 4ACAA 3GEHA 1CBUA 4B48A 2DWOA 3LVRE 4Q9LA 4IDOA 3MGCA 4V0NA 5JS8A 2VHJA 3FMFA 5LB4A 2WKPA 4M1OA 1S1CA 4W5WA 4NYMR 1KSGA 1P7CA 5JBQA 3FTQA 3AP1A 1YU9A 2KWIA 4R2IA 4B34A 2BEJA 3CRMA 1ZU5A 2ZVQX 3R20A 4RZ3A 2HT1A 1S2MA 1EFRA 3A1TA 4Q4AB 4ZKDA 3PG5A 1NG9A 3BFKA 1KI9A 2WJYA 3ZZ0A 4Q1DA 1NKTA 4BE7B 1ZUHA 1HYQA 1KSFX 4FWIB 2WOJA 1ZM9A 1ZD8A 4KVGA 3WYAA 4NYIR 2WWGA 2J5XA 1W36B 3B1XA 2WPDA 3Q5DA 4JLMA 4P4TA 3UXMA 1W0KA 3KKQA 4DLUA 1AZSC 5SZKB 5HTKA 3VX4A 3D6TB 1FQKA 2TMKA 5J5CA 5H8WA 2QL6A 4HB3A 4NBSA 1CR2A 3BRWD 4BFTA 4MGYR 3GJ4A 4DDWA 1R2QA 1W5TA 1IBRA 3IILA 3QOFA 2NPFA 1E2HA 1OSNA 4Q4AA 1I4LD 2Q3FA 5UKDA 1IN6A 1OB5A 1W36D 4LYAA 4YLGA 4Q47A 2GJ9A 3RS7A 1GL7A 2V1UA 3B2EA 1KK2A 1TAGA 4KYUA 1FFHA 1X1RA 3L0IB 4B2IA 2XEXA 1NN0A 4ZO4A 1KJWA 4TL8A 2IUUA 1NG1A 5C1BA 2OE2A 1KYIA 4HYYA 4BGDA 4AYWA 1GUAA 2ZSBA 3NKVA 4E07A 4LHXA 3RSLA 5EE5B 1XCGB 2DFLA 4TLEA 3PUZA 1YJ5A 5LD2C 1GSIA 1XTQA 5LD2B 4TTRA 1D2NA 1U9IA 5FPTA 1G20E 3QXSA 4LC0A 1Z2AA 3MJRA 4UJ3A 4RFSA 2FPKA 1CU1A 3JZMA 1RRFA 1G7RA 2CCKA 2GJ8A 2WSSA 4P4SA 4RD4A 4LBVA 1RFLA 4FMBB 5DYGA 3TQFA 4C0LA 1P73A 2C03A 2ZUBA 5FUYA 4KJZA 4M1MA 1KK1A 3CWZA 5FH9A 2C77A 1A7JA 2VBCA 3FHOA 821PA 2BBTA 3IKJA 4LI0A 2VTKA 3VAAA 4B3XA 3KQUA 2AD1A 2XTZA 3FHCB 1QVAA 1ETUA 1OKKA 4TN1A 2VPPA 3LQQA 1QHGA 2PMKA 4TZ0A 2ZUCA 3ONWA 1A82A 1RJ9B 1NSTA 4CEIB 1W4BA 3RABA 1TUIA 5J40A 1Q1EA 3KJEA 4M8NE 2R6AA 4LJ7A 2OFOA 4C30A 2YOGA 4P4SB 1HH4A 2YNMA 1NN1A 2FA9A 4OBEA 1KKLA 4F7WA 2ZRHA 3KQKA 1GDDA 1G9XA 1WQ1R 3NH6A 1E9BA 2MSCB 5HCNA 2ZSFA 3KKNA 1JQLB 3A1SA 2QQEA 4URXR 4AG5A 4B6EA 2CHQA 3UIEA 2ZEJA 4Q01A 2B21A 1DG1G 4G5OA 1SKYB 1R5NA 3QKUA 2ECKA 4GZLA 4TQ9A 4QGHA 2MMGA 2GXSA 2QENA 4HAWA 4PC7A 2GF0A 1EXMA 5HR5A 4PHFA 5G3ZA 2LCFA 1T8UA 3GLFE 3I8SA 4MKFA 1R5OA 3KUCA 1M1YE 1G8YA 4TWZA 3F3YA 1U99A 3K0CC 1XTIA 3C14C 3OIVA 1JR3D 1TNDA 3BXZA 4IDHA 4JSTA 4LV5B 4B74A 1OYWA 2ZJAA 3U5ZB 1W2GA 1ZC3A 2E1RA 5IHPA 3Q9LA 2GJAA 1E9CA 3BJIC 4LC1A 2A3RA 2HF9A 3WMEA 3PENA 5EZ6B 3SQXA 5KDDA 4WAUA 4AKEA 1TQ4A 5LDDC 2GK7A 3WBJA 2IYSA 3MRSA 3P1JA 4TQUS 3WRXC 2OFWA 3ADCA 1MRSA 1E2DA 4M9SA 1GILA 4G5QA 2Q3MA 2IT1A 2V7QA 4JKYA 1RRGA 4MA4A 3VKHA 4URZR 3LDAA 2RH5A 3PJRA 4NYJQ 1WXQA 2X77A 3TQCA 3I4LA 1GKYA 4DJTA 2BEKA 4XD7D 4HDCA 2A5FA 4CEJB 4OQNA 4PPNA 1R8QA 5HCIA 4E22A 3IHWA 5AJWA 5FOXA 3W5JA 4OQMA 1NMZA 1J8YF 3EAQA 1U90A 3Q5EA 2ZYVX 3SI7A 2GZDA 2KB0A 2XITA 3DO6A 4JVSB 5DISB 1HV8A 3G82C 2XTNA 3MG9A 3QXCA 2BBSA 4LBWA 1H65A 1KSHA 4KODA 3TUIC 1CJUC 1OXSC 3L8ZA 2QRNA 1KZ7B 4ZCMA 2HF8A 2ZR9A 3ZZUA 2XX3A 1KOFA 1NJFA 1G7TA 1KJYA 4IXMA 1XZQA 2XJ4A 4KLNA 1FP7A 1JALA 4G1UC 1TUEA 2YOHA 4C9BA 2IYLD 4Q7KA 1N0VC 2W83A 4DEYA 1SVWA 2H7VA 1S1MA 4V0KA 4QJ4A 3RC3A 1GZSA 5D3MB 4DT1A 3FMIA 3A4MA 2PZFA 1EFTA 3IIJA 4QGAA 2YC2C 1TF7A 2FU5C 3ZH9B 2EW1A 4BWYA
chains in the Genus database with same CATH superfamily
5CURA 3RTCA 1ENOA 3K3PA 4PSCA 2BGTA 2JLYA 1UUFA 3UENA 1WZIA 2C7VA 2NPOA 2C2XA 1JJBA 1H8EA 3DV0B 4PR3A 2P4SA 2PLAA 5KC8A 1WO8A 1ZJ4A 1DS6A 2J5RA 4MV8A 1JZSA 3ER9A 1E4VA 1RAAA 2RG1A 4IOLA 1E18A 3TL6A 4ARZB 4DIDA 2ZXEA 4BKQA 2C57A 3O75A 3ZXYA 2YVQA 2HJHA 3TL2A 2OXIA 1QRUA 1CUGA 2C78A 2DFPA 4J3JA 4D3FA 3ZEIA 5KYWA 3I9KA 2FFHA 3BORA 3GXOA 1TKRA 1P80A 3NOOA 1C3JA 1GUFA 4IZIA 3U7EB 3WMXA 2HA3A 2BMAA 1VIYA 1RXSA 4J7XA 1VJCA 1IN4A 1GEGA 3C4JA 3ND6A 4IWNA 3RIYA 3SICE 4POOA 5JFGA 4W5OA 2XBUA 4UM9B 2IYTA 2I6XA 3GV0A 3OI7A 3ZJVA 4H3VA 2PWYA 3K6SA 4Z53A 1T1IA 5AVJA 3UUEA 1GCAA 4DWOA 3PUKA 1ADFA 5IAEA 3ZHYA 4ZC8A 5J4VA 2AEFA 4GX5A 3JQFC 5SYAA 2P69A 2WIGA 1UEXC 1KGDA 4R2HA 2JHPA 3E6AA 3BCSA 3IDOA 1USWA 1OXTA 3OLXA 4Q9AA 3QEMA 5AI8A 3VUEA 2O8DA 5KREA 1RZ3A 1VGVA 1U2ZA 1QAQA 2EJTA 4P2BA 3CKYA 4MWZA 1VIDA 2Q5HA 3B6JA 3GJ7A 1WXDA 1HXHA 4EB6B 2D59A 4DIEA 2DFTA 1SY7A 4ESHA 2QY6A 3UMSA 1XD9A 4M60A 3B9BA 4CLEA 4XKJA 3NAZA 4IMPA 4D56A 2PMCA 3PDJA 1DCKA 5FUMA 2H8KA 5J4KA 4KO1S 5LKAA 3ASYA 1NPTO 3RS8A 1N2CB 3VU1A 4BRSA 3NP7A 2YMPA 2J6CA 4MRMB 2CV2A 2CLDX 2XUQA 2J33A 3MJHA 3IUYA 4PSUA 3M33A 1PZGA 2X14A 4CDMA 1TZKA 3UGKA 2C9DA 4G56A 1F0YA 2X8LA 4H18A 1T2UA 3E0QA 1Z2PX 4RH0A 4WCFB 2W42A 1K6IA 2G63A 1LK7A 5J2UB 4D8VA 3KQMA 1FW8A 4C7OB 1EZ1A 2JKYA 1RVDA 2WNSA 3NHAA 5EUBA 3U40A 3O90A 1T4CB 5E1BA 5EJ7A 3D2CA 4CEHA 3Q1KA 2DSTA 4B45A 3GA5A 4H1TA 4EPVA 1O94D 1P77A 4WOKA 4J0FA 5DX1A 1PNTA 2HMUA 3VV2A 1DTSA 4O0LA 1JHYA 2P8SA 4BBPA 2ZK7A 4FFMA 4RTPA 4EB6A 3H05A 1HLDA 1HQCA 2CZCA 4Y9RA 2HHHB 4R1MA 3QVXA 4XQGA 3WHIA 4BVKA 2A84A 4AJ4A 4F4CA 5DHFA 4A5OA 3D1JA 1U0OC 3FY4A 1GQQA 3LXUX 4YTEA 1IK4A 1Z07A 2G8NA 4H9GA 3MGKA 3CF6R 2V03A 3CG4A 5IDVA 4FYMA 4IUBS 5KNCH 4KXYA 2QTNA 1E5TA 4FS8A 4C3UA 1PR5A 2A9OA 5B57C 1G17A 1NW9B 2O57A 2OQVA 4A8TA 3TZ6A 5I9NA 1KY2A 4RTMA 4AJNA 4MJ7A 1U2GC 1PUJA 5LKRA 4EAAA 2YCLA 5IDWA 3K0AA 1T4CA 3P2YA 4I1VA 4CV3A 5JAHA 3QE9Y 5JS1A 2LD4A 2NZVG 5K0ZA 3FPLA 1VM6A 1T4DA 4U9IS 1FXSA 4LE1A 1DBSA 3HB5X 1F6WA 4S2UA 4OUKX 1F7UA 3R7DA 5C7YA 2ZZKA 4ZIRB 4Y2XA 2GRAA 5FTNA 1DQRA 5TPWB 3ZJUA 3PGKA 5EXTA 2DECA 3QQPA 1NVUQ 4J16C 3JQDA 3O8OB 5KMGA 1HYEA 1W0KD 5EE1A 5CXXA 3WLFA 2XYHA 4O59O 3TKLA 4V1CI 4IX9A 4NYJR 1G0OA 4PRLA 2PY6A 1DJPA 3CUUA 2E4WA 5CEEA 4WL0A 5AP9A 3E9MA 1I3OA 1MZVA 2J3DA 2P3OA 2FQXA 2PIAA 3L0YA 4FN5A 2DQKA 2Z5FA 3Q72A 3QI7A 4G41A 4XVUA 5CLJA 1W4LA 3ICQB 3DNMA 2YY6A 3IESA 4P8RA 5AVVA 4HNTA 2J0SA 2G5TA 3IMFA 5TDHA 5BSKA 4D4GA 4X95A 2VXYA 1OMOA 4G9EA 3KS9A 3L0ZA 4NK5A 4HI0E 5KSWB 5J58A 5F3WB 1US8A 4Q9HA 5LZ5A 4GOXA 1WM1A 2Y6VA 3VXKA 2BCGY 4BMDA 1QP0A 4ZI7F 4TV9F 3DLHA 2PNJA 1NJSA 1GQYA 3NBAA 1U80A 4DHWA 4K86A 3RVLA 2ZWMA 4TXHA 3BH0A 1L7PA 2FVYA 1G7SA 3LTNC 4B4WA 1O95A 4QIHA 3EH2A 3UJNA 3QUSA 5E2BA 4CKXA 3IAM6 1H0SA 2VJAA 4M4SA 4UATA 4P7BA 2EBWA 4OLFA 2R5WA 4D4LA 4KPFC 5KS2A 2WTBA 1SQFA 1HYGA 2YFHA 3RTDA 3TQSA 3GN1A 1EWTA 2EOAA 4H6WA 2JLXA 4I8DA 4LX8A 1VQ1A 3HMKA 3RWOA 3OJWA 1A96A 2QVGA 3HKEB 3C1UA 5CHEA 4C78A 4BGVA 3AKCA 1JR4A 4R54A 1C1DB 1OI3A 1YR1A 2C7BA 3V97A 4ECAA 4M49A 3CNNA 1TLLA 1GU0A 3RVBA 1QHHA 4V0OA 3DBOB 1W47A 3M1YA 1VPLA 2YBEA 5ES4B 2B4YA 5C3MA 3TSYA 1US8B 3FYCA 1TZ2A 3SHOA 3KOUA 3I6IA 2RHCA 1XZFA 1QH8B 2WSIA 3DF7A 1PCXA 2AH5A 4L8YA 3SR3A 4D4KA 4MJ3A 4KMSA 3MCWA 2XW6A 2W2MA 5JXGA 3CUSA 1YQUA 3HNOA 1SN7A 2XTAA 1Q2UA 3PDIA 4LOHA 1CLUA 2LE0A 1ML4A 5EMMA 4OB7A 2HFJA 1T24A 1G9TA 2JLSA 2GPBA 3F9IA 4R0VA 3R0VA 1OV4A 4QPJC 2YOFA 4LEIA 3VC3A 4EQZA 4YRKA 2BI4A 2QHXA 4CFYA 2XQFA 2MSWA 5KYTA 4XJSA 1T1EA 3I28A 1QGUB 5ALIA 1SXJB 4LWQA 3RUEA 2BFDB 4EKEA 4G1MB 4E4YA 5KHLB 3PC7A 2P4UA 3LVFO 1SQGA 2E4ZA 2JBAA 4YGYA 3UJ3X 1DUIA 2AI2A 4QOEA 3F9RA 2WMOB 1NW3A 1FP4A 2J5QA 1X1SA 2PKEA 1KDTA 3IPRA 1KEVA 4D9MA 1OVGA 1SOWA 5ERGB 4ITVA 5EMHA 4D92A 1HQKA 5HHTA 5BSTA 4IS3A 4C1NA 4MS3B 5E8RA 1JHAA 5JAPA 1CQJA 1NTOA 3S81A 2AQHA 3O8RA 3M3HA 1I2CA 4PQYA 2HPVA 3OE1A 2MHCA 2D1YA 3W5HA 3Q6NA 5ICFA 1VLLA 2I2DA 2FEXA 4V0ME 4AJPA 4Y8VA 3S55A 5BVHB 4V0LA 1OFUX 3BHIA 3GEEA 3E9DA 4V24A 3BXPA 5AVXA 1KARA 4ZTUB 2NVOA 5EXSA 3R3JA 4HN4B 4EB8A 1QO9A 3HJGA 2A0YA 4XSHA 1S2GA 5EJGA 1OILA 3KFVA 2D4AA 1T15A 3SF0A 5JROA 4OYLA 5KTSA 3I30X 3GFSA 1RM4A 3MS2A 3OHMA 5ABPA 1AG9A 1SXJA 3JPYA 2BFDA 1FZQA 1E8MA 2HQRA 5E7QA 2GUGA 4WNAA 4LYFA 3OZUA 4P82A 5DXAA 1GU7A 1I7DA 2NZ2A 1FYXA 4MW7A 3FM9A 1K5PA 3MUEA 5TQ2A 4G5SA 3I2FA 1A8PA 3TD6A 1EP3B 1LI4A 1VL6A 3N8NA 1ZI8A 3SJUA 1CXZA 5EJ4A 3CH5A 1GCUA 4QVIA 1OGIA 5ESWA 4FEAA 1CS0B 3KELA 3NHLA 2F2TA 1GZHB 2BJWA 5IEBA 1IXYA 3L84A 2FKNA 4TLAA 4HS9A 1E0AA 4W99A 2FR8C 2V45A 3TJZA 4DRXA 4EHJA 2JFHA 4U9HS 1A9SA 5BRJA 1BXRA 4YRIA 2WIAA 2ZI3A 3DAYA 3HUFA 4OP3A 3T9AA 4UOEA 2W48A 3DFMA 3P9PA 3CJTA 2G6TA 1JHOA 2RHOA 4L9AA 2GD0A 1QO7A 2FXIA 4OQQA 5DCLA 3TVYA 4BNYA 3EJWA 4B4OA 4LWZA 3CX8A 2QPTA 3PB3A 2A35A 2ZCUA 3EFBA 1JQAA 1AQ6A 1NW4A 3JAWA 3O2JA 4QJIA 5FUVA 3O84A 3LUCA 2PWAA 3OLQA 1FMTA 3V1YA 4EHIA 3C3JA 4NV0A 4Q1BA 1SOAA 3N70A 1N78A 4NDAA 1JJ7A 2UUCB 3EC1A 3MSCA 4IFIA 3KZKA 1VCMA 4H1VA 2VDWA 3H65A 3V7WA 2ZXUA 1PJAA 3Q7QA 2JCYA 1NZFA 3LLCA 1KWGA 4EATA 1I7LA 4DR6B 3RUDA 3LX5A 2C07A 1VE7A 2ZLBA 2NV6A 3DAPA 1B6RA 4WOJA 5T8KC 4NTZA 4JYMA 2YH2A 2IHKA 3FPJA 4G8DA 2J67A 3WMFA 1JB1A 1ODLA 4LFAB 3ANYB 3EVGA 4Q18A 1G5IA 2XRFA 4W82A 1YS6A 4AROA 2P1DA 3U56A 1E1QD 9MHTA 3HYNA 5AI0A 3DAGA 4AG3A 1ISMA 3V00A 3T7AA 3CT6A 1WNFA 2ZBUA 1N36B 2ZBVA 3RU2A 3TNFA 3UT0A 2R5FA 1DRWA 3LGXA 2ZRAA 3D0OA 4O2AB 3TMYA 1U0NA 2VH1A 3AR2A 3RJ5A 1RJGA 3BQNB 1SBZA 3PCRB 3QPUA 4PGMA 4DMCA 1KTIA 2ZJFA 4UU8A 2PUJA 2GBIA 3KQVA 4II3A 5AI9A 4PHTA 1MABA 3IRVA 3IUMA 4JT8A 2R7AA 2EW8A 2WSLA 3F7OA 1JN0A 5DCYA 3ZGYA 1QPZA 3NASA 3MHPA 4KBYA 3MSXA 1U8UA 1GP2A 1ZOOA 3GYBA 2FZLA 3D6HA 5C18A 3QU5A 2OCKA 3GIWA 1YR3A 1NQOA 2OFXA 1KH3A 4MS4A 3ZVRA 1DPGA 4N49A 4AZ0B 4A0FA 1EVKA 4EKGA 1N2GA 3BUSA 2JLAA 3SVZA 4DY6A 2AT1A 3HHEA 5B1EA 1ULBA 1V9CA 4PEVA 4RXMA 1MW8X 1RD4A 4E2YA 3AY6A 1X42A 3WGZA 1U2EA 4OXIA 1E0DA 4EHKA 3LW7A 3BJMA 4XWGA 4M0LA 4RMGA 2V96A 3HB0A 1RXWA 3USCS 3ZDDA 1P2DA 4RKYA 1JMVA 3Q85A 2GFHA 3O3NB 4FDUA 1QVVA 3H13A 2I9KA 2PBLA 4UUPA 4ASUD 4TPKA 4RLQA 5BXQC 2FHSA 1FP2A 1T1JA 1VZ3A 2RHDA 3T7IA 4EM6A 2Z6UA 1MT0A 4OF4A 1E6UA 2YHSA 1ZH6A 4Z51A 1CK4A 1I7NA 1KOJA 1LDNA 3BIXA 4RPKA 2GKSA 4CG2A 5BMVA 3DBVO 4YUZA 3EC2A 2QI9F 2I8AA 3AI7A 3CJRA 1AGXA 1DAEA 2C8JA 4H17A 3PU6A 1EWRA 3PNLA 1WCV1 4MS4B 3AETB 4F04A 3ABQB 1YQEA 2OTCA 5KNDH 5LP1A 1P75A 3Q10A 4DLSA 1T8YA 4C7OA 5EPEA 1X2EA 4LZNA 3LRXA 1HDEA 1CD5A 1KERA 3ELBA 1KO5A 1XR3A 4KZKA 4EYSA 4UTPA 1JLSA 4EB0A 3IX7A 4TRJA 1U28C 1XMPA 1N34B 4AJEA 1NUSA 1UANA 5K1ZA 3U81A 1BE6A 1THMA 3L4EA 3LBFA 2RK3A 4Z7NB 3M5WA 4LHEA 1NJ1A 5JAIA 4DA9A 5MGBA 3E2IA 2Z3ZA 2GERA 2H18A 1ESEA 3X1MA 4YMHA 2WZQA 1O96A 2A30A 3RK1A 3VJRA 3R5XA 1LQUA 5HRCA 4C0KA 1YJCA 3QYPA 4XYEA 4MV0A 4FSDA 2MYUA 4FYHA 4WZAB 2R6HA 2QORA 3MC1A 4HWOA 2D06A 2JJMA 2QJWA 1UOOA 2BHLA 3OT1A 4KNVA 4KXMA 1JS1X 1UF9A 1J1ZA 3OA2A 2DVMA 3GGPA 4MVJE 3WFIA 2PS1A 2PH7A 2R8PA 3K9HA 5A1TA 3RSQA 3TPZA 1T5DX 4JYZA 4R1PA 5LYJF 2FWMX 3K0AB 4LGCA 2W0SA 4K9PA 2LCQA 4DNXA 1CF9A 2R25B 4OO3A 2HZ7A 1X2BA 3VR3A 2Q0SA 3W3AH 3P9YA 1Y42X 1DVRA 1NIJA 4O63O 5DGDA 3LUBA 4ILEA 1ZOIA 2BBOA 1UOEA 3R23A 3KSAC 5D7NA 5DZSA 1IBCA 4BZQA 4DXAA 1YFKA 2B25A 4E13A 3P26A 3O1LA 1XRQA 3ZV6A 4KBFA 4PVDA 1U0FA 3DGEC 3B5EA 3K31A 3PIRA 4HYTA 2O8CA 1X9IA 2HSEA 4W63A 1BJRE 2RI6A 1SH7A 3FLMA 2PH1A 2PD4A 3O93A 3O8OA 3ESRA 2GBLA 4R6XA 2RGWA 4KKVA 4XGQA 3TFWA 4AO8A 1T1RA 2VQFB 2FJUA 3JVVA 3O4RA 3NRCA 4AKGA 4MVCA 4DJFC 3LP6A 4EG1A 3OT1B 4IGAA 3D7LA 1G4HA 1Q1ZA 3NDIA 4HAIA 4ZAGA 4F7DA 2ZRPA 2EFEB 1MTZA 3DD1A 4MZXA 4XB2A 2OYCA 2XECA 1I3KA 5DBOA 3V80A 4BS9A 3AF5A 5B5SA 1TX4B 5IVHA 2B1JA 2GZ3A 1REQB 4MEJA 2XCUA 3THWA 4XDHA 1J39A 1EUDA 2FV8A 4RKEA 3UWPA 3QE0A 1P81A 1TECE 1SEVA 2EKQA 4TKLA 2R00C 3DLPX 2R6GA 1VCIA 4DE5A 4QG7A 1Y0BA 1Y9JA 4UDNA 4B4UA 3E5HA 4PXAA 3VGJA 1M9NA 1YR9A 4XARA 4B6GA 5BN1A 1GTSA 2HLDD 3FKSA 5DCUA 1FSPA 2GAJA 1MOQA 1U0RA 2QLTA 2QN9A 4YXWD 2O8CB 2CY0A 1CVLA 2IKSA 3P94A 5FYDA 1YFZA 2OFPA 3R7WB 3BEOA 1XZHA 1XMXA 1O5OA 3GPIA 2Y66A 3IJRA 1N2ZA 3MIZA 1M33A 1XAJA 4WKCA 2QVLA 3EVNA 3SEFA 3VUFA 3HVUA 2FWJA 1COWD 1Z2NX 2O50A 1DAKA 2QYHA 2W2XA 3B36A 1DWOA 4OHXA 5CX1A 2XGGA 5AJYA 4TL9A 3ZGLA 3BIJA 4QJ5A 2GJ4A 1OB2A 2JARA 4NF2A 4X3OA 1P5FA 1RADA 2F8MA 1MJGM 3REGA 3R8CA 3BA1A 1GG8A 1SUCA 3KO8A 4IEFB 1NU6A 4X7RA 2ZVPX 3HKEA 5AVOA 5TR9A 3ZDEA 5IKEA 4NHOA 2G0AA 4KSBA 1XDUA 1JR3A 1SC1A 1BA3A 2JBHA 1XELA 2VF5X 4GNKA 4JDUA 3D4LA 4IM7A 1DDGA 2R1VB 2FPUA 1XLTC 5K0FA 1ZD5A 2WWYA 2D54A 4CR6A 3AWDA 3QTBA 1U6JA 4ZGGA 2FN9A 3I9MA 4IJQA 1AQLA 4Y6RA 4GI2A 1K7SN 4EY4A 3OJXA 4MIEA 1GOTA 3MWLA 1V3QE 3ZVLA 1POXA 3HCRA 1IMJA 3QYAA 4KGXA 5J2TF 5LC1A 3R3XA 5HZGA 1KU0A 1KS2A 3COPA 4I0WB 1L4FA 1HT2E 4OJKA 3DBHB 3HUEA 4QYIB 5DYIA 5IJ9A 5IXJA 2Z2IA 5DKFA 1SXGA 1CT9A 3RSGA 2Q3DA 5KOHB 5K05A 3WWYA 4DARA 3KJXA 3AO0B 4IINA 3OJ0A 1GPJA 3M9LA 4A73A 4ZZ1A 1FQWA 1BQ3A 2QROA 4YAEA 5HXAA 4MUKA 2HW8A 3K9BA 2O0JA 1W2HA 3ACCA 4U7GA 1DX4A 4EMBA 1W0CA 3KJQA 1SO8A 3SXUA 4IXWA 3DQQA 4ZV7A 1I5OA 2VJQA 5F2NA 2VQ3A 1NJ8A 1H23A 5DXJA 1M8GA 2AD5A 2V9PA 3DTVD 3LLMA 4BFLA 3HZRA 3KFXA 4DQDA 5KOIA 1C2TA 3B82A 5TPZA 4Y7DA 1U7HA 1BCSB 1N6IA 1S3IA 3EZ2A 3HCDA 4WZBB 3HGMA 2ZP1A 1SUDA 4RW0A 3F2IA 4KITB 3KBBA 2JAQA 5AT1A 4IDBA 4IVRA 3S8MA 2XEDA 2ALJA 1LZKA 3B78A 5D5QA 3MNFA 4JL5A 4AYTA 4GQBA 5IJ9B 2IIQA 2JLZA 1C30B 4MRNA 3OF3A 3WDLA 3AJ8A 1CZLA 2IU6A 2EF0A 3CMMA 3WK6A 1DU4A 2B30A 3M6XA 2IPNA 1JLLB 4F1JA 2B7BA 3NDRA 3P0EA 3I1YA 3LIPA 3MWDA 3N7UA 2C8VA 3OQHA 4PCVA 1WNTA 4PZYA 4Q48A 4KDRA 1S2LA 2OSVA 2YFQA 3EF0A 4C43A 4PAMA 3OH8A 5HRUA 2O1SA 4ANFA 2AJBA 1GGJA 4MCHA 5FTJA 1F8FA 1P29A 3ISVA 3LQRA 4BFXA 2G72A 13PKA 2OHIA 1L5KA 4WNAB 5GZ3A 3WHPA 5EIWA 2CL5A 4ZVNA 3FGNA 5TVKA 2CXSA 3I9V6 2X41A 4JCOA 3V1UA 1P0MA 4RTRA 1S2IA 4OTZA 2FOLA 1OC4A 2OV6A 4WZBA 1E0KA 1X70A 2VSOA 2ZI9A 4OJNA 3RFTA 5A5FA 4JI4B 3W1EA 2GO1A 3R3WA 2ZYUX 2AZDA 1N3LA 4TTTS 1GPAA 2QLLA 3CKLA 5F2EA 3U7GA 4TV8B 2QW8A 2GN0A 4AZ3A 1FNNA 2GDJA 4UEWA 2EWMA 1GTVA 2FVXA 3QJ5A 3ZEAA 1RC8A 3TPCA 4WBXC 3SHTA 4ZD6A 1XKLA 4R6WA 5CXQA 5IWAB 5AW9A 3LKZA 1RIFA 3T99A 3MGBA 1X9GA 3D2LA 1P1JA 1SAYA 1BMDA 1WSWA 2EL9A 3MQ4A 1Q1NA 4YASA 2I2XB 3ZK7A 4AN0A 4DQVA 4F97A 4YDQA 1CJSA 2VH2A 5EQDA 2NU8A 3ND7A 3LCMA 4AS2A 5KSOA 3SPXA 3BB3A 3DZKA 2YKGA 2PTHA 2YW2A 3P4YA 2DXIA 5I47A 3K7EA 1WSAA 3DCIA 4UBLA 4MDHA 3NVKI 2VJPA 1SUWA 5GJBA 2GEKA 2XUAA 3OETA 4AUKA 2I7DA 3TPFA 1JG7A 4E5PA 2I87A 4YX9A 2UXBB 2WNHA 4LXTA 1GAXA 5FV7A 2TECE 4B6QA 2J8ZA 3GNTA 4KRYA 4BFYA 3ZDCA 1IY9A 1KMIY 3QF4A 5H5JA 5C1IA 5I7UA 3C41J 4JP8A 2XZPA 1Q15A 3NTOA 4B3RB 3EB9A 4W1SA 4NICA 1OLXB 2DBVO 3FTPA 2H63A 4O4HA 3QVWA 3HKBB 4W9MC 1L3IA 4JC4A 2OD2A 4J91A 1CQWA 1G21E 3MZ0A 3RS5A 3HXTA 3L6BA 4PANA 4R5MA 1KIAA 4XH9B 5TRTA 3TSZA 2E4YA 3UAGA 4IIJB 2AR7A 4O2AA 4E3WA 3QVUA 3KQHA 2G80A 2NU8B 2BY4A 1P0PA 1RBZA 2Y8EA 4NQRA 1E1DA 521PA 3RVJA 2HA0A 1J07A 4AQDA 3OZGA 4K3UA 1M1YB 3A1VA 5FL3A 4FOLA 4DIFA 1HORA 2F3UA 2QRVB 3G23A 3PHBE 2YWBA 4G1EB 5AIBA 3KVOA 3OLCX 2FQWA 2BHRA 1JDTA 2PKXA 3QF7A 4OHWA 3QLUA 3STXA 5K8JB 3E5RA 2VHCA 3AGPA 1PR4A 4YQEA 4AZ0A 1WXWA 2OBMA 5JI2E 4ZOAA 4DVGA 2GK4A 3EDRA 3HKBA 1MDBA 3CUYA 1Q83A 3JYNA 2O0LA 4NOLA 1KVRA 5EVCA 2NMVA 5JS7A 1AQJA 1BDIA 1VLHA 3KR2A 4F46A 1QM5A 2IUYA 3AV0B 3STWA 1YE3A 4Z4IA 3GFPA 4K88A 2DLCX 1ZQ9A 1I8TA 1VYTA 3EIWA 3OZDA 1N3IA 1USUA 4IFEA 4IIJA 2QAGC 4TS9A 4W5JA 3INYA 2I2AA 5J1SB 2QEQA 4EELA 4UPDA 3NJ8A 3TDMA 3ZLUA 3COVA 1E2KA 2O3QA 1AXRA 1CY2A 2F17A 3QTLA 4I14A 4PW0A 3GPLA 2R8ZA 5HZMA 4RQUA 2GLXA 4E88A 2OXTA 4GMDA 2XSZD 2RGCA 3CCBA 2QT9A 1L8XA 1Y3AA 1U1GA 5KAPA 4C3VA 3SR0A 4Z0PA 3ZH2A 1KKUA 3CPHA 5ULLA 2ZITA 2PJZA 1IFXA 5HF6A 1QIGA 1WV0A 1XF1A 4D9IA 4FHZA 3ZU3A 3R5FA 1YDGA 2ZW9A 3KFLA 5KQLA 2FFQA 3K2QA 1GSOA 4OQ4A 1N8TA 1QIIA 1ZCAA 2P2CA 3G89A 3HLYA 2OYRA 3TRJA 1EZ4A 1NDUA 1IWBB 1OROA 5IBPA 3ME5A 3OPYB 4CTMA 2FPGB 2CLLB 2P90A 1KDVA 3H1FA 1TTTA 3LQFA 2GXQA 4HWGA 2JA2A 3MYRA 4QHYA 4XQCA 1B6SA 5C8DA 2IYAA 2GFIA 2J7KA 2V0NA 3D4NA 3DWGA 3NTXA 5FJIA 1XDBA 4J0EA 4CFSA 1Q20A 1GA4A 1VLMA 1KAMA 5A4DA 1T2FA 3OZEA 4Y6QA 5AUQA 4EHNA 4B3IA 2VTBA 2WHEA 4DQKA 1Q0UA 1M2WA 4IEIA 1ODCA 1WUTA 3ORSA 3GLHA 2QU8A 2M2IA 3DMYA 3BIWA 4ZQIA 1JHPA 4JT4A 5BW6B 3VAZA 3ZZ1A 1VKOA 2A9KA 3R8XA 3IAHA 4WUVA 4OATA 1X6VA 4G8JA 1V6AA 5JSFA 4W8OA 1WKVA 1N0HA 1NBIA 5CYOA 1Z4QA 1L7BA 2QTWB 3PWTA 4DTCA 1G2PA 4ZZ0A 4JBGA 4XQEA 3A11A 3OPYA 3HVJA 4XUEA 1GGFA 1NJ2A 3OQMA 1GYPA 3EW9A 4BZPA 3GLGB 2FNAA 1KEEB 4PZCA 4KPGA 4YECA 5HDBB 1W85A 4TMXA 3V4FA 1CZOA 4GT1A 3FYUA 4G5XA 1P2FA 3RT7A 1YA8A 2QGFA 4LGMA 4X1KA 1HEIA 4I4LA 1W19A 1Y7IA 4GXRA 4NG4A 4YCAA 2FSIA 2V4UA 3ANLA 2HIAA 1U9JA 4QT0A 3D54D 5CLLA 3T3EA 2BF4A 2E7ZA 2Z08A 4S1OA 3UOWA 1BKDR 1MX5A 2CZQA 2CCGA 2WDZA 4A2PA 4AAYA 3OCZA 4EX7A 1QTNA 3I73A 4HNAB 4MAMA 3UT5A 2PMFA 3ZS9A 1ZCBA 1Z6TA 3SF8B 2HN9A 2RBEA 1SFRA 1V41E 3TINA 1IIBA 2AQKA 5CVJA 2ID8A 4E32A 1KZ1A 2BZ0A 3DOJA 5JSKA 2QL5A 3N0WA 4F3KA 3SEZA 5AI6A 4F2HA 4R1OA 3GZ4A 4X41A 1SR8A 2Q0XA 1GPWB 4L57A 3FUUA 5DGIA 3FOCA 1G8MA 3DDUA 5CT4A 4ZHSA 3IT2A 4UU7A 2VOJA 4N9QA 4FOPA 1HFEL 2FG5A 3T5BA 4K9RA 2VXOA 3A6KA 1HI9A 3V9AA 2F7SA 2VZLA 1ONSA 3VR1A 3ELDA 4INPA 4N41A 2JLVA 2XE4A 1UMBB 4N0DA 1E64A 1Y8RB 4YQFA 4LW8A 1CWUA 4QPNA 1Z62A 1BMFD 1Y81A 2GN9A 3NCTA 4H6XA 1OFUA 1XD2B 4A0HA 1IUNA 3LBYA 3HXLA 2BHNA 1F3OA 4G9BA 4ZZ2A 4Q3KA 1Z47A 1H0RA 2YS7A 2ZSUA 3D7NA 4Q00A 4D9GA 5ISMA 3S3TA 1YC2A 2O0HA 4RUKA 5M34A 3AF6A 3FFAA 1HT1E 2Z3WA 5H4HA 3BMQB 2ZOSA 4AZVA 2PL9A 2IY8A 2ZBDA 4V0QA 3BWCA 3ENVA 1G5PA 1T29A 3EIOA 3GARA 3IQWA 2KJQA 5HIAA 1JPJA 2EG5A 2X86A 1Q6YA 1QTQA 1TW2A 1GN9A 1ZK3A 2PD6A 2VYVA 3BL6A 1NUAA 1WMFA 1FK8A 1II0A 4RK5A 1KH2A 4WNYA 5IYZF 4M55A 1E6LA 5K45A 4GOLD 3T5PA 4QPPA 4XRGA 1YHNA 4AY2A 3KJIA 3OEHD 2UDPA 4RZQA 1DKQA 2N47A 5EUMA 3E7XA 5IVDA 5FHRA 1NVBA 4B7AA 1AKWA 4UCXA 2VJCA 3HADA 1JWLA 1JLKA 3DLIA 3GP3A 3EQ7A 4B5LA 3G1TA 1T8WA 1WZEA 2EATA 5BSHA 3TGLA 3C98A 3P7MA 5D84A 3NUZA 3PUHA 2FJ0A 5GONB 3WSVA 3OZAA 4BNTA 2I2WA 3AB3A 2DHEA 3GGJA 3QXHA 5ALYA 4QZVA 3GJ0A 2CSUA 3MINB 5CPBA 1XLUA 5FLKA 3BWMA 1G6OA 3D8SA 3LUAA 3AF2A 3NC4A 2I3AA 3U3RA 4D41A 1XYYA 1EVJA 1XTJA 1C3LA 5K01A 3UN1A 2GT1A 4BKRA 1TF5A 3H2SA 5AXBA 3RBXA 2QUBA 2QXUA 1UT5A 1S89A 2OZEA 2W11A 2WW8A 4KDCA 2Z43A 3FPKA 3BOSA 3NB0A 4ZVSA 1JKJA 2C84A 2J6HA 1D1QA 1OI7A 3ADPA 4YB8A 3JQEA 3FFXA 2JD2A 1DBVO 2GQ0A 4NMWA 4QUIA 3CLSC 4NK4A 1KYWA 3QUQA 5JSYA 4ZKEA 4N1AA 1UWKA 2HJWA 3FUVA 2JRLA 1U3CA 4OHPA 1QGED 1CF4A 5JYBA 3QG1A 3VGPA 2HZBA 1Y9DA 2Q6LA 2IEYA 3OPQA 5EL0A 3E8MA 1ORWA 5CBPA 1DIOB 1ULTA 4MUJA 1T5BA 3HKDA 3MT9A 4MAAA 5ELMA 2GEBA 2J7PD 3IMEA 4I9GA 1QQ6A 3F1KA 1NVMB 2UZ3A 4ZZIA 1TEHA 1XK6A 4PIMA 3CZAA 5KJEA 1RI2A 4AO6A 3I23A 3JQAA 1OY1A 4O4HF 1OTXA 3ZE8A 3B20A 1Q12A 2GM9A 1MOZA 5EKXA 2WU0A 4KK4A 4GL2A 3ZU4A 3H4MA 2MCFA 1PR6A 4MDEA 2PBRA 2H5EA 4AYXA 3G3EA 3VHQA 1GKUB 1W8DA 3EGXB 3ELYA 1YVUA 1DC7A 1R37A 1Y1KE 3C5HA 3NHZA 2CF6A 3OFNA 4CR8A 2PUBA 2ZTUA 3JZDA 4G1CA 1JKJB 3IVMA 1RCFA 3CX6A 4IFTA 5J9FA 3ZK8A 4ZTZB 3LA6A 1LS6A 1W5EA 2IYWA 4NFYA 4L08A 4EKIA 1PT8A 3LAWA 4KE7A 4I5FA 1RMQA 4TZTA 2OQIA 1QIJA 3U4QB 4BNUA 3DR3A 4NY1A 5JBIA 4BJHB 1ZH4A 3TE7A 3PXCX 4U8HA 5AK6A 4F71A 4F2WA 5AFSA 2IK8A 3RV4A 5CDUA 4EA6A 2WTEA 3HM2A 1AF4A 3IBFA 3G2LA 4NE7A 3LTEA 3GMDA 4P22A 5DI3A 3R3YA 4KQJA 5KOJB 3HVKA 1X38A 2Q1XA 2Q9BA 4ZO8A 1O6CA 2X2OA 3JQAB 2WFMA 3S2FA 4B44A 3O31A 2HGSA 1QAMA 1JBEA 1UPFA 5TV2A 3PFCA 3VVBA 3ESQA 3OU6A 3V4SA 3FSEA 5JOQA 1DKOA 1ZPDA 1ZIOA 3B85A 3U31A 4HGNA 5ALZA 1Y7TA 1Z33A 5FPPA 1A2BA 3NC1C 3ODPA 2WE7A 3SC4A 3LCVB 2GN4A 4RYLA 3VVMA 3DV9A 3A1CA 1OXVA 5DIZA 3H9CA 2PGLA 5G41A 4YREA 3UOAB 4E1AA 3TUZC 5ILOA 2ZRMA 2DTEA 1HE1C 4QU5A 4R0NA 2CK3D 3FJ1A 4M9QA 2D1SA 2W71A 1QFXA 4JA0A 3ZE1B 2IE8A 1ABBA 2Y1WA 3LFUA 4RE5A 3U9LA 5LMZA 2K6GA 4U02A 5REQA 1JEQB 3NEPX 3UMCA 1YI1A 5FBRB 5LZ2A 3KKKA 2C4NA 2AFRA 3OMLA 2KM1A 3K09C 1MVOA 5IDYA 4ZI7B 4KPUA 4K8RB 3BWVA 4POAA 2VHTA 4CQNA 3W3ZB 5E9AA 5E7MA 1KVSA 3G8AA 4WLEA 3AM1A 4HAYA 3ZD9A 4KXUA 5KJCA 1C0LA 1R0ZA 3PFHA 4FJ2A 4I55B 1IOLA 2ZTSA 4O2BF 4ER0A 1MOPA 5JHGB 1E3JA 1AUXA 1JZTA 3LP5A 4IP0A 4GL4A 3ZOZA 4EJ2A 1EE1A 4QEZA 4Y6GB 1U7UA 1SZCA 2D5AA 3G9UA 3RI3A 2GUWA 4YO8A 3ZLBA 4XGNA 1AV7A 2NO0A 3JQBC 4K6OA 4U63A 5GTDA 3SIPA 5F21A 3BTUA 3DMTA 3UV3A 3OEWA 1GPDG 2ZIUB 2IYNA 3KEGA 1SOUA 4TRRA 4MYRA 4HDRB 2H2FA 1T2EA 4EY7A 4WMLA 4YMUA 3W6ZA 2HBZA 5DSTA 4ZT7A 2QN3A 3PC4A 5G1PA 5KNLA 2KX7A 2WM8A 4NAHA 2VYFA 2RI1A 3CHYA 4LHVA 1Y4DE 4JUAA 3AV3A 5JQGA 2WHPB 2Q99A 1E2EA 1RWWA 4M8SA 2V7BA 3EFHA 3W9BA 4ND7A 5BV2P 1QFSA 3KB2A 1V1JA 2VYCA 1V11B 1M7GA 1BMTA 1HUQA 4CODB 5K3EA 2BFWA 3M4XA 4NCKA 4MVJH 2GHTA 2UUPA 3GQBA 5ALTA 4EI8A 3ZDZB 3EN0A 4N65A 1T9KA 2C1ZA 2XMSA 3KPYA 4JBIA 2OZLA 4JROA 3TDKA 2PUDA 3AU9A 5LLTA 5B1HA 1FDIA 4BX0A 2O4CA 4DTIA 5BWOA 2NVUB 5E7IA 4MHSA 4MITA 1UODA 4QOGA 4QTXA 3FPSA 4ASUA 4EJFA 5A2GA 1HTTA 3ROFA 1X8LA 2JIMA 3TM4A 3STUA 4OK6A 4JOBA 4UE3S 4EJ6A 3LXMA 4J0DA 3BC1A 5JAQA 2W2PA 4A92A 3UQZA 5IKOA 1NP3A 3QIVA 3U26A 1FVXA 3TLZA 1BOFA 2VQDA 1I1OA 5FJJA 2ANBA 5SZIA 3ZHCA 4IDDA 2GGSA 3NTUA 1OXKB 3RT1A 3T54A 3THOA 2YNMC 5AW0A 3R5JA 5F12A 4KV9A 5IP5A 2OESA 1ZJ5A 3C4QA 4CVNA 1BH2A 2VP4A 4EZBA 3FVTA 2F00A 4BP9A 1E2JA 2HRBA 2P3SA 1BOOA 3SQLA 3UOGA 1YBMA 3MMSA 2VRCA 5HMMA 3M34A 3FROA 3GQBB 2HDNB 2Q9CA 4HEA6 3VTKA 4H3HB 2GK6A 2V6FA 1JSRA 2CB9A 3OJLA 4RHFA 5F1PA 4NL4H 3T1OA 2JHAA 1B1AA 2CJWA 4O4IB 3DDWA 4L8WB 1MJ5A 3ZZNA 2CUNA 4JVNA 1E7QA 1RBYA 4QFMA 5EHZA 4W9NA 3Q8LA 5LYJB 1H93A 3QX3A 1UWCA 4EI2A 1SKQA 3M1LA 3OIFA 2FQYA 3MGGA 5IK2A 1MA0A 4R41A 4BMXA 4D6PA 3GLGA 4L4ZA 1NURA 2XVMA 1GXSA 3AYZB 3HCBA 3OA0A 4RNDB 2CHEA 3A2MA 3N6VA 2R86A 5JNTA 2B98A 2DKOA 2O3SA 1K27A 3NG1A 4LDQA 1V3VA 3BJEA 5ENZA 3QA3E 1E62A 1JLMA 2FWIA 3ZY4A 4NU8X 2QUJA 2FEAA 5AM5A 3SGLA 2IL1A 4ZFNA 1WCIA