4TL8A

Crystal structure of n-terminal c1 domain of kaic
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
234
structure length
215
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 74
structure length 215
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl8A00
2O52A 4DEYA 3QG1A 2VSOA 2AL7A 5LDDC 1ZP6A 3QBVA 3LD9A 4V0MA 1CJTC 1I4TD 1VHLA 3NXSA 2F1RA 1WE2A 3MJRA 2C2HA 4G5SA 4Y0VA 2WM9B 4ZDIA 1XEXB 2EFCB 3K8YA 1KI8A 3JZMA 3AVXA 2GEVA 2ZR7A 1O3YA 1DAGA 1W0JA 3SZRA 5IT5A 5IDVA 1I4DD 5B2ZA 2REXB 1G7RA 2AK3A 3QVUA 3FWYA 2DFKB 1XD8A 3SQXA 1J8MF 4UJ3A 3HPQA 1SXJC 3K0CC 1P5ZB 3CRVA 4Q9IA 2X1VA 2J59A 1NG1A 3GEEA 4JL6A 4BZQA 2GJ8A 4LOAA 3LLMA 4PPFA 1TTTA 5G53C 2D4HA 2ZRFA 2C03A 3NC0C 3CNLA 2JEOA 3GLIB 4B44A 3TR0A 2ZM5A 1ZD9A 2ZE7A 1XD2B 2OBLA 2B6HA 2QORA 4FCWA 1KMHA 1T3SA 2NZJA 1AZSC 4LC1A 1ZM4A 3CNOA 3RLFA 4D6PA 4EDHA 2QTHA 1KDTA 2A2ZA 4Q1CA 1KDPA 3NTUA 1XJQA 3GFPA 3IQWA 4O2LA 1QHIA 3U3MA 4RZUA 2ZPTX 4URWR 4OJQA 1LS6A 4Q66C 2OFWA 1A5TA 4RD2A 5FOVA 5L3QA 2NQ2C 4C2TA 1IQPA 3B1WA 3KDSE 3PQCA 2J9RA 2YINC 2LCFA 3BIFA 1YQTA 2GWHA 4FMDF 4M4SA 1Z0KA 2CE7A 5AJVB 1KIMA 5BN3A 4HUQA 4HI0E 3A37A 3S1AB 2GA8A 3D8BA 3DPUA 3ZDQA 2ATXA 4W5JA 5LB2A 3UMFA 4BLTA 2JAQA 1CR0A 2UZ3A 2WIAA 4CEJA 3IUYA 1Z29A 4LYHA 4C0QC 4LJ8A 3O8BA 4IRUB 1R2QA 1UAAA 2XX3A 4UNQA 3PV0A 3B9QA 4M22A 2H16A 4P31A 1HUQA 1KGDA 2DY1A 2OEPA 2QGZA 1VIYA 2FEMA 1G5RA 1KO5A 1HURA 3EIQA 2D74A 4L15A 2FJUA 3M6AA 2G83A 1VYVA 4DLRA 3WBJA 3LVQE 2BKEA 3EPKA 5EXSA 5L3QB 4BZPA 4RSGA 2I1QA 4LJ6A 3KX2A 4EPWA 2DWOA 1WMSA 2XSZA 1Q1QA 1R5BA 2J5XA 4YMWA 1KOFA 4LK2A 3PEWA 2GCOB 1IY2A 2VHCA 4BLQA 4ZCLA 3KFXA 3M1IA 3R8FA 2RCNA 621PA 4JLMA 2WJJA 4BLOA 1BMFD 1E0KA 3U2QA 2NGRA 1G3IA 1N6OA 4US2R 4C0AC 1YZQA 1U94A 1H8HA 3CZQA 4HB4A 4PHTA 3I62A 4JLNA 2V3CC 5KTYA 1N2CE 4KFTA 3GCGA 4DHEA 4QHTA 4MQBA 2YZ2A 3HWSA 2JLWA 4ZV4A 2QA5A 4B74A 4X8LA 5GJVC 5F2EA 5J4KA 2WIBA 4JMPA 5H8WA 2BWJA 2PZFA 4TTPA 1AK2A 1VG1A 3GEIA 2XZLA 1SVMA 1F2TA 1CLUA 1Q20A 2A30A 3RRMA 4V0ME 4AKGA 3GJXC 2VBCA 2A5GA 1FPMA 1G5TA 2CNWA 3KKNA 1HE8B 2OAQ1 4OQNA 1BYUA 2VTKA 3HJNA 2F9MA 1ZNYA 2O8CA 3QEJA 5C46F 2GVDC 4Q4AA 1TU3A 3AF2A 1LNZA 4IVPA 4OQFA 5AUPB 2AWOA 1RZ3A 2WWYA 5FPTA 3W90A 3F3YA 3ZYCA 4UNPA 1M34E 2EFHB 4LHYA 4EJSB 3DDCA 2QP4A 1R0YA 4MUBA 2E9SA 2JJ1D 4LYAA 1NJFA 2XNSA 1Z07A 3QF7A 4KFRA 4MGYR 3OESA 4X8OA 3EPHA 3I92A 3NIBA 3OAAD 2ORWA 2IXFA 1NNEA 2QMHA 2MMCA 3FVQA 1E98A 2IUSA 3GLHE 2C77A 4Q1BA 4O0MA 3S1AA 4NCJA 4HSEA 1OE0A 1GILA 1OHHD 1L4UA 2KE5A 3K9NA 3N2IA 2O0HA 3FKQA 4Q21A 4UXHA 2QBYA 1QRAA 3GLGB 4IXMA 4D0GA 2Z4RA 2J0VA 1LTQA 1ZNZA 1TQ4A 4ZI2A 4HDOB 4EQ6B 4PC1A 2ZRJA 4C7OA 2O8EB 2QL6A 4QGGA 4I1OA 3U3JA 4CT4B 4GZLA 2IUUA 3T61A 3UPUA 1U99A 3THYB 3B1VA 3BAFA 1JECA 4LBWA 5JCPA 4XWOA 2IWHA 3Q72A 4EUNA 1CP2A 1DBSA 2WOOA 1COWD 4KBFA 5FTNA 4FMBB 3A4NA 2PZGA 3A4MA 3H2YA 2OV2A 1TEXA 3FKSD 3QKUA 3K0SA 4BFXA 2Z6VA 2QEQA 4KYIB 2AX4A 2VQSA 3AUXA 4A2WA 4I81A 1XMSA 2ZRDA 4F38A 1G17A 4XWAA 4TL6A 4AD8A 2AWNA 2F1IA 2O0JA 5J4HA 3ZQJA 1ETUA 4G01B 4IKEA 1S9HA 3B1XA 3EG5A 4G5RA 3GLFA 2QQ0A 2PH1A 5FPYA 1WB9A 3KXLA 4ARZA 4LGMA 3EARA 3SFZA 3MGCA 4JKIA 4DDVA 1QBKC 4OBEA 3VR3A 3IBGA 5DYGA 2V7QA 2XOKD 3KUCA 4Q1FA 2QG6A 3DHWC 1R4AA 1CU1A 2A78A 4EPVA 2F55A 3GJ3A 1K6MA 4TL9A 6Q21A 4FWTA 4CGZA 4D4LA 4A8JB 1EK0A 3SJBA 3T15A 3CNNA 1RIFA 2GBLC 2ZR9A 1IAQA 3MFYA 3B1ZA 3X1WA 3FMPB 3U3RA 2FU5C 3PENA 4B73A 5GVSA 3EZ7A 4MRRA 3VKWA 2DWQA 2G0NA 2EFEB 3ADBA 1GUAA 2HCJB 3SBDA 1G6OA 2ZREA 4OI4A 3WHKA 1ZMXA 2BKUA 5TB5A 2TMKA 1J7KA 2AKAB 2VP5A 2PX3A 4BRUA 1F5NA 3SC3A 2P0EA 1GKUB 4V0OA 4A6XA 3HU2A 3QY0A 5CK4A 4PAOA 3R7WA 2A5JA 3QXXA 1XMIA 3A1SA 3CO5A 3NH6A 1W46A 4LJ9A 1ESNA 2BBOA 2WMNB 1FP6A 1R6BX 3BGWA 4R98A 2P3SA 2WJYA 2IYTA 4NYIQ 3SYLA 4R9UC 4U02A 1RE0A 1YHNA 2PMKA 2QAGB 5FTMA 4KVGA 3VU9B 3OE7D 3SJZA 2PJRA 2D2FA 4FIDA 1TU4A 3DOEA 1VYTA 1D9ZA 3SDZA 1LFDB 4DLXA 2IS4A 4P3YA 2OO7A 5BN5A 4C0JA 4V02A 5HTKA 1KSGA 4LHVA 4E03A 4BUJA 1Q1ZA 5J40A 2GVZC 3OIWA 1D2NA 2AFHE 3KZ1E 3F0TA 2R62A 4TMTA 3SE0A 5AWFC 3RABA 3VHXA 4CEIA 4DT1B 4L4UA 3CWZA 1D5CA 3U6BA 3U7EB 2HT1A 1Z0FA 2R6GA 3AF3A 4A82A 3PVSA 1PUIA 1ZBDA 3K0EA 2WHXA 4CT5A 3NBFA 1YZGA 2JA1A 3X1ZA 3GFTA 2ZRCA 5FBQB 3ZS9A 2QAGA 1GIAA 1RKBA 2EFGA 2ZIAA 1S1CA 1GITA 2GXQA 4MRVA 3IHWA 2FFQA 3TRFA 4QBGB 2D7DA 2CL7X 1L4YA 2QAGC 3CX7A 5CB8A 4RD0A 1VCMA 1YJ5A 4RKFA 3CRQA 3CX8A 1ONBA 3KQLA 4BGDA 1N0WA 4RD6A 4HDCA 1T4GA 1ZW6A 3B6EA 5B58C 2ANBA 5AUQA 2J7PD 4AK9A 1KY2A 1F60A 1M74A 1OFHA 1N5LA 3C8UA 3IGFA 5HKKA 1BKDR 3KJHA 2JJ1A 3K9GA 5EUQB 5KNBA 3WYGA 4AKIA 1M7GA 4ESVA 1Y3AA 4C0BA 2P6UA 4P4TA 3IKJA 4B2PA 4JKYA 2RKOA 1KZ7B 4Q7LA 3DM9B 3RWMB 1X8KA 4IDQA 1Q57A 4LJ4A 4KU4A 3AVQA 2C9CA 3BRWD 3L0IB 2GK7A 2WBLC 2YKGA 3KQNA 4BFVA 1R0XA 1NMXA 1Z08A 2G1JA 1FFHA 3Q9LA 5FUVA 4TQ9A 3CW2A 2GJAA 2Q3HA 2WVJA 1DAEA 3DL0A 4OYHA 1CR2A 1IM2A 4BLSA 4I99A 1YVDA 3EIHA 4GZMA 3VR6A 1JI0A 1S3SA 4JLDA 4LPKA 1Q0UA 1G41A 3FMIA 2D2EA 2VHQA 2EW1A 4RFVA 2B8TA 4LJ7A 2XITA 2REOA 5A5GA 4LV8B 4Y0AA 3BFXA 1HT2E 4R2HA 5JS8A 4IDOA 2QPAA 4DDUA 2C78A 3RC8A 3IIMA 3QXCA 3X1XA 2CVFA 1UKYA 1RC8A 1JR6A 2OUKA 3PEVA 4DSOA 4URYR 4NHOA 4B3FX 4V0KA 4WW0A 4IOJA 1FZQA 2J45A 2NG1A 5J4VA 2BDTA 1RYFA 4ZKDA 1QHGA 5BYJA 3RSOA 4GMDA 2XGJA 5JCZA 1YU9A 1AS3A 1R0WA 2JLQA 3EAQA 4IFBA 4Q4AB 4Z1MA 3KFVA 1S8FA 3EC2A 3GQBA 3W34A 3AEZA 4QFMA 4UJ5A 2PCJA 1E79A 3Q85A 4XOIA 4DCTA 1KSJA 3CWQA 4QBIA 1MABA 1X8LA 3AVVA 3C14C 2IF0A 3KKOA 5E3HA 5BYKA 3C5HA 4KBGA 2VSXA 1UBEA 1ZUHA 3QQ5A 5TARA 1V5WA 4RZXA 2O8FB 3NEYA 2FSIA 1C1YA 4DSNA 4KFUA 3AM1A 2XXAA 1VG0B 1WXQA 3T35A 2D06A 3UG6A 1NBMD 2IHBA 1U0HC 3B5JA 4D81A 1A82A 1N5KA 2RH5A 3OEHD 4I4LA 1ZAKA 2C5LA 2RGGA 5DISB 4DKXA 1XWIA 2WWFA 2VF7A 5HR5A 4Q1EA 2N1BA 1NN5A 1SKYE 4TMKA 2V7QD 2XOKA 3G5UA 4K46A 4TN1A 5JS7A 2J7PA 2GAOA 2F3TA 1M2OB 4FD2A 3HPRA 2FOLA 4FINA 1NIPA 3SYKA 2WKQA 2RHMA 2JLSA 3U60B 2H8KA 2ZEJA 2CLCX 1SHKA 1HTWA 3EASA 3RHFA 4IXNA 4RKEA 5EUMA 4FMDB 1XP8A 4OHYA 4L8GA 1NVVR 5CYPA 3BJIC 3EA5A 2CXXA 1CS4C 2GHIA 1F2TB 2OCYC 2OZEA 2XXAB 1E2QA 3T5GA 4KI0A 4WAUA 4BLPA 5HZKA 2ZUBA 3AB3A 1E0JA 1ZIPA 2F6RA 4D0LB 3ZD6A 1CBUA 4D4MA 1OIVA 4JVSB 4NL4H 5JRJA 1AKYA 1NN3A 1UPTA 3L82B 3DZ8A 1MKYA 4YXWD 3FDIA 4C7OB 3EPJA 1XJ0A 2VIIA 1AJEA 3K1JA 4HLUA 4BECA 4JBXA 3OHMA 4GP6A 1M7BA 1IJEA 5KDDA 2GDJA 4Q03A 4PO1A 1QVAA 2AK2A 5ANRB 4B32A 4M9SA 2ZQ5A 4EJSC 2O8FA 4FXPA 5JJIA 2JATA 1HE1C 1LB1B 1M7HA 4NBSA 4PSAA 3AVTA 2VF8A 3P1JA 3LW7A 1FUKA 4KLZA 5F9HA 1T5IA 4B33A 1PV4A 1ELOA 3ASZA 1HEIA 2CBZA 4L9WA 3C7KA 4RD1A 3TNFA 3EXAA 3F5FA 4JLBA 2ZI4A 3W5IA 1GG2A 1UEJA 3KUDA 1A4RA 3QF4A 2ONKA 1FOEB 3GLIE 5HCNA 3P4YA 1P2UA 2FE4A 1QZXA 1UBFA 3UANA 1RRGA 4AKHA 3P20A 4OQLA 4JVNA 3H86A 5HPYB 5JWRA 2NO0A 2YNMA 4PR0A 2L0XA 1J2JA 2X2EA 3B2EA 4CYMA 3P27A 1G8HA 3GJ0A 3AF4A 1IN5A 1QHXA 4DB2A 4C0HA 3MWJA 2HDNB 5EE0A 1W0JD 1E32A 4M0LA 4M53A 5TDHA 1CXZA 4BQSA 3KXKA 8OHMA 4AG6A 3A4LA 2J0UA 5C2JB 4M9XA 3AP1A 3IDQA 3VKGA 1G8PA 2ATVA 4M21A 1AS0A 4C4PA 3LXRA 1CJUC 1YE8A 2FG5A 5CIWA 1E79D 2J0SA 4TT3A 1OB2A 4YDHB 4LJAA 1CRPA 1JXOA 1FW6A 5E95A 2A5YB 4B3GA 3IILA 1KJYA 4LHWA 4AKEA 2ZYVX 3NHAA 2HT6A 2OLJA 1AZTA 4F4JA 4PZZA 4ZI3A 2WWHA 3BB1A 4XSHA 1E6CA 4JBYA 4B34A 2QU8A 1KO8A 721PA 2WAYA 1SGWA 3QIAA 1E2DA 1W1WA 2RGDA 2QY9A 3NHBA 4LHXA 3U3OA 4LPSA 1RPZA 2G77B 1EX7A 4TTQA 2KI5A 3I1FA 1E1RD 2BBWA 4Q4JA 1I2DA 2IW3A 4R71A 3W6NA 3QKRB 2ZI3A 1TAGA 4ITRC 4IOKA 3BK7A 5LPNA 1TQ6A 1FUUA 2ZS7A 3EC1A 4GT1A 2ZAOA 1RVDA 2DFTA 3W3ZB 5J4LA 5AJYA 2QMUA 2R65A 2N46A 3FHOA 5KSZA 4US0R 4B3CA 4A36A 2XZOA 1B23P 2X8AA 2YV5A 5GJWC 2RGCA 4OHZA 4EPTA 4Q1DA 3BH6A 1D2EA 3CRW1 5DSZA 5KUTA 2OILA 2CE2X 2NZ8A 2JIZD 3GMTA 5LD2C 3TAUA 2QP3A 2RGXA 1NKTA 1UKZA 2PEYA 3LX8A 4I1UA 4XVUA 3FPAA 4PSVA 5DN6D 3ZQ6A 4WXRA 4DXAA 3FMFA 4DLSA 1ZIOA 2W58A 1TF7A 4JLKA 1G9XA 3CRRA 1RJ9B 1EFRA 2OBMA 4DRZA 3EPLA 3PITA 2WSSA 2AHOA 3FHCB 5L8VA 3GJ4A 1P2SA 4X8HA 4OI0A 1N6RA 4TLCA 5CK5A 4XSGA 4EFLA 3QXJA 1KNQA 2QAJA 2ZYTX 4QNMA 3NBZC 5FPSA 3E5HA 2HEIA 4M9ZA 1GOTA 4DIDA 1LS1A 4TQAA 5EZ6B 4TYWA 1W7AA 4DUGD 3I4LA 3GLFB 4R7ZA 3WYAA 4OI1A 2WPDD 4KITB 5EZ5A 4ACAA 2YC2C 3FYHA 1Q22A 3LWNA 5DI3B 1KI2A 3AVPA 4U7DA 4IEEA 1MH1A 1R7RA 4DLWA 3LX5A 2YVUA 2QE7A 1Z0IA 1YZTA 4DLYA 4PAQA 5CYOA 3DMDA 5A0FA 1SZPA 2IYUA 3LLUA 1E69A 5DHFA 1N25A 2YWFA 5KO2A 5CIQA 4IW3B 4JJZA 3B8HA 2KWIA 1EG7A 2J41A 4XJXA 4HZUB 2FGKA 5L3SA 3P26A 1D8TA 2R6CA 4AY2A 3LFUA 1KMHB 4MGIR 3TVTA 5EXXA 3PIRA 3TW4A 3QUSA 4B47A 1UKVY 2B21A 1GNRA 4AI6A 3VX4A 3ZLJA 2GEUA 4AURA 3OFND 1XZPA 2E1RA 2OHFA 1IY1A 1GL7A 3RSLA 4DVGA 1ZRHA 2IXGA 3LQQA 3VQTA 1QF9A 1KHTA 2BJWA 3B7GA 2EU8A 5LBIA 1X3SA 3A36A 4B2IA 4PX9A 4TLDA 2Z0MA 2QUZA 1Z3IX 3NBYC 3EZFA 3K9HA 2OFXA 4DCSA 4RFSB 3NWJA 3H84A 3L0OA 5D3MB 3I73A 1T3LA 4LCBA 2QI9C 1NMYA 2ZS8A 4B75A 1N0UA 4QRHA 1EX6A 1MO6A 3VKHA 3RDPA 2QTFA 5C1BA 2WSMA 1S9DA 1QG2A 2R9VA 4Q4LA 1QHHA 4W5WA 1GM5A 5H1YA 1H8ED 3MLEA 4TMWA 2IYSA 1GL6A 1NMZA 3T34A 5FOSA 3CLVA 3QXHA 2O8DA 1KNXA 4QL3A 4XVRA 2H57A 5JJKA 2NO7A 2WICA 1EGAA 1Z0JA 4UXIA 1NVXQ 2G88A 3C15C 1Z47A 2JJ2A 5J4YA 3ZVMA 2QT0A 2FA9A 1Z63A 1X8JA 2IA5A 1W2GA 1AM4D 1VDZA 1G18A 2GK6A 4Q9HA 2IEYA 5AUNB 1NN0A 1TADA 4PC2A 2FSHA 4XWKA 4PSKA 5TMPA 1E2IA 4CEJB 2JLXA 3WNDA 1Z8FA 1G16A 5HE8A 1ZNXA 3DM5A 2ZRNA 4NE2A 2OXCA 3C16C 4QHYA 1X86B 4R2IA 3MSXA 4U00A 1A1VA 1JJVA 3AVYA 1N3BA 3GD7A 1SVWA 4ON9A 2V1UA 3OIYA 2ZTSA 1XEWX 3FFAA 4NYMR 5KSPA 1P7CA 5DI3A 4LJ5A 3QKTA 4TWZA 3W8RA 4OL0A 1MO5A 2F3RA 2XAUA 3ASYA 2REBA 2Z43A 1QHNA 3HYRA 3C4JA 1N6LA 4MUAA 2HJVA 3BOSA 2NPFA 3U44A 1T6NA 2UVQA 1W47A 1HY3A 4MYCA 4UXJA 5DLQC 3V9PA 1OF1A 4JLPA 4WIAA 2GTPA 4RZ2A 4N0EA 4MITA 1KK2A 1CKEA 1XMVA 4BPBA 2H18A 1S3GA 3GLHB 2H7VA 4NCKA 4NTZA 3FTQA 2A9KA 4UNNA 4BFUA 3FFBA 1OPXA 3R20A 2AR7A 1SXJD 2H1LA 2QBYB 1NVUQ 2CVHA 1T8UA 2WKRA 3AQ4A 1OH7A 3IPYA 4JS0A 4Q4HB 1T5LA 4JL5A 3RS3A 2IS2A 5AJXA 4PHHA 3DO6A 1M8PA 3FGNA 4GMXA 4TL8A 4B3DA 4NCHA 1N6HA 4ZCIA 1MO3A 1SXJE 2HYIC 1Z2CA 2XJ4A 2BMDA 1KJZA 1P72A 1DAHA 3ADKA 3L0SA 3Q3JB 5P21A 1X6VA 2ZJOA 3KJIA 2BM1A 5FBWB 2QSZA 1TL7C 2J87A 3CIOA 4A0FA 5SZIA 2NO6A 4BFWA 4ARZB 1II8A 2XTZA 1A2BA 1IN8A 5FR2A 1P60A 1XX6A 2YOGA 5KSYA 4ZDJA 2ZYWX 3U6KA 4FN5A 3UKDA 4NH0A 2GJ9A 2FMXA 1AA9A 2MSCB 3B13B 3LO5A 2E87A 1EESA 3TLXA 1T3HA 4LRWA 2GJKA 2WMOB 3TR5A 1Q1EA 2PLFA 2PX0A 1GRRA 1UKEA 4LBYA 1SVLA 2ZUDA 4PANA 2H17A 4IJMA 4KSBA 4DT1A 3MG9A 4B6FA 3L43A 1PZNA 4KSCA 5TV2A 3K70B 2A5FA 1NI3A 2CCKA 2XTNA 2QPOA 2V6JA 4KLNA 4DSTA 4TSFA 4DWJA 5FOTA 1W44A 1XEFA 1ZM7A 5FH9A 2QRZA 5G3YA 1NJGA 5TXGA 2NO9A 2CCJA 2W83A 3KXIA 5IK2D 3GLFE 3W6PA 5HZHA 1V43A 2CMKA 1N5JA 4J0QA 3PCRB 4DUGA 5B57C 2Z83A 4JLAA 1ESMA 221PA 2F7SA 4QGFA 4QNRA 821PA 5C18A 1MOZA 2ZAMA 3PEUA 1E9RA 1XB2A 2O0KA 1W5TA 2BMEA 2ZANA 3QKSA 3L8YA 2F43B 3UWKA 3R7WB 3LY5A 1U0JA 5FFMA 2FWRA 2C95A 2J46A 1ZINA 2IYZA 4PHGA 2WJGA 1E3MA 1KI7A 3LBIA 3A6PC 4JSYA 2IYRA 1II8B 3CKLA 5FOXA 2QNRA 3NDPA 1L8QA 4QKQA 4KAXA 1YZLA 3Q8XB 4LV5B 4B3XA 1NL3A 2DFNA 4RCZA 4GBMA 1SXJA 3K0CA 3Q5EA 2GJSA 2RHDA 3VR5A 1GTVA 1W0KA 3RS2A 2NO1A 1UF9A 2EFDB 2CJWB 3RRNA 4Q00A 1IXSB 4FWIB 4WBSA 3VU9A 2ORVA 3K0FB 4MGKR 4WZAE 4WVFA 3JVVA 1UFQA 4BASA 3RS4A 4MRPA 3KQHA 4AIIA 2OLKA 4IDHA 5EP2A 1G1MA 4B35A 2YHSA 2C8VA 2NPIA 1P73A 1KK0A 1E0AA 2ZJAA 1E2KA 1SVOA 1SXJB 2R6DA 2ZSFA 3IIKA 4HAXA 4O3MA 3QXSA 1HA3A 4Q47A 1OYWA 1Q1BA 5KSOA 1Q21A 3ZZUA 5JI3E 5UKDA 1BYIA 3SI7A 3V00A 4ZDWA 3VR1A 3I5XA 4BEJA 1CEEA 2AFIE 1AQYA 1G8GA 2W6JA 1G3MA 2H5EA 2RMKA 5E7JA 1Z6AA 1CJMA 3OIVA 5GVRA 5AK0A 5ELXA 1PVOA 1FMJA 1UJ2A 3QPWA 4NPHA 1E96A 2ZSDA 1TPZA 1W4RA 1WDTA 2HLDA 1O87A 4MH0R 4QJ3A 1A7JA 2CL6X 4GOJA 421PA 5A4JA 3GLGA 2VP2A 2YOHA 4B2LA 2R6FA 4NONA 1YR8A 1KY3A 2WWWA 3K09A 4NU0A 3VR4A 2FN4A 1GNQA 4AYWA 5KPDA 4RCYA 3CF2A 3THXB 3B1YA 2VRWA 2X77A 5FUXA 4H9GA 5H70A 4V0NA 2XNDA 4XD7D 3WRXC 5FI1B 3K09C 2W6IA 2ODEA 3IHLA 1PJRA 4HAVA 1E1QD 4MGZR 2CEAA 2JDID 2G9NA 1GKYA 1H8EA 1WA5A 3B78A 2X2FA 4HYYA 4PC3A 1YZNA 2NTYC 2WOJA 4F92B 4BRWA 1I4LD 1G4UR 3JZAA 5JEEA 1E2HA 4A6PA 3K0FA 4ERNA 3VR2A 1MRSA 2QTVB 2CK3D 3B85A 2GESA 3IPXA 4HB3A 4HZUA 4AYXA 1KI3A 3G0HA 1E2NA 1W36B 2A3RA 1OSNA 2HYDA 3F8TA 4Q18A 3N70A 2GCPA 2I1VB 5EP4A 2GZAA 3WYFA 1QG4A 2G6BA 2WJVA 5BW8A 3W3AA 4QG7A 3A58B 3RS7A 1P75A 2CK3A 1R5NA 1UBCA 4P32A 1D6JA 4PO8A 4YMVA 1E9BA 4D4KA 3E70C 2FZ4A 5DO9A 1NG9A 3PG5A 1OXSC 2IS1A 4M2LA 4LBVA 2ZRAA 3HP1A 2F1HA 4B71A 1KTVA 1OH6A 1P6XA 3EIEA 1OFIA 3TVDA 3TSZA 1XBTA 4IFEA 4YXWA 4UNSA 3U7HB 1KK1A 2ODBA 4IVRA 4ASUA 3QKRA 1VYUA 3GFOA 2JDIA 3EZ2A 4S35A 3DKPA 4AG5A 1Z0AA 1DG3A 5F3WB 1IHUA 1X1SA 2VSFA 2X19A 1RRPA 5L3SB 2BCJQ 3DZDA 4TZ6A 4D25A 2CJWA 3BXZA 4D82A 2ZITA 2F9LA 3O47A 4JLOA 4CRWB 2ZJ8A 1QDEA 5GJCA 1YKSA 3CX6A 2BBSA 1KI6B 1XXHA 2BHRA 2BVNA 5FPKA 1YR6A 4PTLA 3AGQA 1VECA 5DHAA 5K8IA 1NLZA 4WZBE 5FBLB 2HLDD 4TLBA 1NIJA 3ZZTA 1N6PA 2B92A 2IBMA 5BQ5A 3GLIA 1RJ9A 1NF3A 1U8AA 1W4CA 4DLZA 2VO1A 3KKQA 4N0DA 1A2KC 2RGBA 1GZSA 1GFIA 2JJ8A 4LDJA 2ZJZA 1LF5A 4MA4A 1G7SA 3U3KA 2UZIR 1OXVA 1SVKA 4NZYA 4LHZA 3UIEA 2XB2A 2PZEA 1II9A 2WAXA 4HB0A 5D3MA 2OE2A 2OG2A 2ZU6A 1KDRA 4TQUS 1PLKA 2VHJA 1NVWQ 5DN6A 3ZIAA 4K81B 1CULC 1OFTA 1IN7A 3TQFA 4LBZA 2JLVA 4QBHA 1NP6A 3I61A 5E4FA 1GL9B 2DHRA 3WP1B 4YQFA 5K8LA 5EXTA 2Q21A 4JL8A 1GNPA 2RGNA 5CM9C 2NMVA 1SULA 4HUQB 2OM2A 1KKMA 2ZJYA 2QMEA 4WZ6A 5EE5B 5FOWA 1G3RA 2CDNA 2FFHA 5IHPA 1VPLA 3DKVA 3LH5A 5H68A 1C4OA 4KJZA 2ZI7A 3HU3A 1RFLA 2WWIA 3RANA 3TH5A 1QHYA 1US8A 1DOAA 2GCNA 3EWAA 3A1UA 4LZZA 4GRAA 1VHTA 2J0QA 1IBRA 4CZ2A 5AR1A 3CUEF 1DO0A 1KSHA 3H4MA 4E5UA 1LW7A 4B43A 3THYA 4A2QA 1AN0A 2VA8A 2ZVPX 3MAAC 3PXGA 4EIWA 2G3YA 3CB4A 4CVNA 3L2OB 4CIDA 3OFNA 4PQFA 1G4AE 1VTKA 4QBFA 3AH8A 4NYMQ 1XU4A 3MCAA 4ZIRB 2VPPA 4TT3D 3SHWA 4HATA 2JLUA 1JR3A 1BIFA 5GJBA 1DG1G 1DARA 1GKIA 1OKKA 3QENA 3TW8B 4JLJA 4P33A 3ZJYA 2K5UA 2EQBA 2P2LA 4HLQB 3A1VA 3W9YA 2WKPA 4V03A 2DYKA 2IEZA 4F4IA 1VG8A 3H1TA 1JR3E 4YMTA 3BH7A 5M04A 1ZYUA 3U5ZB 1T0HB 5IF9A 1OKKD 1U98A 2GXAA 3GJ6A 3GLHA 1DAMA 2NOAA 4C3ZA 3N5CA 4BFSA 1XDBA 4A1FA 5FTKA 5JWOA 3MRSA 3SYNA 2OAP1 5FL3A 2O8DB 1R0ZA 1NBME 1PUJA 4M9QA 3MD0A 1VKJA 1XF9A 4A4DA 1Z83A 2JCSA 4A8JA 2ZETA 2P5TB 5FPHA 3ETLA 2KBFA 1K5DA 3ICQB 3R8CA 3CF0A 3T06B 4BLRA 4IHQA 2XNDD 4Q48A 2R2AA 4XD7A 1KO4A 5SZHB 2B7BA 2AN9A 1KAOA 1KI6A 1Z6YA 4KO8A 4NYJQ 5JZVA 2HF9A 4ILEA 4P4UA 2ZE8A 4H1VA 1JPJA 3CPHA 2ODWA 4HAUA 1JB1A 5JI2E 1MV5A 1HH4A 3ADCA 1FQKA 1G3QA 2FGJA 3NG1A 1DAIA 2C99A 4OHVA 1YRAA 2AXPA 3ZZ0A 3WXMA 4IOMA 1EFHA 1G64A 3P4XA 2ZI6A 2KJQA 1RYHA 4Q7MB 2VP9A 1G20E 2HV8A 3AF0A 1U8ZA 2AD5A 2ZUCA 1F6BA 3E2IA 2ERXA 2Q9CA 1JQJC 1JPNA 2IYYA 3BC1A 1MR3F 2UKDA 4IOLA 1TX4B 4TTRA 3SJCA 4N1AA 2FZLA 5FBVB 4M1KA 2CHGA 5FL7A 4OQXA 5FUWA 1E1QA 4UKDA 3U4QA 3NH9A 1G5PA 3WHLA 1DTSA 1E1RA 5KYKA 1WP9A 2MMGA 2EYQA 1KK3A 2FEOA 5D3QA 3K0AB 2YC4C 4JZKA 4KV9A 3PFIA 4BEBA 3V4RA 2VEDA 3BE4A 1DPFA 3KB2A 4NP6A 4RFSA 3RRZA 3RC3A 2BMFA 5EP3A 1W48A 2ZI5A 1E2LA 4OK6A 3AGPA 4PPNA 1DO2A 1Q3HA 1DAFA 3MWYW 1Z2AA 4CEHA 4EAQA 1TEVA 2BMJA 3PR1A 1Z6TA 5FTLA 4M1SA 4HAWA 4O25A 2QPTA 1LF0A 4Z8XA 1ZC4A 2RGAA 2HCBA 1KO7A 1H65A 2GILA 1ZVQA 3ZGXA 4C0SA 3BFKA 2GZHA 2V4ZA 3OEHA 4JYBA 3CONA 1TUIA 3TUIC 2IX3A 4LY6A 4CEHB 2PT5A 1G19A 3B82A 5E7MA 4C2UA 4URVR 1LV7A 5TVKA 1VCIA 4MKFA 4C0LA 2FFAA 4U5XA 1EWQA 1KYIA 2W2TA 3AVUA 2IHYA 1EFUA 4BZXA 3K53A 5HE9A 1EFTA 2ZE6A 3NKVA 3SEAA 2OCPA 2W2VA 3D3QA 3R9XA 2QSYA 4GL2A 4Q9JA 3RAPR 2DWPA 4XTRA 1ZU5A 4G5GA 5LB4A 2XB4A 3AUYA 1S1MA 2ZRLA 1IY0A 3L8ZA 5KDOA 4F7WA 1W36D 3ZS8A 3IO3A 1W4AA 1E94E 2CHQA 3QJYA 4TSFD 1R5OA 5JMTA 2V6IA 3QBTA 4A0GA 1PLJA 2ANCA 2FSGA 5F9FA 1IXRC 4MYHA 4US1R 3QNUA 4LYJA 4GPTA 3TUJC 4HAYA 3WMEA 5KHOC 5EP1A 3AVOA 2ZRGA 1U0LA 3BORA 4OHWA 3FB4A 1JR3D 1SHZA 3MJHA 1KZGB 4A2PA 3R9IA 1Z5ZA 5IRCD 3A8TA 4DDWA 3QSYA 4KFSA 2G0TA 2JLZA 4MKIA 3RNLA 1CTQA 1ZM9A 4B48A 2H92A 1OV4A 1Z06A 4G5OA 4RD4A 4LWZA 2GEDA 3AP2A 2FV8A 3GJ8A 4ZCMA 5B30A 2C04A 2QENA 1UADA 3NVAA 4OHXA 1DAKA 4DLTA 4QM6A 3B9PA 3FE2A 1TUEA 3Q5DA 1EXMA 2QQEA 4DEXA 5C4GB 4MYUA 4WXPA 1TF5A 5JHGB 1VIAA 1MT0A 2QE7D 4PHFA 1DS6A 1IOZA 2O5VA 3DEFA 4OK5A 2C9OA 3O8DA 4A0HA 2G1KA 3SJAA 1OIWA 1VG9B 5CLLA 5B64A 4Z8YA 3OEED 1IN4A 4Q9KA 4Q7JB 4FCVA 1GRNA 4D2IA 1XPUA 2D3WA 1AQUA 2Q3MA 2DBYA 4DCUA 4TLEA 1K8RA 2ZRIA 3UMRA 1KO1A 4JBWA 4C30A 5KU1A 1J99A 2WPDA 3I8SA 1E99A 3OF5A 4FMCB 2D7CA 3LA6A 1ODFA 3HR8A 4KYUA 3K70D 4NYJR 2O8BB 1XRJA 4FCTA 3IBYA 3EWSA 5E7IA 5AJZA 2J3EA 2ERYA 3BD9A 4YONB 3UG7A 3W5JA 5HCIA 4DJTA 5KOYA 3D6TB 3LXXA 1ZJ6A 2PCLA 1OYYA 3IO5A 1WBBA 1NBMA 4MDEA 4EPRA 1HYQA 2GCOA 3RWOA 1Z6GA 3I32A 5FI0B 3X1YA 3RYTC 2WJHA 1W4BA 3BFVA 4LJYA 1DELA 2ZE5A 2RGNC 4M1WA 3SS8A 3QG5A 5AJWA 1TMKA 5CDFE 1P9NA 4M1TA 1CR4A 3HU1A 3ONWA 2CLDX 5IK2A 2DR3A 1OJLA 4PFSA 1OT3A 2I4IA 4QJ4A 4TMXA 1KI9A 2JASA 1TNDA 4DCNA 5BXQC 2PL3A 5CDFA 2BCGY 1WRBA 4JVLA 3WNCA 2GNOA 3CBQA 3OEEA 4LX0A 3L0PA 3ZVRA 3K9LA 4LUCA 3V4FA 2Y8EA 3P32A 1HV8A 2OFOA 4JYCA 1LVGA 1G21E 1TQ2A 3VMFA 3M0EA 4PC7A 5CB6A 2EWWA 3J81k 3KL4A 4ABYA 4UNRA 3D7MA 4PAMA 3KQKA 2B8WA 3BB3A 3OE7A 4EPYA 3NDBB 1XCMA 2OCBA 1B0UA 2IT1A 2V1XA 3KKPA 1E9EA 1Q12A 4QOSA 2FSFA 3AKCA 2AKYA 3TJZA 1RW4A 1XTKA 1G291 4MKHA 4UQOA 4YMSA 2OESA 3CH5A 4LYFA 3KJGA 1M6NA 3MWKA 2IYVA 3CZPA 4GOKA 1U8YA 1P9RA 5JWHA 2WTUA 1XZQA 3THWB 4TL7A 1GSIA 2XSZD 4QC2A 5CM8B 3LVRE 3CM0A 1ZD8A 2YOFA 4FI3C 4IDPA 1US8B 1CR1A 4HEJA 5FOUA 4TZ0A 2JJ2D 1IXZA 1P4SA 1E2FA 4F93B 5LD2B 3REFA 3WBKA 4P4SA 2QROA 5AUOB 5BWMA 1F2UB 3H0KA 3ADDA 1N6NA 1U81A 2VYFA 2W0MA 3SFVA 4TLAA 2WWGA 2BIFA 5EJEA 2CLSA 2GXSA 4Q4JB 1KSFX 4II7A 1ANKA 2ZRHA 1G8FA 1QVRA 3AV0B 1Q3TA 2YWEA 4DSUA 5KDLA 4ACBA 1DEKA 2R44A 3TAHA 5HKKD 1WBDA 3WMFA 1Z28A 1NSTA 4JIMA 3U7GA 1XCPA 3TQCA 3LBHA 3ECCA 1E9AA 1OXXK 2EWVA 1VCOA 3VNUA 2QMOA 3CRMA 3VNVA 2FFBA 4ZPXA 4WOPA 1BH2A 2EVWX 1XXHE 4IEIA 1EFCA 1F48A 1MRNA 4HLCA 3FMOB 4HZIA 4AYTA 4RZ3A 1E2EA 2IK8A 1ZCAA 1PLLA 2KB0A 5CLQA 3UK6A 2DPXA 2DFLA 1L2TA 3K0AA 1SKQA 2IXEA 1IN6A 4KHZA 1K5GA 3X2SA 4QGHA 4IDNA 4GP7A 5DNYB 4OKSA 1J8YF 3UXMA 3PEYA 4TYPA 3WNBA 4Q1AA 2W6ID 4XVQA 5EE9A 4LI0A 1E9DA 3U61B 4AC9A 2W0SA 1G7CA 2JIZA 1W5SA 3SHFA 1P9WA 1KAGA 1F2UA 1KJWA 3C5CA 5CITA 3EA0A 1LY1A 2IL1A 2A7QA 4K8OA 5DYIA 4DIEA 3Q7QA 1OHHA 4PQYA 4A0RA 2MSDB 4P0TA 4NYIR 4HLUC 4N3NA 2ZJ5A 5SZJA 1W0KD 2QM7A 2RGEA 4E22A 4RVCA 5DGXA 1XTRA 2KSQA 1SQ5A 1ZU4A 3QOFA 1T8TA 1KI4A 4DB4A 2GETA 5TY0A 2FPLA 3THWA 4PZLA 5KNCA 4EJSA 4URXR 4GDFA 2W6JD 3FHTA 2ZVQX 4NMMA 5DI9A 1XTIA 4W5HA 3RS5A 1N6KA 2RB4A 3W6OA 3SU8A 5JFGA 5EQTA 1E4YA 5G3ZA 1XTQA 2FPMA 3C41J 2ODNA 5JJLA 3EZ6A 1YZKA 3A1WA 4L16A 2Q0HA 3PUWA 2B7CA 3QPUA 4WA7A 4DCVA 1ZCBA 1ZM3A 3IQXA 2OT3B 5JHHB 2KBEA 3CPEA 1HT1E 2HXYA 4E07A 2JLYA 5G40A 5EE3A 4B3BA 3SNHA 4O2RA 2PT7A 4GI7A 1FL9A 3MUFA 3T1TA 4FW9A 5GADl 4HAZA 1AKEA 2P5SA 1XCGB 3QVVA 2D62A 3AKYA 2LWIA 2XZPA 4HB2A 2AD1A 4MRSA 1E2MA 2BBTA 4DLVA 4EFMA 1E4VA 4KCGA 2PBRA 1FX0A 2VP0A 1G7TA 2IYLD 3M4YA 3T1QA 4A9AA 4PC6A 4AWXA 4G1UC 5J47A 1MABB 1KI1A 4I1SA 5JSZB 1E9FA 3AVWA 1BS1A 3BERA 1JXMA 2BEKA 1H8HD 2OBNA 2VH5R 1BO6A 2R8RA 4NCNA 4OJKA 1GWNA 1GVNB 2XEXA 3QF4B 1VCNA 4TMZA 4URUR 5SZKB 1ZUIA 2CCGA 1OH5A 2FNAA 3FKSA 2P6RA 3I3SR 3GJ7A 1FTNA 4RJLA 1I2MA 2ZI9A 5KPJA 5JSZA 2XJ9A 1S0UA 2IUTA 3THXA 3LBNA 2PMDA 3LW8A 1GRQA 2YJTD 1IONA 1XD9A 2VL7A 3LV8A 4ZDKA 3DVLA 2QP9X 3D31A 3A1TA 2ECKA 2ZXUA 1EFRD 1FNMA 3TKLA 5L3RA 3SR0A 3CH4B 4G3XA 2Q3FA 2IYXA 2ZSBA 4XH9B 3PUXA 1U9IA 1WQ1R 2ZRBA 4BE7B 1NY5A 3WY9A 4NCIA 4X8MA 1NSFA 4P4SB 2FH5B 1Y63A 4DLUA 1U9IC 3TIFA 1T91A 4CEIB 4MYTA 4RY2A 5C4MA 3U44B 3PUZA 2HXSA 4GSYA 1GAJA 1FQJA 1P3JA 2WWXA 1DE0A 3THOA 1NY6A 3LRPA 2J0UB 3BBPA 5J5CA 1J90A 2LKCA 4G0NA 2YWGA 4PPQA 3KTAB 3ND8A 1OLOA 5K8TA 3PUYA 1FMLA 2GRJA 4PO9A 3VTKA 4CW7A 1RRFA 1CRQA 4BFTA 2EYUA 1JALA 2WSSD 3TSWA 3AF1A 3UMSA 1U2RA 5FBRB 1FNNA 2IF2A 2BOVA 4L5BA 1JAIA 3RVBA 5JLJA 4JSTA 3TSOA 4MRNA 3NBXX 3CPJB 1Z0DA 2LKDA 3VFDA 4EPXA 2HF8A 1OIXA 4YMUA 1ZC3A 2ZS9A 4L9SA 4E09A 1II0A 2IS6A 4H1UA 1F3OA 4EQ6A 4V0LA 4MDFA 1R8QA 2NIPA 5L3VA 3R9WA 2R6AA 3OZXA 2WJIA 3DOFA 1CJKC 1X1RA 3I72A 2VP4A 3TK1A 2BM0A 5DIFA 1XTJA 3ND9A 3TMKA 3VHLB 2CHVA 1S96A 1T0JB 3KTAA 3IEVA 1XXHB 1AS2A 4TYQA 4DZZA 2JGNA 1NLFA 2HUPA 5FL7D 3TE6A 1KKLA 2JLRA 1ZM2A 3CF6R 4ASUD 1CF4A 1YR7A 5G41A 2GF0A 2MSEB 3SN6A 2Z5FA 2N42A 2QM8A 4C9BA 3VX3A 1JEDA 2VHTA 2IWRA 2GF9A 2C98A 1BMFA 4NKRA 4CDGA 2P67A 4ESHA 2P65A 2QN6A 4JT4A 4Q02A 1AGRA 4M1OA 1Q44A 1P2VA 1XPOA 4RD3A 4OQMA 2Q9AA 3CR7A 3E1SA 2IYWA 2BJVA 4BFZA 1S4QA 1JQLB 1P61B 2BC9A 3KB1A 1P62B 1WCV1 1YZUA 2OXRA 3BB4A 3VAAA 2IC5A 2V55B 3UWOA 3X1DA 1NLYA 2PLRA 2ZR0A 4KXFB 1BOFA 1AIPA 3EX7C 4BWYA 2ONJA 1M1YE 1UDWA 1W49A 4MKGA 1GP2A 4TYNA 3B60A 4Q19A 2ZU0C 2ZRPA 1N6IA 1OW3B 3T1OA 3T5DA 3U7FB 1E9CA 3HDTA 2V8OA 3NC1C 4C0KA 4ZKEA 4XIGS 2C96A 1TF2A 4Z54A 3LAWA 2YYZA 3MMPA 2O8EA 2GZDA 4Q01A 4POAA 1WF3A 5FTJA 1AGPA 3KJEA 4Q5IA 5FR1A 1W2HA 1T9HA 1QHHB 3AKEA 2QRNA 2RAPA 1JNYA 2ZYUX 4GNKA 2W00A 2C9YA 1XD2A 1KDOA 1XMJA 3ZVNA 3QKSB 5CJPA 3RS0A 4EKDA 3O8CA 4HDQB 1D9XA 1OH8A 3T12A 2PJZA 2GXUA 2BV3A 4QHSA 1P2TA 4OI2A 4JJKA 4D80A 3WRYC 2VP6A 4QM7A 1Z22A 3WP0A 3IEUA 1OXUA 2Q6TA 4D0NA 1OFUX 4D26A 1XEWY 1YR9A 1DADA 1N5IA 2ASEA 1SVIA 1L7VC 4QXAA 1UEIA 2FX3A 2YWHA 3CR8A 4TMVA 4NDZA 2QGNA 4JT2A 1G6HA 5KNDA 1C9KA 4D4JA 1COWA 3JVUA 1VMAA 4B76A 1RRCA 4GFDA 5DH9A 4FMCF 3LQRA 4S2EA 3KKMA 2VLIA 2O8BA 4YC7A 1J70A 2FF7A 2QZ4A 3TGPA 1FP7A 1CIPA 1FX0B 2Q9BA 4LV6A 521PA 3TUZC 3ZD7A 2OSBA 4PZYA 2VHUA 3OIUA 1HQCA 1ZD1A 2V9PA 2F1JA 2FDCA 3SQWA 2PEZA 4HLDA 4OK3A 4LC0A 3FOZA 3REGA 1G3UA 2WZQA 1XJCA 4F4CA 1R8SA 5F98A 1OB5A 5JBQA 1CJVC 4BFYA 3GLGE 3BWDD 1DVRA 2J1LA 1YRBA 3SOPA 3QEOA 3G82C 1XPRA 3BH0A 4QGAA 3IIJA 3PJRA 4PXAA 2GKSA 4JVMA 2QT1A 5CJ2A 4A92A 2BEJA 3W8NA 3OAAA 4Z1MD 2P6NA 3NEJA 4Q9LA 1QHSA 1FTSA 1E2JA 4Q4HA 4ZO4A 2DCUA 3ZIAD 3U4QB 3TBKA 4M1MA 2OCAA 4DC9A 1UBGA 4URZR 4M1YA 1EWRA 4DBLC 3O8RA 3N2EA 3ICEA 1HQYE 1N0VC 1R10A 3ZH9B 4LSGA 4HUTA 3AP3A 4F91B 1XTSA 2ZROA 3DMNA 2SHKA 2ZJBA 3PUVA 2WV9A 1S2MA 4W9MC 3K70C 1D2MA 4A15A 2W2XA 1SVSA 2ORIA 1XNJA 1JEEA 1TQDA 1E2GA 2CNWD 3QPVA 4XTCS 1GDDA 1ZUNB 2HJGA 2ZRMA 3GPLA 4CF7A 4PQRA 4YLGA 4JLVA 3GP8A 3I8XA 1NVVQ 2GAAA 2I3BA 2DB3A 1MO4A 4G5QA 2ZSAA 1G8YA 3UATA 1UDXA 3HYTA 3T1VA 2FPKA 2V54A 5BN4A 4ZIRA 2IYQA 4DDTA 5JRZA 1OXTA 4KVAA 4IVQA 3RRYA 3I5YA 2O8CB 2J7KA 3EW9A 3LNCA 5K8UA 1Z6XA 2AXNA 2F43A 3GJ5A 3GEHA 4B6EA 4Z51A 5EXPA 2XTMA 1E0SA 4M8NE 4PPGA 4YDSA 1JBKA 2GBLA 3KQUA 1E9SA 4QJ5A 2ZRKA 5DE3A 4KODA 3ZVLA 1IJFA 3QI2A 2A5DA 3EZ9A 4TYYA 3AKDA 3BS4A 3MWLA 3Q7PA 4W7SA 1JJ7A 3HR7A 1NN1A 5JECA 2ZJ2A 1KMQA 5JEDA 1NKSA 1UM8A 3SBEA 121PA 4A8JC 1XEXA 1XFAA 4EFNA 2Z4SA 3LDAA 5FUYA 1JAHA 4GOXA 2CL0X 2ZSEA 3WMGA 1ZNWA 1U90A 1NRJB 4Q7KA 1E2PA 4I1VA 5EE1A 1SKYB 1W36C 3QE0A
chains in the Genus database with same CATH superfamily
3FPJA 4WFKA 3N8HA 3FF1A 1PEDA 3OOJA 3OZIA 2CXRA 3NXSA 2F1RA 4RQAA 4ZDIA 4G5SA 4R4JA 2WM9B 3ER9A 3B9BA 4C4SA 3BZWA 1NVBA 3HHEA 3CH7A 2A0XA 4TWBA 1FP4B 1DAGA 1W0JA 3SZRA 1EPUA 4RANA 3WK6A 1GPAA 3FNIA 1I4DD 2VWQA 2PXXA 3L77A 5F3RA 1GRVA 3FWYA 5F23A 1ZKMA 1DWPA 2DFKB 3DGFC 3I04M 4YJKA 1GQSA 1T2NA 4GXRA 5IN5A 1B6TA 4D8XA 2H1OA 2WK1A 2A0WA 2FK8A 2GYYA 1JJBA 3K3PA 3NHRA 4R69A 4R05A 3VH2A 1NVMB 2AMJA 1KQOA 2M6SA 5JRDS 2V65A 4ZO9A 5LQDA 3ELBA 1MIOB 1KHHA 1C7FA 3RTEA 4LOAA 5EEGA 1TTTA 1W9HA 4JCOA 2ZRFA 5DK6A 3BJZA 3ILVA 2ID7A 3BXEA 1EDBA 3MVEA 1U7OA 2X8JB 1NF2A 2V5VA 4YUXA 3QLJA 2W71A 5SV2A 1XL0A 4YAJA 1NHGA 2AOTA 1T0BA 2QORA 2Y2UA 3RSQA 1AA6A 4RMIA 3HE3A 2UXCB 4TX1A 4XSVA 5HHTA 3ZCXA 4ARBA 4LC1A 4BNLA 1RC0A 2GAIA 4IIJA 3PD0A 2D0IA 4Z99A 1Q95A 1XJQA 3GFPA 4OSPA 4O2LA 1QHIA 4QAJA 2SNIE 1X15A 4R9VA 5EGSA 4MVYA 1LDBA 5FOVA 5L3QA 3DC7A 5JPDA 3RGWS 4C2TA 4K9OA 1YH3A 3KDSE 2DBVO 3KTFA 3M6LA 4RHUA 4XGIA 5KHLB 2J9RA 2P2YA 1YWGO 3C7TA 5AK3A 1SCUA 3W2HA 3WMXA 3DXYA 3PI7A 2E5FA 4M4SA 4UUMA 4F3YA 3C3XA 4F46A 1Z0KA 1KR2A 1YZYA 3LTNC 4IILA 5C5CA 3RVOA 5BXYA 2R60A 3RWBA 1FJXA 4HUQA 3ZDQA 2GA8A 1JDVA 3ZN2A 1ZA1A 2CEKA 1O89A 4W5JA 2HA7A 2JAQA 1QVVA 2GN6A 2NUPA 5AJUA 2WIAA 4CEJA 1Z29A 1CUFA 3O1HB 3OT4A 4B4DA 2VQFB 1YIAA 2GAFA 2BTOA 1V37A 3NC4A 1R2QA 3PFKA 3ZX4A 2XX3A 1UAAA 3KT6A 4J4TA 5H4GA 3UFBA 1KGDA 3S99A 2E4YA 1VIYA 2BKXA 2BH9A 1KEEB 2GYWA 2ZZKA 2OK7A 1SUCA 3TZLA 4ZCPA 3BHIA 1J1UA 3EPKA 2IDJA 2I80A 2XUFA 4BJ3A 1QZ3A 4BZPA 4AJ2A 5L3QB 3VH4A 1E2BA 4H1TA 2I1QA 4B6JA 4MS3A 1Q1QA 4R54A 4DXDA 5ITVA 1QZTA 5IT9A 3PC3A 3LP5A 2HU7A 2XQGA 4P34A 1INLA 1NBHA 2VHCA 1AGYA 1I5EA 2R751 2VLBA 3KFXA 1CUAA 3ROKA 2RCNA 3C3BA 3KOWA 3Q9UA 4JLMA 3IJRA 3RYHA 4FGLA 3AETB 1P17A 3Q9NA 3DEJA 5H9VA 3LLVA 4YK7A 3QLUC 2PRIA 4C0AC 3CZQA 1U94A 5E38A 1E1LA 3SZUA 1X7HA 2Q62A 4PHTA 4TKZA 4PCUA 1GD1O 3W2IA 5KTYA 3QJGA 3DUFB 1ZXBA 1CUJA 2O7SA 4MQBA 2YZ2A 4PFQA 4RCVA 4AJIA 2O5CA 3D3EA 2G71A 3UHFA 2WI8A 1Z4JA 4Y2UA 1T2UA 3KSUA 1GPUA 2BTEA 2W4IA 1E3TA 4C6TA 2JW5A 1VLHA 4PTZA 1BMQA 1KRWA 4JMPA 4TTPA 2J33A 1BDMA 1QV9A 1SVMA 4B6OA 4JI2B 3K0BA 1CVIA 4K86A 1DKNA 3L4EA 1JDBB 2B6NA 3H17A 4FOSA 4XQCA 1GGJA 3GVHA 4QQRA 4IR7A 4FE4A 4TWJA 3E9NA 3OM8A 4X00A 2YWCA 3HJGA 3QI7A 1P0QA 1NHWA 3AY7A 2EAUA 2A1TR 4NK4A 5AM4A 5IPFA 2O8CA 4FFNA 4CNQA 4UTZA 3IR6A 4P3OA 5IFLA 4GZ5A 3PFCA 4CHGA 1PT6A 4RPGA 2Q8PA 5AUPB 4I4IA 5FPTA 3PTAA 1DC8A 4UNPA 5ARCA 3RUFA 3LYLA 4MTCA 4YQZA 3WGNA 3GG9A 2Q3BA 2QD5A 1A9PA 1NJFA 2BGWA 1KPGA 3LA8A 4K5QA 3DNMA 3G8YA 1EE1A 2ZIWB 4UDNA 4YTEA 3G2NA 3EJ6A 2I6GA 4ZQEA 2NV6A 1QYIA 1W87A 3JASA 2DCMA 2ZIEA 1MX5A 3OAAD 2IHKA 2ZCUA 4HPWA 5C3UA 3MWGA 1G1AA 1OBCA 1EUDB 2W2KA 1JKJB 1SCJA 1XHEA 4ZP1A 4Q1BA 4U6SA 2J9FB 2JK0A 2YXNA 1YDWA 3KK0A 4NCJA 4AQDA 1OE0A 1FYVA 2KE5A 1R74A 3AUAA 3GLGB 2XGJA 3OA0A 2Z4RA 3ZDRA 4Z86A 1EK6A 2XCRB 1VL2A 2FCAA 1TQ4A 2VYVD 2BI4A 4HDOB 4QOGA 1TEZA 1CR6A 5EHZA 2Y27A 2PR7A 4FHZA 4G0QA 4F72A 3L5OA 2QL6A 4JXZA 3NYWA 1O95D 5KKCA 3U3JA 5FWXA 2XMSA 2CNBA 1K7EB 4FXOA 1GZ5A 1YDHA 3T61A 5AMXA 2ZZNA 4LS3A 1QX4A 1F14A 4XCQA 1A2OA 2OWEA 1QIJA 1Z15A 3EVEA 5K4AA 1VGRA 3G1UA 1XRNA 4NCAA 2REQB 1DBSA 3ORQA 3DD1A 4KBFA 3SBOA 3VC2A 4FMBB 5LQNA 2DGDA 3QGMA 1FNCA 3RH0A 3A4MA 2XCOA 1KFEB 2ORED 1ZVVA 1QHFA 3W1VA 4QUHA 4QWWA 4C7VA 3MZ0A 4B4KA 2RSLA 4NG4A 3ZLTA 1QUFA 3B20A 3FH0A 4HX9A 3AUXA 5C0OE 1U3FA 3NNSA 4ZAXA 5EJ6A 1PR0A 4IIFA 4QYWA 2GBGA 1K7SN 1N9ZA 2AJBA 1G17A 4KQMA 3UA3A 4F38A 3I23A 4G4SO 4X3PA 1JU3A 2YDYA 1H1LB 1ESZA 2I71A 4N47A 2HIAA 1IYZA 4AJHA 3ZQJA 1IEQA 4G01B 3ANTA 2ECFA 4IKEA 3MFQA 4G5RA 3L1KA 3GLFA 2QQ0A 1WB9A 4ARZA 4MUEA 4IUYA 2VTVA 3ONVA 4GDMA 4B45A 4REQB 5JPCA 4DDVA 1HT3A 1QBKC 3JAKA 3VKUA 1U7PA 1L5ZA 2MHCA 1EFAA 2A0FA 5DYGA 2XOKD 3KUCA 2O6HA 3E7PA 4XX1A 4UUAA 3DHWC 4Z3DA 2F55A 2A78A 1R9GA 2IRWA 4TL9A 2GEBA 3RVLA 2NTVA 4A8JB 2IYOA 2PX5A 1OXMA 4IMRA 2XB8A 5F5LA 1R4NA 3H4TA 3SJBA 2H5IA 4A16A 5LA6B 3A4VA 4M7RA 1GGVA 4BGUA 4C1BA 7AT1A 1K92A 1QV6A 4DV6B 1MEJA 3KZXA 3P94A 4H3KB 2DWQA 2G0NA 3ADBA 4N3CA 1JBEA 3SBDA 5THKA 2IDKA 1A7KA 1K4YA 1DC7A 2QTAA 3R4CA 5I5GA 4UU8A 3FPLA 4BVJA 1EZZA 2DJIA 3LUKA 2TMKA 4BX0A 4OBBA 1TMGE 1VRVA 4BRUA 3GH3A 5EIFA 3GJRA 2WAOA 3JZDA 1JDBC 3MIZA 1A5AB 5CK4A 4ZQFA 1L9KA 2J4FA 4PAOA 5HQ3A 4EVRA 2IELA 2AEFA 2VF2A 2EJVA 3L84A 4I2NA 1AO0A 1C7JA 1RBMA 2AMVA 3A1SA 4JT9A 4J43A 4LWQA 1GPLA 1ESNA 4LFCB 2XQIA 3ORFA 4P36A 2I2WA 3DBLA 4LE0A 5DYYA 2GPBA 2P3SA 4Z0HO 5BN3B 2I8CA 3HDJA 3WQBA 3EBLA 3SYLA 3MPUA 4R9UC 4UTVA 4U02A 1RE0A 2DSNA 3E81A 1LKZA 4KXWA 3IV9A 4OM7A 3OE7D 5AKKA 5ECWA 5SICE 2D1QA 3PFGA 2HGSA 1BS9A 1XVIA 2NO5A 3IOBA 1M34A 2NV0A 1F1JA 3DOEA 3G0CA 3KAJA 1VYTA 3X1MA 3L1JA 9LDBA 1OXBB 2X40A 2VT7A 3DKRA 3L49A 3RB8A 2D0PB 1ZEJA 3WFZA 2GNPA 4P3YA 2Y05A 2OO7A 2VNHA 3S44A 4I3GA 4C0JA 5HTKA 1QRTA 2FQWA 2L19A 1J00A 4BUJA 4LXTA 3UGQA 1Q1ZA 3ZDBA 4EZBA 1SZCA 3CRNA 1ZO8A 2FP3A 2NLOA 3CUUA 4L0DA 3RABA 4NDAA 4B8YA 5AVSA 4DT1B 4DDKA 1HDCA 2P6MA 3AJDA 1XRSB 3EH2A 2WP8J 1F8FA 2DR0A 2IU3A 4JLWA 2R6GA 5KOHA 1JEYA 3LWDA 2HT1A 3L92A 1ZBDA 4OB6A 5A5FA 1E5DA 5NULA 3AJEA 1IZ7A 1EVLA 1PW5A 3QNWA 2WFZA 3T38A 2VWPA 4CT5A 5LA6A 3S8EA 3DVRX 1QG0A 1U1FA 2JA1A 2YMPA 4TTTS 1H05A 3EMKA 1XLWA 5HX7A 2BN4A 4OUDA 1WEKA 4QE3A 1WWKA 3IVXA 2Q6VA 4MWEA 4NFHA 1ECGA 3O2QB 4EKGA 1H2FA 6YASA 3F4BA 2IH2A 3PVCA 2G4VA 9GPBA 2I03A 1MOPA 4BV9A 3IHWA 2MOKA 4QODA 3U26A 5JMOA 2CL7X 3UK7A 1L4YA 2BKAA 3CX7A 3ICWA 3N6XA 4YP0A 3WGYA 1VCMA 5IMSA 1ST3A 3CRQA 3CX8A 1GGHA 1ONBA 2CF6A 3NBAA 4YAOA 5TQVA 1AU9A 3TR6A 4WBNB 3HCOA 5KYNA 3IAM1 1U5BB 3I5UA 2YWXA 1E92A 5B58C 4MJLA 1GPYA 2J7PD 2PKYX 2PZMA 4BBPA 1OFHA 3C8UA 5K2OA 4ZZ3A 3KJHA 3LPLA 2QLFA 3BK1A 4F9TA 3DB2A 4HAOA 4Y1RA 5JCOA 3BTVA 3G2IA 2PQMA 1MX9A 1YQXA 1H6DA 3WYGA 4RVNA 3KQSA 4JCCA 4R1SA 2VDQB 3TCXB 4QFCA 2P6UA 2V3WA 3GNTA 4P4TA 3KPYA 3EXIA 4HXGA 5CBPB 5K0FA 4JKYA 3NUQA 4UATA 3HN2A 3LUJA 2AB0A 2WF8A 4LF4B 1NM5A 1LFAA 4TXNA 4A6EA 1ZCZA 5IJXA 1CS0A 4C6SA 2C00A 2BR5A 2V6GA 3LWZA 1NW9B 1I14A 5K6TA 1O5OA 5IAAA 1FFHA 1DB3A 1KAHA 1T34A 2J9XB 2QVLA 3QA9A 3Q9LA 4IM7A 4OMDA 5D3ZA 5DCUA 3ZGOA 2UYGA 5DXJA 1M0WA 1Q0SA 3FBWA 5CFQA 3DVQX 4AS2A 1T0PA 1VLJA 4I99A 2RHJA 3HHPA 3CYFA 3O21A 3I1JA 3HRHA 2E49A 4RKRA 3AHJA 2X4DA 1JI0A 1S3SA 4JLDA 3R7DA 2GEJA 2P0AA 4IG4A 4LPKA 2R2GA 2VHQA 3BL8A 5FEMA 2HWUA 2GTIA 3LOPA 3MINA 1N34B 3PWTA 4MUIA 3SC6A 2XITA 2REOA 4URFA 5LA6F 4PBTA 3H18A 5JS8A 4G0XA 4QDXA 4TLMB 3WKEA 1NF8A 2QPAA 4DDUA 1L7NA 1UXIA 2C8JA 3GGGA 2BEUB 2P2ZA 2OGWA 3IIMA 4QJBA 3QE9Y 3X1XA 2CVFA 4AIRA 4OBXA 2Y4NA 3PEVA 1JR6A 3SMQA 4NY1A 4R6WA 1BS2A 3C98A 2FMTA 1FZQA 4GOMD 2J45A 4ZT2A 2QI9F 1JA9A 3KS9A 4GGMX 4WZAA 2F64A 4X93A 3TOSA 5JZ9A 4ZKDA 1JLLA 5CU7A 3WK9A 5HRUA 3CJQA 3HVRA 1FMFA 3BHJA 2Q27A 5JCZA 1YU9A 1AS3A 1R0WA 2G9VA 4Q4AB 3IDZA 4JEUA 4FDLA 1S8FA 2JAOA 4G5FA 5AOAA 4LJRA 4JQZA 4QFMA 1QANA 3DMFA 1E79A 4UJ5A 1ZI9A 3Q85A 3QZUA 5IYZF 4AUNA 5LU8A 1H3EA 2BHNA 1A1SA 1FNSA 3CXUA 4DCOA 3Q7TA 4E12A 4RYDA 4M0PA 5LKRA 5J2UF 3AVVA 5I4IA 4MMZB 4LNAA 1XP5A 3KKOA 3DDOA 5H4HA 4J7XA 1U1DA 3C5HA 1EKXA 4RZXA 2NT3A 1C1YA 3NM6B 1B6GA 1XKXA 4ZYXA 3EE6A 3QX9A 2LD4A 1A95A 2V7WA 4EYOA 3AM1A 3V6LA 3DE4X 2HRRA 1KEZA 1VG0B 2IZ0A 3T35A 3UXHA 4JYZA 2CW5A 1L3BA 3UG6A 4MWCA 1NBMD 1RBZA 1T4CB 6LDHA 5HWSA 5IX8A 4KOAA 4EF5A 5AI4A 3LI2A 2J3IA 2AYYA 1RHKA 2RGGA 5DISB 4CMHA 4DKXA 2QN2A 5B55A 4CM8A 2J0EA 3CT6A 5BSHA 2YWRA 1T4DA 4AMBA 3FA2A 4TZKA 5L40A 3S2IA 2B9VA 4OA5A 3MILA 4PG6A 4K46A 4TN1A 3W9BA 5MDHA 2K2WA 3KD2A 1UC4B 4UM9D 5C7OO 4J49A 4HP8A 2VK1A 3E5RA 1FS5A 2FOLA 3ZWKA 5AVJA 4ALIA 1TRHA 3K9CA 1YS2X 4U9HS 1PWEA 3DV0B 2PUWA 2H8KA 3FJYA 3O82A 2RDMA 6GPBA 3OIFA 4J9UE 1X2BA 3QTBA 3IDSA 1PK8A 3LT0A 1U2TA 2PFGA 1RXVA 4TS3A 5M34A 3T7IA 3VV2A 3BJIC 4FFPA 2FUEA 3A6KA 4HGNA 1F2TB 2OCYC 1OTXA 3NEAA 4WNAB 1MH9A 5FEUA 1NLMA 3Q98A 3AUKA 1OAOA 1NXQA 2CDRA 4LJSA 2JBHA 1CZNA 4JVSB 4NL4H 1AKYA 1I3NA 1NN3A 1TIKA 3PYXA 4M0DA 5J59A 2MR6A 1MKYA 2QQFA 3FM9A 1RRMA 3LUCA 2FW0A 2IGBA 4C7OB 4EELA 1OAOC 1XJ0A 3WDMA 4BECA 4UMEA 4R2XA 1A72A 2ETXA 2JKZA 4Q03A 3WJ2A 1R6TA 1JQDA 4LRXA 5BMVB 4MDYA 3RW9A 1B8UA 2PX4A 2ZQ5A 4EJSC 4PONA 1K7YA 4FXPA 3I2YX 2QYSA 4FGZA 4K1LA 3L79A 5AI5A 2WZCA 2YV4A 3ND7A 3T6KA 3VAYA 4BE4A 2VF8A 5LYJF 1JKFA 2VQ6A 2PHZA 2WHPB 5K51A 5B4VA 3W3AD 5EIXA 3IUSA 5F9HA 1UK9A 2QVCA 1MIHA 2XA2A 1RAFA 4KQEA 3ZDXB 4RJTA 1PV4A 2IEAA 4ZYVA 3USES 1RLUA 2PQ6A 3LCVB 2WMDA 2VHZA 1ADYA 3F5FA 1UMBA 1YBVA 4JLBA 4TMYA 3VR0A 4XXHA 2BMAA 1A4RA 1N7GA 1ZGBA 3CZ4A 3UT5A 2B4TO 1FOEB 2Z2IA 5HCNA 5CHYA 4NBUA 4JY7A 3OVMA 4DPKA 4QUBA 3DMTA 1QFZA 4Q93A 4QFBA 1HM5A 1OGYA 2CMGA 2GPWA 1AXEA 1QFMA 3C4VA 1V8ZA 1RRGA 3QWBA 4J90A 3UXYA 3P20A 4L07A 4PG8A 2XNCA 3L8GA 5HPYB 2JHPA 1E7WA 2P9CA 3ILYA 3L7NA 4ZT3A 3HCAA 3ZXYA 1HSOA 3KHTA 3B2EA 4HF7A 4KQHA 5CW1A 3NYRA 3UW3A 4H1WA 2G25A 1D1TA 2R8ZA 5EHGA 1IN5A 1WZNA 1QHXA 4PFKA 4EWLA 4DB2A 4C0HA 4LK3A 1UDCA 2B30A 2HDNB 5B1SA 1TKRA 2GBPA 2XA1A 3QPAA 2PUFA 1DX4A 4HWTA 2I29A 4RADA 3J7AC 2XRYA 2OCLA 2Y0EA 3S2YA 4BNVA 3D2LA 4M0FA 3DJFA 3VKGA 4F2HA 5CVTA 6NULA 2HOQA 3WWYA 2VSYA 1VGVA 2FG5A 2Z1DA 1XU9A 1E79D 1NDUA 5K9ZA 4R8VA 3BD8A 5MHTA 4R9RA 1XKTA 2Q1UA 3E84A 1RWBA 2BGJA 2R6JA 3PIDA 5HBRA 1FW6A 1BDHA 4B3GA 3KT3A 1BDIA 4AKEA 1CJBA 2XOEA 3IYLW 3WOVA 3NHAA 1WMAA 1YDEA 2CY0A 2IHJA 3R0ZA 4YJGA 3JATB 2N75A 4G84A 1LD3A 1ABEA 2QKYA 3H9BA 3NASA 4G89A 1Z62A 3C3CA 3TIGA 1XWWA 2H00A 4PZZA 5EC8A 5LUBA 3T3GA 4ZI3A 4DRYA 3DKIA 1D09A 3P2MA 4XSHA 1KEVA 1YVUA 5DM1A 1XPJA 3OSUA 1I94B 1DI0A 4B34A 3SSMA 2QU8A 1KO8A 2Y99A 3IP6A 4AX8A 721PA 5F2OA 4DXHA 4IH9A 1E2DA 3IMCA 3SZGA 4RIEA 3U3OA 4LPSA 1DBRA 1CRLA 1JXQA 1ZK3A 4GI2A 1ABFA 3KEQA 2IUYA 1CRWG 2KI5A 3F90A 3M5WA 1NJ8A 1E1RD 4CVNA 2C8KA 3N3AC 4HEA1 3ZGYA 3ZHQA 1JUDA 3VU3A 5BUZA 1FC0A 3W6NA 2ZI3A 2NQTA 1E9VA 1TAGA 1UC8A 4IOKA 4JXJA 4P35A 5LP6F 4OX9B 4F8JA 1EE2A 2P75A 1GDHA 1CUCA 3GNLA 3IAM6 4GT1A 1H6CA 4EZEA 2QMUA 3ZDAA 3NBMA 2FPIA 3FHOA 5KSZA 1KJ9A 1WZIA 4KGDA 2VYCA 2YV5A 3AEKA 4IHJB 3BXHA 3RUPA 3VR5D 4UEOA 1QCDA 4YDQA 3HV0A 3WSTA 3ZW9A 3DF9A 2E4ZA 4MYSA 1ILWA 3UQYS 4CT0A 3KLMX 4QT4A 1O95A 1XDWA 3FCOA 3GMTA 4EB8A 2NU7B 1IUNA 3IEIA 1BXKA 5IANA 1WV0A 5IJ9B 1NKTA 4I1UA 3RAJA 4KSYA 4KTTE 1ZMBA 1YSCA 3JQFA 4WXRA 4D9CA 1LRLA 4MEBA 1TF7A 2H9IA 4A6DA 1LPOA 4REOA 1MMFB 1RJ9B 4FZ3A 2F2TA 4NZNA 3EPLA 3N8NA 5DBGA 3OCYA 5L8VA 3LK7A 4GF5A 2J9GA 2H4HA 4OH7A 2XB6A 5B1YA 1E1NA 1F0YA 1N6RA 4TLCA 5ED0A 1SUWA 4QULA 4F84A 3AZQA 4LSZA 4GAEA 1XDGA 4ARVA 3OE5A 1V48A 1KNQA 1SBTA 2QAJA 3BWCA 5ERXA 1JYFA 3NBZC 5LNK1 4EX7A 3TL3A 4DIDA 4TYWA 3AV3A 3JQQA 1W7AA 3ZJVA 4DUGD 3I4LA 3GLFB 1B8OA 3WYAA 1G20B 2JBAB 4FWBA 4KITB 2X7HA 1Q22A 4K9MA 4YRKA 5L3SA 3PFBA 4D3XA 1GPDG 3IAHA 4HDMB 1LDNA 4U7DA 1RDFA 4WNIA 4G2NA 5ULLA 4DLWA 1NNI1 2EC5A 3RJ9A 4G67A 3WGKA 1Q0HA 2RKBA 4UBNA 4OFWA 1YZTA 4IJKA 1TYZA 1W85A 3DZGA 4W1RA 3M8KA 4P3XA 2IYUA 5FI5A 1N25A 1Q7CA 1RM5A 3GC6A 4M46A 4UAVA 5LP6C 3NVMB 1PQWA 4MJ3A 2NAFA 4ND8A 1GGNA 1ID8A 4QJIA 3A6HA 2IOFA 3B8HA 2J41A 4K9LA 1DQSA 3E3NA 5CD9A 5ALTA 2R6CA 4W9NA 4HADA 4MLPA 3TVTA 4ZYTA 3GHHA 4BN5A 3V4LA 1NQOA 4OIMA 3VX4A 2VNJA 4J07A 4WK0B 3MMNA 5JCXA 4LQCA 1T3GA 3RSLA 3FETA 1K89A 3F71A 4P0QB 3VQTA 4AZWA 3GGOA 3IXQA 4ZCQA 4BWGA 1C9YA 4YXFA 1X3SA 2QUJA 3GLUA 3M3PA 4FYKA 2PRSA 1MB3A 4MKXA 5EZYB 4UAGA 3V3TA 1V8DA 3ADPA 3D6AA 5ENVA 3SS9X 2QUZA 2H54A 1PDVA 1FU8A 2Y1EA 4L9RA 4XQ9A 5K6AC 1EWVA 4RFSB 5CPFA 2QTNA 1ST2A 4TUYB 5BVGA 2HJSA 3H84A 3L0OA 4KXLA 1W25A 3UJ6A 3NCHA 3O0DA 5DP1A 1FFDA 1M2GA 2XE7A 3LGSA 2GUWA 1XLTA 1N0UA 4GPAA 4RK6A 1EX6A 3VKHA 3AHEA 2VJLA 5HILA 7YASA 5LLTA 1QG2A 1T4BA 1FEZA 1QHHA 2R9VA 3EODA 4Q4LA 4AY4A 4DJAA 4B17A 4F6RA 4M89A 3ENKA 5E0KB 4E2ZA 2XCQA 5DTQA 2B98A 4MUNA 3X1JA 3ETDA 5FOSA 1VB5A 2UXBB 3Q11A 2O8DA 4XVRA 4MP8A 1VSTA 1ETHA 4C3OB 2H57A 3ZCQA 5JJKA 2R4QA 1SBQA 1NVXQ 3C15C 2Q4BA 2QT0A 2I9KA 1T2DA 5BV7A 5IF3A 1Z63A 2A59A 3GG2A 3K0KA 1EQ2A 5DRTA 1B3BA 1UFKA 5G4KA 1AM4D 1PDWA 3E5MA 2GLTA 3K2EA 1UIMA 3JVEA 2FEXA 4LXUA 4RA9B 4AF8A 4EA6A 1NN0A 4H60A 4PC2A 4GC9A 2IIQA 2VATA 2WU0A 3K72B 1Y1QA 4DCGA 4F5DA 4P4LA 4ZEWA 3IJEB 2ZTLA 3EWIA 4KYVA 1ZNXA 4HPXB 3DM5A 2ZRNA 5H0IA 4NE2A 2DSTA 2OXCA 5DW0A 4YNBA 1Y9AA 3DEHA 4U00A 1RTTA 4L5IA 3DUFA 5ELMA 3ICOA 2LDBA 3OF2A 1SVWA 5EJFA 2V1UA 3OIYA 4NYMR 5KSPA 1P7CA 3LX4A 1MN6A 1GY8A 4DBVO 5IKMA 4FSXA 1V4NA 4I5EA 1NPDA 1WXXA 3U7RA 3A1DA 1Z9BA 2D2XA 2REBA 5DZSA 4AUEA 2HJVA 4EO9A 1T6NA 3G1WA 2H06A 1XVLA 3ST7A 4HQLA 1HY3A 4RXTA 4UXJA 2WJAA 5E6SB 4WN3A 3Q4GA 4JLPA 1D5WA 2ZCVA 2WYHA 1Y8CA 4WIAA 3V9AA 1QYWA 2GTPA 3PIIA 1RLJA 5DLEA 4RZ2A 4AKTA 3R44A 1F1BA 4N0EA 4QYIB 5EL0A 5FWXB 4MITA 5JFOA 4D8WA 2C7VA 4L8WB 5G4KB 1ZN8A 4PS0A 5A62A 4DMUB 1E6WA 4MWBA 3FTQA 3KR1A 4UNNA 3LPAA 3KHSA 3SHVA 1Y8AA 1R6UA 4KL8S 3FFBA 4C4ZA 3WXBA 1QP4A 1OPXA 1YAJA 1TU0A 4HWSA 3EFOB 2QIOA 3D6HA 5FTWA 4KLCA 4LGYA 5LZ8A 2AT1A 4BKQA 2WKRA 2JGLA 1OH7A 3AYZB 4OB8A 5FV4A 2C07A 4JL5A 3RS3A 1J2RA 2ASVA 3WLRA 3KSRA 1I2AA 2VYVA 4A8HA 1M8PA 3HCFA 1TAHA 1A9ZA 2H4YA 2ID9A 3KSZO 5EOVA 3ZNOA 4B3DA 3IODA 1Z2CA 3MTJA 2W11A 2ZUVA 5JXIA 3FHLA 1TL7C 3IVGA 1TZBA 2YHAA 3GVCA 4F9GA 4B7UA 1DFGA 4S2UA 3UJ7A 3USCS 2XTZA 3TL2A 2J32A 1KQNA 4GM1A 5ITSA 1UXKA 3SIWA 2YXBA 4ZDJA 3EVCA 2WLSA 2ZYWX 3IERA 3DE1X 4FN5A 2Y66A 2GJ9A 4PINA 1DKQA 2AW5A 5AOBA 1EESA 3WGLA 5BW4A 5HTOA 4IKPA 1T3HA 4DN6A 2PZAA 1CY0A 1F17A 1SOVA 3CY6A 3GLTA 4OOEA 5JV5A 2WMOB 5JE8A 2PLFA 1JLMA 1XIVA 2CUTA 3HJUA 2QTMA 2NVWA 1QHEA 2C2YA 4LBYA 4NI5A 2ZUDA 4XGKA 5EINA 3UCFA 1EMDA 1R4ZA 5I5EA 1XTZA 3O95A 1NI3A 2H31A 2CCKA 1RQ2A 5DNAA 1NVTA 4CCWA 1JIXA 3ID6C 4KLNA 4BMYA 4EYGA 3SVTA 3A10A 1J21A 2ZBGA 2JH8A 5FOTA 1RPAA 1UP4A 3JAWA 5I51A 4WERA 1F6DA 5EIBC 2XQFA 1U5BA 3QHAA 3HB5X 4TUYF 4BVBA 3MRXA 3J7TA 4ZARA 5G3YA 5TXGA 1NXVA 4CM4A 5JYCA 5JO9A 4TXMA 5IK2D 3NHLA 2ODQA 4FBLA 3W6PA 5HZHA 3RVNA 3M82A 5IDYA 5LYJB 1JU9A 1KYYA 4J1SA 4DV4B 2L17A 2XUAA 3TX2A 1F51E 1MOZA 5EWMA 1T6ZA 2AQHA 4KV7A 1ZLXA 3G59A 3HCWA 2BMEA 4JD5A 3HVKA 4N18A 2K2QB 3L8YA 2Z5LA 2FMHA 3PRHA 4RM3A 3RRFA 1VSBA 3LY5A 4JYPA 1S89A 4ZGWA 3E3MA 5D7BA 1C1DB 5EQDA 3ZWMA 4L3WA 5AHXA 1LDYA 1BA3A 3H8SA 4PHGA 5B58T 2OFPA 2ZR8A 3WA6A 1SHJA 4KWCA 2QZ9A 2I6QA 1AHHA 4UM7A 2AUNA 2OLEA 2HWKA 2LGJA 1MPXA 1X94A 4RETA 4CIWA 5FOXA 3LPNA 1XVUA 4CIXA 4TRRA 3OU6A 1U6JA 3NIGB 4KAXA 3HKDB 3TYXA 2M32A 3N8IA 4Z7QB 3WI7A 3AEQB 5ALSA 2FWMX 1CHNA 1F0KA 1LZKA 4BLUA 5C5IA 1Z39A 1SXJA 4LQLA 2VDMB 3U7JA 1IN1A 5FAXA 3RS2A 3ZOZA 3L04A 3CR3C 2PKEA 5D3KA 3ZWNA 3RRNA 1X80A 3IR7A 5CXQA 2PZLA 1IXSB 1OWLA 4FWIB 3UMMA 1U8XX 2O05A 3HO1A 1B8PA 3IAXA 3F4LA 4WBSA 3VU9A 1Z7EA 2ORVA 2HBZA 3K0FB 1PR3A 4JVOA 5JSKA 1WMDA 4WVFA 3V6MA 1UFQA 4MI9A 1VKRA 4KGXA 4IDHA 1OBHA 2GPTA 5DT9A 1KK0A 4ZQIA 1KC3A 1E0AA 3NWPA 1OFUA 2AUMA 1NNUA 2R6DA 2AC2A 2OCXA 2YRFA 3IIKA 3GI1A 3NM5A 4J7AA 1HA3A 2C42A 2R97A 1YUMA 1Q1BA 4Q47A 1Z34A 4RUKA 5C8VA 5K8VA 1P9LA 3DE2X 3N0XA 4RDXA 3KJXA 2JCYA 3A2MA 2E6KA 3A05A 3B6JA 3QMPA 2VDNB 1K2WA 4NEQA 3CEHA 5CW2A 4BEJA 3D1JA 5B3AA 3TAXA 3WSVA 4WBNA 1CEEA 1YMVA 3AI1A 3JQAB 3L4SO 4HNAA 1G3MA 1QXSA 1ESDA 1XDSA 2HA6A 1UZMA 2P11A 3PS9A 3MWDB 3FCCA 2VRNA 1WSDA 3R6TA 1VA4A 3TJMA 2PUAA 1ZG3A 1SURA 4M86A 2CB0A 1R0KA 4I50B 5ALZA 1FTYA 1RLOA 4DR4B 3U62A 3FYCA 2ECPA 3V42A 2QT9A 1WDTA 2H2FA 2HLDA 1DC4A 3QWHA 1A7JA 4LRYA 2FWNA 4RORA 1JRLA 4YO8A 2WYVA 3H99A 3WIBA 1NVEA 421PA 3SF8A 3W5BA 1VE9A 2PZJA 1T35A 3A11A 3L7YA 4IIDA 1HETA 3TQTA 1EWYA 1NFRA 4DKJA 3R6LA 3K09A 1SXPA 4LE1A 2XYPA 2FN4A 2V3VA 4RJKA 2VXBA 3UPTA 4RCYA 2QTZA 3WX0A 5H70A 1RLTA 3IOMA 5DHTA 2ONZA 4OVKA 4EHIA 5HIJA 1T2EA 1WXHA 3INYA 3K09C 5F1YA 1SG9A 2PRKA 1V3UA 5F2NA 3RCBA 1Y4SA 3WZLA 1ZR4A 1BJKA 2W6IA 4XLLA 1N57A 2I6FA 4HAVA 3WE7A 5LZ2A 1JS1X 4MGZR 2BEWB 1GKYA 3CVWA 1GO2A 2H6EA 4GLLA 4Z7NB 5LUAA 5JARA 3SQDA 1N2JA 1YZNA 4FC7A 5AVTA 4FUQA 5EZYF 4BRWA 1DSSG 3NFRA 4JXKA 3JZAA 1YI0A 3UAVA 5JEEA 4G1FA 1E2HA 1EAYA 1JQ5A 3L0CA 3K0FA 1WHTA 4YT2A 2C88A 3DZIA 1K68A 4JZYA 1YR3A 2C1EA 3BSSA 4Z6KA 1QKIA 2OP1A 1G55A 1KDVA 1K9VF 3UAXA 2GESA 4QLAA 4WEOA 4EGCB 4HZUA 3TNYA 2RI6A 1KI3A 3ZHUA 4OY3A 3MGBA 3VTFA 2C5BA 1XTPA 4M7WA 1OSNA 3RFTA 4G8BA 2ONCA 2QUBA 4EY8A 4YECA 4OO3A 4N7JA 4JSRA 3ZY5A 1RFGE 3ULKA 1QG4A 4ZV9A 5BW8A 1PYDA 3C6QA 3MT8A 1MW9X 1ARZA 1IY8A 2C7BA 3V33A 1P75A 2CK3A 5F1PA 1R5NA 3HZRA 3KL2A 1TVKA 4DLBA 3LHSA 4RC9A 1E9BA 4D4KA 1I32A 3CF4G 4A3SA 4HMPA 9LDTA 1NG9A 4K1XA 1QQ6A 1WULS 1J24A 1OXSC 2WUEA 4KQ1A 4M2LA 2Z6QA 2P8SA 1TGYA 3H5VA 2JFZA 3B3FA 3WV4A 3ZZNA 1RWOA 2ZRAA 4ZN6A 2GSWA 4BB9A 1DCKA 1YJQA 4M8SA 4HO1X 1IWBB 1OH6A 2Y92A 3WKBA 5C1IA 1NVAA 3T95A 4QASA 2R7AA 4B0PA 2CFRA 3RU7A 3N5KA 4B82A 4OKNA 5LXTB 1KK1A 4IVRA 3EGIA 4BKRA 1J97A 1SOMA 3GRUA 2VSQA 5KVAA 4D8VA 1FUIA 4FEEA 4Y2PA 3FMGA 1Z0AA 4M0KA 3KR0A 2EJWA 1YBHA 3ZZ1A 2VSFA 4KW7A 3ZXUB 3GLRA 5L3SB 2NVBA 2ZWIA 2QSUA 5M29A 1CZRA 4RVGA 4D25A 1HRKA 2ZDHA 2CJWA 1NQ5A 4QEZA 2F9LA 2ZB4A 3LWBA 3MUNA 4EY3A 5GJCA 3NX4A 2WV7A 2QYHA 1KMNA 2BVNA 3HYLA 3PR3A 4MULA 4YACA 3OICA 5HZMA 4PN7A 3UT6A 2IPAB 1WV1A 3KUXA 4L22A 4CM5A 5K0NA 4DNXA 3C97A 3EOBI 3IJPA 5DXFA 2O3QA 1SBYA 3M70A 1XLUA 3KQTA 4FNMA 4ZO8A 5FBLB 5REQA 2BH2A 2JZNA 3L1HA 5IBRA 4EHFA 1FTGA 5J2UB 5BQ5A 2FR1A 3LCRA 2Z9DA 3GLIA 1H6AA 3VO9A 2O1EA 2VO1A 3KKQA 1A2KC 2BRUC 5AKEA 1GZSA 3MJTA 3PT5A 2JJ8A 4MA4A 4NZPA 2GO7A 1U8EA 3CKKA 3RTDA 4QTYA 2PZEA 5CVVA 2HJHA 4B1FA 3B70A 5D3MA 1QGZA 1NPTO 2VHJA 1USGA 3MERA 1NVWQ 5DN6A 5DULA 2IKQA 2PGDA 1HFKA 3WGUA 4EJ2A 1IN7A 2P8JA 1M0TA 2VJDA 4WSOA 1UPXA 1ZDMA 2JLVA 4CM8B 4AF7A 4O4LB 3GAZA 1NP6A 1P31A 2IIBA 1YCFA 5E4FA 3B12A 4YQFA 1Q91A 4OLHA 4Y6RA 3OPNA 4FB4A 2PT6A 4JL8A 1GNPA 5HSGA 3F96A 4NOJA 3VHRA 1QLWA 1U3VA 3EW7A 2P1RA 3OMXA 1L5LA 1OZHA 4TKMA 5JXHA 2NMVA 2OM2A 2YIDA 1KKMA 1S7CA 2ZJYA 5FOWA 5F7XA 2YYAA 2XIJA 1G3RA 2FFHA 1U8TA 3RIMA 5IHPA 1VPLA 1O54A 1C4OA 4UTPA 1E7QA 2ZI7A 1IUKA 1M33A 3N75A 4NS4A 1US8A 4EB3A 5LXTA 2KYRA 3BL6A 2G6TA 3A1UA 4QTZA 5ALIA