4TL8A

Crystal structure of n-terminal c1 domain of kaic
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
234
structure length
215
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 74
structure length 215
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl8A00
5HR5A 1NLZA 1S3SA 5J4LA 5AUNB 1ETUA 4PO9A 1NSTA 4A92A 1SXJB 1DARA 3CF6R 4M8NE 4ACAA 1Q1BA 3OIYA 1V5WA 4TYQA 2ZI3A 4KITB 2QP3A 2ZU6A 3T1VA 3ND9A 3BOSA 1T3SA 2IEYA 2DHRA 3B13B 4PHTA 3G0HA 2D62A 4V0LA 3MLEA 3IGFA 2G83A 4PX9A 3K9NA 4D4LA 2MSDB 3DOFA 2ZJYA 1IAQA 2C95A 121PA 1AIPA 1KK3A 1U0LA 5FTKA 3C5HA 3THYA 1CR4A 2YZ2A 2IYQA 1XCPA 1Z28A 3FMPB 4LHWA 4C3ZA 1VMAA 2R6CA 4JYBA 4TL6A 3E1SA 3BH0A 5DYIA 1D2MA 4LJ8A 2VBCA 4FMCF 3ADKA 3TBKA 3U5ZB 5AJYA 5K8TA 4ESHA 3EW9A 4TLDA 1W4RA 2CCKA 3HWSA 2B7BA 2NZ8A 4TMVA 2RMKA 5FUVA 1II8A 2XTMA 2WSSD 4HDQB 1YJ5A 4NKRA 3CRVA 3SI7A 4DZZA 2WHXA 2A5JA 4CIDA 4UNRA 3A6PC 4TT3A 2VYFA 2GXQA 1W2GA 2BM0A 3K09A 2WM9B 4GI7A 3HJNA 2XGJA 2JJ2D 3LX8A 3KKQA 2JGNA 1GFIA 3X1ZA 1C1YA 4G5RA 1UKYA 2QA5A 1TPZA 1EFUA 1U8YA 3KTAB 3WYFA 4A2WA 1IJEA 2BBWA 4URWR 4ESVA 2J7PA 4F4CA 5FBLB 2VO1A 3GPLA 1KSHA 1VG0B 3WRYC 4Y0VA 2ATVA 2QY9A 3X1YA 3KQHA 3L82B 4B73A 2NPIA 3L0PA 2IWRA 1XMJA 3KUCA 4WBSA 2EW1A 3QY0A 1R0WA 2VH5R 2RHMA 4Z8XA 4TSFA 4TT3D 1IBRA 2EYUA 2BBTA 2ZUDA 1MR3F 3WYGA 3VHXA 1TU4A 2AHOA 2XITA 1OE0A 3H4MA 4QHYA 1YKSA 1IONA 2IL1A 2PMKA 3CF2A 1WBDA 4B6FA 1KO4A 2QNRA 3EZ2A 2QQEA 5L3SA 1XJQA 2B8TA 4LUCA 1L4UA 3SJAA 3GLGB 421PA 3H84A 1II0A 1NLFA 4JLAA 1KNXA 1ZM7A 1SVKA 4O3MA 4DXAA 3T1OA 1ZM3A 3FMFA 4P4UA 1GRRA 3I8XA 3GLFA 1XD2B 4DCTA 3ASZA 1AQUA 2PCLA 3NBXX 3D8BA 4TMXA 5EUMA 1OPXA 4ABYA 2Z4RA 2EWWA 2IHBA 3VX4A 2ZVPX 1XCMA 4ZDJA 2JJ1D 1EX6A 2HJGA 1NMXA 2IHYA 2JA1A 2WKQA 2V3CC 4HZUA 1E0JA 2FPKA 1UFQA 2J45A 1VKJA 3KZ1E 3UMRA 3U7EB 2YNMA 3BH6A 3AM1A 3BBPA 4GDFA 5IF9A 4LHZA 3C4JA 2AX4A 3RC8A 2R6AA 4Q4AA 1JPJA 1YE8A 3DM9B 5FTJA 3ONWA 3QPWA 2F9MA 1E99A 5DE3A 4Z8YA 1GRQA 5CYPA 4JSTA 3W5JA 4S35A 3CF0A 3CKLA 1KI3A 5G53C 5HKKD 2ZREA 2ZEJA 1AA9A 4Z54A 5L3VA 2FSHA 1S9DA 1GP2A 4RZXA 2C99A 2XZPA 5JCPA 2J1LA 3PUWA 4NYJQ 3UMFA 4ZKDA 1BH2A 1GNRA 4Q7KA 1M7HA 4QC2A 1QBKC 3F5FA 4M1KA 3A1VA 5BN3A 1PV4A 4QXAA 4C7OA 2GA8A 2BKEA 3FE2A 3KJHA 1J7KA 4A82A 1VCOA 1A82A 3ZVLA 1C9KA 5EXPA 3AP3A 4FINA 2J3EA 3CBQA 3I5XA 4JLNA 3SS8A 4OI4A 4YDSA 2IXEA 5L3SB 4YMVA 2P6RA 5EE3A 1O3YA 1P7CA 2V8OA 4HAYA 2NOAA 3K53A 5B58C 1XEWX 3U61B 4IDHA 5EP1A 4KFTA 4KVAA 1OFHA 1JAIA 2J0VA 3IHLA 4GP7A 3ZD7A 4CGZA 1XD9A 2QGNA 2CEAA 2N1BA 3T61A 1XBTA 1UBEA 3K0FA 4TLAA 2XAUA 1ESNA 2W6IA 4V0OA 2N46A 1R8QA 2R62A 4BZXA 3FOZA 1RE0A 1TF2A 2ZRNA 4KLZA 4GNKA 4QFMA 1DAKA 3QG5A 1KSJA 1MO3A 3A4NA 5CJPA 2BEKA 2HYDA 2OG2A 1XJCA 3BH7A 3ZDQA 4Q9KA 3SYKA 5JLJA 1IJFA 2WJJA 2YINC 2GCOB 4Q7MB 3O47A 1Q0UA 4D4MA 2JDID 2JCSA 3O8RA 4LBWA 1YR7A 1EFHA 3GLHE 4L8GA 3LVRE 4JLOA 1E32A 1ZUIA 2XNDD 4CEHA 4KVGA 4NBSA 4Q1CA 2C2HA 3JZAA 4BASA 2XNSA 1N5KA 2I1VB 4YXWA 5EXTA 4EFLA 3BORA 2QEQA 4U02A 4NCIA 521PA 4OHXA 1P2UA 2YOHA 5TB5A 1Z0DA 3KJGA 1ZC4A 4IOLA 3EWAA 1OKKA 2FEOA 2GJKA 1OHHA 3C16C 2DR3A 3LFUA 4A0FA 3F8TA 2WKRA 3VFDA 4WXPA 1E2NA 1SVLA 1P72A 4XIGS 4MUAA 2GEVA 3U7GA 2A5DA 2ZRHA 2REOA 2UVQA 2AL7A 4A15A 2JLRA 1IY2A 4QBFA 4XSGA 2ZYWX 4AKIA 3L0IB 2R44A 1W0JA 4UJ5A 2VP2A 4KYUA 2ZI4A 4FCVA 1W0KD 1X8KA 4CZ2A 5FI1B 1MH1A 2BV3A 4JLVA 2E1RA 3PCRB 4D0GA 2FFBA 2YWGA 4NCNA 721PA 1VIYA 1X8JA 1Q57A 2VP0A 3QUSA 1X6VA 3B85A 4Z1MA 4MDFA 1F2UA 1UM8A 1TF5A 2IC5A 1Q1QA 4MA4A 4L5BA 4V0MA 3U4QA 4Q1DA 4DVGA 3MSXA 2Z5FA 2JJ8A 3MRSA 2IWHA 4AWXA 1N0VC 1XTJA 4NTZA 3GJ7A 5JWHA 3B7GA 2B21A 5SZIA 3KKPA 4CT4B 2PX0A 1JXMA 1US8B 2D74A 3AGPA 1CRPA 2BIFA 3W9YA 3H2YA 1XD2A 2IA5A 3KXKA 2XB2A 4PC6A 2ECKA 4URUR 1EXMA 3E2IA 2X8AA 1YZGA 4TTQA 3K0CC 2QPAA 1IOZA 4EPYA 1Z0JA 2F6RA 2C96A 5FTNA 3CX6A 4JKIA 4R9UC 4NZYA 2BJVA 2ZJZA 1N5IA 4JLDA 2H57A 1T0JB 2Z43A 4RD6A 3RLFA 3VU9B 1NMZA 3SEAA 3H1TA 3R9WA 3BD9A 3LQRA 1D6JA 1ESMA 3AUXA 4DC9A 4F7WA 4URZR 1UBFA 4XH9B 4DT1A 2XZLA 5DGXA 4CEHB 2ZSAA 3CNOA 4TZ6A 1TL7C 1Z08A 4GPTA 4DHEA 3HDTA 3K1JA 3TMKA 1G8FA 4X8HA 4UNPA 1RFLA 2FE4A 3TH5A 1KZ7B 1WMSA 2GRJA 5H70A 1UPTA 2CDNA 3NDBB 2CE2X 3THXA 2D7CA 1KI7A 4H1UA 2WAXA 2MSCB 2C03A 1FPMA 2GCOA 2IX3A 4TTRA 4P4TA 4DSNA 1F3OA 1XPUA 2RGDA 1E3MA 1W5TA 2VF8A 3VR2A 1N6PA 4TQUS 4BFSA 3FHOA 2O0KA 4HAVA 5EP3A 2A2ZA 2GCPA 4PSAA 1OXTA 2WPDA 5FPSA 2E87A 3GJ6A 3FFAA 5DI9A 4IKEA 4D26A 4WOPA 3CW2A 1Q44A 1GKYA 2GF0A 4KV9A 3E5HA 2I3BA 2MMCA 3L2OB 2DFTA 3GEEA 3FKQA 1JJ7A 4CF7A 2IYLD 1N6LA 1R6BX 2BMFA 4WZAE 3Q85A 2WVJA 2F9LA 3AF2A 2CLCX 4LHXA 3GLHB 5JFGA 1GDDA 2A9KA 5E95A 3TUJC 2RGGA 3WY9A 4LC0A 1HE1C 2Q3FA 2QMHA 5CB8A 4OJQA 1P9NA 3VR6A 4D2IA 4RFSB 1WXQA 2ODWA 3KFXA 3SJBA 3BERA 5J4VA 2BOVA 1GTVA 3OIWA 1FL9A 1NG9A 1NKTA 4QGFA 5BYKA 2C04A 1OB5A 3A36A 1E0AA 3QEOA 1QF9A 3CRQA 1ZUHA 4Q02A 5JZVA 2DWOA 2OE2A 3NWJA 4BE7B 4B34A 1Q1EA 2WWFA 1E79D 1GL7A 4DLWA 2ZJ5A 5IK2A 1EK0A 2QRNA 1P9WA 2XSZA 1R8SA 4G1UC 2Q3MA 4DLXA 3U60B 1JEEA 1FOEB 1NG1A 2FEMA 4U00A 2PL3A 3FMOB 3W6NA 2NO9A 2QTFA 2EWVA 2W2VA 1LS6A 5TXGA 4TMTA 4IFEA 1XTIA 3FHTA 1SXJE 1Z6GA 1KZGB 4OI1A 4EPWA 5BXQC 2RGNC 5EZ6B 2GXSA 3CZPA 3V4FA 2ZQ5A 2IXFA 4JVMA 3WMGA 1PLJA 1E0KA 3K09C 1W36D 1D9XA 3KTAA 4GBMA 5J4YA 1XXHB 1AZSC 1CJUC 3FKSD 4N0DA 2CL0X 3IO5A 4OK3A 5EP4A 4MH0R 1KDPA 1EWRA 3HU2A 2FSIA 2NGRA 1AKYA 5JJKA 2R6GA 4AD8A 5C46F 2CJWA 2UKDA 3BC1A 1OFIA 1QVRA 4GMXA 2G77B 4S2EA 4LC1A 1A1VA 4K8OA 2CL7X 5IK2D 1UJ2A 1FQJA 1FP7A 4UQOA 3F3YA 1FMLA 4TL7A 3ZS9A 3EA0A 5J4HA 3NH6A 2AKAB 4B3XA 1MO6A 3R7WA 4LPKA 4EJSC 3W8NA 3LDAA 3ND8A 2A3RA 5JRJA 4QJ5A 5HPYB 2QT1A 3B8HA 4MRNA 1D8TA 5FI0B 3DOEA 3BFKA 4JLKA 5JJLA 2OBLA 4LV6A 1GAJA 4LSGA 2B7CA 4KU4A 1YRAA 2WIBA 4P33A 1KNQA 2NMVA 3OEHA 2QT0A 1Y63A 4C0SA 4KYIB 4MGZR 2ZR0A 5KU1A 3OFND 4G3XA 4DUGD 1ZP6A 2QBYA 5E3HA 1T6NA 4JYCA 2OBMA 1MRNA 1E1RA 3T1QA 4FW9A 4DSOA 2ZAOA 2P0EA 1E2IA 1G4AE 4BECA 5LDDC 1DAFA 3K70D 2JLZA 3CZQA 4ASUA 5EE0A 5FPHA 1VG9B 2AFHE 1TU3A 2IXGA 2XJ9A 2ZJOA 3RWMB 4NL4H 5E7MA 4D81A 4MKGA 3K70C 3NC1C 2IS1A 1NJGA 2YWHA 3GJ5A 3NC0C 1P60A 1II9A 3Q72A 4GOXA 3CH4B 1W36B 4PPQA 2IYUA 1Y3AA 3RRYA 3ZGXA 4NH0A 3SC3A 4PZZA 3ZQ6A 3CRRA 2VP5A 3AKDA 3O8BA 2W6ID 5L3QB 1NN0A 1ZM9A 1CJVC 3BWDD 2PJRA 3VNVA 2GJSA 3CR7A 3PXGA 1KAGA 2I1QA 4GZLA 1H8HD 4CEJA 2VHQA 4PPFA 3TSWA 2ODEA 4HAUA 4LJ4A 2WWGA 5KPJA 3IILA 4WIAA 1E9EA 2ZJAA 3PFIA 4ACBA 4XSHA 2OUKA 5JI2E 4D6PA 2HYIC 1EFRA 1E4YA 5DN6D 1WA5A 4US0R 3PUYA 3SYLA 3I61A 1NY6A 5FPYA 2P65A 4JSYA 4NCKA 1G3IA 2CHGA 1AK2A 3TNFA 1J8YF 2KWIA 3EIHA 1HY3A 6Q21A 3QF4B 1EWQA 4AI6A 4KJZA 1R5BA 2CVFA 2XEXA 1KTVA 1XMSA 5CLQA 3LWNA 3CUEF 2DFNA 5CIQA 3RS4A 3CPEA 1A4RA 4A0GA 3K70B 2NO0A 4Q01A 4BQSA 2J0UA 2R8RA 3IBYA 4D4KA 4RZ3A 3GLIA 821PA 4F38A 3VTKA 1JR3E 4HUQA 4OK6A 4EJSA 5LB2A 1E9SA 2LWIA 3EZ7A 3R8CA 3FWYA 3RWOA 1C4OA 4Z1MD 1DELA 2OESA 3PEUA 5A5GA 3PEVA 2BMJA 4WAUA 3CX7A 3NEYA 4ZKEA 1Z06A 3PITA 1P2TA 2H16A 1Z0AA 3GLIB 1U8AA 1QHHB 3S1AA 1GILA 3SU8A 3MJHA 4O2RA 2ZR9A 2V9PA 4ZIRB 1KJZA 1UDXA 2QM7A 4DLSA 1FNMA 3ZD6A 3JZMA 3SE0A 1RJ9B 4A1FA 1ZU4A 2G1KA 2ZE8A 1II8B 2PLFA 3IKJA 1EX7A 3RYTC 4DLYA 3QKSA 2HUPA 4UNSA 4TYNA 5CDFE 2Q9AA 1XXHE 4R98A 1A2BA 2F43A 3H0KA 1X8LA 4O2LA 1GNQA 3AUYA 3LH5A 1NVVR 4BZQA 1SXJD 4XTCS 3AF0A 2ZETA 5JWOA 4MRRA 1BO6A 1Q21A 1Z07A 3N70A 3A1WA 2VHCA 1GKIA 1NVWQ 1SULA 3HU1A 4MGIR 4C4PA 4XWKA 2GCNA 4TSFD 2ERXA 3D6TB 4B2PA 5C2JB 2IS6A 2O8DA 1ODFA 5HCNA 4IVPA 1Z5ZA 3KJEA 1PLKA 2KB0A 3WBJA 4GL2A 3UG6A 3CPHA 1ZYUA 1K8RA 2ZYUX 3MG9A 1WF3A 2J7PD 2XOKD 1KI9A 1LW7A 3WNBA 1TTTA 2QUZA 1KKMA 2ANCA 4PHHA 4Q1EA 1GRNA 1DO0A 1JALA 1EG7A 5FBWB 5KSZA 1TX4B 2HEIA 3GJ3A 5JEDA 4AURA 1U9IC 3VX3A 4LHVA 1HT2E 2QG6A 5KDLA 2C9YA 3DVLA 1FQKA 1SQ5A 4J0QA 4ON9A 2GBLC 1PUJA 4AK9A 2R6FA 1OB2A 2HXYA 2GJ9A 2W83A 1RRGA 2QPTA 3Q8XB 3ZJYA 1G16A 1KMQA 3C5CA 2FNAA 2OXCA 1JI0A 4H1VA 4HDCA 4BLTA 5EJEA 4E03A 1WE2A 2ZYTX 2L0XA 1T91A 3EIEA 2ZRBA 5FOTA 2ZSEA 2VPPA 1A7JA 4XOIA 2RKOA 4TYWA 2R9VA 1L4YA 3U7HB 3SN6A 1KHTA 3V4RA 1HV8A 4LX0A 3TJZA 3C14C 2WWWA 1OXSC 1EFCA 4AYWA 4RVCA 4A8JC 1P5ZB 2FG5A 3GJ4A 3KKOA 4XTRA 2O8FB 1E2DA 2Q9BA 3EZ9A 1W44A 3CWZA 1OFUX 3K0AB 1G7SA 4MGYR 4Q4HB 2QROA 1OLOA 3SFZA 2GBLA 2A5GA 4IW3B 2NQ2C 3SJCA 2NG1A 3PUVA 3EX7C 1KMHB 2ZI7A 4PO1A 5CJ2A 1TEVA 3TR5A 3LW7A 2ZE5A 1Z3IX 3HR8A 2EFHB 5FFMA 1HH4A 1GOTA 3AF1A 1JBKA 4NYMQ 5JRZA 3ZVNA 4TYYA 3EPLA 2J46A 4PZLA 1FUKA 5CITA 2J41A 3MCAA 5B2ZA 2EFEB 1E1RD 1U81A 4OHYA 4I81A 4PSVA 4A9AA 1E2HA 3TW4A 4Q9JA 2QTVB 1CTQA 1XU4A 5J5CA 3KQKA 3BRWD 1J90A 2ZRLA 3EIQA 3NH9A 2FFAA 1JR6A 1LFDB 1KK0A 1E9FA 3AP1A 3N2EA 4C0KA 3CWQA 1T8UA 1E6CA 2IS4A 4PR0A 2FWRA 3P4XA 4JJZA 1E2MA 5AJZA 3SQWA 4BFXA 2WWIA 2W2TA 3THWB 3THWA 2JLUA 3AVPA 2FV8A 4M9XA 1JXOA 1FTNA 2A78A 1GG2A 2OBNA 1B23P 4GOKA 1ZINA 3BFVA 4V02A 1GUAA 2HF9A 4DCUA 4C30A 4G0NA 3MGCA 4G5GA 1XTRA 3CIOA 5HZHA 2J87A 2CCJA 1NNEA 3WXMA 3JVUA 1Z0FA 3AQ4A 3L0SA 5KO2A 3J81k 3TLXA 3EPKA 2HCJB 2G9NA 2ORIA 5JBQA 1HTWA 5C18A 1U2RA 4OQLA 2GWHA 4RD1A 5CYOA 2WOOA 1BIFA 1OH7A 2AXPA 5GJBA 3TQFA 2JLYA 2JJ2A 2UZIR 4QKQA 1N0UA 1CR1A 3QKSB 1NBMA 4NCHA 4LOAA 3JVVA 2WOJA 4KXFB 3IEUA 2G88A 4K81B 4RD3A 5JMTA 1F2TA 3CR8A 5KOYA 5FBRB 2ZE6A 2QAGB 3UANA 1OHHD 1R2QA 1T4GA 3GQBA 1ZIOA 2C8VA 2C98A 4LBZA 4PTLA 4EPTA 2DBYA 5F98A 3SDZA 4B3DA 2CK3A 2Q3HA 3NKVA 4EKDA 4R71A 3TRFA 3CM0A 1GVNB 2O5VA 2RGAA 1RIFA 4US2R 2P3SA 4RD0A 2EVWX 1Z2CA 3UPUA 1E2FA 1GSIA 3Q7PA 1Z0IA 2F1JA 1VTKA 2V6IA 3QXCA 4MYTA 3P4YA 2BEJA 3EPJA 3PUZA 2CHQA 1CU1A 4WZ6A 2HXSA 3THXB 1QDEA 2NZJA 4LBVA 4ZDWA 5GADl 3DO6A 2FSFA 1F2UB 2VSOA 2AXNA 4Q7LA 5FH9A 1OH5A 2QPOA 4G01B 1XJ0A 5FUYA 2ANBA 1R5OA 4QNMA 4UNNA 4EFNA 2VL7A 3VQTA 1GITA 3NXSA 4DSUA 1WB9A 3VMFA 2QMUA 5GJVC 1KSFX 3AGQA 4PANA 2PJZA 4M2LA 3VNUA 1MABA 4M22A 3RC3A 1QHIA 1SZPA 3VR4A 4ILEA 5DIFA 3X1WA 4AYXA 1SVIA 3VKHA 3CH5A 4Y0AA 4N1AA 2LCFA 1IXZA 4RZUA 2ZROA 2IYTA 4E07A 4HATA 1KO5A 1KK1A 3DKPA 2IT1A 3AKCA 3KFVA 4HB3A 5FOSA 3T12A 4BFUA 2YJTD 2V1XA 1D5CA 3RS0A 5KNCA 3TGPA 1XMIA 1AGPA 5GVRA 3U3MA 2GDJA 3UIEA 3VR3A 2QTHA 1ZIPA 4FMBB 1E4VA 1XTKA 1TNDA 4DLVA 1G5RA 3U6KA 1COWA 1T0HB 2ZR7A 1A5TA 2OLJA 1KKLA 4L9SA 3ZS8A 4DDUA 4Q00A 1QRAA 5K8IA 4OK5A 1ZU5A 2W6JA 4LJAA 3K0SA 1E96A 2J7KA 2RAPA 4XVQA 4YONB 1OH6A 1XEXA 1WCV1 3AF4A 5H68A 3L8YA 1SKYE 3AH8A 1J2JA 1CKEA 3DMDA 1Q20A 2ZRCA 2C9OA 4AG5A 4LYAA 4NMMA 2ZRAA 4QHSA 5FPTA 4WVFA 4B3GA 1DE0A 3R20A 1KAOA 4EPRA 4JKYA 4P4SA 2A7QA 4B47A 1XP8A 5G40A 1W49A 1XPOA 2XJ4A 4Q48A 2BM1A 1DS6A 3LLUA 3ZLJA 1I4DD 4LYHA 4UXIA 2B8WA 3OHMA 1SVWA 3K9GA 3TVTA 3RS3A 5TY0A 5D3MA 1QHXA 3A4LA 3O8DA 3HR7A 5GVSA 1TEXA 2GZDA 2A5YB 2QL6A 1X1RA 5A4JA 2O8DB 1JECA 1ZC3A 2ODNA 1MV5A 3B1YA 4P0TA 1J8MF 3W6OA 2RGBA 2ZM5A 4A36A 3ZYCA 4R7ZA 1DAHA 2CBZA 1DOAA 1G7TA 3VKGA 5FUWA 2YYZA 3QI2A 2BCGY 2FFHA 4XWOA 4IOJA 3P26A 2V54A 2RGNA 3BJIC 3T5GA 2CLDX 2RGCA 3G5UA 4RD2A 3GEHA 5DN6A 3VHLB 4EPVA 1UKEA 3VU9A 3LBIA 4M1MA 2Z0MA 4OKSA 1JQJC 1XCGB 4LDJA 3AVYA 4AY2A 4DDWA 1W0KA 4KLNA 1QHSA 3RSLA 2P6UA 1G7CA 3LW8A 4BRUA 4GOJA 3B60A 1E2GA 3QXJA 1GNPA 4EQ6B 2CHVA 1CR2A 3ZIAA 2P5SA 3EWSA 1I4TD 1S4QA 1K6MA 2XOKA 3GJ0A 3N2IA 2JLXA 4NYIR 4M9SA 2D2FA 2YV5A 2ZAMA 3QJYA 4JMPA 1QZXA 3K0FB 4BZPA 1L7VC 1OV4A 4URXR 3HYRA 1NKSA 4PAQA 4G5SA 3DEFA 1MKYA 1NMYA 2XXAB 1NN1A 4JLBA 3EAQA 4IDOA 4D0NA 3CB4A 1O87A 1TUIA 2PEYA 4I99A 1F6BA 2ZE7A 1OT3A 2XZOA 2GILA 2ZJ8A 2GESA 2ZUCA 4K46A 2YHSA 5DNYB 1E0SA 1SKYB 5KYKA 3TSZA 3QF4A 3SQXA 2FX3A 3B1WA 3K0CA 5JI3E 2OHFA 2QENA 1W4AA 2AD1A 1UF9A 2W0SA 3FFBA 1W36C 4AIIA 4Q1AA 1ZNXA 1T5LA 1HUQA 1KI8A 4E09A 5JSZA 3GMTA 1XTQA 4CVNA 1IXSB 2GETA 1P6XA 3KUDA 1WBBA 4Q1BA 1BMFD 2ASEA 2FZ4A 1SXJA 4NPHA 4R2IA 3VR1A 1ZD9A 4FXPA 2IEZA 4HLQB 3M1IA 1M8PA 5J4KA 1BYUA 2REXB 1OSNA 3PUXA 3ADBA 2OAQ1 2N42A 2WICA 5L8VA 4IDQA 2WJVA 3RNLA 3N5CA 2BMDA 3A37A 4BGDA 1FTSA 2QN6A 5DI3A 1EESA 1ONBA 2YWEA 3U3OA 4V03A 4D80A 3BK7A 4DIDA 4M9ZA 5AJXA 3R7WB 3IIKA 3A1SA 2FFQA 4JJKA 4WXRA 3ADDA 3CPJB 4DBLC 3GJXC 3W5IA 3IPYA 2BDTA 1JR3D 2JIZD 4ZDKA 2C5LA 3SHFA 2O8CA 2X2FA 4A6PA 1T9HA 3TUZC 1OYYA 2OLKA 3AP2A 3SBDA 4OHWA 3MD0A 5M04A 4JLMA 2Z6VA 3KX2A 4LZZA 3OZXA 4OQFA 1N5LA 5E7IA 3QF7A 2V7QA 2PT7A 4Q9HA 1NF3A 2F1IA 1BS1A 1ZUNB 1NY5A 3EZFA 4YLGA 5H1YA 4DIEA 4QGGA 4A0HA 4OHVA 2ZI9A 1XTSA 3A1UA 2ZS8A 1D2EA 4EJSB 1OXUA 2VSFA 2XTZA 4DCNA 2JLSA 2J5XA 1VCIA 4PHGA 3UKDA 4MQBA 5C4MA 2QZ4A 4IDNA 4OQXA 1I2MA 4D0LB 2WTUA 2JATA 1YR6A 4P3YA 4DT1B 4R2HA 4B3FX 1S96A 3ICEA 3OAAA 2V4ZA 4NONA 1VCMA 3NBFA 5EE9A 4AC9A 4KI0A 2EFCB 4OBEA 2BWJA 1QHNA 4L15A 2V7QD 3I72A 4FCTA 1M2OB 5JS8A 3TVDA 1E94E 1N6RA 1NVVQ 2OEPA 4FD2A 3UATA 2BHRA 1YZUA 3WMFA 4C0LA 5D3MB 3WMEA 3FDIA 4LV5B 2REBA 4TMZA 5LPNA 1Z0KA 4JIMA 3K9HA 1FNNA 2DPXA 3VR5A 1LF5A 2HV8A 3QXHA 4PZYA 4RFVA 3FYHA 3RS7A 4PC2A 1XMVA 4HAWA 3TIFA 5JCZA 2V55B 3PENA 2FN4A 4ASUD 1US8A 2DFKB 1OIVA 3CLVA 2OM2A 2FZLA 2P2LA 2YOFA 3G82C 3QENA 5DHFA 1XEFA 4NYMR 2ZJBA 2OFWA 3REFA 3D3QA 2VA8A 4I1VA 1XXHA 4A2QA 5KDDA 2FGKA 5SZHB 4QNRA 3WHLA 1KGDA 2FPLA 3LO5A 2O8CB 2SHKA 3DL0A 4CT5A 2GVZC 4LV8B 4YXWD 5CIWA 3WNDA 3RABA 2NTYC 4B32A 3IPXA 2OO7A 2O52A 5A0FA 2ZS7A 1YHNA 2XNDA 3AEZA 4LWZA 1Z6YA 1E9DA 1HA3A 4M1OA 4C9BA 4PC1A 4BFZA 4M0LA 2H92A 4DUGA 4YMUA 4Z51A 4KFRA 3ECCA 5F2EA 1Z6AA 1NBMD 4PO8A 1ZCBA 3MWLA 1TQ2A 2ONKA 4JL5A 5EUQB 1CBUA 4D4JA 5DH9A 1F5NA 4EDHA 2VRWA 1N2CE 3SFVA 5J47A 4NCJA 3OEEA 4OQMA 3IQWA 2A30A 5G3ZA 4TN1A 4JBYA 1KSGA 5KPDA 3HU3A 4B2LA 2VHUA 3AVOA 3C15C 3EG5A 2FPMA 4NHOA 1Q22A 2BCJQ 1AZTA 3LXRA 3RS2A 5TARA 4DEYA 1P2VA 1RRFA 1M6NA 3UXMA 4N0EA 1YZNA 1F60A 4DB2A 2KBEA 2ZRGA 5ELXA 2YC4C 3RANA 3MMPA 2WJGA 1R7RA 4JVLA 1NI3A 2GK7A 5AR1A 1Z2AA 1X3SA 3GLHA 2PH1A 4Q47A 3QBVA 2IUSA 4IJMA 4M21A 1HQCA 3OAAD 3GFPA 4MUBA 2OV2A 3B2EA 4OJKA 3PJRA 4FMDF 2F1HA 2QP9X 3LXXA 3MUFA 4FN5A 5SZKB 3EZ6A 2XXAA 3TQCA 5D3QA 3B1VA 2W2XA 3RDPA 1YZLA 1JPNA 4L4UA 1FX0A 4I1UA 1RRCA 3X1DA 5E7JA 2GTPA 4QRHA 1P2SA 4XVRA 4UXJA 1KDTA 1FUUA 2AN9A 2WWXA 3SBEA 3NHAA 1FX0B 4JBWA 5JHHB 4AKGA 4JT2A 4C0AC 5TVKA 4JT4A 3QKTA 1TF7A 2GEUA 4M1WA 4D25A 1E2JA 3MFYA 3B9QA 4QBHA 2QP4A 2OFOA 4GP6A 1RYHA 4HYYA 2GXUA 2HLDD 1W5SA 4OL0A 2GZAA 1T8TA 2IYXA 3LLMA 3DM5A 2VHJA 1EGAA 4UXHA 5KTYA 2HT6A 3R8FA 1JAHA 1W47A 4Q18A 1YR8A 3IBGA 3LNCA 4ZCIA 1E69A 4MYUA 5BW8A 1WQ1R 4ZI2A 4NE2A 4GT1A 2BVNA 4LHYA 3THOA 1DAMA 1BYIA 1XRJA 2ODBA 3DHWC 4P32A 5EE1A 4EIWA 3ZVRA 1CF4A 2CLSA 2BMEA 1MO5A 2YKGA 2ORWA 1EFRD 4JVSB 2CCGA 4OHZA 5DSZA 3QEJA 2AK2A 2FSGA 1VPLA 5CK4A 4MDEA 2Q0HA 2DY1A 2DB3A 5K8LA 4QM7A 3W8RA 2RGEA 4P4SB 2JAQA 4W9MC 3GFOA 3D7MA 1H8HA 2ZRMA 3MWKA 1E9BA 3KQLA 4W7SA 1G6OA 2IF2A 3I1FA 1P62B 3QSYA 1UKVY 2CMKA 2J59A 3M6AA 2NPFA 2QM8A 4B3BA 1E9RA 4QGAA 2O0JA 4AYTA 1HE8B 1CR0A 3RRMA 5BN4A 2RCNA 2DYKA 2ZRIA 4B48A 2UZ3A 1NL3A 4B76A 5K8UA 3A4MA 1IM2A 1H8EA 1P75A 1U98A 2QRZA 3U7FB 1N6IA 1N6HA 1R10A 2IYRA 2OCYC 5FTLA 3ZVMA 1Q3TA 3ZIAD 2F3TA 2Y8EA 1LF0A 1TADA 4QJ3A 3WNCA 1GIAA 2O8BB 1EFTA 1UBGA 1ZVQA 3EXAA 4FCWA 2VP6A 4DWJA 3KXLA 3AB3A 5C1BA 2C78A 2OFXA 4D82A 3OEHD 4PFSA 2JLVA 4XD7D 4DEXA 1G3RA 1MABB 2ORVA 5EE5B 4CEIB 2HF8A 2JJ1A 1G19A 3A1TA 1XFAA 4NYJR 4XWAA 4PPGA 2ZS9A 3DZ8A 3RAPR 2D7DA 1IXRC 3HP1A 2VSXA 3PG5A 2W6JD 4XVUA 2HDNB 2OILA 3SZRA 4V0KA 5TDHA 3NG1A 1T3HA 2FA9A 3KDSE 3QKUA 4MITA 1X1SA 5LD2B 3PEWA 2OXRA 2PBRA 2KJQA 1ZBDA 1E98A 2AKYA 2OCPA 3AVQA 4LPSA 1ZD8A 3A58B 4KSCA 2ZSBA 3FPAA 3W3ZB 2WSMA 4LYFA 3LVQE 2MMGA 4A4DA 3GLGE 5FOXA 1LNZA 1ZM4A 3LY5A 2ZI5A 3QKRA 2EYQA 1DAEA 2VP9A 2F55A 3RS5A 2P67A 1DO2A 4M1SA 2H7VA 1E1QA 3B6EA 3NBZC 3LAWA 4M4SA 4TMWA 1UEIA 1SXJC 2FH5B 4TMKA 1B0UA 4GFDA 3AVXA 1NIPA 1LTQA 3QVUA 4V0NA 3DDCA 221PA 5HTKA 3BFXA 5JWRA 2G0TA 2ZSFA 4W5WA 2FOLA 2WJYA 2WJIA 1RPZA 2G0NA 3EASA 2C9CA 5B30A 1XEXB 3W34A 4LJ9A 3Q5EA 4NP6A 3V00A 1G8YA 3I3SR 2GAAA 2CNWD 2PCJA 2Q9CA 3QPVA 4PPNA 4ZO4A 2FF7A 2R6DA 1Z29A 1Z8FA 2K5UA 1LB1B 2ZTSA 3P32A 5CDFA 5TV2A 1YZKA 2BC9A 3L0OA 4MKFA 2ONJA 2O8EA 3I5YA 3BAFA 4G5QA 2YOGA 3CNLA 1VIAA 1IN7A 1OFTA 2AFIE 4BUJA 5HE9A 1Z6XA 1IN6A 5FL3A 3T15A 4AKEA 3DZDA 3ETLA 4PAMA 1KMHA 4KODA 1G41A 4U7DA 5AUQA 3GLGA 3ASYA 2D06A 1JNYA 1CULC 4A6XA 4TZ0A 1NJFA 1UBCA 2QGZA 3PVSA 4C2TA 3CX8A 3QG1A 4C0QC 4OYHA 3RRNA 3BGWA 5BYJA 3T35A 5BWMA 2PT5A 2WMNB 5DISB 1NVXQ 1G5TA 2VQSA 4MYHA 2W00A 1IQPA 4HLDA 5FR1A 4HDOB 1G8GA 1GL6A 1XZQA 1GM5A 1L8QA 1XD8A 1VHLA 2VHTA 5DYGA 4DDTA 3R9IA 1H8ED 3KXIA 4HZUB 2EU8A 2P5TB 4BLOA 1Z47A 4C0HA 1NVUQ 1XNJA 3I32A 4YC7A 4NU0A 4LJ5A 4KCGA 1RYFA 3W6PA 4E5UA 1BMFA 1U99A 4BLPA 2ZRFA 3I62A 3FTQA 3GLFB 2F7SA 2WSSA 2D4HA 1NN3A 2RB4A 1WP9A 2ZIAA 4KSBA 1YQTA 4M53A 4RD4A 5H8WA 1DADA 1P3JA 3AVVA 1KI6A 2JLQA 2GKSA 4IEIA 2DFLA 2QAGA 1AN0A 5LBIA 4POAA 3KKMA 4A0RA 5B57C 1XDBA 3FMIA 4L16A 3P27A 3TSOA 4ZV4A 3UWOA 2GK6A 2B6HA 1ZW6A 3K0AA 4LJ7A 1PUIA 3GFTA 1XB2A 2XX3A 4IVQA 4LJYA 2IUUA 1S8FA 3T5DA 2GNOA 4CW7A 1DAIA 4EAQA 2O8FA 4QGHA 2JIZA 1KO7A 3B82A 3DPUA 2IYYA 5B64A 1NRJB 5FL7A 2H18A 3O8CA 1KI4A 4QOSA 4B35A 4DCSA 3K0EA 5L3RA 5TMPA 5KSOA 2G3YA 1HYQA 2CVHA 1KDRA 1AS3A 2VP4A 3V9PA 1K5DA 4PQRA 4LBYA 4BLQA 3FKSA 5G41A 1AKEA 1S3GA 1K5GA 3WBKA 5KNDA 5CM9C 3U6BA 1U94A 5KUTA 4W5HA 4DB4A 3REGA 3TAUA 1JJVA 1ZD1A 3C7KA 1YR9A 2FGJA 1AS2A 3B78A 4ZCMA 4TYPA 1XX6A 1E1QD 3W3AA 4RCZA 1DTSA 2AR7A 2MSEB 1BOFA 1E2KA 3ADCA 1T5IA 1ZRHA 1RKBA 1RZ3A 3OIUA 2NO7A 2OZEA 3S1AB 1E2EA 5EP2A 3KJIA 2QMOA 2C77A 3NTUA 3MWJA 4LYJA 2QBYB 4QM6A 4US1R 4B3CA 1N3BA 1U8ZA 1AM4D 4GRAA 3TE6A 1XF9A 1Z22A 2GF9A 1FMJA 2AWOA 3LRPA 3PR1A 4HUQB 1N0WA 4YMSA 3U44B 1LVGA 4EQ6A 4IOKA 2WWYA 3QBTA 5GJWC 1KY3A 1KDOA 1QG4A 1ZAKA 3KB2A 1A2KC 4LJ6A 4RZ2A 3TUIC 4YQFA 2ZUBA 1VCNA 2VF7A 5DLQC 3X1XA 1R4AA 2DWPA 4ZPXA 1KY2A 8OHMA 1FP6A 1XZPA 2AK3A 2IYVA 2BJWA 4II7A 1SVOA 4PQYA 4BFYA 4F91B 4X8OA 1FZQA 4TL8A 3M0EA 4A8JA 2GVDC 3OF5A 2D3WA 3WHKA 4ZCLA 1W4BA 1AJEA 3FVQA 2J0SA 3TKLA 3C8UA 1MRSA 4UJ3A 3IO3A 3T06B 2IBMA 4KFUA 1S2MA 3DKVA 4Q4HA 1ZM2A 5CK5A 3EPHA 1Z83A 3BS4A 1W0JD 2YWFA 1MOZA 3VAAA 1P4SA 3B1XA 3QE0A 1G64A 5J40A 1SHZA 2GZHA 4HB4A 2WZQA 1CJTC 4DSTA 4GMDA 3HYTA 4TLEA 3LBHA 4CEJB 5F3WB 2HCBA 5IT5A 2A5FA 2TMKA 1AS0A 2ZITA 1VYVA 1X86B 2QSZA 1V43A 4TWZA 2ZPTX 3QQ5A 4YDHB 4Q19A 3EC2A 2FMXA 2QORA 4FMCB 3RHFA 5DO9A 1JQLB 5IRCD 1ZCAA 1PVOA 3LX5A 4ZI3A 5E4FA 4RCYA 3NVAA 2CK3D 1SVMA 2WMOB 5FR2A 1E9CA 1L2TA 1W1WA 2GJAA 2B92A 2ZU0C 4WW0A 1VG1A 5FOUA 3NIBA 4PQFA 2V6JA 3GLFE 1RRPA 5GJCA 1MT0A 2ZRDA 2RGXA 2QU8A 4LK2A 5EXSA 3C41J 3AVWA 1M7GA 5G3YA 5JS7A 1FFHA 4KBFA 2G6BA 5JECA 3TAHA 1ZNYA 3NBYC 3BB3A 2WJHA 4U5XA 5JEEA 1E9AA 1CP2A 4Q4JB 2H1LA 1N6KA 3HPQA 5HCIA 3PQCA 2H8KA 1YVDA 1N25A 4LRWA 3LD9A 4E22A 4HAZA 3OESA 4TQAA 3GP8A 1R0ZA 4PC7A 2KBFA 4MRSA 5AUPB 5F9FA 4B44A 5AK0A 4GSYA 4QJ4A 1IY0A 1W46A 1OYWA 4BRWA 4RFSA 3AKYA 4LCBA 1TQDA 4KAXA 2VIIA 1G3QA 3GJ8A 5KSPA 4HB2A 4KFSA 1DG1G 1IN8A 4QBIA 2WV9A 2ZANA 1Q3HA 5EXXA 2FDCA 2ZJ2A 4HEJA 4TTPA 4FMDB 4WZBE 3U44A 3CRW1 1P73A 3WP1B 2F1RA 3T1TA 1ELOA 1RW4A 4A2PA 5JSZB 4UNQA 3UG7A 3MWYW 3SJZA 2ZYVX 4PHFA 5FOWA 1H65A 4RSGA 2F43B 3SNHA 3CRMA 1GZSA 4FWTA 4W5JA 1J99A 4G5OA 4WA7A 1UAAA 4TL9A 1G7RA 3MAAC 2WBLC 4C2UA 1UKZA 2W58A 3SR0A 4ZIRA 5HZKA 4OI2A 1N6OA 3DMNA 2KE5A 1KOFA 1LY1A 1ZNZA 2PLRA 1DVRA 5FPKA 2Z83A 4M9QA 2CL6X 1QHHA 1G4UR 1NIJA 4DJTA 1CJMA 1TUEA 4B33A 1PJRA 3GD7A 1RVDA 3FB4A 1Z63A 1MO4A 4LY6A 1KI2A 4JL8A 5CM8B 3RSOA 4L9WA 3QIAA 2QMEA 2NIPA 3AKEA 1PLLA 1S9HA 4BEBA 4QHTA 2OAP1 5DHAA 1ANKA 2ZXUA 2EFGA 4IDPA 5FL7D 3WYAA 3SHWA 1S1CA 1D2NA 3QVVA 4HB0A 1KJWA 1GKUB 4URVR 1S1MA 1SHKA 2CE7A 2JEOA 4EPXA 3AVUA 3BB1A 1KO8A 3ICQB 1S0UA 1HQYE 4BFVA 3B1ZA 1WDTA 1G291 2O0HA 1G9XA 2WKPA 2XB4A 1N5JA 1U0HC 3IUYA 3Q7QA 4ARZB 2VEDA 2IUTA 2QSYA 4MYCA 1M34E 2CXXA 621PA 3OEED 1KI6B 4HZIA 1OKKD 5KNBA 1CEEA 1Q12A 1YZQA 1YRBA 4IEEA 4A8JB 4HLUA 2XSZD 1JB1A 5BQ5A 2BBSA 3UMSA 5LB4A 1NSFA 3OFNA 2GAOA 4HUTA 3BB4A 2X2EA 4B6EA 1G6HA 1W4CA 4PC3A 3IHWA 1PZNA 3QPUA 3TR0A 2NO1A 3X2SA 2QI9C 4JVNA 4Q4LA 2DCUA 3H86A 4JZKA 4MKHA 1AGRA 4AKHA 4O25A 1E2PA 3IDQA 4RY2A 5C4GB 3KQUA 4Q21A 1VG8A 1AQYA 1OH8A 2PZGA 2R2AA 5AJWA 4MGKR 5EQTA 3CNNA 1TMKA 5LD2C 4ITRC 2D2EA 2ATXA 1SKQA 2G1JA 4Q1FA 2PX3A 1E2LA 1TQ4A 5JHGB 1OXVA 1YU9A 3I4LA 3U3KA 4AG6A 1VYTA 4N3NA 4HSEA 1ZJ6A 3BIFA 4JBXA 1HURA 4PXAA 4DKXA 1G17A 2BKUA 3ZQJA 4B43A 3KL4A 1XPRA 3OE7A 1QVAA 4HLUC 4NYIQ 1NP6A 3EARA 2Z4SA 5SZJA 2IYSA 2PEZA 1OIWA 2ZI6A 2H17A 5KSYA 4QBGB 4QL3A 2QAGC 3LA6A 2O8EB 1M1YE 1I2DA 4ERNA 1YZTA 3PV0A 5UKDA 3ZZUA 3WP0A 2P6NA 1DPFA 4JLJA 2IYWA 4YMTA 2X77A 1OF1A 2LKDA 3NDPA 1DAGA 1IHUA 2WPDD 3SOPA 4CEIA 2IK8A 4Q4JA 2LKCA 1QHGA 3TK1A 4JLPA 3ZZTA 4B75A 1P61B 2AWNA 4DRZA 4F4JA 2EFDB 3AF3A 1QHYA 3KB1A 2ZRPA 3FGNA 3QNUA 4UKDA 3UWKA 1W7AA 1RJ9A 1ZMXA 5FBQB 4I1OA 2RHDA 4URYR 2WAYA 5FTMA 2JASA 4Q9IA 4F93B 3PIRA 1Q1ZA 2GXAA 2GEDA 3I92A 1NN5A 2AD5A 5HE8A 4BPBA 4Q66C 1G5PA 4C0BA 1XWIA 4RJLA 4H9GA 3NHBA 2GHIA 4KHZA 4EUNA 1R5NA 4YMWA 4CRWB 4DLZA 3QOFA 2VLIA 1N6NA 4B71A 4FI3C 1G3MA 1KIMA 4MRPA 1NBME 4IVRA 4OI0A 4HAXA 4BLRA 4DLUA 1I4LD 1U0JA 4TQ9A 1OXXK 2ZVQX 2PZEA 2KSQA 3E70C 1CS4C 2WIAA 3TW8B 5JJIA 3EA5A 5IHPA 2E9SA 2QQ0A 5KDOA 4I4LA 5FUXA 2IF0A 3CO5A 4I1SA 2X19A 1JEDA 1LS1A 2CNWA 2ZRKA 2OT3B 1F2TB 3F0TA 1LV7A 4QG7A 1DG3A 3NEJA 4M1YA 4HLCA 1KI1A 4OQNA 5ANRB 3LV8A 4C7OB 1HT1E 4GZMA 4RKFA 1E79A 4F92B 4BWYA 3W90A 2YC2C 3GEIA 1R0XA 2IS2A 1CRQA 2O8BA 1UADA 3RRZA 4IXNA 3OE7D 2EQBA 2QAJA 4DLTA 4HI0E 1OW3B 3LBNA 1UDWA 2WWHA 2H5EA 4Q5IA 4IOMA 2ZSDA 1U90A 2IW3A 3Q9LA 1OIXA 2W0MA 4DLRA 4Q03A 3T34A 1CXZA 1NLYA 3CONA 5KHOC 1KYIA 1G20E 1W2HA 1IN4A 1VDZA 2YVUA 5AWFC 4IRUB 2R65A 1M74A 3GCGA 4Q7JB 3U3RA 4B74A 4PSKA 4O0MA 1G3UA 3BXZA 2X1VA 3P1JA 1WRBA 1DBSA 1KO1A 1DEKA 3LQQA 1GWNA 4JL6A 1FW6A 2HJVA 1SVSA 1VYUA 4XJXA 1Z6TA 5P21A 1D9ZA 3R9XA 4DDVA 3HPRA 4IXMA 3AVTA 4X8MA 4PAOA 3MJRA 4Q9LA 4BFTA 1SGWA 2JLWA 1KK2A 2FU5C 2XTNA 5CB6A 5IDVA 3U2QA 4XD7A 2V1UA 3KQNA 2F3RA 2ZRJA 3QXSA 3RVBA 3QKRB 2OCAA 3IIJA 1TAGA 2DWQA 3U3JA 1G8PA 3Q3JB 5FBVB 2GJ8A 4FIDA 4BLSA 1M7BA 4ZDIA 1VHTA 2J0UB 3AV0B 1P9RA 4FWIB 4BFWA 4IHQA 3WRXC 2HT1A 2ERYA 3FHCB 4MRVA 5EZ5A 3IQXA 5F9HA 4EFMA 2JDIA 1G1MA 3EC1A 4LI0A 3L43A 3K9LA 3VKWA 1G8HA 2Q21A 3A8TA 4B2IA 5BN5A 1RC8A 2J0QA 1T3LA 1R0YA 2FJUA 3D31A 1IN5A 1CJKC 2RH5A 4CYMA 1QG2A 5FOVA 2VTKA 3SYNA 2J9RA 4C0JA 4ARZA 4M1TA 4BEJA 1E2QA 2KI5A 1UEJA 1BKDR 3L8ZA 4P31A 5CLLA 5AJVB 3M4YA 2HLDA 3I73A 4KBGA 1VECA 3QXXA 2CJWB 2Q6TA 4TLCA 2QE7A 1G18A 3UK6A 1COWD 1U9IA 4V0ME 4CDGA 4DCVA 2I4IA 1G21E 2IYZA 1W48A 1IY1A 4JS0A 3B9PA 5L3QA 1HEIA 1F48A 3P20A 2QE7D 4Q4AB 1CIPA 5AUOB 1J70A 3IEVA 3PEYA 3IIMA 1GL9B 4MKIA 2PZFA 2PMDA 3ZZ0A 3U4QB 2OCBA 2OSBA 4NDZA 3ZH9B 3I8SA 3B5JA 1XEWY 2NO6A 3KKNA 1ZNWA 3K8YA 4RKEA 1OJLA 5HKKA 4KO8A 5DI3B 2BBOA 3BE4A 4F4IA 4LGMA 3GLIE 4X8LA 3THYB 1TQ6A 3OIVA 3Q5DA 4TLBA 1JR3A 1CLUA 4IFBA 1KJYA
chains in the Genus database with same CATH superfamily
4DCMA 2J5QA 2XYQA 1EUDB 2FMIA 2XDYA 2QV7A 3DNMA 1I3NA 4J2HA 4JFRA 3V4SA 4NDAA 1VI5A 1PK7A 1SA0A 1P2FA 1V5WA 1WUKS 2QHXA 3VO2A 1K68A 2ZU6A 3OM9A 3C3EA 2YS6A 1MOPA 3OE4A 1OAAA 3F6SA 5KKCA 3G13A 2MYUA 2D62A 4V0LA 5E1MA 1E3EA 3MLEA 5HOQA 3IGFA 3GRPA 1MTZA 2RJ3A 1QFYA 3BEDA 2PXAA 3K9NA 5C8ZA 5KTNA 3OQOA 5KYUA 4OQDA 5GWXA 121PA 5FTKA 1EVIA 1X38A 2VYQA 3ZQKA 3IUPA 2IYQA 3NTRA 4ZZ1A 4LECA 1MT3A 3CEPB 1K0FA 4NEQA 4EEKA 2PG3A 3RYHA 1CVIA 1KJNA 2GMWA 1ZY2A 3FYUB 3E1SA 1VL8A 4YT5A 1X14A 3EVEA 4HCJA 3BH0A 4IJ5A 1ATIA 5LXTF 4LJ8A 3ADKA 4A73A 1YL7A 5K8TA 3BDVA 3V1MA 4M83A 1HX7A 3GIWA 3HWSA 3OP1A 3WLLA 5FUVA 1XE3A 2G6TA 2JRCA 3ZUGA 1PL8A 4HDQB 1TIPA 4NKRA 3RU9A 4GVXA 5EJIA 3X43A 3SC2A 1CDZA 1U3DA 1YKGA 1K63A 4RACA 2A5JA 4HWOA 4Y1FA 4CIDA 4UNRA 1W9MA 4ZAZA 2VYFA 2GXQA 2BM0A 1MMFB 2NYUA 2B2CA 4GI7A 1KIFA 2VTVA 4WNAA 3LX8A 3DCNA 3UM9A 2D5IA 3VI4B 4UTXA 1QYIA 3KZXA 3NLLA 1UKYA 3ZHUA 1EFUA 1T8PA 4A2WA 4DUPA 2BBWA 4GPAA 1Z4QA 5JZBA 3HRIA 3KT0A 1ONOA 1JLMA 2J7PA 4F4CA 3L8CA 4ZYLA 4ZZ3A 3O8QA 4Q3DA 3GPLA 4DHWA 3JWJA 4B09A 2OXIA 3QBDA 1G42A 3RD5A 5L9AA 1XKXA 3L82B 5H9VA 2ECPA 1J8QA 1H2YA 5EIFA 1YFJA 3CZAA 4MB6A 4Q3KA 1Z4PX 1WPXA 3LUKA 3KUCA 1TGVA 2DGDA 2X15A 4GC5A 4WBSA 1ZHOA 3EIUA 1R0WA 1EBUA 1IL0A 2FPWA 2RHMA 3FCSB 4MEAA 3WYGA 4DA7A 2ZUDA 3H2JA 4F8JA 1MHTA 4KXWA 2BEWA 3RUAA 1XMXA 5KTPA 3NOOA 1EWVA 4J3FA 1GCGA 5JXJA 2FFRA 2OFPA 2W2NA 3KLOA 3EXIA 3UB2A 3DLPX 2PMKA 5FOQA 2I54A 2NU7A 1QRRA 3IH5A 1QJCA 1KO4A 2B3TA 2IPAB 5FL3A 1W0CA 2V97A 4KXXA 2B8TA 5E4TA 4LUCA 3ROTA 3TINA 2GM4A 2ZIZA 1U5BA 2AW3A 3JAWB 3SJAA 3U7IA 421PA 4IZIA 1LBEA 4R1MA 3GK3A 3GLGB 2WP8J 1RLOA 4ZQFA 1ZM7A 3MUOA 5DBGA 4O3MA 4DXAA 4LDNA 3JQAA 3OCYA 4YQZA 4PG4A 1JR2A 1YVEI 4DGQA 4E31A 1P5FA 3U4CA 1B74A 1ONSA 4EHNA 5KKNB 2PCLA 1KJIA 1XNGA 3KU1A 3N2GB 4NJEB 2Z4RA 1S7GA 1RR6A 1MNAA 1TCBA 1YB4A 3FROA 4E08A 1OI4A 1RP7A 2IHYA 1NMXA 2H4ZA 3MWEB 4UATA 4GKKB 1RLTA 4PIVA 1TJ5A 5BN4B 1E0JA 4ANFA 3I5YA 1KDYA 4CM8A 4WFQA 3ZZ1A 3BH6A 1U80A 1IHPA 2IHZA 1C3XA 1VRWA 2AX4A 4NZZA 2R6AA 1NUTA 2PUGA 3NETA 1U63A 2Q0QA 5JANA 2VNKA 3ONWA 1N2XA 4E1VA 1J0BA 2BW0A 2DTDA 4Y18A 4B6OA 3LY7A 3P5BA 1DL5A 1SXPA 3CEJA 3GB9A 3K16A 3U56A 1WV1A 2Z04A 3CF0A 3Q3HA 1ESZA 1HQKA 4QLOA 1AA9A 3SQDA 3D4BA 4EW6A 3I9V1 1GP2A 4KQ9A 1SC6A 1J8VA 5LQRA 1T2AA 3PUWA 1JA9A 3OUUA 5ADUS 2C9BA 2SNIE 1FVHA 3HDVA 2GPSA 4BL5A 3H99A 2QLLA 4C7OA 1P1IA 1RM5A 1PNVA 4HRXA 4UMDA 2XA1A 3ZCUA 3FNFA 1C9KA 3C3XA 3OCJA 1DX4A 4EKYA 2OZLA 4JLNA 4EO9A 3BVPA 3GLUA 1IHOA 2DP4E 4OI4A 4F96A 3HADA 1RCTE 3SZ3A 4JUFA 1NR7A 3WTCA 3LT5A 1MTOA 3NFYA 3ELUA 3GJQA 1P7CA 1B8NA 1PQYA 4DV2B 3Q11A 4IDHA 4B85A 3PXAA 4W9RA 5ECYA 3MT8A 4KVAA 4N01A 1FBNA 2QR2A 5F2KA 4WADA 4I5DA 5CNIA 5FJJA 1FQOA 3OWHA 1NM5A 1BJRE 2CEAA 2GPYA 2QGNA 3DBLB 6LDHA 3BHNA 4M9CA 4H31A 4N48A 3CO0S 3DEHA 3K0FA 5GOZA 3TLCA 3ZNNA 1ESNA 1WUIS 1GN9A 2N46A 4WY2A 1TF2A 1UXGA 2A9QA 2VTEA 1T9AA 3OMLA 4TS3A 1DAKA 2ZYHA 4JROA 1KSJA 5EIHA 5K0GA 4DGSA 4LDQA 2XLCA 1K88A 3FNEA 1XJCA 2WUGA 4GXRA 5F23A 3RJMA 2XBUA 3WLPA 3ZDQA 5ALLA 3GQBB 4Y6LA 5JD3A 3OWOA 2FXIA 3WV5A 2PUVA 3O8RA 4DV0B 4CV0A 1JQEA 4CMBA 4AX4A 2VEOA 3GLHE 4L8GA 1GT6A 1KE2A 4JLOA 3KJFA 1B8UA 2WWVD 2IEDA 5B4VA 5HIAA 1K98A 3ANLA 2FPPB 3M3HA 5JAPA 2V0GA 1X0XA 4Q1CA 1T10A 3EA4A 1XDWA 2C2HA 4II3A 3JZAA 4Z9BA 2IITA 3TLZA 4BASA 2XNSA 2BD0A 1OGJA 1HYGA 5EXTA 4EFLA 1OFVA 3FPFA 1H6AA 4UNIA 5E4YA 521PA 3WIUA 2YOHA 1KZHA 4YR9A 1Z0DA 3RM3A 7YASA 1PCXA 3FDJA 3VO8A 3WGMA 4B5KA 1JHRA 3TG8A 3EWAA 1Z6PA 3JQ7B 3UK2A 5CH5A 1OHHA 3LFUA 2DR3A 2LXNA 3O8OA 4KQFA 4A0FA 3VFDA 3PL5A 4P36A 2XIQA 1C1DB 1P72A 1SAYA 3UMVA 5FWYA 4IHJF 1Q16A 2BFCB 4AF8A 2GEVA 3O26A 2A5DA 4BAZA 5HFNA 1XF1A 4KYVA 2W70A 3W0LB 2AI1A 4YJHA 4OMUA 2G5TA 1X1QA 4QBFA 3TFQA 4A15A 2X23A 4CMJA 4AKIA 3QE2A 1RZRD 6AT1A 2YR0A 1T9DA 2ZBUA 4PG7A 4KYUA 4FCVA 4II2A 3IKLA 4BKRA 1W0KD 2QL7A 2VHYA 3EQ2A 2BV3A 3ILHA 4LSMA 5FI1B 1C14A 1G21B 1H2EA 3PCRB 3QV2A 5TQ2B 4WK0B 3EIWA 1PZEA 2HO4A 2YWGA 4MVJF 4WKCA 2G17A 4NCNA 5DT9A 1X8JA 2IIBA 1CB7A 3GI1A 4DILA 1YBFA 3QUSA 1EFPB 2BRUC 2HBQA 5HIMA 5CDYA 5FDFA 1DGQA 2J9FA 2QTVA 4MA4A 2PO7A 2NVUB 4BVJA 3KVYA 4MS4A 4V0MA 2JI6A 3MSXA 3ZHVA 4D43A 1G21A 2VAPA 3AYXB 3B5IA 1VYHA 5E4JA 4EI9A 3AFGA 4RPGA 5BR1A 1XTJA 2J3KA 4NTZA 1DKNA 2FEPA 8GPBA 3L8GA 4CKBB 2NPOA 1QYXA 3DTTA 1JXMA 1US8B 3AGPA 1CRPA 1EFLA 5K8JB 3W9YA 4GM1A 4W1PA 2F1OA 4JQSA 2CNKA 2IA5A 4UU7A 2R00C 4ZQHA 5EKSA 3RFVA 1OI3A 3WTBA 2PANA 2ECKA 3B6IA 4PC6A 1EXMA 5HJ5A 5IAOA 3H3XA 4K2HA 1SUBA 4XGRA 7ABPA 5GGYA 1PZGA 3U80A 1Z0JA 3OJOA 2D8MA 4Y2JA 1UPAA 5D5QA 2O05A 3LBAA 2C96A 4K3UA 5G0SA 1O6CA 3CX6A 3LKDA 1SQ6A 3RHTA 2GB4A 2R7NA 3NR2A 3WGGA 4AX8A 4R41A 1G5QA 1N5IA 4KGVA 4RANA 1T0JB 2Z43A 5JZMA 2X13A 4N18A 4RD6A 5AK5A 5ESXA 3RLFA 3EGOA 1BHJA 1GSHA 4ZAYA 1WQ3A 1U7HA 2Y77A 3B20A 1VFPA 4FYKA 3BHMA 4XH9B 4MV1A 3HACA 1QBGA 1EWKA 2P4SA 1ZJWA 2QUAA 3HFSA 3ZG6A 5CFOA 2XZLA 3QLVA 2ZSAA 3CNOA 3JD2A 4FOSA 4IWYA 4OAQA 4DA9A 4DLKA 1NASA 1W73A 5IBCA 1Z08A 2WU8A 3QX7A 4DHEA 5FI5A 4FZRA 3HNPA 1GA4A 1KERA 4ENWA 4UNPA 3TH5A 2I3DA 1FRZA 1KZ7B 1WMSA 2PTHA 3MILA 4PLWA 1UPTA 1O57A 3FG9A 5D8DA 4O1MA 2CE2X 5H70A 4Z7QB 3T5TA 2VQEB 1KI7A 3THXA 2PUAA 3BMOA 2WAXA 1FPMA 4TTRA 4DSNA 1XPUA 2X5XA 4RL4A 1E3MA 1N6PA 4TQUS 3WRXA 1ZOPA 4YWHA 4S04A 5EI5A 4LXTA 2D1YA 2J9ZB 5DLYA 5EP3A 2A2ZA 4PSAA 3CZ5A 2FPGB 3AETB 1EBBA 2UUPA 1JJIA 3P0IA 1V5EA 3JR7A 3GJ6A 2W7TA 4D8XA 2M98A 3ISVA 5DI9A 5DVZA 4D26A 3KXDA 2H9YA 3JQBC 1NUAA 1Q44A 3CW2A 1GKYA 4FGSA 5HUQA 4OA5A 3A9SA 3E5HA 4L6AA 2RIRA 4ND1A 3AM4A 2EJBA 3ESYA 2XUFA 2EFYA 3FKQA 5CA0F 4CF7A 1N6LA 1R6BX 1V5FA 1BAPA 2BMFA 4FKZA 3WA6A 4EKEA 1DRUA 2HUNA 4Y2RA 1USIA 2F9LA 4KXQA 3LT0A 4LHXA 3TOXA 3GLHB 2Q2OA 3C1AA 1QK5A 3OH8A 1YIOA 3WWOA 1JEYB 3DDWA 4G8BA 1BNCA 3RKRA 2DERA 3AF6A 4HDNA 4XGQA 5K3EA 4IGIA 1RCFA 5H59A 3ZIDA 1P9NA 2P2DA 4JI5B 4EP1A 3MBOA 3GPIA 3SJBA 1AHHA 4FM9A 4HPWA 1FL9A 2OUIA 2K2WA 3OKCA 3IMEA 1NKTA 1NG9A 1BMQA 3DLIA 1EP2B 1Y98A 5EHNA 4EX6A 5HUJA 3RPEA 3QITA 3T5PA 1A7KA 4DA4A 1WHTA 3DONA 3I0ZA 5BV2P 3HNRA 3I09A 5C0OE 1ZUHA 3OQJA 4FT4A 2PLNA 5IBRA 4DY4A 2WWFA 2B82A 3TMAA 4G5YA 3ZZNA 2P9HA 5B6PA 1EJ0A 2F48A 4KV7A 5IK2A 1SH7A 1EK0A 4O33A 1P9WA 5E6SA 3WB0A 2XSZA 4G1UC 5DLDA 4DKJA 1IOWA 3JASA 4AECA 4XIFA 2D1RA 4IXDA 1FOEB 1MAUA 1M9NA 1OZAA 2H00A 3WNQA 4HGOA 3TTTA 1YC5A 3ROFA 3IODA 3PT5A 3EN0A 2AOVA 4YXFA 1FMTA 2QTFA 2LR0A 1OLUA 1EK5A 3G2HA 3RUEA 4E0BA 4P7GA 1V7CA 1C29B 1MC5A 2FW7A 1E7QA 1HDGO 1PNTA 3IJRA 4KDCA 1AHNA 1J9EA 3PR3A 1WMEA 4JVMA 3V4FA 2BR4A 1PLJA 3K09C 2I1WA 3O7WA 3OOSA 1Q7CA 4O3FA 3DXXA 5J4YA 1QUEA 1ULSA 1XZAA 4N0DA 1CJUC 2FPOA 5C31A 3U13A 3W79A 4BAGA 4DTCA 5EWMA 1Y7LA 1NW9B 1IHYA 1KH1A 3C43A 1EWRA 1IUPA 3HU2A 3IDAA 3CEAA 5CVEA 3RTCA 5LU9A 1O4VA 2R751 3M34A 1L7BA 5ALZA 3IMGA 3BC1A 4U8GA 4RWEA 4BYMA 5EJMA 4GMXA 4OHFA 2CXPA 3AHIA 1SY7A 4K5QA 4S2EA 1A1VA 1HG0A 4YVFA 4ARBA 5EYPA 2CL7X 3ZEAA 5KVVA 3V55A 3CLHA 3KOUA 1QLWA 1B16A 1FMLA 3E22A 4TL7A 4UHCA 1N7IA 1GGMA 3EA0A 4A1OA 3HUTA 3ZD8A 3QMWA 2PMBA 4NK4A 2G4CA 1SUEA 3R7WA 3QMMA 3OX4A 4G0UA 1BZYA 3VR0A 3M82A 3MCUA 3D0KA 4EMBA 4OHOA 3LDAA 2C7RA 3E35A 5FHRA 2A3RA 5D7BA 4OLAA 3B8HA 3NC4A 1D8TA 2FWBA 1JXAA 1L7EA 3FCYA 1E6KA 4MRNA 3DOEA 4N7MA 5FI0B 4O2BA 2MCFA 3F6EX 5JXWA 2Z6UA 5JROA 4YP9A 3OQ1A 1R0BA 5AIBA 1EUYA 4M46A 5JJLA 1QWSA 3SSMA 1TKCA 1OFUA 3EY4A 2B7CA 4JX9A 3LPLA 2J6HA 5C5EA 5DLPA 1CZRA 1PDWA 1WCIB 1QYVA 3EUEA 2NMVA 3OEHA 1Z56C 3R5TA 3HZHA 1Y63A 2F8SA 4RW0A 1RQNA 1MJ5A 5TT0A 1G6KA 1LQUA 4G3XA 1YJ8A 3NX4A 3S2FA 4CLHA 3WLAA 1DLJA 2P9CA 4CKEA 4KYTA 1MRNA 3MRTA 3OCXA 4OO3A 3N59A 4FUQA 4F4HA 3QPAA 1G4AE 3NONA 4BECA 4NEHB 5LDDC 2XQIA 3EQ9A 1IRIA 5JO9A 3GDHA 3FD8A 4P53A 3V8MA 1K7YA 1TD1A 1VG9B 1XALA 5FFNA 5L4NA 2XUJA 3ZOKA 2QLTA 1TXGA 4G0YA 5DNCA 2EBUA 2BKVA 3T94A 3SAJA 3GJ5A 1UBNA 3PQ5A 2C42A 3A1EA 4NH4A 2NSDA 16PKA 2AOTA 2Q1UA 3Q72A 1P18A 1KZYC 2AKEA 3LCCA 1AXRA 3BD6A 4H7JA 4NQRA 5FV7A 5BO5A 1YQEA 2XNKA 5D5HA 2BGIA 3I45A 3VV3A 3HA2A 4YWJA 4PZZA 3H6HA 1K9VF 2VZLA 4MCHA 4DR1B 2QXTA 2VP5A 3AKDA 4URHA 4PG8A 2IBSA 2PLWA 1ZM9A 3LL7A 1JFRA 4F9GA 3VNVA 3I6ZA 3CR7A 1PJQA 2X0FA 1XZIA 1LPBB 5CEJA 3AUTA 1Y4ZA 3RRXA 2J6IA 3PJDA 4PU0A 2Z56A 3IPCA 2DF8A 2VHQA 3GAMA 3TSWA 3FPEA 4BNWA 3DG9A 3F2VA 4DC1A 5B7PA 5CU7A 5D7NA 2QLBA 2MSNA 4J94A 4PFKA 2GN4A 1PBNA 1JQBA 4JJAA 4JLWA 1HBJA 2FQYA 3PFIA 4ND7A 5BRNA 1GU1A 5E8JA 3AZPA 2BSAA 4TRRA 3TFOA 3WXBA 4AUEA 1WA5A 4PYOA 1B3BA 1NVEA 3HGTA 4US0R 3H97A 3Q6IA 2K87A 4J49A 2LTAA 4PRYA 1NY6A 3N8HA 1ACMA 1X7GA 3SYLA 3UTDA 5CP8A 5LMUB 2PV0A 3PDIB 1G3IA 2NSHA 3FIUA 3ZOZA 5KVSA 2ZIGA 3TNFA 5JCXA 3G5MA 2VCYA 3G1TA 5AKEA 1BDIA 1HY3A 3O2QB 4XUGB 4L4ZA 5EJAA 1ISIA 4GAEA 1JLKA 2V5UA 4ZT7A 3WDMA 4YAKA 4KO1S 4F3KA 1U4NA 4C08A 2ZG6A 3G89A 4DM3A 2GARA 1SB8A 2ZUWA 3GOQA 1W25A 3CUEF 5BSMA 1AKTA 3AG6A 3HJHA 1RWNA 3OLXA 2CLHB 2W6PA 3EZGA 4Q01A 3SX4A 1FYVA 3KJNA 3PDUA 2XD9A 3IBYA 3R4CA 4GR5A 4J0GA 1W93A 4F38A 4YT2A 3D5TA 3PPXA 1XOIA 4OK6A 3HSSA 5LB2A 1P1BA 3G3EA 3EZ7A 3R8CA 3DZIA 3WVNA 2NZXA 1UBMS 1DELA 2POQX 1CHDA 2YWBA 3CX7A 3QFHA 1RWXA 3HXKA 4ZKEA 3OOWA 1Z06A 3MUNA 2H16A 1Z0AA 4G24A 1CEQA 1VBMA 3S1AA 4WE3A 2AOTB 1AK1A 1UBKS 1UMDA 1EFDN 2VNIA 1E1KA 3L1IA 1GILA 2O7SA 5KYXB 1YL6A 3MJHA 3CLRC 5B2FA 4B8YA 3FNHA 1M8KA 1JSRA 1MC8A 1WNFA 2LZ0A 1H0SA 1UDXA 2QM7A 2VG8A 1N1MA 3GY0A 3A6GA 4PLHA 4WACA 4A1FA 1A4IA 3E3MA 3D4NA 3V7NA 4X1IA 1BEEA 2ZE8A 4OX9B 3RYCB 1WSDA 4S1WA 4DLYA 3EB9A 4YUXA 4UVGA 4P7BA 1RVV1 3EHEA 2Q9AA 3H9CA 4R98A 4CLEA 1A2BA 4H1TA 1P6UA 2O48X 4AKHA 1X8LA 4IGKA 1GGJA 1H2WA 4O2LA 5BR4A 1GNQA 1PVVA 1IU9A 1NVVR 4BZQA 4YH1A 3AF0A 1F0KA 4RX1A 3BKWA 1CQWA 1KJJA 5EPEA 1BO6A 1QRDA 4B5LA 2Q4RA 4ZOLA 1NVWQ 3D02A 5HKOA 2JFGA 4KUEA 2OZKA 3EXG1 2WNSA 3S2ZA 3T0GA 3P97A 5WRFA 1SEPA 3UC9A 4B2PA 1MEJA 1UANA 4R01A 1U8UA 4EW1A 4AJ1A 3PGA1 5HCNA 1Z5ZA 1IHXA 3KJEA 5LIRA 4HDSB 1BD3A 5U9CA 2Y93A 3PF8A 1YS6A 3WBJA 1M72A 1LQTA 1BA2A 4QUAA 4M1EA 5C7LO 1KFKB 2ZYUX 4WDRA 1WF3A 5A1TA 4ECAA 3SS9X 5HF8A 3G8CA 2SBTA 5KNDD 2QUZA 1TTTA 1KKMA 1H1DA 1QXSA 3DD1A 4OVKA 4PHHA 4Q1EA 5ALHA 4J29A 5FO0A 4OAPA 2X9LA 1GRNA 4TUYF 2H06A 5KB3A 1KH2A 3I23A 1DEAA 1TX4B 3TZHA 1R8XA 1JLSA 2ZBGA 1S02A 3BXXA 2R6JA 4HFJA 4Q3NA 4BJHB 4CR7A 5JASA 4LHVA 2LVBA 4L74A 1S01A 2P9BA 4LNUA 2YIMA 4DDMA 5ABPA 2HK6A 4AK9A 1R4ZA 2FVYA 2W83A 5JNLA 1I01A 1U1FA 2UUBB 2DKNA 3TG2A 3NOQA 2FNAA 3A1DA 4W8GA 1JFTA 1OTHA 1WVIA 2OOKA 1WE2A 3PD7A 2L0XA 3SQOA 3I83A 4D9CA 3QEMB 1C9EA 1CF9A 2HCFA 2EZUA 4YASA 5C5IA 3IESA 1SPXA 3H04A 4RDIA 3HG7A 3SN6A 2EQAA 4QODA 2ON6A 4PCLA 1AF7A 1MIOA 3DE2X 3C3AA 3FLBA 4HGPA 4WZBA 4EA9A 5B1EA 4IZ6A 5BWOA 2UU9B 3BMQA 5TQ0B 5KNBD 3GWGA 4D3DA 4G25A 5IFLA 1Y6ZA 2O7QA 4RVCA 3SLGA 3AHHA 2LIVA 3TL2A 2I4TA 3TEMA 1P5ZB 2L69A 2ZT7A 3UC5A 1TUGA 4RTNA 3A9CA 2ISCA 3BDIA 3MQFA 2XUKA 1E2DA 3N7UA 4F4DA 1V37A 2Q9BA 2V74B 2OFFA 1W44A 2JLAA 3OJCA 5I4IA 1RMYA 3K0AB 4QA9A 3QLTA 4RXUA 2P27A 4F3NA 2UUCB 1U04A 3LK7A 4FX5A 4MGYR 4Q4HB 4UBNA 1CEYA 1OLOA 2F1KA 2JGFA 3O2SB 1UM9B 3PKIA 5D1HA 4MI6A 5EXEA 3PIIA 3NCTA 2AS0A 2NQ2C 4DYHA 4L2IA 3FWHA 5ALQA 2ZI7A 4PO1A 2CNNA 2D2IA 1TEVA 1XL1A 4RXTA 1QIEA 4YJ2B 5TJ9A 1C8BA 2EQ5A 1HH4A 3GCZA 1GOTA 3AF1A 4NYMQ 1DKPA 4JYPA 1L0BA 2CMHA 5JRZA 2JA2A 2SKCA 2IX9A 3BJZA 3QXGA 4PG6A 4AAYA 3EPLA 4IP0A 3AIIA 5CITA 2HEGA 2IH4A 3OD1A 3QELA 3DFKA 1M76A 3P8ZA 1HDXA 2BH9A 2BGJA 5AVJA 3M4NA 4EYEA 4D3SA 1JEYA 1ID8A 4PGHA 1HDYA 1E2HA 3BTVA 1XU4A 2FWJA 1ZH6A 3DKRA 3KQKA 3EFBA 2M32A 1GGNA 1RM3A 3H1AA 3VC1A 5K2OA 1JR6A 3GJYA 1S7CA 1KK0A 3GUCA 3N2EA 1MJHA 2WF5A 4G1EB 3T5MA 2GI4A 4YREA 4YRNA 1YFLA 1XMOB 1CLEA 5DN9A 1GUDA 2GF2A 1E2MA 1DMRA 3C3CA 3Q1KA 5AJZA 1TVMA 4FE3A 3F4LA 1ZD3A 2W2TA 4AWBA 1Y6GA 3THWB 2XUGA 1JIIA 2WB4A 2JLUA 4U6SA 3AVPA 3KAJA 3D7NA 4M9XA 2NTJA 4R7GA 4ZCPA 1R27A 4MPDA 1FTNA 3NJRA 3AETA 3M9LA 3VUFA 3FCXA 4MSUA 3W7BA 1B23P 4GGPA 4ZC8A 3S81A 3TPFA 1ZINA 1ORRA 3BBLA 3Q0TA 3QW2A 3GRZA 2X8BA 1N8TA 4IXTA 4PGFA 4V02A 1WY5A 4G0NA 1NJ6A 1XQYA 4NFHA 1A04A 4QTYA 3EZXA 3OZTA 1F9AA 3CIOA 1SEVA 2VDMB 3V2HA 4DA0A 4KDFA 5F1YA 3REQA 2HR1A 2X9GA 1QIGA 3JVUA 3AFIA 3AQ4A 3EEBA 3JD4A 1TT7A 3J81k 1L4GA 3BSWA 4KR9A 2HCJB 3BTSA 3ZE0B 1VP3A 3B3AA 3FPSA 1AB6A 1TC2A 1YS2X 3SYRA 4C06A 3N2KB 1ZPDA 5JBQA 5C18A 2OY0A 3I9FA 3HB9A 4FSXA 1M6WA 5CYOA 4WK6A 4RLSA 1U4OA 4C1NA 2GERA 1U4SA 1PT6A 1W29A 2A9PA 3IAM6 3PWKA 3QZUA 4IDEA 2GEKA 3DL7A 4BNVA 1BQ3A 1SRRA 2VK1A 5DM1A 5KX5A 3NYQA 4QKQA 3K6SA 3U40A 4LNHA 5HX7A 1Y3HA 1KYTA 1NBMA 2AVNA 1ITZA 1PJLA 1U8TA 2B8JA 3JYLA 1ZW1A 4QQRA 3VI3B 5AOBA 4KXFB 4G5XA 4KGDA 5DM70 2I03A 3HO1A 1XMPA 3KZMA 4RD3A 4C6TB 5FBRB 2VUSA 2QAGB 4HNUA 1M3SA 1J25A 1I3LA 1R2QA 1YI0A 1ZIOA 3KFLA 4LBZA 2E6KA 5TGTA 2CK3A 4RCVA 2GLXA 3U9TA 3UUFA 3GN1A 4KQGA 1SUFA 2PSEA 2RGAA 4US2R 3OSZA 3TTYA 1EZ1A 1PGQA 2H2HA 2V4UA 3K6JA 1L8AA 2GQ0A 4RD0A 3Q7PA 1Z0IA 2F1JA 1THGA 1YR2A 4N6GA 2BE7A 2V6IA 3QXCA 4TTAA 2VI5A 3EPJA 4K88A 4AICA 3ZJUA 2HXSA 1QDEA 1LJ8A 2GZ3A 2I6QA 3GVCA 3HJUA 1AKRA 2VWHA 3OCUA 2ZYAA 3DO6A 3Q12A 4HN9A 4MW7A 1F2UB 3RT1A 2VSOA 2F4VB 2AXNA 5FH9A 3DAOA 3OBIA 2N3ZA 1RD4A 4V39A 5DNAA 1AC5A 1MQ9A 3L5KA 3A31A 3NKFA 4UM5A 4UNNA 1NJSA 1J2YA 3VQTA 7ADHA 5EKUA 3U48A 4G26A 5KNCH 2O7VA 3NGMA 3LQ2A 2H48A 1EDDA 2QLMA 4WBNA 3PTLA 3GGDA 4AQYB 3A10A 1XMQB 4CIVA 1E9VA 3AILA 3JSXA 1POWA 2JGKA 2EJWA 2HA4A 2PJZA 4RELA 5FBZA 2ZWPA 4E12A 4F2GA 1D0SA 1QH9A 4M22A 1J4AA 3RC3A 1CZNA 1QHIA 5AXCA 1NW8A 2VDWB 3X1WA 1WKCA 3CH5A 4Y0AA 3UWPA 2PA3A 2R8PA 2ODAA 2XMPA 4UCFA 4YJ3F 1SHUX 4ALKA 5LIPA 4E07A 5I7UA 1BVYF 3DKPA 1YJAA 2F3PA 3AKCA 3KLPX 1GZVA 3EOBI 5FOSA 1JPVA 2YJTD 3T12A 2V1XA 1D5CA 3NBUA 4OFWA 3RS0A 3HDJA 3TGPA 1AGPA 3RS8A 4N8EA 5GVRA 3EGDB 2GDJA 4C5AA 3BMQB 3N2KA 4WOCA 1DKQA 2QTHA 3VR3A 1LVHA 1ZIPA 4U39A 4L7QA 1TNDA 1V5IA 3T3NA 1UT8A 3NGXA 4UREA 1COWA 1DC4A 1T0HB 1UOOA 3BDAA 4BJ1A 1KKLA 2Q41A 3PPYA 5EZSA 5FB3A 2AI2A 4Q00A 4UTNA 5K8IA 1OBVA 3QUQA 4KLRA 4DYVA 3MSCA 1E96A 3D6HA 4KNYA 4ZEVA 4U5QA 2WJ6A 3L8FA 2B36A 3ZWXA 1SKYE 3AH8A 3CF4A 1CKEA 3D9QX 4G1VA 4Y6GB 1A95A 3UXYA 1GPMA 5IVPA 4LYAA 3WDKA 2QN8A 2W5UA 4NMMA 4YUYA 1I5RA 2PH5A 3MK31 1E4OA 3WLIA 4WVFA 4B3GA 5CCEA 2P3QA 1I32A 4H16A 4DQ0A 4A2PA 1NHWA 2A7QA 2OO5A 4BP9A 1W49A 1ST3A 4L50A 2IVFA 2XJ4A 5I8PA 1R16A 1A5BB 2PWZA 2XWQA 4OHMA 4Q48A 1I51A 3C3WA 4RUKA 4MX8A 4A6EA 4CM3A 1DS6A 1VMDA 1XC7A 4GX5A 5IBQA 1QIJA 4OD0A 4UUBA 4A6DA 4UXIA 1JHQA 4MUNA 1M6EX 1SNYA 4R9NA 1IXKA 1YBMA 1YVRA 5C81A 4QYMA 2JI9A 3OQBA 2XQFA 1ENYA 3O8DA 2QLFA 2PKYX 3HR7A 2H85A 3DDOA 4QBKA 3LUGA 2BSQA 3RR2A 5DXJA 4MPRA 5FAXA 1X1RA 5A4JA 3OCCA 1Q0QA 3I05A 2ODNA 1MV5A 1HLPA 2XMDA 5ER9A 3W6OA 2NP6A 4HPJB 4M0CA 4R7ZA 1U3TA 2CBZA 4LRSB 2NSJA 3K9QO 5CRIA 4BIMA 3IV9A 3VKGA 2CLEB 3F2IA 4WFJA 5JRDS 4XWOA 3S1LA 5J59A 1AU9A 3P26A 5IKMA 5AKIA 1KJ9A 2ODQA 4X00A 2JIMA 3BJMA 3PHHA 4EMSA 4PPYA 2RE8A 3MTGA 4A8PA 1YOVB 3WLHA 1SQFA 3GEHA 5DN6A 3VHLB 1P45A 4RNCA 4INZA 3QYAA 1V3QE 3ZNPA 2Z0MA 4DZRA 3FUXA 1CUAA 3QV1A 2WHPB 1Q7BA 1LRJA 1NLMA 4LDJA 4MWTA 3WLQA 5BV1A 4F4FA 3I30X 1W0KA 2GVNA 1VJ0A 4Y6RA 3ZPXA 3KZVA 2BISA 3TLBA 2H5IA 4B87A 4JI0B 2HPHA 3LZ6A 3KELA 3A3KA 1G20B 3LW8A 3L4KA 5HCUA 3B60A 1E2GA 1JSXA 4XPIB 5HEKA 3H7AA 4R4JA 1CR2A 2ZB8A 5A4KA 3EWSA 1I4TD 1S4QA 4B46A 2IHNA 1J6UA 3IAS6 2XOKA 3GJ0A 2BHLA 2YV5A 4AO7A 3PD1A 5JY1A 1AQNA 5J2UB 1QZXA 3HB1A 4RU1A 2EGHA 3A11A 4URXR 3WGIA 4G5SA 3FBTA 2FPRA 1MKYA 1RPJA 1USGA 3MF4A 2EXXA 3QBJA 1IG3A 1KAHA 5DGCA 3IOBA 5THKA 3B7WA 4U2GA 3G1WA 4RS4A 5CFZA 1F6BA 4B6RA 2ZE7A 1OT3A 3AJ9A 3GGJA 3C3BA 3PA6A 3I01M 5AJTA 2YMMA 4BC1A 2YHSA 5KYKA 3OM8A 1YFZA 3TSZA 3KQQA 3QF4A 4FTWA 5KNCD 2FX3A 3K0CA 3UMGA 4QXPA 1GKKA 5JBNA 3K73O 2QENA 1NBEA 2G4VA 3QVSA 3OG9A 4E4RA 2XMQA 3FFBA 5JCJD 3IS3A 5DHPA 3UQYS 4AIIA 1O2DA 1DZ3A 1JEQA 4FC7A 1KI8A 1EIWA 3KT8A 3NFRA 1T9KA 2XMBA 2IV3A 4UARA 1VSBA 1BMFD 3W2IA 3CG0A 3L84A 4UMEA 1G8AA 1Z37A 1PQWA 1SXJA 2ASEA 3UEOA 4R2IA 2Z3VA 4JJ4A 5FT9A 3FYDA 3CKKA 2EIHA 1NNLA 3HQ4O 3LTEA 3D7KA 3O75A 4HMQA 3VGJA 5J4KA 1EI9A 2C1XA 3ESZA 5BSVA 1TJYA 1PN3A 1XVUA 2GSWA 3I12A 1QB7A 2N42A 3ENKA 3WKBA 2R4TA 5HMLA 3PVCA 3RHSA 2WJVA 1Z7EA 1DOZA 1YZVA 1P4RA 4HMPA 2QN6A 3N7AA 3A6FA 5DB4A 1EESA 1L7AA 3U3OA 2G80A 1D1PA 1SCBA 1VE9A 3LFTA 4NWIA 4D80A 4DIDA 1I6LA 2SECE 3CB2A 5EVJA 3V4OA 2QX9A 5D2CA 2C83A 2WEKA 4HGZA 3A1SA 3ZWDA 5JSQA 4DBLC 5GV7A 3W5IA 3IPYA 2BDTA 3EXEA 1B2RA 2PXXA 2HLPA 1C7JA 2PBZA 3S1SA 2FLWA 2I87A 4HRYA 4IGFA 3DPIA 3NT5A 1V25A 1T5BA 4NK5A 1M8FA 1UDRA 3A70A 1BCSA 2IKSA 1ARZA 1ZUNA 2MOKA 4OHWA 3SBDA 3TB6A 4AJJA 3KYBA 1E77A 2AE1A 4KGXA 3ECSA 3BZBA 1XWFA 3AESA 3H2KA 3OZXA 4KN9S 3CN9A 4LZZA 1GD1O 2O4CA 3GUHA 5E7IA 5F33A 5SYMA 2C7VA 2V7QA 4C2BA 2WM2A 1MB3A 4Q9HA 2F1IA 1KY5A 1NY5A 4F6CA 2QOEA 3AERB 3EZFA 1FBTA 4YLGA 1SQ0A 2GCEA 4QGGA 3RTBA 3IVGA 1C81A 5EL0A 3D1LA 4XUDA 2HK7A 1D2EA 3KB6A 3AZOA 3L7JA 3IV7A 5K3SA 1EZ4A 2AXEA 2J5XA 3FSJX 1KP2A 4X61A 2IOQA 3UAOA 3DYIA 2ST1A 3UFBA 5FAKA 3CJQA 3T99A 3HYCA 3QUTA 2CXQA 2ZZMA 4P3YA 3T4EA 1TCCA 3OAAA 2YDXA 4YCLA 3BXOA 1NTRA 4OYRA 2HMAA 1ZSNA 2NYAA 4QXRA 1ZN7A 4BZWA 5I51A 2E85A 3D0RA 2NZYA 4GX1A 2EFCB 4OBEA 4L15A 4Y9TA 2A0XA 5JPCA 4DYDA 5L7TA 4FCTA 4CV3A 2Q6OA 1SCQA 1CB0A 1CP3A 1E94E 4G86A 4PC7A 1OTXA 2B7LA 2D5AA 4LSZA 1GAQA 2OEPA 2VDJA 4FD2A 5B1IA 2ZSIA 1NBIA 3UATA 3UH1A 4DM4A 1I2AA 1UFVA 2C2OA 4ZYVA 5JW6A 1B7GO 1J06A 3W4KA 4TMZA 2CV0A 3LCUA 4MQLA 2YXBA 2DHCA 4TUYB 1JA1A 4Z5XA 4MV7A 3FCAA 3QXHA 4RFVA 3KYDB 2NU8A 1YQDA 2OBFA 1HI9A 2WJZB 3HSYA 4JA0A 3TIFA 1AH2A 2CD7A 2CEKA 3V2UA 1RI5A 3MWFA 1US8A 3IOEA 5GAJA 1OIVA 2OM2A 4HDKA 4R1QA 2JZOA 3WLJA 5LOVB 3PCXA 3N28A 4ZT6A 5FWDA 2OFWA 1G9SA 4KAJA 4A2QA 3EMKA 2FQQA 4P5DA 4QNRA 4E4YA 1KGDA 2JIRA 3JQAD 1QRUA 4YIHA 2OKCA 2QTRA 4AN0A 1NURA 2GVZC 2ICAA 3RBAA 3WNDA 1WB6A 4BVEA 4YP0A 4J7UA 2PKWA 4GPIB 2OO7A 3WHPA 4C4RA 4TKMA 1YHNA 3GNLA 5CDSA 3F4BA 1A8UA 1TJ3A 3L6CA 4BFZA 4DUGA 1YMQA 2P7IA 4WLVA 4YMUA 1SG0A 3FIJA 2DWCA 1Z6AA 4PO8A