4TL8A

Crystal structure of n-terminal c1 domain of kaic
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
234
structure length
215
Chain Sequence
b'HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
total genus 74
structure length 215
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl8A00
5FL3A 4L16A 1Z06A 1KO5A 1XEWX 2R6CA 2PBRA 1A4RA 3W6PA 1AZSC 3VHXA 4QBFA 4M1KA 1XMSA 4QM6A 3AF1A 1SHZA 4KVAA 3T12A 3KXLA 1ZJ6A 1ZUHA 4OQFA 4V03A 4OHXA 2QAGA 1I2DA 3KKNA 1FQKA 4RCZA 3PENA 1GVNB 1J70A 4D81A 4BGDA 1LB1B 4QGAA 2F3TA 5CYPA 3CF2A 1JJVA 3FYHA 4B3CA 2ZITA 3N2IA 5EZ6B 3WP0A 4BLRA 2JDID 4TQ9A 3KKQA 3L8YA 2F6RA 2J7KA 4AY2A 2BMEA 1NG1A 2VP9A 2ZPTX 3A36A 2O8FA 1RRFA 3DVLA 2W6ID 4OK5A 4BLSA 4X8HA 3GJ3A 3CX8A 2HT1A 3ETLA 1KI2A 2GZHA 1RC8A 2KWIA 1P5ZB 4JLJA 3GFOA 2QQ0A 2DFTA 3AKCA 4M21A 4NCJA 4KSCA 3D8BA 4OQNA 2EU8A 1OHHA 2HCBA 3QPWA 4IOKA 1LF5A 4RZ3A 1KZ7B 5EUQB 5FPTA 1NNEA 1F60A 3B7GA 4PC1A 4YC7A 2D3WA 4LBWA 5AUPB 1CJKC 1AJEA 4EQ6B 2OILA 2ZVPX 1US8A 1G5TA 4FMBB 1N2CE 3PITA 1XRJA 1SULA 5F3WB 4TLCA 3U3RA 4Z8XA 2EQBA 3X1ZA 4AYTA 4BLTA 4OQLA 4MKFA 3RS7A 1PLKA 3EAQA 2CNWA 3TSZA 4EFNA 2ZSAA 2JJ8A 2QRZA 1ZINA 5KSPA 2DWPA 3RS3A 1J8MF 3I8SA 4C0QC 3QKTA 4BASA 4Q9LA 3W8NA 4G5RA 4D0LB 2OBMA 3R9WA 4G5OA 2WV9A 4JVNA 2QPTA 1Q3TA 1HH4A 4YDHB 2PMDA 4ACBA 4BWYA 1HE1C 3HR7A 4HLUC 3B8HA 1ZMXA 2WAXA 2ZRBA 4DSTA 5GJBA 1HY3A 2GTPA 1IN5A 2ATXA 2QP9X 1KKMA 3K0AA 1TQ4A 3OFND 1VYUA 2CXXA 2IS2A 1TEVA 3X1XA 4JSTA 1U2RA 1OFTA 1NSTA 2C04A 1D2EA 3K1JA 5HZKA 1VCOA 3HU3A 1DE0A 4ESHA 2QSZA 3GFTA 2NPFA 1KI7A 1EESA 4TLBA 1SVIA 4WA7A 3N70A 1NN3A 3U61B 1GL9B 1QVAA 1W48A 2ZYUX 3LWNA 3X1DA 1CS4C 2G0NA 2QROA 3ZGXA 1TQDA 1ZUIA 3MJHA 3K70D 1CBUA 4MH0R 4DLWA 3VKGA 5L3SB 2QM8A 1VG9B 4QGGA 2R6AA 2IUUA 3RWOA 1R0ZA 4HDQB 1U9IC 2WWYA 3Q7QA 5G41A 4DKXA 2CHQA 2FV8A 5TVKA 4HSEA 2ZE6A 2EFCB 5J4YA 3CPJB 5K8LA 3AUXA 3BH0A 4ZDIA 4GDFA 4YMSA 3IIJA 2R6GA 2WOJA 1KNQA 2J1LA 1U8ZA 4N0EA 1ZD9A 4JT4A 3PVSA 1HEIA 5A4JA 5JJIA 3ZVMA 3BAFA 3H84A 4XTCS 2A2ZA 3OEEA 3RC3A 4Z51A 2ZU6A 4M22A 1MOZA 2FNAA 4NYIQ 3H0KA 1G6HA 1HURA 3QKSA 2IX3A 4O3MA 2FPMA 4LBVA 3T5GA 2OHFA 4L5BA 3I3SR 1E0SA 1MRNA 1WA5A 3THWB 3AVOA 4BLOA 4X8OA 4M1SA 5EE9A 3HJNA 2ZRKA 3RRZA 4LJ7A 4W5JA 1GKIA 3CRMA 3NG1A 3JZAA 5C2JB 2GK7A 1T4GA 3TE6A 5BN3A 1G16A 2P5TB 4UNSA 2XJ9A 3LRPA 1JEEA 1XD8A 5JRZA 4F93B 4DXAA 3GPLA 1P2SA 1E2DA 1R2QA 3P20A 1AK2A 4P4SB 3MWKA 3CX6A 4DHEA 4EAQA 4GFDA 1MR3F 2KJQA 2I1VB 4TTQA 2LKDA 3TQCA 1ZM4A 3KJEA 3REGA 3MRSA 3E1SA 2WMNB 2UVQA 4CYMA 4CEIB 1DAEA 2V55B 2Z0MA 3QXJA 2YWEA 2DWQA 4LC1A 5FR1A 3B13B 3LBIA 4CW7A 2W6IA 1N5KA 2H5EA 2ZXUA 1XP8A 2J45A 3AKYA 1G6OA 4FN5A 2ZVQX 2DBYA 3FVQA 4NE2A 4QL3A 1EX6A 5ANRB 4DRZA 1OJLA 3K0SA 1CR1A 3O47A 1ANKA 3BRWD 4BE7B 1SXJC 1Z8FA 3R7WB 3DM9B 3LXRA 1TF2A 1ZIPA 3LA6A 2OCBA 1EFRA 2WWIA 3WYFA 3TGPA 5JJLA 2QP3A 1YZGA 2GXQA 5BYKA 2Z4RA 3BOSA 3TAHA 4M1YA 4DDUA 1QHXA 3UWOA 3ZZ0A 5EZ5A 2JLUA 2GCNA 1U8YA 2IL1A 3RLFA 1J99A 2ZS9A 2ECKA 3DZDA 1DAFA 3IDQA 5K8UA 1R8SA 4OI2A 3AF4A 3DOFA 1G9XA 4OYHA 4KI0A 5DN6A 3B6EA 4KSBA 3UIEA 3HYTA 4JS0A 3GCGA 5FPSA 2PZGA 1ZU5A 1SQ5A 2IS6A 2O8EB 2VO1A 1YQTA 1P9WA 3U7FB 3GLIE 2QSYA 5J4HA 1XTSA 2ZEJA 5EJEA 3SHFA 2ZJOA 2QPOA 721PA 3LX8A 3UWKA 4OQXA 3SJCA 2F1JA 1HT2E 2CK3D 4FMDF 3ZS9A 3RC8A 3OFNA 4UNPA 1IBRA 2DPXA 1FQJA 2QEQA 2R9VA 1XD2B 5F2EA 5G53C 3W8RA 1SXJE 4QGFA 2V6IA 2HJVA 2ZRHA 2YNMA 2ZRNA 1IM2A 2ZRAA 4KFTA 4Q4HB 4WIAA 2PJRA 3A1SA 1NJFA 2QT1A 1G8HA 2F9LA 4MGZR 2XB2A 2CJWA 1AKEA 1Y3AA 3CH4B 1LVGA 1M74A 2JLQA 4US0R 4TT3A 1G3RA 5JLJA 4MRSA 3VX3A 1RYHA 3PXGA 5KHOC 1IAQA 1ZM3A 4A0GA 3GJ4A 4TTPA 5EXXA 1G4AE 2B7CA 1E2KA 2ZJZA 4PAQA 3AVXA 1VYTA 2OFXA 2OBLA 1QHYA 2FJUA 4URZR 4FMDB 2QT0A 4AG5A 4PTLA 3EW9A 1V43A 1LF0A 1UDXA 2G77B 4XD7A 3K9NA 1KSGA 5BXQC 4AKIA 1E2LA 2WICA 4RY2A 3A1UA 3MMPA 2QGZA 3LLUA 2DR3A 4FD2A 4GOJA 3T15A 4ZCIA 3DHWC 1JR3E 4I4LA 3THYB 2W6JD 1Z0AA 1E98A 4ERNA 2WSSD 2AD1A 2N42A 4LSGA 2V1XA 4NU0A 2F43B 3UG7A 3A8TA 3EIQA 3H4MA 4R7ZA 4LV6A 3A1WA 1BYUA 4TWZA 2W0SA 4Q9JA 3AKDA 3OF5A 2NPIA 3DKVA 1DAKA 4WOPA 3F3YA 4GT1A 5LB2A 1P2UA 1XZQA 1RRCA 3GLHB 3IBYA 4IKEA 2QTFA 2ZUBA 3GJ6A 2FFAA 4EPWA 3TUJC 4LHYA 4UXJA 2JLWA 2XTMA 4EQ6A 4Y0VA 1Q22A 4ITRC 2ZSEA 1XWIA 2OCAA 3GLGB 2DFKB 3SDZA 2Z6VA 3AV0B 2PX0A 4PZYA 3SU8A 4B3FX 3RVBA 3ZVRA 2QMEA 3CUEF 2J46A 1LNZA 4RZUA 2RGCA 2ZROA 4QOSA 3KQUA 3MGCA 1XTJA 2CCKA 2C8VA 4IEEA 4PC2A 5CJ2A 1VG1A 2QAGC 4NMMA 4YMTA 2CCJA 3MFYA 1K8RA 1CR4A 1X3SA 3D31A 1D9XA 3X1YA 2PH1A 1JR3D 4C0LA 3L0PA 2ZI5A 2XNDA 5HE9A 3U7GA 1S4QA 3QVUA 5M04A 2C9CA 3BXZA 1SVSA 3FE2A 2VLIA 4K81B 5E7IA 3CNLA 1Q20A 2K5UA 3QBTA 4TL8A 4LWZA 2AXNA 3EWSA 2IYYA 4EJSB 5F9HA 2V4ZA 2J7PD 1DADA 1V5WA 3A58B 1K6MA 2GJSA 4C3ZA 1VHTA 2MMGA 1VCNA 1A7JA 2DWOA 2RCNA 3EC2A 4US2R 4LV5B 3CR7A 2XTNA 3U44B 1UBGA 3PG5A 1NI3A 2FU5C 3QG5A 3NBFA 4QNMA 2ZS7A 3UMRA 2VSOA 3PQCA 4L4UA 3RAPR 1E1QD 1S8FA 2YV5A 3CPEA 4GP6A 4QM7A 3BBPA 2XJ4A 4ZKEA 821PA 2UZIR 2V7QD 4IFBA 2GF0A 5JCPA 1XCMA 4P0TA 4PSAA 4DT1B 2XSZD 3WBKA 2CK3A 1S3GA 3TVDA 1N6KA 4PANA 4YLGA 5JI3E 3AVWA 2RGXA 1XMVA 4HZUB 3LY5A 4A0RA 3TK1A 3A37A 4HB2A 3LX5A 5H1YA 4HUTA 2OXRA 1T5IA 1F2UB 1XFAA 2IWHA 5EE0A 3TSOA 1G5PA 1XPUA 5H8WA 4H1UA 3NIBA 3QOFA 1MT0A 3EWAA 1E6CA 1Q57A 2XOKA 2GCPA 3BFKA 3I73A 3VR6A 1OE0A 5J4KA 4M4SA 3SEAA 3EZ2A 2BBWA 1G3MA 3G5UA 5KDOA 1QG4A 1G18A 2EFHB 3BB4A 1W0JD 3PR1A 4HDCA 2CHVA 2D74A 4PQFA 5AJWA 1DG3A 1DS6A 3B60A 3KTAB 2BJVA 3L0IB 4IEIA 2QE7D 3VHLB 5JS7A 3GJ8A 4DWJA 5TB5A 5GJCA 3OESA 3THWA 5FTKA 1X8LA 2L0XA 1E69A 4CT4B 4MYTA 2QMOA 2WJYA 4R2IA 3WY9A 3EXAA 4EPTA 1DEKA 2ZQ5A 3KKMA 3QEOA 2CBZA 2EWVA 4TYWA 2G1JA 2WSMA 1II9A 4P4SA 2W6JA 2DY1A 1S0UA 1F48A 3TRFA 4ZIRB 2V9PA 1U94A 2WSSA 4P3YA 1K5GA 4MRVA 5FPYA 4JVMA 3PUYA 4OI4A 3IILA 5FUVA 4G5QA 3IHLA 2ZJAA 2BMJA 4DDVA 4CEIA 2CEAA 5AJYA 4DC9A 1OXTA 2GK6A 2ZRPA 1AA9A 3RABA 3R20A 4K46A 3K9HA 4O2LA 1YZKA 3QE0A 3EZFA 3ECCA 5B58C 1W4RA 3LO5A 4IVQA 4Q7KA 1HUQA 1U0JA 1XJ0A 1TUEA 4LGMA 1MV5A 4PC7A 4QC2A 3U2QA 1GDDA 4UXHA 4V0MA 3R7WA 1E9CA 1DG1G 1E2EA 4JLNA 4QXAA 3UPUA 2QGNA 2OG2A 1AGPA 3LW8A 4WXRA 5C46F 2YKGA 2AFHE 5FL7A 5CLLA 2FH5B 2FOLA 4NONA 2VHTA 3WYGA 4JIMA 4D4JA 1FNMA 1GP2A 4Q7MB 4M9ZA 2ZJ2A 2WAYA 3MWJA 4CEJB 2V3CC 1S2MA 4ACAA 2OCPA 1OHHD 4GSYA 2QBYB 4PPQA 1NP6A 2YOGA 1T3HA 2HYIC 4OHVA 521PA 2RGNA 2XZPA 1DTSA 2O8EA 4M1TA 5DGXA 5AJXA 1G1MA 1QZXA 2V6JA 2XGJA 1NY6A 1ZW6A 3BIFA 1Q44A 4MKHA 2DHRA 4BEBA 5FBRB 3EIHA 2BOVA 3FDIA 4F4CA 3I5YA 5GADl 3T1TA 3VR3A 4ZKDA 1UPTA 1XTRA 3QEJA 4Q1CA 1BYIA 2VSXA 4CRWB 2REBA 5FUXA 3A6PC 5CITA 3ADKA 4TSFA 3Q72A 2YWGA 2NTYC 2CNWD 2IYQA 3U4QB 4IOJA 4FI3C 4JBXA 2CCGA 3QENA 3RSOA 1XD2A 1ZP6A 4JJZA 3QPVA 4JL8A 4TLEA 4Q4HA 1XTKA 2FFHA 2ZRDA 1KDPA 5BN5A 3P26A 4AKEA 4F92B 1NVUQ 3FMPB 2B8TA 2R6DA 4TMVA 2JGNA 4DZZA 1OKKA 2WJGA 3C7KA 2VL7A 1Q12A 1Z6XA 1VMAA 1DO2A 1U0LA 1W4BA 2P6NA 2FZ4A 2FEMA 2ZAOA 4HAUA 2GZAA 1TPZA 4S2EA 4YDSA 2KI5A 1E0KA 4PHGA 2QG6A 1Z47A 2QN6A 4IDOA 4LX0A 2ODBA 3KFXA 2WTUA 2OAP1 2FSIA 2BKEA 5E4FA 1XB2A 4P4TA 2WHXA 1Z0IA 4QHSA 2WKQA 1UFQA 2N46A 3THYA 4G3XA 4FWTA 2P6UA 1GKYA 4M1OA 3LDAA 3MJRA 4NL4H 3TJZA 3SZRA 2VF7A 2JLSA 1GOTA 2F43A 1Z3IX 4PX9A 4DIEA 1A2BA 4KU4A 1JPNA 1LW7A 2AL7A 4KCGA 4M9QA 5JSZB 1E2PA 2A9KA 2J9RA 2QE7A 3FGNA 1KJYA 1TX4B 3K8YA 4OQMA 4GBMA 4H9GA 2J0QA 1L2TA 2VP5A 3C14C 2RH5A 5TY0A 3K9LA 2GRJA 1VIYA 4ARZB 3QPUA 3PUVA 3GLHA 4DEXA 1IN4A 221PA 4HDOB 3TKLA 3OEED 4HLCA 3M0EA 5HCNA 2CLCX 4DB4A 4RCYA 1NKSA 4Q66C 1GIAA 1G64A 4F91B 1E9AA 2CVHA 2PZFA 2X1VA 1II8B 3GLGA 4PXAA 2WIBA 4A1FA 1CTQA 3WP1B 2VTKA 3A1TA 4POAA 4OBEA 1X8JA 4FW9A 3QF4B 4LZZA 2OXCA 4B6FA 2HCJB 4DLXA 1E1RD 1IONA 1NIPA 5IDVA 3RRNA 5FOWA 1UBFA 1XPRA 5CB6A 1O3YA 1YVDA 3NH6A 3WXMA 2F3RA 4U7DA 2PJZA 2W2TA 3E2IA 3TW4A 3F0TA 2W00A 2UKDA 1VDZA 1UKEA 421PA 4BRWA 1NF3A 5FBVB 4ZI3A 2AFIE 4C2UA 4LY6A 2P6RA 1WCV1 1OH6A 1W1WA 4IOMA 3B82A 3AVUA 4PFSA 2NO0A 4KHZA 3EARA 1CIPA 2EFDB 2ZRGA 3TBKA 1D2NA 4PHTA 4C9BA 1GITA 1S3SA 3H86A 5EP1A 4C0BA 1M7HA 5JWOA 4BLPA 3BFVA 2WZQA 3KKPA 4EJSA 2NIPA 4B6EA 2VPPA 1AZTA 3L82B 3SQXA 1J7KA 2QP4A 3CWZA 3QXHA 3NWJA 1BKDR 1XNJA 1VIAA 5FUYA 3TUZC 4MQBA 4EKDA 2KBEA 3U44A 4B74A 1EFRD 4YXWA 1XD9A 2PZEA 3HWSA 2ZSBA 2QY9A 3LD9A 3WYAA 2ZE7A 4LJ8A 4TZ6A 1KOFA 1XEXB 4LDJA 4F4IA 1Z6TA 4ZO4A 1XEFA 3LLMA 4DT1A 3CLVA 3ND8A 4PO9A 3NTUA 1Z0DA 8OHMA 1Q3HA 2RMKA 3EZ7A 2KBFA 3TR0A 5DN6D 3O8DA 2JATA 2FA9A 3IGFA 4HZUA 2VP0A 5AUQA 3RRYA 2HF9A 1F2UA 2GCOB 3SYNA 1FTSA 4JLPA 4E07A 4OL0A 1E79A 4EFLA 2BEJA 1KSJA 1NSFA 3FMFA 4HAYA 1WRBA 1KO4A 4KXFB 1NVVQ 4B71A 4BUJA 4TQUS 5DNYB 3AVTA 1KK0A 4NCNA 4HI0E 4YONB 2EWWA 4C0JA 2D7CA 1P73A 4XIGS 1VECA 1RRPA 4GP7A 5DLQC 5KSOA 3BK7A 1Q0UA 4HLDA 5DE3A 1LTQA 1AS2A 2AWNA 1Q1EA 3W9YA 5DISB 4B47A 2ZI4A 3KTAA 1C1YA 2O8CB 3UATA 3K0FB 1T91A 4NYJQ 3PEWA 5EQTA 1P4SA 4XJXA 1FNNA 4LRWA 1Z2AA 2HUPA 4NDZA 2PX3A 2XXAB 4G1UC 2WBLC 5FOTA 1L4YA 1Z28A 3I72A 1ZC4A 1L8QA 1SVKA 3DM5A 3NXSA 1AKYA 2C03A 4TT3D 4B3GA 4DLSA 4F7WA 1CJUC 1YR8A 1EX7A 2CL7X 1OXSC 4JL6A 1J90A 1OXVA 5GVSA 2YJTD 4NBSA 2JCSA 3QJYA 4ZIRA 4LBYA 4ZCLA 4US1R 4D82A 2FSGA 2NG1A 3KX2A 1KO1A 1T8UA 1ZBDA 3RS5A 2YZ2A 2CVFA 4MDEA 2H8KA 4XD7D 1YKSA 1Z0KA 2GVDC 1TADA 2WJHA 4QNRA 4F38A 2ZUDA 1LS6A 3B1ZA 1E4VA 1Z08A 4DLVA 1G5RA 4ZCMA 3CBQA 2NGRA 1YR9A 3D3QA 3PUXA 5HPYB 1DAHA 1NVWQ 4JLOA 1ZNXA 3OZXA 3R9XA 1WMSA 2C9OA 2OT3B 1ZNZA 4AKGA 2XX3A 1TL7C 4XVQA 3L8ZA 1E2GA 2ZSFA 2P65A 3K09A 3RS0A 1E94E 2J0VA 2ZE5A 4W5WA 3I5XA 3OEHA 2Z4SA 2B6HA 2PEYA 4PC6A 3AVQA 5EXSA 5HKKD 1ZM2A 4B48A 2CL0X 2X77A 4RFSB 1KK1A 1F5NA 4L8GA 3P4YA 5TXGA 4B2IA 4A92A 4A2WA 4IJMA 4NTZA 3WMGA 4MRPA 1RYFA 2EW1A 2O0KA 3C16C 2QBYA 3ADBA 2KB0A 2B92A 1E1RA 2E87A 2FFQA 4QRHA 5BWMA 1RJ9B 2CHGA 3ASZA 1GZSA 1OW3B 2MSDB 3BH7A 3VR2A 1SGWA 4TMXA 1TU4A 4UJ3A 1IXRC 4ZPXA 2H57A 3SNHA 3AVVA 1ZD1A 2VRWA 4Q4JB 1XPOA 3I8XA 3EIEA 1KI3A 2QMHA 3SBEA 2KSQA 3VTKA 4WBSA 1NMZA 1QHHB 4JVLA 1P9NA 3Q3JB 2ZI9A 3BORA 5KDLA 4B3BA 3U4QA 1F2TB 4LJ5A 2H7VA 4Q21A 4A8JB 5UKDA 5J4LA 1IY1A 4UNQA 1CRQA 3DPUA 5KNCA 4LJ9A 2ZR7A 2XEXA 3VU9B 2VF8A 3FB4A 2WMOB 4MA4A 1CJTC 3QXXA 4Q1FA 1P72A 1KMQA 2ZM5A 3GQBA 4DCVA 4D4LA 3IQWA 2P67A 2ANCA 2BCGY 3R8FA 3K53A 4GMDA 1T8TA 1TAGA 4LPKA 4B2PA 5ELXA 5AJVB 2XNDD 4EPRA 4TYQA 4ESVA 2AWOA 3KZ1E 5J47A 1ETUA 1ESNA 1XBTA 2YC4C 2FEOA 3CO5A 2IYWA 3W6NA 3KQHA 4GMXA 1TEXA 3T35A 4CT5A 1IN8A 3G0HA 2ZYTX 2B21A 2FDCA 2HV8A 3T5DA 2JLYA 3SHWA 4Q1DA 1FX0A 3BERA 5BW8A 4C0SA 1UKZA 3AGQA 4RD2A 4Q7LA 2C9YA 2MSEB 2D06A 1CKEA 4ZV4A 4GRAA 4Q5IA 5IF9A 4KLNA 3F5FA 1N6LA 2FN4A 2RGNC 3EA5A 5TARA 4BZQA 4EFMA 3MCAA 5HE8A 2WWFA 4HB4A 3SQWA 3KJHA 1G4UR 1Z83A 4ZDWA 5FTJA 1S1CA 1C4OA 4HAZA 3WRYC 3SFZA 2ZRIA 1ZCBA 1YZNA 3T06B 1W5SA 3ZH9B 4RVCA 1N5JA 5DI9A 1A1VA 4UXIA 3W3AA 5JSZA 3I92A 1DAGA 1FOEB 1F6BA 4MYCA 2OUKA 1KGDA 5FPHA 1RE0A 3GP8A 1VCIA 3QQ5A 1IY0A 3BD9A 4A2QA 2XOKD 5JEEA 4V0LA 4V0ME 2NZJA 4ARZA 2ATVA 4DLUA 1U99A 4LJYA 5DYIA 3CH5A 5KYKA 1UEIA 4IDHA 1KJZA 2ZJ8A 4Q1AA 2PMKA 1GNPA 1W2HA 2KE5A 2WKRA 2RB4A 4XSGA 3U3JA 1KI4A 5AJZA 4PAMA 3RS2A 4I1OA 1GNRA 3CPHA 3GMTA 5GJWC 4TZ0A 3FKSA 3WRXC 3IQXA 3U3KA 3B1WA 5FBWB 3ZVNA 2XAUA 4DDTA 3CM0A 1II8A 1KSHA 1OH5A 5A0FA 3B5JA 4NH0A 2LKCA 1N6RA 1OT3A 1S96A 3KJGA 4Q1BA 2Q9AA 4Q9KA 3QF4A 4JLKA 4MDFA 2OSBA 4GZLA 1P7CA 2WVJA 3W34A 2GJ9A 4BLQA 5IT5A 5KDDA 4NCIA 1KK3A 1YU9A 1JQJC 4C0KA 4DIDA 4EPVA 1KKLA 3CX7A 2ZJ5A 3T1VA 3PV0A 1M7BA 3ADDA 1CU1A 5G3ZA 1E3MA 1SKYB 3H2YA 1OFUX 2QORA 5JBQA 3U7EB 2MSCB 1NJGA 1LS1A 4JKIA 2ZSDA 4A9AA 1ESMA 1G21E 2ONKA 2ZYWX 1M7GA 5HKKA 1W7AA 3UANA 1KI9A 4CVNA 1E2JA 3AKEA 4MKIA 2IUTA 1GILA 5FR2A 1HQCA 3BS4A 3KUDA 3TH5A 4AKHA 3QUSA 3P4XA 4DEYA 2NO6A 4XWKA 1GRQA 3NBXX 3IIKA 3VMFA 1E32A 2BM0A 2AK2A 2Q0HA 4I81A 3VAAA 3THXB 4B2LA 5KTYA 2JLVA 4M0LA 2WWHA 2AD5A 1ELOA 3R8CA 4Q7JB 5FL7D 2BMDA 3L0SA 1NKTA 5KSYA 2O8BB 1RRGA 4IRUB 1XEXA 3EPJA 1G3IA 1NBMD 2F1RA 1TNDA 1GSIA 4FXPA 5FPKA 1GRNA 1H65A 1GRRA 1W0KA 2GEVA 2ZRFA 1T6NA 2Q21A 2ODNA 4LYJA 4PQYA 3GJXC 4XTRA 5DIFA 5B64A 1RKBA 1EWRA 2REXB 4MITA 1XXHB 4LC0A 4FMCF 4NYMR 2GAAA 1JB1A 4BPBA 4Q19A 3WNCA 3M6AA 4I99A 2GCOA 4Q02A 4Y0AA 1AN0A 2NMVA 1PUJA 1YHNA 5J5CA 3CRRA 5KPDA 3G82C 3FOZA 3BJIC 4LCBA 1YZUA 2R2AA 4S35A 1JPJA 1JAIA 2ZI7A 3PEYA 3B1VA 2AHOA 4TSFD 1MH1A 4L9WA 2BHRA 2W0MA 2WJIA 4HZIA 4PPNA 1NY5A 1W49A 3A4LA 4K8OA 4KO8A 1X6VA 1YZQA 1XTIA 5KUTA 2O8CA 3K0FA 2A5GA 1KI1A 4DBLC 3N5CA 2FPKA 1RZ3A 3DOEA 4LK2A 3EC1A 2XXAA 2NO9A 5L3RA 3GLHE 3KXKA 3RYTC 2J41A 5E7JA 4EJSC 2HF8A 3CW2A 4FMCB 4TYPA 1MABB 1L4UA 3BWDD 5CK5A 2ZI6A 4D2IA 4TN1A 1OKKD 4MRNA 3SC3A 4HAVA 2EYUA 1QVRA 3IIMA 3VNUA 2O52A 1N6PA 2CE2X 2VHCA 3NC1C 1Q1QA 2JEOA 2FE4A 2R6FA 4JLAA 3TR5A 3W5IA 4DCSA 3GLGE 1SVMA 3ZD7A 3BE4A 3VFDA 4BRUA 1I4DD 1VTKA 2GXAA 2GAOA 5CDFA 4C2TA 4BZXA 1E9EA 3E70C 1KDRA 1EK0A 1VPLA 1G7CA 4FIDA 2W2XA 1JR6A 5CIQA 1U0HC 5LB4A 1J8YF 2A5FA 1H8HD 3KUCA 3Q9LA 1I4LD 2IYUA 2EVWX 4Q4LA 4ILEA 1CJMA 1XJQA 3JVUA 1D9ZA 3Q5DA 4O0MA 1EFUA 2QMUA 2V8OA 3NHAA 4KAXA 1FZQA 4BECA 5AK0A 4W5HA 1EFTA 1P6XA 2Z83A 1P60A 4L9SA 4URVR 2O8DB 3ZIAA 1GFIA 1T5LA 1K5DA 1UJ2A 2JIZA 4RFSA 2ORIA 2UZ3A 4JBWA 3C5CA 2J0UB 3FTQA 5EXTA 1YRAA 5JZVA 2GF9A 1E9BA 1D2MA 1WBDA 1KDTA 2GHIA 2GKSA 1JAHA 1UF9A 1Z6AA 4KJZA 3SOPA 1GTVA 3DKPA 1RJ9A 3QNUA 4JJKA 2X2FA 3ZVLA 5FTLA 1E0AA 4LHVA 3Q85A 3FFBA 1VHLA 1C9KA 1M6NA 2NO1A 4TYNA 1KHTA 1E96A 3NBZC 4Q4JA 4KYUA 5FFMA 2RHMA 1YZTA 2QRNA 1AGRA 4LHWA 4XOIA 1QHHA 3PEVA 4BEJA 3PFIA 4QBIA 1OPXA 2HT6A 1F2TA 1T0HB 4A8JA 1W36B 3BB3A 3VR4A 2CL6X 3ZZUA 2PT5A 4B32A 2EFGA 3VU9A 3TSWA 3W90A 5FTNA 4LHZA 3T61A 2JLRA 5L3QB 1XU4A 2ZJBA 4PAOA 3RWMB 3V9PA 2IT1A 3EX7C 4PPFA 1WDTA 1KJWA 5LDDC 4G0NA 1X8KA 1B0UA 3ADCA 2IWRA 2QTHA 1S1MA 1P2TA 5E3HA 1KY2A 3K09C 2RGEA 3QBVA 3MLEA 3B9QA 1NBMA 4N1AA 1G20E 5B2ZA 2BBSA 3MD0A 2P2LA 4BZPA 3A1VA 1DVRA 1FUUA 3FPAA 2WKPA 3IUYA 4AIIA 5J40A 3JZMA 1N6NA 2ZRCA 3MWYW 3V00A 5FOUA 3FHOA 4QGHA 2YOFA 4RD0A 4YXWD 4OKSA 1WP9A 2Y8EA 3VNVA 4D0GA 3K9GA 5FH9A 2Q3HA 1E0JA 2RHDA 1JI0A 2GZDA 3IKJA 3CF6R 3IBGA 1FL9A 1VYVA 4JT2A 1FW6A 3RNLA 3LAWA 1KAGA 2H18A 3UMSA 4YMVA 3NDPA 1EFHA 4IXMA 2WWWA 3LQQA 4A0HA 1Q1BA 3SR0A 3UK6A 1M34E 4W7SA 2B8WA 1Z07A 1E79D 3PJRA 3PCRB 5AUOB 4LJ4A 2DB3A 2ANBA 1XEWY 2WM9B 2FGKA 1WQ1R 3EG5A 2IBMA 2ZR0A 4NYIR 4TLDA 2E9SA 2EYQA 1AIPA 2FZLA 2GA8A 3SE0A 3HYRA 3OAAA 3OIUA 5JS8A 1KDOA 3QKUA 4Q1EA 1TF5A 4M2LA 2O0JA 5JMTA 3I4LA 3UXMA 1J2JA 2DCUA 3U6KA 3GLFB 5AR1A 4RKFA 2YYZA 4UNNA 3AF3A 3ZZTA 2HXYA 2W83A 3B78A 1T0JB 2LCFA 2HEIA 3P1JA 4QJ5A 3UG6A 2F1IA 2CMKA 3LV8A 4CZ2A 4PZZA 1CULC 4IHQA 4IOLA 4ZI2A 5FUWA 1H8HA 2HJGA 2N1BA 1KO8A 2G9NA 2AR7A 2IF2A 1CEEA 5KO2A 4NCHA 4JMPA 3S1AB 4HAXA 1P62B 1NMXA 2QAJA 1Z6YA 1Z6GA 3DMNA 3ICEA 1RIFA 5L8VA 2IK8A 2GXSA 3MUFA 4TTRA 2G6BA 4DCNA 2ODEA 2IS4A 3LBHA 4D25A 1JEDA 5IRCD 5FOVA 1DARA 4ZDKA 2C99A 5DYGA 4PR0A 2IUSA 2IW3A 4Q4AB 1EFCA 2ZTSA 2WPDA 1BS1A 1Z22A 3KDSE 4NPHA 1IHUA 4G5GA 1YE8A 3THXA 4AD8A 2ZRLA 1FMJA 1KIMA 4XVRA 3OEHD 1LY1A 2IYTA 2BV3A 1KO7A 1FUKA 1U81A 3WHLA 1AS3A 2O8BA 3NBYC 4FINA 4D80A 3EA0A 1A82A 3MSXA 3QI2A 2IEYA 1ZNWA 2BMFA 2GJKA 3AP3A 3B1XA 1COWD 1QHGA 1VKJA 5CIWA 3WMFA 5HTKA 2OLJA 3I1FA 4C7OB 1IJEA 4A0FA 1XXHA 3FFAA 4BFVA 1OB5A 1A2KC 3CR8A 1RPZA 3K0CA 1XCGB 1JQLB 4KVGA 4DSNA 2ASEA 1OF1A 3WMEA 5C1BA 1CP2A 2VQSA 1ZAKA 1MRSA 3K70B 3B1YA 3W5JA 2WJVA 1M1YE 1DOAA 4JYBA 1ZCAA 1KI6B 3AF0A 1GL7A 4MUAA 1KYIA 2FG5A 3RANA 2A3RA 4E5UA 1N6OA 1PVOA 5D3MB 2X19A 4C30A 1ZNYA 1ONBA 2ORVA 4R98A 3X2SA 5JHGB 1Q21A 2YHSA 1UBCA 2AKYA 2QZ4A 2QPAA 3GJ5A 4UJ5A 2NOAA 3SYKA 4BFZA 1MABA 1GUAA 3SJBA 2O5VA 3LVQE 5P21A 4M1WA 1RFLA 2IHBA 5FI0B 1BIFA 3C8UA 4GOKA 2CLSA 2FF7A 5HZHA 3T1QA 1EWQA 4KFRA 4IVPA 4MGYR 4QKQA 2JJ2D 1YR6A 2BBOA 3EZ6A 2JLXA 3O8RA 2V54A 1E2IA 1Z0JA 4E03A 4CF7A 2JASA 3SN6A 1OSNA 2F55A 5EE1A 4IDPA 2D2FA 2TMKA 4GNKA 4WZBE 1MO3A 2JLZA 2G83A 5DHAA 4DUGD 4UNRA 1GKUB 4TL6A 2YVUA 3C4JA 3EPHA 3NEYA 4WW0A 2QENA 4JLDA 4N0DA 2Q6TA 1QG2A 2PL3A 4XH9B 2H1LA 3REFA 4B73A 2O8DA 2ZI3A 4A15A 4TMZA 2R8RA 1P75A 3NHBA 1ZRHA 2ZREA 3N2EA 4WZAE 3GD7A 1XMIA 2J0UA 1OIXA 4MRRA 1GL6A 3VQTA 1YRBA 1W44A 3BB1A 4URYR 1UM8A 4M9SA 4URUR 1MO6A 2PT7A 2IXFA 1KY3A 5JWHA 3HR8A 5CM9C 4BFTA 4B76A 4DLZA 1AQYA 1XDBA 1R5OA 1E2MA 2GNOA 1HYQA 4IW3B 4WXPA 1G8FA 1X1RA 2P3SA 2HDNB 3W6OA 1RW4A 2FSHA 4QJ4A 1XJCA 5H70A 4C4PA 1R6BX 1R0YA 1KSFX 4PSVA 1A5TA 2SHKA 3FKSD 5K8TA 1X86B 1R0XA 1AS0A 1G17A 1R10A 2B7BA 1KMHB 2ODWA 3LH5A 1L7VC 4JBYA 4OJKA 2VHUA 5FBQB 5EXPA 3ND9A 3UKDA 1HV8A 3FMOB 3IEUA 3AP2A 4O2RA 3RDPA 1N0VC 5KSZA 4D4MA 4RD4A 4P4UA 5F98A 1WB9A 1OYWA 4HEJA 4QBHA 3SI7A 3EPLA 5L3QA 4X8MA 1OH8A 3WHKA 2I1QA 1UEJA 2BVNA 1OV4A 1NN5A 1N0UA 4G5SA 2A5DA 3GEEA 1JBKA 3H1TA 3IPYA 2OEPA 4AWXA 5BN4A 3CB4A 3OE7D 2QQEA 3AF2A 2W2VA 1SVOA 2H17A 2YINC 5FTMA 4Z1MD 3SYLA 2ERXA 1N5LA 2C95A 2VEDA 4V02A 4U00A 3U6BA 3ZLJA 1NRJB 2IXEA 1XCPA 5A5GA 1BH2A 1GNQA 2FX3A 4RZ2A 1PZNA 4JKYA 1COWA 4CEJA 4BQSA 1G7RA 3TW8B 621PA 1VG8A 4UKDA 1G3UA 3GJ7A 3IPXA 4RKEA 4A4DA 4EDHA 2Q9BA 3CWQA 4P31A 1S9DA 1UBEA 3FWYA 5CDFE 4D4KA 4ASUA 4TMWA 2PCJA 5JJKA 5H68A 3HDTA 1M2OB 4NZYA 4QBGB 4AG6A 4Q48A 3SFVA 4EUNA 1XX6A 3CZQA 5DI3B 4B43A 3KQLA 1W0KD 4TL9A 2C78A 3HP1A 1QHNA 5SZIA 3Q7PA 4J0QA 4A36A 4JL5A 4B33A 2Q3MA 4A8JC 1T3LA 1OH7A 4PO8A 5TMPA 2A5YB 1KI8A 2QI9C 4FWIB 4HUQB 4CEHB 2WWGA 3QKRB 4YMWA 4KODA 4NHOA 3CONA 1P61B 3DO6A 3ZJYA 2VA8A 3GLIB 1G8YA 2XZLA 1Z0FA 3OIYA 1NG9A 3AQ4A 1KK2A 4KBFA 2JDIA 3GLFA 1QF9A 5EUMA 2IYRA 2RAPA 2C2HA 1G7TA 2VP2A 2JJ2A 2A7QA 2J59A 3BFXA 3O8CA 1E9RA 5CB8A 2QL6A 4AYXA 2BWJA 3CRVA 5C4GB 4OK3A 1SXJB 1JECA 3QF7A 3ZS8A 5FBLB 1NLZA 3QVVA 3DEFA 3NKVA 1R7RA 1WBBA 3NDBB 1YZLA 4DUGA 3TAUA 4DB2A 3IO3A 4CDGA 4DDWA 2ZJYA 1NL3A 3U60B 4Q47A 2FPLA 4U5XA 5SZHB 1ZUNB 4TL7A 3C15C 1ZU4A 4ZDJA 3S1AA 1Y63A 2RGBA 3NEJA 3TVTA 4QHTA 1FP6A 2ZU0C 1Z5ZA 4D26A 5CK4A 4WAUA 4AURA 1TF7A 1NVXQ 4UQOA 3KKOA 2RGAA 1QRAA 1LFDB 5KPJA 1IQPA 1R8QA 4KFUA 5EP3A 1CLUA 1W4AA 4HB3A 4Q4AA 4V0KA 4I1VA 2XTZA 4YMUA 3QSYA 4B3DA 1UAAA 5BQ5A 2YWHA 2DYKA 1JXMA 1OXUA 2OCYC 1YR7A 5HCIA 1NBME 5BYJA 3ZIAD 3B9PA 5DO9A 3QXSA 2JIZD 2IF0A 4EPXA 4YQFA 5F9FA 4PHHA 1W46A 2Q9CA 1NMYA 3SJZA 2X2EA 4RD1A 2AX4A 1ZIOA 3OIVA 3KFVA 4URWR 4PO1A 4C7OA 4KLZA 3BGWA 1WE2A 3PUWA 2QNRA 1D8TA 2PEZA 1MKYA 4KV9A 4O25A 2J5XA 4QG7A 3K0EA 2OO7A 5KNBA 4DCUA 4KBGA 4DCTA 2OM2A 5C4MA 4JSYA 3I61A 5JEDA 3IHWA 2ZIAA 2QM7A 1HQYE 2GBLA 4JLBA 1GG2A 1N5IA 3SJAA 1G8PA 4D0NA 4MGKR 2G88A 4OHWA 4A6PA 4Q00A 3LVRE 3WNBA 4PZLA 2IC5A 4H1VA 5B57C 3QXCA 4JLMA 2IYXA 2VSFA 1CXZA 1E2FA 2QA5A 2VBCA 4ON9A 2GEDA 4JYCA 4XVUA 2GJAA 3L0OA 5IK2D 1KI6A 4Q9HA 1LV7A 4X8LA 4AYWA 4KFSA 3L2OB 3OE7A 5JWRA 1Z29A 5D3MA 4Z1MA 2YWFA 2IHYA 2ZYVX 3LBNA 3SBDA 4DSUA 4MKGA 1WF3A 3TLXA 3TNFA 3VKHA 3EASA 4I1SA 1I4TD 3ZQ6A 3MAAC 3AUYA 2VYFA 3VKWA 5SZJA 1PV4A 4IDNA 2NO7A 2VIIA 2OBNA 1HT1E 2IS1A 1SZPA 1UADA 2YOHA 1NN0A 4FCWA 1E9DA 1W2GA 3BH6A 121PA 1PJRA 3UMFA 3AM1A 2PLRA 2P5SA 2FSFA 3SS8A 1GM5A 3HU2A 4TMKA 4Z8YA 2IXGA 3RS4A 1MO4A 3P27A 4Q03A 3U3OA 4FCVA 5CYOA 3VR1A 3ZDQA 4BFWA 1SXJD 1IN6A 2OESA 1U98A 3HPQA 2QUZA 5AWFC 2DFLA 1SKYE 3ZQJA 1E9SA 3NH9A 3K0CC 1FPMA 1G19A 1GAJA 1XMJA 4KYIB 2RGDA 3FHTA 3NVAA 5SZKB 3EZ9A 1R0WA 4WVFA 5DSZA 4B3XA 4GPTA 1BO6A 4EIWA 4I1UA 2ZAMA 1ZC3A 3E5HA 2R62A 1SVLA 1CRPA 2OE2A 2G0TA 2OFWA 5CLQA 4M53A 1E2HA 4LPSA 2CDNA 2GWHA 2QAGB 2HLDD 1FTNA 3I32A 4HLUA 3J81k 4BFYA 1OIVA 3KB1A 1PLJA 1OYYA 4L15A 4RFVA 2NQ2C 3RRMA 2GDJA 4EPYA 1EG7A 2WOOA 3OAAD 1KNXA 1XF9A 2REOA 3TIFA 3ASYA 5L3VA 3LW7A 1E9FA 1NIJA 4DVGA 3CF0A 3LXXA 3O8BA 4LJ6A 1FP7A 2A78A 5TV2A 2O8FB 2C77A 1BMFD 4D6PA 2BM1A 1XXHE 1E2QA 1GWNA 4Z54A 1II0A 5FOXA 1KMHA 3AH8A 2YC2C 1M8PA 4C0HA 4Q01A 5JI2E 4HB0A 2AKAB 4RZXA 1E99A 1JNYA 4Q9IA 4BFXA 3MWLA 1CR0A 2OAQ1 4V0NA 3I62A 3D7MA 4LYAA 2PCLA 4IFEA 1OIWA 1G7SA 3RSLA 4AC9A 2W58A 5IHPA 3ICQB 2ZRMA 1US8B 2IA5A 1IXSB 2JJ1D 2OV2A 3KXIA 1I2MA 1BOFA 2I4IA 2HXSA 3A4NA 1U9IA 1N3BA 1S9HA 1SVWA 3AB3A 2ORWA 4LHXA 3KQNA 2FFBA 1IY2A 3PUZA 4IXNA 3TQFA 5K8IA 3T34A 1DPFA 1NN1A 1AM4D 1OLOA 1W47A 4OHZA 4HAWA 4QFMA 1E2NA 4A6XA 2ZUCA 1EXMA 3KJIA 3U5ZB 1TQ2A 4GI7A 3VX4A 2A5JA 4R71A 2FMXA 5FOSA 1T3SA 2H16A 2I3BA 2WPDD 5CJPA 4PSKA 4XWAA 4RD3A 1H8ED 4OI0A 3K0AB 1W5TA 4MUBA 2X8AA 5AUNB 3T1OA 2OFOA 2ZS8A 4N3NA 1QHSA 1KZGB 2NZ8A 1ZD8A 1W4CA 1N0WA 3M4YA 3WBJA 4E09A 3R9IA 3CNOA 1OB2A 4M9XA 4MYHA 3IO5A 3TMKA 1TU3A 4JVSB 2BDTA 1TMKA 1XZPA 2GXUA 5DI3A 2IYSA 5IK2A 3D6TB 4DJTA 5KU1A 2ZETA 4CGZA 3DDCA 2PLFA 4JLVA 4R9UC 1NVVR 4CIDA 4XWOA 1P2VA 5LD2B 3B2EA 4LYHA 2XZOA 3LQRA 5G3YA 5J4VA 4LJAA 1NLFA 2IYVA 4II7A 5JCZA 1JXOA 1D6JA 3PIRA 5LD2C 1W36C 3OIWA 3KB2A 2G1KA 4R2HA 3CRW1 3FHCB 3TUIC 3ZYCA 4AI6A 1TQ6A 3C5HA 4BFUA 1ZM9A 4HUQA 5KNDA 4CEHA 4RJLA 3QKRA 1IOZA 2OLKA 3LNCA 3GLIA 4IVRA 2ERYA 4NYJR 4F4JA 1CR2A 1G8GA 1VG0B 1X1SA 1JALA 1Z2CA 2F9MA 4W9MC 3KQKA 2XNSA 2C98A 3P32A 1QDEA 3A4MA 1E4YA 1D5CA 3GJ0A 2VHQA 2A30A 5JECA 6Q21A 1R4AA 4PHFA 2CLDX 1OXXK 5CM8B 1TUIA 4LV8B 3HU1A 1SXJA 1DBSA 2Z5FA 2BCJQ 1HA3A 3M1IA 3CRQA 1O87A 1RVDA 4C0AC 2GETA 1P9RA 2WWXA 4B75A 1R5BA 1AQUA 2HYDA 3AP1A 4RSGA 1R5NA 2AK3A 2DFNA 3C41J 4NCKA 5E7MA 3HPRA 4OI1A 4LBZA 1KAOA 3THOA 3ONWA 3AGPA 3LFUA 4PC3A 3QKSB 1B23P 1KTVA 4KITB 5DHFA 4GZMA 1FFHA 3V4RA 2IYZA 4G01B 5TDHA 1TTTA 1IXZA 2VP6A 2J0SA 3CKLA 5HR5A 2F7SA 4DSOA 4PQRA 5GVRA 2RGGA 2HLDA 3CNNA 1ZM7A 3MG9A 2GEUA 1DAIA 4Q18A 3ZD6A 1JJ7A 1QBKC 4LUCA 2BBTA 5C18A 2AN9A 2F1HA 3F8TA 4HYYA 1JR3A 1HE8B 5GJVC 1DELA 1FMLA 1N6IA 2AXPA 3JVVA 1G3QA 4AK9A 4TYYA 4A82A 1HTWA 3X1WA 1G291 2IEZA 3Q8XB 1ZVQA 2JA1A 4RD6A 3IEVA 1P3JA 3AVYA 4P32A 4DLTA 2H92A 2ZR9A 5D3QA 1BMFA 2V1UA 1OFIA 4LYFA 1IN7A 2VH5R 3DZ8A 4B34A 4GL2A 5DH9A 2J7PA 3U7HB 4M8NE 2OZEA 2D62A 3FKQA 3U3MA 2FWRA 4XSHA 4B44A 3L43A 2BC9A 3GEHA 4B35A 4DLRA 5L3SA 3RHFA 1YJ5A 1N25A 4GOXA 4QJ3A 1UKYA 4QHYA 1DAMA 1E1QA 4MYUA 2IYLD 2ZANA 5JRJA 3Q5EA 1XTQA 2JJ1A 4M1MA 1UKVY 2FGJA 2V7QA 2ZRJA 2XSZA 1VCMA 1EGAA 5EE5B 2WIAA 1FX0B 5EP4A 4NP6A 2ONJA 1W36D 3EPKA 2D7DA 3VR5A 2C96A 2VP4A 1NLYA 2GILA 2CE7A 1OFHA 3CIOA 3KL4A 4LI0A 4TLAA 2BEKA 2VHJA 4OJQA 3PEUA 2MMCA 2Q3FA 5E95A 4E22A 3V4FA 2XITA 2WJJA 4TQAA 2Z43A 4NYMQ 2GESA 3DMDA 2GJ8A 4HLQB 1UDWA 4FCTA 4NKRA 4V0OA 4BFSA 1U8AA 2D2EA 2LWIA 3GEIA 1PLLA 2QTVB 2ZE8A 4WZ6A 3NC0C 4A2PA 2JAQA 3GLFE 3W3ZB 3OHMA 2GVZC 2XB4A 1H8EA 5LPNA 3FMIA 1ODFA 1QHIA 1W0JA 3AEZA 5G40A 1DO0A 2RKOA 1G41A 2D4HA 1F3OA 2E1RA 1U90A 3BC1A 1MO5A 2O0HA 4P33A 5EP2A 3WNDA 2EFEB 2BKUA 5LBIA 1SHKA 1SKQA 1N6HA 2J87A 4LOAA 1ZYUA 4HATA 3QG1A 2BJWA 2J3EA 1T9HA 2CJWB 4PPGA 1PUIA 1Q1ZA 4OHYA 2R44A 4TMTA 2G3YA 5B30A 1CF4A 4JZKA 3QIAA 5JHHB 2P0EA 5KOYA 2R65A 3CZPA 5EE3A 4MGIR 4ABYA 1CJVC 2C5LA 5FI1B 1Z63A 3AVPA 3DL0A 1IJFA 4OK6A 3GFPA 4ASUD 4IDQA 2GBLC 2QU8A 3QY0A 4U02A 3B85A 4DLYA 5JFGA 2BIFA 4URXR 3K70C 1WXQA
chains in the Genus database with same CATH superfamily
4L16A 5I8ZA 1Z06A 3LIIA 4I9GA 5D5HA 3W6PA 1Q0QA 4D46A 3IAS6 1WVIA 4OM8A 1RXWA 3CV3A 3RIMA 1SQFA 3IUEA 1LK5A 4KVAA 4L0CA 3KXLA 2D1TA 1ZUHA 4IGAA 4OHXA 7YASA 2QAGA 4JI3B 1A50B 1RZRA 4NY1A 2QHXA 2KW5A 3AR6A 1I2DA 5HP4A 1SBHA 1M2NA 1FQKA 3K5HA 4ZP1A 4GXNA 3L92A 4D81A 3I0NA 4PXSA 4FYYA 3EUEA 1FS6A 4H7DA 4RMHA 5A6VA 5IX8A 1TECE 3FYHA 3V8NA 3ZXIA 3WLOA 3U56A 1H5UA 4JXZA 2WEKA 2F6RA 2AJTA 2VP9A 4R1TA 5DNCA 2I7XA 2ZPTX 3A36A 3HVIA 4LOLA 4BLSA 2O8FA 5JAMA 3GJ3A 1NFQA 3HVKA 2A0FA 2H4ZA 3G2QA 2O54A 1RC8A 1SY7A 3GFOA 3OU6A 5B7PA 1YCHA 4EGSA 5J5VA 2O2XA 1LF5A 3L9WA 1KZ7B 4ALJA 1GT6A 5B55A 4B79A 1F60A 1YOVB 4IO0A 4PC1A 3WYCA 2D3WA 5E0KB 4Z4HA 1C7RA 1AVTA 5CDGA 3BWVA 5CYGA 1YT5A 1V5GA 2ZVPX 4EARA 2BFEA 1G5TA 2HI0A 2OCXA 2DT8A 3LUBA 4FLEA 1ECLA 4FMBB 5SICE 1XRJA 5JFTA 1OBOA 1PK9A 2P69A 1RJGA 4RSHA 3IAM6 4EFNA 3UMCA 3L4BA 2QRZA 1KFBB 3NTLA 4XIYA 5FORA 1YFKA 2C59A 3RS3A 5JROA 2YFKA 1ADBA 1J8MF 2NZWA 4FVTA 3QKTA 4XX1A 4L8LA 1JXQA 1P9LA 3FVRA 2Y4OA 4NBVA 4BASA 3CN7A 3JYQA 4JJEA 1O96A 1YVPA 1L5HB 3R9WA 4L8WB 5M34A 2LVBA 2EATA 2QPTA 3UKJA 2X8LA 5FA8A 1YJ8A 3WL7A 4ACBA 1HE1C 3HR7A 4HLUC 5ILOA 3QLTA 1RJDA 5GJBA 1GZ7A 2YN0A 2OBFA 4YO8A 3S2ZA 4AKTA 1YRWA 4DFDA 4TMFA 3HB0A 4JSTA 4IYJA 1L3CA 9MHTA 4MUNA 2XOXA 4TUYB 2LBPA 3EA4A 4JB3A 3TZBA 2BGWA 1XLTA 2VH1A 3NM5A 2DMRA 5C35A 2C88A 1FZTA 1CB7A 1ZK3A 3TLKA 5B7QA 2QSZA 3ENKA 4AP5A 1DNPA 1NQVA 5IM5A 1C4XA 2HK7A 4CM6A 5FI3A 1INLA 3DNFA 1JLHA 3GEPA 3LUKA 4HS9A 1V0JA 1UXOA 3ETDA 3OOYA 3OQOA 3AL2A 4AJ2A 3ELWA 3U61B 4P92A 4C01A 2YN4A 1UBKS 1PL8A 2ZT5A 1TQDA 2QWXA 4HEQA 3FTEA 1H94A 3MJHA 1NF9A 1YU6A 3NB0A 2WF6A 4NEHB 1CBUA 1CS0B 1H1DA 4Z7JA 5ALTA 3NIWA 1H4SA 2B4RO 3DZBA 4XUGB 3FPGA 1V7CA 3PX2A 4C6TA 1KORA 1WKCA 1VG9B 2EWMA 2R8ZA 3KZKA 4UHEA 3UXYA 4F2WA 3J7AC 4YUZA 1VLZA 2R6AA 3RWOA 2HWWA 1BS9A 4I6EA 2X13A 4HH3C 2BR5A 2IHUA 2F4VB 3A9CA 5AKGA 4CKCA 1KPIA 5GM1A 1B1AA 4ZV7A 5F2OA 4CM5A 3HLTA 3HFGA 2PWBA 3OX2A 1FNDA 2IKSA 3QEBZ 1LDYA 2BR3A 2DSTA 4Q34A 4QYTA 3WFIA 4WCFC 1ODKA 1C7FA 4AN4A 4GRDA 1QV7A 4BUJA 4N0EA 2GERA 1ZD9A 4I08A 4DA7A 4JT4A 3PVSA 1HEIA 5JJIA 4TKUA 4G26A 2A2ZA 2IPXA 4C3VA 3QUQA 4Z51A 2ZU6A 1I7LA 4M22A 2FNAA 3AU8A 4RHCA 3GG2A 3L7JA 3B3FA 3WWZA 1XQ9A 2IX3A 3UBTA 2O8VA 2H0AA 1BXGB 2EIHA 3F2IA 1LPPA 2DQYA 2IYAA 3MWGA 2AMVA 5BOVA 3RJZA 3THWB 3AVOA 1UANA 3RUEA 5EE9A 3RRZA 2ZRKA 2ZFUA 4LJ7A 4W5JA 1GKIA 3C7DB 2I7TA 3CRMA 3JZAA 1RQ2A 3NG1A 4FK8A 2GK7A 4QFDA 4PTZA 2W6ZA 2F2TA 3CVJA 1USIA 3D0OA 4Y2TA 5BN3A 1HRKA 3WSWA 1CY4A 3ZW7A 2QR3A 1JEEA 3GPLA 4G86A 2HU7A 3ORQA 4F93B 1YR2A 4ER5A 1I01A 2QZ9A 3Q6NA 1PP4A 1T24A 3CX6A 3MWKA 2JVJA 5CT8A 2BEVB 3K31A 3SSAA 1GXSB 1DPGA 3JASA 3K6JA 1U7XA 3QVMA 3R3VA 4RJIA 1LQTA 5LZ5A 2LKDA 4PHCA 3KJEA 1UEXC 1E5QA 5DWDA 3MRSA 3REGA 4R1UA 4G67A 4HWPA 1V95A 3A1FA 5DF1A 1XZMA 2VT7A 4GI5A 3E23A 3GGPA 5ER9A 4BNYA 4C5AA 4CYMA 4DAOA 4IJ5A 2YWEA 4PG4A 4AWAA 4CM3A 1CDOA 4O4JF 3S40A 2ZWVA 4IBOA 1YDMA 2W6IA 2GYWA 2H5EA 2HNAA 3WO1A 5MHTA 4WBNF 4GX1A 3OVMA 1X1TA 4MVXA 3FVQA 3STTA 4DRZA 3K0SA 1T9GR 2XQVA 1XQWA 2XUHA 3IR7A 5TS3A 5I8WA 1KOGA 1UJ4A 1T4MA 2HV9A 2MJLA 2L17A 3JQ7A 1T4CA 4FDLA 2HZ7A 5JDIC 1QF6A 2W6OA 2LUOA 2QQFA 3VKVA 1Z8FA 3HN6A 3R7WB 5CBKA 3PFCA 2PE5A 3WLIA 1TF2A 1ISHA 2IODA 1ZIPA 2VYVD 3DWEX 3S2IA 1EFRA 2QG9A 3RTGA 5L4NA 4RK1A 4FKMA 5DTEA 5H4GA 4DDUA 1TJNA 3KPWA 1OVGA 3PDHA 2GCNA 1U8YA 3FCEA 4FUTA 5F21A 4EEKA 1EWYA 1DAFA 1SKBA 5G4LA 1R8SA 4OI2A 5J2UA 4K0RA 1K98A 1YJQA 2ZRQA 3M49A 2GD0A 3QWFA 4KI0A 3VI4B 4UDOA 2W22A 5BQ3A 2YYSA 1JVSA 4KSBA 2RBGA 4KL8S 1M83A 5C1OA 3LGAA 4OYYA 1PZEA 4BV2A 1SQ5A 2AE2A 1BMTA 1M10A 3RIYA 2B5WA 1FU4A 3X0DA 4IDGA 1V8DA 2D0IA 2HFJA 4WXYB 5TRTA 4BKQA 3GLIE 2P2YA 1BNCA 1OH5A 2ZEJA 4BNKA 2DAPA 2QPOA 2ZJOA 4TWAA 3WQRA 1FFGA 1MTZA 3KJQA 4BWVA 2A35A 2CK3D 4CF6A 3WC4A 3RC8A 3MRVA 4Z4FA 1Q77A 5AW8A 1E63A 3WZLA 2FQQA 4CMHA 1BCRB 3ITNA 3CPSA 1KBOA 3K2QA 1E5TA 3FYCA 3CSSA 1QYVA 5G53C 3UJHA 2E5WA 3QWIA 2V6IA 2ZRHA 2AN1A 2YNMA 4FKBA 1XPJA 1IM2A 2JAUA 1VB5A 2BP7B 2CXTA 3NYRA 5F4ZA 3HB1A 2QT1A 1G8HA 1XZKA 4LZOA 2XB2A 2CJWA 1AKEA 1LBTA 5EPOA 5JALA 1GRVA 1M74A 1Z4MA 1I4EB 3SE7A 4AZ3B 1E5XA 2Z56A 3CJQA 3HCFA 5JLJA 1XU9A 2GI4A 4P1ZA 4H0CA 3ZOKA 4E32A 3IVXA 4X7MA 3WFJA 1YQQA 5AKEA 5GAJA 5LXTF 1KP2A 2JBAA 1NPTO 3S2SA 5FHRA 4RW0A 3MJDA 4G0UA 2V9ZA 1SCUB 2BI7A 4WFKA 1CUUA 3FYUB 4LWOA 3ID6C 1GV1A 2FJUA 4FMDB 2QT0A 4FZVA 3HSYA 4R4JA 4PTLA 4J0CA 1V43A 5C52B 4X97A 3K9NA 1KSGA 1KS9A 5HFNA 5BXQC 3KHTA 2HBYA 3KKKA 5A3SA 2H85A 2PZLA 2ZUSA 4RY2A 3G6WA 4QSHA 2WWRA 5DM1A 2ZJ4A 2CBGA 3LLUA 4DILA 1P0QA 3FH0A 4BCCA 5AKLA 1XF1A 2EW8A 3H0EA 4J0FA 4I4LA 3L3BA 4RVUA 4DCGA 1G2OA 1O8CA 2N42A 2NV6A 5ECYA 4N9WA 4JOCA 4YDQA 4IILA 2O7SA 2GN6A 2V03A 1S2IA 3HP7A 4JP1A 4ZYYA 1A9XB 5BR4A 5EIBC 3UG7A 3N7TA 5KIAA 5K3CA 5K09A 1V8PA 3TO5A 3SF8B 3PUIA 3RJMA 5JAOA 1QSGA 1Y1TA 3KZVA 4BNHA 2JD1A 4O4IF 1LPAB 3DL2A 2NO5A 1RAFA 5BYBA 3DKVA 2ET6A 3DV2A 4FGUA 3V4OA 3WK8A 1OUMA 3MWFA 3TX2A 3KT0A 4WOPA 3RFUA 3VYRB 3W3AH 5IZCC 3VNAA 2Y1CA 3BHIA 5K8VA 2X0RA 3LCVB 1RRCA 1YOVA 1AY0A 3IBYA 4IKEA 5FADA 5F7JA 1L4BA 2G9RA 3ESRA 3D5TA 2OQRA 4G07A 4GPAA 4UXJA 4C4RA 4IGFA 5D7NA 2CFRA 4MCIA 1IQUA 4JYMA 7ADHA 2C5FA 2ZB2A 2PIDA 2ZSEA 3I9FA 4CMAA 3VA7A 5DWVA 1TKCA 2P91A 3OTOB 3GLGB 1JAYA 2ODTX 4DEVA 1ILEA 3JD2A 4KRXA 4M99A 4F2HA 1KXZA 4H59A 3KKEA 1UZAA 4LAFA 1YS4A 2AB0A 1LNZA 3B5EA 1SC4A 2FEAA 4FGZA 4JI8B 3BGIA 4X84A 5F4BA 3DHEA 3JQQA 1L5HA 2CCKA 1KP9A 3O8OB 4W9NC 2WQ6A 4O8ZA 1DC6A 4IR7A 1YB5A 1YIOA 3FPJA 3DTYA 1WZUA 2CCJA 3K4PA 1K8RA 3UGJA 3MUEA 4Z53A 3BRWA 3D31A 4NMWA 4DIUA 1ISMA 3I6MA 1SPBS 3KHSA 2XNDA 2OK8A 4YP7A 1J1ZA 3GWZA 3KAJA 2JAHA 3KQPA 4IH1A 4JLSA 1PGQA 1SVSA 4K05A 4TUYA 2VF2A 4P3PA 2C97A 2XMSA 3DMGA 2YV2A 4TL8A 1I30A 2AXNA 3EWSA 4S3MA 4KR6A 2J7PD 1I2CA 2I4TA 2YHBA 1NV8A 3A31A 3L77A 2GJSA 3H1PA 1JG1A 3C45A 5FBKA 4C3ZA 3C6QA 5KNLA 1RABA 1YNSA 2OV6A 3S1SA 2XTNA 2H63A 2VJAA 2B82A 3QG5A 1NI3A 2FU5C 4ZHQF 1MX9A 3NBFA 2ZS7A 1OYOA 3RAPR 2PKWA 1JL3A 2ZB8A 3CA8A 5F2NA 1BVUA 4CLEA 1CS0A 2IHZA 4H16A 5J1SB 4IFBA 2GF0A 1U2PA 4P0TA 4XJTA 2I9KA 2CF5A 1YZ3A 2Z5LA 1BH6A 1J8FA 1RQPA 3BSYA 3C2QA 4K6FA 4PANA 4Y9RA 4YLGA 5IJAA 1CUXA 1PT8A 3TCNA 3TK1A 3OWXA 5H1YA 2OXRA 3K1AB 1F2UB 1W96A 2O0LA 4LDQA 3A9UA 2Y0DA 3F97A 3HJCA 4R9NA 5CB4B 4RELA 3WJ2A 1MJGM 1ML3A 1G98A 3NIBA 1BX0A 3VUEA 1Q57A 3BFKA 2QSJA 5AXDA 2LD4A 4WECA 4XYGA 3O3MB 2NYVA 1DFGA 5IU6A 1WO8A 4IQ8A 3SEAA 4DYDA 1G3MA 5IUKC 4F9EA 2BPOA 2EFHB 1RXVA 4KKVA 2BGMA 3E7XA 4PQFA 1Z18A 2JFZA 4KK3A 1V1JA 5ERXA 1OWPA 1AT1A 3DFFA 5EQFA 2CMDA 2QE7D 2ONYA 1J42A 4MQEB 1BXGA 1Y1SA 4R68A 4R7TA 4DWVA 4GYWA 4GM0A 5B1IA 4RFLA 4KPGA 5GJCA 1EFPB 2A6PA 4G2NA 5CXSA 3THWA 1AKTA 5AVSA 4PN7A 2L0XA 4XGRA 2IV3A 3HSKA 4GKAA 1EP9A 3G23A 1O97D 5DTIA 4R2IA 3EXAA 4BVLA 3TF5A 3V6LA 4DA4A 1KEEB 3KKMA 3QEOA 4MMXB 3VSAA 1A7KA 2I6QA 4RA6B 3WGNA 2WSMA 2IXDA 1Y3BE 3I83A 3IRVA 3OPYI 2E4VA 2QW1A 3BF8A 4QU8A 2BEVA 2W6JA 3LUAA 5BO5A 2CDRA 3GFGA 3TRFA 1GXSA 3ORHA 3BMXA 1GN9A 2A0XA 2GFIA 3PUYA 4QODA 4OI4A 4KXUA 4Y6PA 4UU0A 5FPYA 5I7FA 4G5QA 4IEFB 5F23A 1L8AA 2BMJA 3TW6A 1VGQA 2G1UA 3PT9A 5AJYA 1ID1A 1XT6A 4TV9B 4RJKA 1PWXA 2ZRPA 3FCAA 4H31A 3OMXA 4K46A 1NFRA 4KQ6A 1ZW1A 2OYSA 2WU1A 2FP4B 4OQQA 4F8EA 1XDDA 3CUSA 4YECA 1W4RA 2RAUA 1X39A 3I8OA 4IVQA 3S44A 3SIRA 3WWPA 3L4SO 1TUEA 1VE3A 1MV5A 1WSWA 2C5GA 4KXLA 2WTMA 1GDDA 1PNQA 1QXSA 2CB0A 3R7WA 3TSAA 2X7XA 3U2QA 3W1VA 1DG1G 1E2EA 1EP3B 1PZXA 2AQ8A 4E0BA 3C6YA 1NKVA 3Q3CA 5AW9A 1S2OA 1BAPA 2EFJA 4PICA 3CF4A 4UEKA 5CLLA 4DR6B 4JIMA 4CL8A 1FNMA 2WNSA 1VBFA 1FVOA 4D3ZA 4Q7MB 4M9ZA 4JUFA 2ZJ2A 2E4WA 5SY9A 4EGAA 2FCRA 4XUCA 3MWJA 3EDOA 4DM7A 1S2MA 2V3CC 4ACAA 1S2DA 3DUFB 1BEEA 2M98A 3GBPA 3NHKA 4GSYA 2QBYB 2XDAA 3CEAA 5KYGA 4OHVA 1PD1A 1DEHA 2RGNA 3RVLA 4M1TA 5DGXA 4GZ5A 4OHMA 1JKFA 1S8NA 2VTEA 1C9JA 1ZW6A 3BIFA 4MKHA 4V38A 1JU3A 5FBRB 3A6JA 3WRYA 5CXXA 2ESRA 1WG8A 3FDIA 4GLOA 4J4HA 4Z9AA 1VXOA 4EHIA 3I5YA 2ZGVA 3N59A 1BYIA 2VSXA 4QXOA 4W6QA 1ZPDA 2HU8A 4LSZA 1PX0A 2Q0QA 2ZP1A 5DN9A 2IOQA 3Q72A 1AGYA 4E3WA 1VRCA 1UIRA 2YWGA 4RGBA 2PUBA 2L42A 5THKA 3OLWA 4FI3C 1BCRA 1GZDA 2CCGA 3FM9A 2V59A 1A69A 4N82A 4RSRA 3DBIA 1JWBB 3MS2A 3VZBA 4BJ3A 3HXOA 2VCYA 4I4TF 2OV8A 4TLEA 4ONEA 2BP7A 1VJ0A 3NFYA 4TX1A 3GA5A 1FFCA 4FLMA 5CNKA 2ZRDA 4FJ1A 3SX0A 2ECQA 4XXHA 1X7YB 2P5YA 2Q4BA 3G8BA 3NV9A 4Z0HO 4AKEA 4JUIA 4AZ3A 2WILA 1Q14A 1RR6A 2IHKA 1PT5A 4OQZA 4ARSA 2JGNA 1EJ6A 2HNBA 3BWYA 2JG3A 5EESA 3ZZMA 1H2WA 1SCIA 1W581 1VMAA 2VK2A 2FG7C 3ZHZA 1DO2A 3UHPA 2FUEA 1U0LA 1W4BA 4M37A 2QE6A 1H6CA 3KR0A 1SCUA 1I4OA 2VNAA 2ZAOA 1I3NA 3FYUA 2H1HA 3HYNA 4HAUA 3HO1A 4S2EA 1ISFA 4FUQA 4TKZA 3VUFA 2CNLA 1XYVA 4XE5A 2GBPA 2JLAA 2QG6A 2W93A 3LTEA 3C6MA 4R9SA 4K3VA 2QN6A 4EG4A 5IANA 2ODBA 4I19A 3USES 4G8BA 4RZHA 4R05A 1LWOA 6REQB 1D7OA 1ZD4A 4P4TA 2II6A 1HK7A 1XO1A 1QTNA 1WXFA 2WKQA 3PSHA 4QHSA 4H60A 1CUHA 2C9DA 2FEPA 2VAXA 2VATA 1YB7A 1S6YA 4RHTA 2N46A 2VJDA 4CKYA 2C8KA 3VVBA 2FUG1 1AZLA 4Q1VA 1JYEA 1CZNA 2IIVA 3JV7A 4RE5A 5LM3A 3LDAA 4HGQA 1GFZA 3TJZA 1TYCA 5IUJC 4BNZA 3QE2A 4K7JA 1A9XA 3RC2A 2YMMA 2ATIA 5JNSA 1U2GC 4MWCA 1M1YB 1JPNA 1NOJA 4RV4A 5C37A 4YP6A 3SF8A 3V4VB 3BTOA 2VJNA 5TEWA 5JSZB 1DV1A 2RC5A 3D4NA 5CJJA 1TX4B 1XOIA 2D2IA 1OU0A 3K8YA 2P9GA 3KHKA 1YFZA 3OZRA 1R8YA 4OATA 4B81A 1Y48E 2VSNA 5A9RA 1AXGA 1DAPA 3H9GA 2QMQA 3LBAA 5CRIA 2ID4A 3ZPXA 1VIYA 4ARZB 2GBIA 3H42B 4UVGA 5CHEA 1NC3A 1YB2A 1NBOA 3TKLA 1WMBA 4UULA 2XCOA 5FV7A 1DGQA 4HLCA 3ICCA 1SZCA 4Q66C 2ZJ1A 4PZAA 3TCXB 1GIAA 4DYHA 4DNFA 3FYTA 3KOMA 5CVDA 4MARA 2B83A 3GLGA 4GMFA 2Q3CA 1DRWA 1PIWA 2WIBA 2JAPA 2NV2B 4EY4A 3WAGA 2VTKA 3GGJA 4OBEA 2DT5A 2FQYA 1BE0A 2X7HA 4M36A 4PYMA 1HE3A 3FJYA 1VE5A 2OXCA 4WOKA 5YASA 1WXWA 2CXPA 3LQ2A 4V3BA 4PRKA 4AO6A 4B6FA 1E1RD 5GP1A 4DLXA 4R69A 4DV0B 1NIPA 5LP6B 3RRNA 4FE7A 5FOWA 2C2GA 2HWUA 5JAHA 1FDIA 5CB6A 1YVDA 3O8OA 2P90A 4N54A 3DTVD 2PJZA 2GD2A 3DXZA 1K3UB 4PX5A 3F8SA 3W04A 4Y3UA 5FPQA 5C7OO 2UKDA 1UKEA 5BNIA 3EZLA 1YA4A 1V35A 3K4HA 4F1WA 1Z13A 2Q49A 4HN2A 4WQMA 1YQ9A 2QQGA 3ONNA 5E2AA 4AUMA 1UUFA 4ZI3A 5A5EA 3F49S 1NRWA 2P6RA 4XX0B 1EXVA 3DDSA 4ZV9A 1CUEA 3M4XA 2EFDB 3TBKA 4XYMA 1CF9A 3FJOA 1AH2A 4MZXA 1RMQA 3HY6A 5E2IA 2AZXA 3G8AA 1YBHA 1TW3A 3T0GA 2R60A 3IH5A 3KKPA 3NP9A 3M3HA 4I5IA 3GPCA 4B6EA 3O7WA 3ZK8A 4ZVSA 3DPSA 1MGOA 1THTA 3L82B 4M87A 4WZAB 5P8WA 1B0AA 1H9BA 1BKDR 1T0UA 1T8WA 1XKXA 2EQ5A 1AV6A 1YVEI 4YT5A 4PAGA 2XODA 1G6Q1 4WKPA 1XD9A 2PZEA 2RHCA 1TQ8A 4ID9A 2ZSBA 5G2OA 3WYAA 2QYHA 3EDYA 4DS3A 3P2OA 2AKEA 2XQJA 3DOIA 4GC9A 2WF7A 1Y82A 3IELA 3VU3A 3RUHA 4OA5A 3MTBA 1Z6TA 4F4IA 5HKBA 4OFXA 2P62A 2Q4EA 3FDFA 3SM3A 4M8KA 1JFSA 4RK7A 4FN4A 1E7SA 2RMKA 4E5SA 4MTCA 4KK4A 5DN6D 2JATA 3V8MA 1Y7IA 2FA9A 2UYYA 5BT8A 1UXHA 3RRYA 1KAHA 2HF9A 1VSVA 4WNYA 1EVIA 4ALIA 3H8VA 2UYQA 3K1AA 1F2UA 4Y1FA 1IBLB 4JLPA 4LRTB 5BPHA 5CB4A 2I03A 2YWCA 5REQB 4B71A 3MJSA 3AVTA 5DNYB 3ECSA 3BD7A 4NCNA 2WW8A 4QLOA 3UH0A 2G9VA 4ENTA 1QVWA 4KE6A 4XIGS 4ZZ1A 1KVSA 1RRPA 4MRMB 2Z6QA 3BK7A 1W25A 3BIJA 4KNYA 3E9EA 3KZNA 1ULAA 4KXYA 1I3CA 4YJ2B 5DE3A 4AM8A 2RI0A 1AS2A 4KTVE 3T5MA 2B8JA 1Q1EA 2VUHB 3KETA 2JHCA 2OCKA 2DOKA 3NMUF 5DISB 4B47A 3PKJA 1LPMA 2ZI4A 5AI4A 2UUOA 1BQ4A 3K0FB 4MQEA 1C1XB 4WE3A 4WNIA 5FA6A 5EJ9A 3QV2A 4UAUA 4DPLA 4DG9A 5C9ZA 1MZPA 4NDZA 3BHJA 2R7NA 1MW8X 2O07A 4Q7EA 5FOTA 4CM8B 1L4YA 1Z28A 3R0XA 3A7DA 3A6DA 3D8NA 1U63A 2PSHA 3SMVA 4FOTA 4EECA 4RHFA 1AKYA 4MXDA 2NACA 4DLSA 1DBWA 3IJPA 2PRKA 3OMLA 1KEEA 2N9UA 1BFUA 3Q7EA 4MULA 4RA6A 3SYMA 1PS0A 1MPTA 3A9TA 3GDFA 4JL6A 4IXWA 4TV8B 4ZT5A 4N01A 5EKXA 1OXVA 2YDYA 3FUWA 3ZTYA 1P5RA 4FHZA 4RH1A 4NBSA 2WY2D 2YQZA 5ALJA 4QWMA 1OFUA 4U3JB 4YR7A 1CZUA 3CF4G 1YS1X 1KO1A 1T8UA 3M81A 1FU8A 2QV7A 3ISJA 4HDKB 1ECFA 1K8YB 3QX8A 3RS5A 5BQXA 3D7RA 3M5PA 4XD7D 1YKSA 4JNCA 2C5AA 1YMUA 3VR0A 2G8NA 1PWYE 4OHBA 3SEZA 5CDSA 1K89A 1LS6A 4TV9A 3UPTA 1LX6A 1ZOOA 4X7RA 4BMDA 1M2VB 3CBQA 1SUWA 1T9GS 5IMBA 3D3QA 3IX7A 3QVKA 4N39A 3N9IA 2IVFA 2G0AA 2FP4A 2Z98A 1A8IA 3OZXA 3G5TA 4NCXA 2H31A 1P7VA 1W8DA 2EL7A 5L3ZA 3SHVA 3WLQA 2OT3B 4AKGA 2XX3A 5IM4F 1K8QA 3ZQKA 3L8ZA 4XGQA 5E1BA 4AVYA 1E2GA 4D9GA 4B7AA 2P65A 3K09A 1E94E 2J0VA 4MDYA 4YRGA 3I5XA 3DR3A 1URPA 4IICA 4BB6A 4KDRA 3QTLA 2O1EA 3DE4X 4G8JA 2A1IA 4YP1A 4E5VA 3C97A 4B48A 5HKKD 2X77A 5IT4A 2HQOA 4XQCA 5ED4A 4RFSB 2QI9F 1DIAA 1KK1A 3AB7A 5D1NA 2WABA 3GRKA 1XDZA 4L8GA 4B2IA 3ZNNA 3M9LA 2O2YA 2WNIA 4IIXA 3CBGA 1WF6A 1H4TA 3BGDA 3DUFA 1EBFA 1NA5A 3MGKA 1RYFA 2EW1A 2O0KA 4K8RB 3ZW9A 2QBYA 1ZY2A 3O38A 2WT4A 3ADBA 3LP6A 3TIIA 3V7NA 3VO9A 2E87A 5FDFA 1DDGA 4PIVA 4QRHA 3DLTA 3ROZA 3O4IA 2JK1A 2C3YA 4KEAA 3E84A 4PEVA 4Y2QA 2I4LA 4FR2A 3VR2A 2IOHA 1KQ3A 1SC9A 1CQIB 1WNTA 4UJ3A 4ZPXA 5EMHA 3H2BA 3KYIB 2OKGA 4II3A 4Q4JB 5DCUA 4UTRA 1XPOA 1R6UA 1SVUA 3LC0A 2G80A 3HEBA 4HHEA 4MPJA 1LI5A 5IW8A 3D4IA 1QHHB 1X9IA 4JVLA 4LMRA 3TBFA 3EIFA 3HP4A 4HUJA 4WPGA 3WB0A 4ZQEA 5C7YA 2YRWA 3L40A 3GC6A 2H7VA 4Q21A 1T5OA 1MC1A 3WICA 3TSYA 3PJGA 3Q6MA 3DPUA 3UHFA 2WUVA 4RKWA 2ZR7A 2XEXA 4NMXB 4MA4A 1TO1E 1CJTC 1NF8A 2DUMA 1P72A 3DLPX 3QXXA 4Q1FA 5ALWA 4D6XA 2ZM5A 1RKUA 1TE2A 2PKXA 4INJA 5A9SB 3NBUA 1DBIA 1QP8A 2FETA 1X7YA 2BCGY 3ODGA 3QYFA 4FQ7A 4GMDA 4NG4A 5CVCA 4F11A 5HRCA 1UP4A 1PGOA 1E59A 1MJFA 3TRJA 4B2PA 4RM2A 1GGHA 1I6KA 5AJVB 3KNZA 1AGNA 1X19A 4GE0A 4ESVA 2B94A 3QLVA 1R18A 1JHXA 2P6PA 2E6KA 3LOQA 4XJSA 4WRRA 3SM9A 2DC1A 1XBTA 2FEOA 2O3RA 1O6CA 2VUSA 2WJ6A 2P75A 1PG5A 3ESQA 4GMXA 4R1NA 3WL4A 3ZDYB 3CXRA 5CA1B 1E5DA 4ZIRB 3T5DA 4AULA 4INPA 4C89A 3AT1A 1TPYA 3W5AA 2C0PA 2HSZA 3DQZA 2X9LA 1MAUA 3GB9A 3UJCA 5BW8A 4JOQA 5JU6A 3TKAA 2AEMA 1OZAA 1UKBA 4RD2A 4Q7LA 1P9OA 2PA0A 2PRJA 2WYVA 2MSEB 3UAVA 3W8DA 1ADCA 4BU0A 1Q0TA 2V96A 1CKEA 6REQA 3D1LA 2J48A 4IGKA 4MIYA 4QT0A 1H22A 1R6TA 1VL8A 4R0MA 1GG8A 1ZH4A 2EARA 2R3SA 2ZYAA 3EA5A 3PRHA 4EYKA 5HUHA 1XMOB 5A0TA 4HNRA 3PC3A 3OC6A 3SQWA 1VLVA 1OBHA 3I34X 3I6YA 5FTJA 3JQ8B 3UV6A 1QKJA 2OXTA 2ZRIA 1TM3E 2XUZA 3RTBA 3TEFA 3F5DA 1Z5NA 2P2DA 1YZNA 3HGTA 3OFJA 1SCKA 1QFXA 3IQIX 1ZGZA 4YAWA 1CB0A 2A1UB 2D2XA 3RYHB 2ES4A 3W2EA 4DGSA 1M1YA 1JHVA 2WLSA 5DI9A 4UXIA 2B8NA 2V6BA 3W3AA 1B6TA 1H2FA 4KN8A 5JSZA 5CVUA 5FA5A 3CT4A 4IF4A 4MYCA 1QH9A 1KGDA 4B7XA 3GP8A 1VCIA 3V8RA 1QH0A 5DLEA 4A2QA 4F5ZA 5CVJA 4YLYA 2MYPA 5JJLA 4XQGA 4WLNA 5EZYF 1PJ8A 4Z0NA 1PDVA 3FTNA 4JJFA 3YASA 4ARZA 2ATVA 1U31A 4LJYA 1UFKA 2ZJ8A 4WKGA 3RFFA 3G9XA 3FSJX 2PJDA 2KE5A 3HG7A 3TQIA 5J2TB 4D02A 4J90A 4HN4B 1NAIA 2A9OA 4DLNA 5AIBA 3RS2A 4I1OA 2XOEA 2QV0A 3U4HA 3F6EX 3ZGZA 3U4MA 3C39A 4NOMA 5KKCA 4YWHA 2DULA 5FBWB 4BQRA 4CJXA 1MLDA 3ZVNA 1KSHA 3F3KA 1Y1LA 3IPRA 3CO0S 3SZMA 1I13A 4NH0A 2LKCA 4PYOA 1S96A 3KJGA 2OORA 1N92A 2JZOA 3M6LA 2V74B 4DDKA 4Q9KA 3E22B 3TOXA 4GZLA 3BL8A 2WTBA 4BVBA 2WHYA 3OM0A 4DV5B 4NCIA 4A2CA 1ZJ5A 2A8YA 1XMXA 3N8GA 5AVJA 4DPMA 1A3CA 5LP6A 4DXDA 4RE6A 2H4HA 4UNIA 1PV2A 1ZXLA 3NEAA 5G0TA 5CD9A 1MEEA 3PV0A 5L4LA 1H23A 2OGWA 2D54A 1CU1A 2XNJA 1XVIA 3L8HA 1MT3A 1NBWB 1ZHOA 5GWXA 2HPZA 2RI1A 3H2YA 2VZ0A 1GTRA 4RY0A 1OFUX 3DAYA 4YFVA 2PYIA 1WDLA 2QX4A 5C8YB 1L7RA 3HBJA 1LS1A 3JW8A 4QYMA 4XX0A 4QGSA 2H9AA 1QV6A 4A9AA 3DE5X 2XPCA 2ZYWX 5BSHA 5MF6A 5JE8A 5JCOA 2BISA 3AKEA 3AIOA 3FWHA 2IUTA 2J3JA 3ETCA 4NAVA 2A57A 2Z3VA 3A04A 4HQRA 1GILA 3C8MA 1PSDA 1HQCA 2M32A 4URFA 3TEMA 3KUDA 3GAZA 2YTZA 4AKHA 3RFCA 2ZXFA 4WZAA 4DEYA 4XWKA 3OX1A 1A96A 3Q11A 4DC0A 5I5EA 1DRJA 3IIKA 4RNCA 4TGLA 5D2CA 1MP0A 3EN0A 4X45A 1IY9A 2Q0HA 1YK0A 1O5OA 2FZVA 3DLAA 4I81A 4M0LA 2WWHA 3THXB 1ELOA 2Z8ZA 3BSWA 2HRBA 5JSQA 1O97C 5FL7D 2IGBA 1P2DA 3L0SA 3H4VA 3OQVA 4ZVTA 3DH0A 2O8BB 3HUUA 1YGYA 2PT9A 2IUFA 2PU5A 2A0YA 3E48A 3NTXA 2VDLB 2NLOA 5JAUA 5DSTA 4HMPA 1SUSA 1GRRA 5EQJB 1O9BA 2Q21A 1P39A 4PQYA 5J9FA 2ADFA 3GJXC 4ND7A 1MO2A 5C3UA 1QIKA 3HCOA 1R66A 4C06A 1ORWA 2GAAA 3N2YA 1JB1A 1GPWB 3MXOA 4HAOA 5ALDA 3UWDA 3M6AA 1TMGE 2O48X 3IOBA 3RWBA 3VPFA 1U7ZA 3GARA 5DP1A 4Q02A 4JGGA 1FF9A 5REQA 1AN0A 2YJ5A 3ZY4A 4ENWA 4MVCA 2I9PA 3PWKA 1PQ4A 1UBOS 3KS9A 4O02B 3VH1A 3B1JA 1BJRE 4HS4A 3AM4A 3JVEA 1G8AA 3BJIC 4F6RB 4MMYB 2C92A 4MCJA 1ZBQA 3CWCA 4MRMA 1JAIA 4S35A 1E6EA 3B1VA 3LGXA 4TSFD 3U7RA 4YJ2A 4L9WA 4XQ0A 2BHRA 2W0MA 5C5IA 3VHXB 2H0QA 3FWNA 5D6NA 4D9CA 1W49A 3A4LA 1N2ZA 4KO8A 1D1TA 2DPGA 4RK0A 1ABBA 2VAMA 4I5FA 4C43A 1XTIA 4FFVA 2QD5A 3K0FA 1C1XA 2Q0XA 4DBLC 4U2CA 4ZI5A 1JIJA 2GA9A 4BJHB 1WTCA 4CTOA 4LK2A 3DUWA 2I8CA 4W82A 4BJ5A 1SIOA 2JHGA 4CM8A 3KXKA 1TQHA 4ZVNA 4KPEC 3MERA 5E7JA 1AUPA 5ALIA 4EJSC 3HWWA 4FMCB 4NATA 2I7DA 1L4UA 5CK5A 4D2IA 4TN1A 1CQPA 1OKKD 3DO5A 3MVEA 4MRNA 3IKLA 1XZLA 3IEMA 1QVRA 3H0CA 4GVXA 5K45A 2O52A 1H3EA 4TV8A 5BNTA 1Q1QA 2QVGA 1XC7A 2FE4A 1HSZA 2R6FA 1JPUA 4LWQA 4MQUA 2HD4A 4YT8A 3VH4A 1VTKA 1DC5A 2FWBA 2WM3A 3D4LA 2GAOA 1XL1A 4QE3A 1CE8B 4R2JA 4U3JA 2GXAA 3HDQA 3GNSA 1KDRA 3KOOA 4HDKA 1GL3A 1ZCZA 2FR8A 1G2PA 1G7CA 2PQMA 3A6ZA 3AHIA 4FIDA 4RETA 5CIQA 5F33A 3PXAA 3P9RA 1QAOA 1CUSA 1J8YF 1P1CA 3JTEA 1RJFA 4ZAGA 1Q7EA 1M2VA 4RABA 5ERGB 5TLSA 1DJLA 3D43A 4N5LA 3TE7A 4ID3A 2FQXA 1GKLA 1ZK1A 2IQIA 3I4CA 4Z99A 1H9AA 4EUSA 2E18A 2DSNA 3G2OA 3EH1A 2HPAA 4EB8A 3LC7O 1MB4A 5DU2A 3NHAA 1XZEA 5FJJA 4FONA 4L9RA 4GPBA 2PUDA 4KAXA 1HWYA 1HE5A 4PLCA 4DBLE 3R44A 1FZQA 4ZAVA 2QTTA 4X60A 3SKVA 4IFIA 4PCVA 3U7IA 1VHWA 1J00A 1EFTA 2CHUA 4DNQA 5FUMA 3HK2A 4NK4A 2O8DB 3NVDA 1ADFA 1K5DA 2JIZA 4ES6A 4RFSA 2ORIA 2UZ3A 1R8JA 4W7HA 4C4TA 4OX9Y 4UMDA 3DD1A 2AEEA 1RI2A 3QFRA 4TRMA 5JH7B 1YRAA 1W5BA 1D2MA 1JSZA 2Y0PA 4JP2A 3KQVA 1L5NA 4U0KA 1RHJA 5JY6A 3LX4A 3PF8A 2CNNA 4KJZA 1SIUA 2BI4A 3DKPA 3SOPA 5DXFA 1H9CA 2HLHA 2UZAA 1FVFA 2COUA 3T7EA 3ZVLA 5FTLA 1SQGA 4LHVA 2C29D 1CQIA 2RC6A 1ML4A 3I2IA 2NO1A 3C3WA 2Q1XA 3K96A 2ONZA 3QE4A 4TYNA 2H51A 3T9CA 3UMVA 3ZDFA 4Q4JA 2OOSA 4J0HA 4Y2UA 2YW2A 1MQAA 1YZTA 2QRNA 4RU1A 2GKGA 1AGRA 1G66A 1DIBA 4LHWA 1ACJA 1QHHA 1YUNA 4KIGA 4XOIA 1AXRA 3JSXA 1KDYA 3PFIA 1G38A 1IK4A 3LJKA 2HT6A