4TL8A

Crystal structure of n-terminal c1 domain of kaic
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
234
structure length
215
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 74
structure length 215
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl8A00
3IIKA 1LNZA 1N25A 1UKVY 3W6OA 4CW7A 1NN5A 5JECA 1ELOA 4C4PA 5KHOC 5KYKA 3K70B 3LVQE 1VDZA 1XXHB 1CBUA 1NMXA 1E2DA 1G64A 4P3YA 2C9YA 2BM0A 1HT2E 3MGCA 4Q4AA 1NIJA 4TYWA 1II8A 1G41A 5AUNB 3CBQA 5F9HA 2JLSA 3VAAA 2ZJ8A 3LXRA 5EE5B 3RANA 2ZRMA 1ZRHA 2ZANA 1XJ0A 3B5JA 1OW3B 4OI0A 4CYMA 4KFUA 1E9DA 4N3NA 3LLMA 3L2OB 4PPNA 1CRPA 1K8RA 1BIFA 3I5YA 3QG5A 2P6RA 3OAAA 2X2EA 4ZDJA 4ZIRA 1EFRA 2PH1A 3HU2A 4IXMA 4LDJA 3QJYA 2XB2A 2L0XA 1UEIA 3PXGA 2ZPTX 4Q00A 2WJVA 1RFLA 2YJTD 3HDTA 1V5WA 3PG5A 2AKYA 3LFUA 5IT5A 2FFBA 2ZRBA 5EE9A 4EPYA 3SHWA 3BRWD 1ZM7A 1SXJA 2JGNA 3BC1A 2ZS7A 3KQKA 2ZRPA 2RGBA 1T3HA 1TF5A 2MMGA 1ZBDA 4P4UA 2BWJA 1W0JD 1W0KA 2OG2A 2PCLA 1WRBA 3KTAA 4NYMQ 4XTRA 1Z0KA 2BDTA 4XD7D 2P6UA 4DLUA 4GSYA 3VR5A 1JAIA 1Z2AA 2VHQA 3UG6A 1GNQA 4YXWA 2BOVA 2W2TA 3TJZA 3VNVA 2QE7D 2OO7A 4D2IA 1QHGA 4GMXA 1AQYA 2P5TB 3K0EA 1E2IA 3NC0C 4JYCA 1TL7C 3E1SA 4JLKA 3OIUA 2FWRA 5KO2A 5F3WB 3UXMA 4B33A 3L0IB 2BEJA 1VG8A 2QM7A 1E9FA 2XX3A 3R9WA 1R8QA 5C18A 4HB3A 2KE5A 4IJMA 4DLTA 2QZ4A 1E2EA 2J0QA 2DYKA 2Q9AA 3P1JA 3MG9A 4KVGA 3GLIE 2GCOB 2ZRAA 2VP6A 5CK5A 1W0JA 1F2TA 1SZPA 2JASA 2OFXA 5CYPA 3TSZA 1DAHA 2WOOA 4B73A 3WYFA 4M4SA 1M7GA 3VQTA 3I1FA 2OCYC 4YMVA 3ZS8A 4QNRA 3VFDA 3GJ8A 1OKKA 3SE0A 3V4RA 4NYMR 2HLDA 3PEVA 4FCWA 4DT1A 1E2FA 2O8BB 2JCSA 5FPHA 4Q9HA 1V43A 5JEDA 1J8MF 4GOJA 1FNNA 1U8YA 1DAIA 5B57C 2IYLD 2VA8A 3ZIAD 3UATA 2GZHA 4PSAA 1TAGA 1Z6AA 4HAUA 3Q7PA 3DKPA 2NOAA 4NONA 2XEXA 4UNPA 1TF2A 3AF1A 4D82A 1KYIA 4TSFA 1W36C 4Q21A 4EFLA 5JFGA 5IDVA 2QQEA 4KLZA 1W36B 3VR3A 2G0TA 4RY2A 5GJVC 5H1YA 3BS4A 5LDDC 2V7QA 1NN0A 2EWVA 1E0SA 2QRNA 4AURA 4OQNA 3K9HA 1LF5A 4AYTA 3BFKA 3C7KA 3SJAA 2VLIA 1OIVA 3WHKA 4RD3A 3Q3JB 1H8EA 4MRSA 3REGA 1U99A 1CR0A 2PZGA 3A4MA 5EJEA 4XVQA 1S3GA 2CEAA 2IHBA 2PZEA 3LA6A 4LJYA 2ZREA 4KSCA 4ZIRB 1YKSA 5CB6A 4TMKA 3NH6A 5B30A 3CONA 2WWWA 1X1RA 1XDBA 2OBMA 2GAAA 1NJGA 3I61A 4G1UC 1EFTA 3VTKA 1UPTA 2RGAA 3SR0A 2VHTA 2AD5A 2WKQA 2WSSA 2VH5R 3ZZTA 2IW3A 4H1UA 2ZJOA 2ZU0C 1ZW6A 1LTQA 4Q18A 3G5UA 1EESA 1VYUA 1ZCBA 1GNPA 3QKSB 3T1OA 2R9VA 4LGMA 1FP6A 2ASEA 1IXRC 1RIFA 3KZ1E 3U7EB 2HCBA 2A7QA 1D2MA 2QROA 2RB4A 2WKPA 1GWNA 4HAYA 3OZXA 4YC7A 3R7WA 3ZD7A 1AKYA 4BFYA 3QXJA 1J7KA 2UKDA 3QBTA 4ASUD 2PX0A 4PZLA 1MO5A 2J0UB 2VF8A 1EGAA 4LHXA 3GLIB 2HUPA 1KO5A 3CKLA 2Q9CA 4IFEA 3IGFA 4JT2A 5G40A 1FQJA 4M9XA 2F9LA 4DSOA 5L3VA 3GJ6A 2ERYA 1MO6A 1AK2A 1ZNYA 4M1MA 2QQ0A 4U00A 1OIWA 2V54A 3CR7A 3WMGA 3GQBA 2WJGA 4L4UA 1P9NA 1Z6XA 2R8RA 2GWHA 2J59A 2KSQA 2GBLC 3THYB 4B44A 4RKFA 4BZQA 1NI3A 1X6VA 2N46A 4CEJB 3SJBA 4RZ2A 5L3RA 5B64A 1UKZA 2QPOA 1X8KA 3QQ5A 2AL7A 2YC2C 4LPKA 4Q1FA 5LPNA 4FI3C 2WMOB 3PCRB 4K46A 2EU8A 3EAQA 1MABB 4NBSA 2QMOA 2FFQA 5J5CA 1FP7A 4LSGA 2JJ8A 3DZ8A 3GCGA 4A8JC 3U3RA 5HZKA 1XFAA 4IDNA 1FX0B 1CP2A 1XX6A 2WWXA 4JVNA 4O2RA 3U3OA 1Z0JA 1E99A 3U6KA 1QDEA 4YDHB 1UADA 2ZS8A 4EKDA 4ARZB 3KB1A 3RS2A 4RFSB 3TH5A 4PSKA 3FTQA 2R62A 4Q1BA 4PPGA 1Y3AA 5GJCA 2IYSA 3VR6A 2RGEA 2OEPA 1XJCA 4Q4HA 4US1R 4FW9A 1NF3A 2B8WA 2OESA 1KDRA 3THWA 2PJRA 2WBLC 4OK3A 4QGFA 1G3IA 3N70A 4R9UC 1CJTC 4I1OA 1LY1A 3MUFA 3QPWA 4PHGA 3ASYA 5C2JB 1ZD8A 3T34A 2CJWA 3KQNA 1HA3A 2OT3B 4TL8A 4MDEA 2WVJA 3EWSA 3LNCA 1XB2A 2BMDA 1GDDA 2ZU6A 1KSFX 2OFOA 2Z6VA 4HB4A 3WRXC 4B47A 1VG1A 4B43A 4HYYA 2QGZA 4ZI2A 1KJZA 1XTKA 2GHIA 4BFTA 3UPUA 1XEWY 1VECA 4Q1DA 1NLZA 2C96A 2C5LA 4M53A 2P6NA 4TSFD 4P33A 3SJCA 2YWEA 1TQ6A 1W4AA 3K1JA 5K8IA 3ZZUA 4RCZA 1WCV1 3ND8A 3K0CA 4TLEA 1FZQA 2PL3A 4UJ5A 3ND9A 2QGNA 4DHEA 3BH0A 5JS7A 3CX8A 2FEMA 2FSIA 4GZLA 1TU3A 3U3JA 2C2HA 4B3BA 2GJSA 4LZZA 4V0OA 4Q4JA 2YZ2A 2FN4A 2GK6A 2H92A 3TAUA 2VTKA 1HT1E 2FF7A 4IFBA 3TK1A 2ZIAA 3UMSA 3C15C 1MO3A 5HKKD 1B23P 3ADBA 4YQFA 3GJ0A 1Z6TA 5JWOA 1E2HA 3EZ2A 1WB9A 4X8MA 3LBHA 4EJSA 4PFSA 5EZ6B 4F91B 3AUYA 1MH1A 2GDJA 1R5BA 2CXXA 1W49A 1S96A 1GL7A 1NMZA 1X86B 4F7WA 3RS5A 4B71A 1GL9B 4QBHA 2G6BA 4FWIB 5EP3A 3T35A 1ANKA 4MGZR 1QVRA 2DWPA 1XD2B 4CEIA 5FBLB 3QF7A 1T9HA 1GP2A 4LI0A 4LOAA 4DCUA 1JR6A 4HAXA 5FI0B 4A0FA 4QJ3A 2ZE6A 4MYHA 4CZ2A 4YXWD 4B3DA 3QENA 4QXAA 1PLKA 1KJWA 1E0AA 4MUBA 2ONJA 4DLXA 4DRZA 1IN4A 3W3AA 1DAFA 1UJ2A 3UIEA 2VYFA 1U0LA 4MKGA 2QAGA 2IC5A 1G4AE 1XTJA 2GEDA 1DEKA 2F1RA 5DI3A 3THYA 4EIWA 1G8FA 4MYCA 2WSSD 3K9LA 2A9KA 4WOPA 3A4LA 2OBLA 1TADA 3X2SA 3AB3A 1NVXQ 4DJTA 1VG9B 5DHAA 1KJYA 4QBGB 4MRPA 4NP6A 4POAA 1U9IC 2GK7A 2Q3FA 2CBZA 2HEIA 2WPDD 5H70A 3CRQA 3A8TA 2ECKA 1G18A 1II9A 3NVAA 3SYKA 3LBIA 4NMMA 2HLDD 2GAOA 4R71A 3NHAA 1A7JA 3QEOA 5KNDA 1E2KA 2BKUA 2G3YA 5DN6D 3A37A 4LK2A 4IDOA 3MLEA 4X8LA 3U7HB 1I4DD 2AX4A 1E9RA 2J0SA 2ZYVX 5EZ5A 1A2BA 1IAQA 4HAVA 4A6XA 1UFQA 1M7BA 4JBXA 3WXMA 4QNMA 1AGPA 3BIFA 1W2GA 1VG0B 2ERXA 2XAUA 1NBME 1TF7A 2AWOA 2FFAA 4DXAA 3GLFB 1LV7A 1OPXA 2CK3A 3AEZA 3WP1B 1TMKA 4YMSA 5AR1A 3U2QA 3ZIAA 2VRWA 1U0HC 3B1VA 4RJLA 5TVKA 4OK5A 1RE0A 1F2TB 2CHQA 4LHYA 5FUVA 2CMKA 2ZI5A 4AKIA 2C95A 3H2YA 3GLGA 1P9WA 1KNQA 3AKEA 1EWRA 3RHFA 2BV3A 1SGWA 3QKSA 1CR2A 1UM8A 1W5TA 1DOAA 1UBFA 2WJJA 3KJGA 4PPFA 1DE0A 1PZNA 3TNFA 3FKQA 3B8HA 3JVUA 3O47A 2ZJBA 1CKEA 2GF9A 1KMQA 5E7JA 1XEXA 4LJ7A 1P2UA 2J7PA 2E87A 3NWJA 1YZUA 3DHWC 3DOFA 4PR0A 1VCNA 2I1VB 2NQ2C 2RCNA 3OEED 4TMTA 4C0LA 3FHTA 2C78A 4TT3D 2LCFA 4IVRA 4A8JB 3B2EA 1N0WA 5J4VA 2Q3MA 4R7ZA 4A0HA 1RYHA 1F5NA 1Z0FA 4NHOA 2GJ9A 3AKDA 3WBJA 3PEYA 1L4YA 5HR5A 1OHHA 4B2LA 2RHMA 1E1RD 1GRNA 1AN0A 3Q85A 2ANCA 1Q1BA 3T1TA 2O0KA 4D26A 1A82A 1N6RA 4Q48A 2D7DA 1A4RA 1M1YE 3W6NA 4ABYA 5E7MA 4LV8B 5ELXA 4BZPA 1VCMA 5DSZA 2VHJA 1OXUA 3MRSA 1MT0A 3VR1A 5FUWA 1TUEA 4EFNA 2TMKA 5ANRB 2C8VA 5BN5A 1YZKA 5DHFA 1W0KD 4RD2A 1R0WA 1S1CA 4PC6A 3W6PA 2W00A 2GZAA 3REFA 1XTRA 4XOIA 4EPXA 1T3LA 4L5BA 2CK3D 3NDPA 3SS8A 3I8SA 4HLDA 1ZM2A 2OZEA 1F2UB 3RLFA 1G5RA 2PT7A 2JLWA 3U5ZB 2W6IA 2ZE7A 3BJIC 1MRSA 2Q3HA 4PQYA 1HE1C 4G5GA 1LVGA 1GG2A 4HSEA 1T5LA 1NY5A 4S2EA 2OV2A 2RAPA 1OXVA 2F55A 2IEZA 5UKDA 3TMKA 4MYTA 2JJ2A 3DEFA 3RS3A 2WOJA 4TYPA 4JLPA 1AIPA 5EE3A 1GSIA 4W7SA 4Y0VA 2XJ4A 3CWQA 5EP4A 2BBWA 3FMOB 4YLGA 1IONA 2BIFA 4LRWA 4MYUA 4TLDA 3OEEA 1ZNWA 3QIAA 4MUAA 1KTVA 4K81B 2RGDA 4AG6A 4QGAA 3RRMA 4A92A 4DLVA 5KOYA 2D4HA 3AF0A 4PO9A 4IHQA 1IXSB 2WAYA 1RPZA 2QA5A 2ZM5A 1SKYB 1VYTA 5JCZA 3G0HA 3K0CC 2X1VA 4U02A 3NXSA 4QJ5A 4IVQA 5KU1A 2B7BA 4OYHA 3I4LA 4GFDA 4KBFA 5AUQA 5H68A 5JRJA 3FB4A 5JJLA 4R2IA 1NSFA 4JL8A 3I32A 1QRAA 5FL7A 3SI7A 1RRCA 3SHFA 1QG2A 1HV8A 4BFWA 4KLNA 4OHVA 1DO2A 1HEIA 1MOZA 2BCJQ 2ZE5A 1TU4A 3X1ZA 4G0NA 3K53A 4QBFA 1XJQA 1VIAA 3BB4A 4DT1B 3QXCA 1IN5A 1Q44A 2AKAB 2ZAMA 3QVVA 4G5RA 4Z1MA 1E2GA 2GZDA 1T6NA 2FV8A 4F93B 4PXAA 4IW3B 3ZVMA 3BXZA 1JEEA 3GLFA 1K5DA 2QL6A 4M9QA 4EPTA 5EP2A 2QM8A 3I73A 3GLIA 1W36D 4NL4H 2BC9A 3EZ6A 3N2IA 2R6FA 1G5PA 3GJ4A 4LJ5A 4RZXA 4B32A 3N2EA 4ZCMA 1E9AA 3BBPA 1KY3A 2VSFA 4RCYA 3DMNA 4YONB 2R44A 3LBNA 4PAOA 1JAHA 3OIVA 2V1XA 4OJQA 3AP3A 1ONBA 1XCPA 2KB0A 2C9CA 2FGKA 2GXUA 2QUZA 2GCPA 1OXTA 2FPMA 1UDXA 1Z47A 3B1XA 1JXMA 2V8OA 1G3QA 4NCHA 1R10A 2IEYA 1US8B 2IUSA 2RMKA 5G53C 2AD1A 4BPBA 1AQUA 5CDFE 1OT3A 3OIWA 1AZTA 5DE3A 1AS3A 2F6RA 3N5CA 2KBEA 4CT4B 1L4UA 3BAFA 3SBEA 1ZC4A 3ZGXA 4AC9A 2CVHA 2YVUA 2E9SA 2IYRA 5KSPA 4CVNA 3TW8B 3ZS9A 4JLAA 2X19A 3A1TA 3K0AB 3OEHD 3W5IA 4S35A 1ZU5A 3EA0A 2VIIA 2HF8A 1YJ5A 2O8FA 3ETLA 1OXSC 1PLJA 2Q21A 4HI0E 2REOA 3K8YA 3QI2A 2I1QA 3NC1C 4I81A 4M1TA 5FTKA 1A2KC 1N6IA 2ZSBA 4TL9A 2G83A 1BYIA 4Q7KA 3ZD6A 4PAMA 5E3HA 3D3QA 4NH0A 4U5XA 4DIDA 3THXB 2GVZC 4ITRC 4UXIA 4HEJA 4FMDF 4N0DA 4EAQA 2QRZA 4AKGA 3EASA 5KDOA 1TNDA 2XSZD 3VKWA 3U4QA 3ADCA 1M8PA 4EJSB 4AYXA 1IY0A 1SXJB 2GESA 5FFMA 3TLXA 3V9PA 5D3MB 1UAAA 3U3MA 2CL7X 3LWNA 3EC2A 3CRW1 2QSZA 1PVOA 1SHZA 5JWHA 1W7AA 4O25A 2R6DA 2WZQA 4MGYR 3TIFA 1Q0UA 2BBSA 2REBA 4HZIA 4V0LA 3LAWA 2K5UA 4OK6A 3UG7A 1QHHA 3CO5A 2QT0A 5FOUA 4G3XA 3GFTA 2WWGA 3TQCA 2GJAA 3W8NA 3CLVA 4OHZA 2VP5A 4NE2A 2YV5A 4W5WA 1VIYA 3Q72A 2JJ1A 1R0XA 1TPZA 1IHUA 4I1VA 3D8BA 3DVLA 4PZZA 3TKLA 1E69A 1H8HA 2Z83A 3C16C 5BYJA 5KSZA 1KDPA 2JLYA 4C0SA 3PEUA 5EXXA 2F1HA 5EXPA 2IS2A 2B6HA 2DCUA 3I8XA 1JPNA 2GCOA 2ZUCA 3MWJA 2GEVA 2G88A 4I1UA 4DDVA 3MD0A 3TSOA 1EWQA 4KI0A 1UDWA 4BLRA 4NTZA 3RRZA 4C3ZA 1CJMA 3B85A 1Z22A 1RKBA 3NBYC 2D7CA 3MMPA 2NIPA 4ACAA 4HDCA 1RRPA 1YQTA 4GZMA 1PUIA 1A5TA 1PUJA 1OB5A 1W46A 1YZTA 1NSTA 2SHKA 2FU5C 3LH5A 2G0NA 4GT1A 1JPJA 3AF3A 1G5TA 4KYUA 4CRWB 1OH8A 1KI6A 2O8EA 1Z5ZA 3OE7A 3NBZC 5AUPB 5G3YA 4JYBA 2FFHA 3TVTA 5JJIA 1G6HA 1D5CA 1E96A 3GFOA 5SZJA 3RRNA 1ZUIA 2OHFA 2J87A 3GPLA 5JJKA 5FOSA 1Z0AA 2W6ID 1KKLA 2OLJA 4X8OA 4DCTA 5J4YA 2ZI3A 4Q4JB 2FSHA 2ZJAA 4JLOA 1XZQA 5L8VA 2ZROA 2X2FA 2ZSDA 4LJ4A 5HZHA 2ORIA 3KXLA 4C0JA 4DB4A 1RVDA 3NTUA 3FMPB 2VP9A 2Z4RA 4OQMA 2NO7A 3IO3A 1W44A 3RABA 3GD7A 2GXSA 2KI5A 3SFVA 5TARA 3K0FB 2C98A 5FTMA 1S4QA 3A1VA 4JJKA 1KI2A 5J4KA 1E2QA 2ZYUX 4WVFA 3RSOA 3RWOA 3EZ9A 2EWWA 4JLMA 1R0YA 4MITA 1AZSC 3BERA 3H1TA 3F3YA 4UXHA 4BFVA 3BE4A 3CH4B 2I3BA 4WBSA 5J47A 1JR3E 1OYYA 2WWIA 4L16A 1TEXA 2VSXA 3OF5A 4MGIR 4B3FX 2IX3A 5TXGA 5FR2A 1SVIA 2PEYA 5K8LA 4A8JA 2HXSA 5FUYA 2ZRJA 4HAWA 3U44A 1ZM4A 1HQCA 1W4CA 1KAOA 1LW7A 3OHMA 1U94A 3FVQA 5C4GB 5C4MA 2GILA 3CX7A 1FFHA 2C77A 4US2R 2QBYA 3U4QB 1M6NA 3QY0A 4TZ6A 4ZCIA 1SHKA 1DTSA 2QTFA 4TMVA 2A30A 2R6AA 3THXA 5FOVA 4PC7A 1OIXA 2HJVA 3ECCA 4QRHA 1HQYE 1GKUB 4PTLA 2YOFA 1WQ1R 2VP4A 2QEQA 1IOZA 2JLXA 2WMNB 3C14C 2B8TA 1E0JA 4HDOB 2LKCA 1E2NA 5LB4A 3NG1A 5DISB 1KO7A 4HATA 3DZDA 3PR1A 2G1KA 3KFXA 2Q0HA 3UMRA 5L3SA 4EPWA 2EFHB 1XEWX 1T91A 4TYNA 2H57A 4B3GA 5BQ5A 4YMUA 1H8ED 3L0SA 2DWQA 5DGXA 1T3SA 5KSOA 1E6CA 1YU9A 1I4TD 2ZI6A 5KTYA 2YHSA 4ZDWA 4TL6A 1SVOA 3AGPA 1KNXA 4XD7A 2OXCA 2XZOA 4GI7A 3P32A 1PJRA 1FL9A 4JSYA 1N5LA 4HAZA 3WYGA 2QMHA 4GDFA 5LD2B 1SXJD 3D6TB 4Q9IA 4AIIA 2ZRHA 3QF4A 4JVMA 3S1AB 3VHLB 1KI8A 3AVPA 2ORWA 2CNWA 5L3QB 4GPTA 3FYHA 4JBWA 3KKPA 2FEOA 3QKUA 3FMFA 2Q9BA 1XPUA 1EFRD 4LYAA 2JDIA 2WWHA 3WRYC 5GVRA 2REXB 1OKKD 2AHOA 4LC1A 3ICEA 3IHLA 4LYFA 1J70A 1U98A 2XNDD 3U61B 4GMDA 1EFHA 2QAGB 4D81A 1YZQA 2A5FA 2J7KA 3KKOA 3IPXA 3BWDD 2ZI9A 4JL6A 2ODNA 4DCNA 1NBMA 4DLYA 1G3RA 1R5NA 1ZU4A 3AGQA 4UJ3A 4B6FA 3HR8A 2WJYA 4Q02A 2DFTA 2PLFA 1Z06A 2DHRA 3IDQA 1OH5A 2JEOA 2NMVA 1RYFA 1DPFA 4JMPA 3ZLJA 4XIGS 3EA5A 1NRJB 4O3MA 2ZRIA 4M1SA 1OXXK 4HB0A 3KUDA 3CNOA 4M9ZA 3KTAB 2OAQ1 2ATVA 4WXPA 5FTNA 3SC3A 2ZUDA 1I4LD 2QE7A 4FWTA 1VCOA 3T15A 3RYTC 4BLTA 1XU4A 2FA9A 1DADA 4PC1A 2OSBA 4CEHB 3M6AA 1R7RA 3DM9B 3U7GA 2JJ1D 2Z5FA 1N6LA 1JR3D 4A0GA 1COWA 3HU3A 5G41A 1WBBA 3NDBB 4C0AC 1OV4A 1ODFA 1CTQA 4OKSA 2V6JA 3P26A 2G1JA 3M0EA 5F9FA 8OHMA 1P3JA 1TQ2A 4JLDA 3S1AA 2B7CA 1WF3A 2FX3A 2BKEA 3NEJA 4G5OA 1XP8A 2YWFA 2ZR9A 1QHHB 2VP2A 5HCNA 5B2ZA 2JIZA 5IK2A 3AVVA 2C04A 3VKHA 1FMLA 2W0SA 1IN6A 3B82A 2JATA 1YZNA 3MFYA 2B92A 1J2JA 4B3XA 4V0MA 4RD4A 2FPKA 3HWSA 4KXFB 2N1BA 3NHBA 4L8GA 4OL0A 5FPSA 4PPQA 1ZNXA 2P3SA 5FR1A 1NVWQ 5AJZA 3KJEA 4DEXA 1BMFA 1E3MA 4GRAA 3TE6A 1QHIA 3CW2A 5JSZB 2QPAA 4RSGA 3A1WA 4HB2A 4Q66C 1Q1ZA 1WXQA 1T8UA 5FI1B 2BMJA 3WNDA 5FPKA 1GOTA 1JJVA 2WSMA 1JBKA 4FXPA 2WPDA 1E32A 1P2TA 3RSLA 4E22A 4LCBA 3GJ3A 5GADl 4WW0A 3QXSA 3H86A 1GIAA 2IS1A 5FOXA 3SQWA 1XD8A 4CIDA 3U7FB 1MV5A 1BKDR 1G19A 1Z3IX 2R6GA 3A4NA 1OH6A 4C7OB 3V4FA 1RJ9A 3CNNA 3AQ4A 3CPHA 3CF6R 2ODEA 4V0ME 3LV8A 5C1BA 1YR8A 4KAXA 3I62A 1DVRA 3DMDA 3QUSA 2ONKA 5DI9A 1ZUHA 4B3CA 3CZQA 1G7RA 5L3SB 3PV0A 1D6JA 1VKJA 1G7TA 3EZ7A 3I5XA 4PAQA 2RKOA 3K70C 4ZV4A 1NIPA 2A3RA 5FH9A 2O52A 4DCVA 2IXFA 3OFND 3Q5DA 2WTUA 4URWR 1G16A 3PUVA 3JZMA 1G8HA 1KDOA 2AWNA 2X8AA 3WNBA 3IILA 5TY0A 2PZFA 1Z6YA 4TYYA 1UKYA 4ON9A 1QZXA 2RH5A 2FZLA 3KXKA 1UEJA 2NPIA 3O8DA 1JECA 1MRNA 3CPEA 1FUUA 1U81A 1YR7A 2DFKB 3G82C 1Q20A 1NKSA 1QHSA 4PO8A 2QP3A 4XH9B 2A78A 2P2LA 5CDFA 1YR9A 4F4JA 2BEKA 4OHWA 5EUMA 4L9WA 4L9SA 1E4VA 3WP0A 1RJ9B 3UANA 5L3QA 1IM2A 3FHOA 2DR3A 3IPYA 4LJ6A 4MKFA 2QBYB 4OI2A 2VF7A 5JCPA 1XXHA 2F1IA 4M1YA 2FPLA 2KWIA 2BMFA 1DAGA 4II7A 3T12A 5JHGB 4JIMA 1QBKC 2YOHA 1RC8A 1WBDA 3BH6A 5DYGA 3QKRA 2O8BA 4TQ9A 4CGZA 4D0GA 4C2TA 4JVLA 3ONWA 3PUYA 4WZAE 5E4FA 2BHRA 5EE0A 1R5OA 1IJEA 2HDNB 1KO8A 2J9RA 4F38A 3GLFE 3IUYA 2GXAA 1FQKA 4TYQA 2FE4A 4LJ8A 1AS2A 1XPRA 1XF9A 4LJ9A 3RS0A 5F98A 2WKRA 4Q5IA 1E1QD 4URZR 4RD0A 2V6IA 3M1IA 2E1RA 1XXHE 2JIZD 3K09A 5IK2D 2OCAA 4L15A 2BCGY 4DWJA 1F60A 2F3TA 2FOLA 1IJFA 3H4MA 1G8YA 3EPKA 2W83A 3IEUA 1P5ZB 4P4SB 3C4JA 1W4BA 2WAXA 2XSZA 1DBSA 2WWFA 3KX2A 1T0HB 4PO1A 2NO6A 3GEHA 3NKVA 2YNMA 4E5UA 1JXOA 4LUCA 4BFSA 3PJRA 4TQAA 1KY2A 2ZR7A 3EIQA 2NO1A 1P4SA 3RAPR 2F43B 2W2VA 2N42A 2QORA 4PQFA 3ZQ6A 2ZRCA 4TTRA 3FKSD 4ZPXA 1S1MA 4LYHA 4B76A 1M34E 2ORVA 3O8CA 2R2AA 3L82B 1N6PA 1P61B 4RD1A 4W5JA 1OH7A 2NZ8A 3GEEA 2GRJA 3LVRE 4LYJA 5JLJA 5EE1A 1SVWA 2XTNA 1SKYE 2C03A 3CRMA 1Z0IA 4AKEA 4MRVA 4M2LA 3AV0B 3CUEF 4QJ4A 2PMDA 2PJZA 4DVGA 1XCGB 3K70D 1OLOA 1LS6A 3UKDA 3VHXA 1VHTA 2ZS9A 4G5SA 1LFDB 2OBNA 5CB8A 1KI4A 2Z43A 3PENA 821PA 2GETA 3AVTA 1SVLA 2IK8A 2YC4C 1FPMA 2ZI4A 2ZR0A 4JKYA 4AD8A 4C9BA 4IOLA 5EP1A 1ZD9A 2IYUA 2MMCA 4JKIA 4UQOA 4WAUA 1FMJA 1JI0A 3D31A 4A15A 4DSNA 5CM8B 4A2WA 4TZ0A 1F2UA 3QVUA 2AR7A 1W5SA 2WJHA 4BRUA 1NNEA 4G01B 1LB1B 3O8BA 1T8TA 4KSBA 4CF7A 4A36A 1SVKA 5AJYA 4A2PA 3AF4A 1Q3HA 1Z0DA 2R65A 1KI6B 1G7SA 4A6PA 2EFEB 4NDZA 4EQ6B 1ESNA 1H65A 3AKCA 4KFRA 1XMJA 1Q3TA 1ZAKA 4W9MC 3QEJA 4I1SA 2GJ8A 4RZ3A 1DAMA 1GL6A 2JAQA 3QNUA 4DCSA 4QGHA 3NIBA 3SN6A 1S0UA 4NCNA 4A9AA 4Z1MD 3C5CA 3LX8A 4ILEA 1X3SA 3CH5A 3SOPA 4BZXA 1GRQA 3TAHA 3VKGA 3FFBA 3K9NA 4Z51A 3ICQB 1HYQA 4BRWA 4F4IA 2CJWB 3DM5A 4UXJA 3E70C 3DO6A 4JL5A 1Q1EA 4JLNA 4LC0A 4BFZA 2XJ9A 2G77B 4OI4A 4IEEA 5FBQB 4Q19A 2OAP1 3FMIA 3IBGA 3RRYA 4O2LA 4EUNA 1KI3A 2HJGA 4O0MA 3U60B 4FMDB 3B6EA 4GP6A 1C4OA 1G20E 3B1ZA 3GP8A 2F3RA 4HZUB 4UNSA 5FTJA 2QMEA 4NPHA 2BJWA 1U8ZA 5KSYA 4C2UA 4YMTA 2CLCX 1BH2A 2QNRA 3KKMA 4NYIR 4FMBB 3IO5A 3GJXC 4ZDIA 1GUAA 2A2ZA 5DLQC 2ZUBA 3UWOA 4QOSA 4BLSA 3SZRA 4C7OA 1OFIA 1Z6GA 3B9QA 2GJKA 4KFTA 4QHSA 3RDPA 2R6CA 2ZRDA 1ESMA 2D2FA 1GRRA 3F8TA 1QHNA 3MJHA 4QC2A 4QGGA 3EX7C 5JRZA 4KITB 4P31A 3EW9A 5JEEA 3KQLA 1KZGB 4XJXA 4C30A 5AK0A 1KAGA 3ZQJA 2ZYWX 2QT1A 4LBWA 3EPJA 1OHHD 2DPXA 4C0QC 3FE2A 3HPQA 3IHWA 1J8YF 4NYIQ 1R4AA 1JQLB 2OLKA 3SQXA 2O8DB 1KIMA 4QHTA 5AJVB 1CF4A 4LV5B 4IDHA 4NYJQ 4ZKDA 3T06B 1TX4B 4D80A 4EJSC 1R8SA 4HZUA 4IRUB 5JHHB 4KU4A 4IEIA 4Q03A 2FMXA 5CITA 4NZYA 4EFMA 4CEHA 4HLQB 3RS7A 1XTIA 3WMEA 5FUXA 2ZSEA 2V1UA 4LBVA 621PA 1OB2A 4HLUC 1T4GA 4JBYA 1G7CA 1JR3A 4OJKA 1AGRA 3BH7A 1D2NA 1NY6A 2AK2A 1CULC 3CPJB 4FMCF 4Z54A 2ZJ2A 1D2EA 3X1YA 3FKSA 5FPTA 1N5JA 3LW8A 2XITA 2OE2A 3EIEA 4Q7JB 1E1RA 1FUKA 3CRRA 3OESA 4BEJA 2HXYA 5B58C 4DLZA 4J0QA 2RHDA 4B75A 1ZVQA 4OQXA 4D6PA 3EPHA 3DL0A 3IIMA 4Q4HB 5JS8A 1P9RA 3GMTA 4DZZA 2WHXA 2LKDA 3ADKA 2Q6TA 2IF2A 2IXEA 5A0FA 4DUGA 3RC8A 1EFCA 4QKQA 1NBMD 5CJPA 1XEFA 2W2XA 4JT4A 5HE9A 721PA 1SULA 4XWKA 4RZUA 3EWAA 3NBXX 2J0VA 1KK0A 1B0UA 2VBCA 1Z07A 3FOZA 4V0NA 2YWHA 3THWB 4Q4LA 5JSZA 4AKHA 2VHCA 4RD6A 1H8HD 2JDID 2P0EA 1SVSA 4ERNA 5KNCA 3VU9A 1SXJC 5P21A 3Q7QA 1E2PA 4MH0R 4C0HA 4TTQA 4KCGA 2FG5A 3AVUA 2NGRA 1VCIA 2AFHE 3I92A 3KXIA 4AWXA 1ZP6A 1S9HA 3B13B 3W3ZB 3FGNA 4DDWA 1CR4A 3IQWA 5EUQB 3MCAA 2EYQA 2C9OA 4NCIA 3PUWA 1IBRA 1S3SA 2UZ3A 3KL4A 2ZRLA 3OE7D 4LV6A 5EXTA 5JWRA 4TWZA 4M1KA 1DG1G 2CCGA 1UBCA 4AG5A 1Z28A 3BOSA 3PITA 5EQTA 4BFUA 3THOA 3QXHA 5IF9A 4MDFA 1WA5A 4TLCA 5DO9A 2P67A 4P4TA 2HYIC 5JI2E 1CR1A 2MSCB 4IOKA 1AS0A 2ZRFA 3P27A 2OCBA 1W4RA 1ZIPA 3VNUA 1SVMA 3L43A 2RGNC 5KDDA 1O3YA 4PHFA 1GZSA 4LHWA 1KOFA 3B1YA 4N0EA 2ZRKA 4A0RA 5HPYB 2GEUA 2OCPA 3SYLA 3TUJC 2P65A 1ZM3A 2H17A 1N3BA 4XVUA 4KV9A 4LJAA 3CB4A 2ANBA 2J1LA 3A6PC 3ZVLA 2EFCB 1Z63A 3R8CA 1ZUNB 2JLZA 5D3QA 1CS4C 1FX0A 3ZDQA 2A5GA 2NG1A 4HLCA 1E98A 1XNJA 3B78A 3HYRA 1UF9A 4A82A 1XD9A 5HKKA 3MWYW 1MKYA 2AFIE 1Q21A 2FGJA 4DLSA 5DI3B 3F5FA 1CJKC 4YMWA 1XMVA 1YVDA 3QXXA 5G3ZA 1NVVR 3A1SA 1HY3A 4PZYA 1D9ZA 4Q9LA 1HUQA 1IN8A 1GTVA 2IYQA 2HT6A 1CU1A 1QF9A 4DEYA 2H8KA 1Z83A 3Q9LA 4EPRA 1NG9A 1LF0A 3W8RA 1G6OA 1JALA 1FNMA 1NLFA 5BW8A 2BMEA 4EQ6A 2DWOA 2BBOA 3BB3A 1M2OB 2NZJA 1U90A 3QF4B 2ZRGA 1UBEA 4QM7A 3U44B 4KHZA 3BGWA 4G5QA 1ZMXA 3DPUA 1HURA 2QAGC 4OBEA 1U8AA 4BWYA 5LD2C 1KK3A 4R98A 1T5IA 3AP2A 5FOTA 1G291 4LY6A 4E07A 121PA 1E0KA 4V0KA 1ZCAA 2A5JA 1MO4A 4NU0A 2IF0A 2GA8A 2ZSFA 1MR3F 3CX6A 4JLVA 3VR2A 1GAJA 1NMYA 2YYZA 4GNKA 4AY2A 4FCTA 2W0MA 5K8UA 3T5DA 1GKYA 2IT1A 3RNLA 4F92B 3HPRA 3E2IA 2QY9A 3SBDA 3VU9B 4BLPA 3K09C 3BFXA 1JEDA 2HCJB 2C99A 1TTTA 5A4JA 1N6OA 5FTLA 2O0HA 1N5KA 1E94E 1EFUA 5J40A 3U6BA 1HE8B 2OILA 1YR6A 1BYUA 3P4XA 4M22A 1R6BX 2EYUA 1NJFA 2W6JD 4EPVA 3OFNA 1G4UR 1QG4A 4DIEA 2JLQA 4I4LA 4V02A 1J90A 2CHVA 2WICA 1P62B 5SZKB 2RGGA 4E03A 2ZJZA 3AVXA 2ZQ5A 1S2MA 4IVPA 1UBGA 3SDZA 5AUOB 4FD2A 5K8TA 3IKJA 4NKRA 4MGKR 3W9YA 4MQBA 4TMWA 4DB2A 1FTSA 2VQSA 4LBZA 3WMFA 4ESHA 3CIOA 3L8ZA 2O8CA 4D0LB 3TUZC 1K5GA 1KMHB 3RS4A 3CF2A 3OIYA 1TQDA 4FCVA 1VHLA 3BK7A 1NG1A 1XD2A 4URVR 4YDSA 3SJZA 1U2RA 5C46F 2XGJA 1GFIA 3K0AA 1G8GA 1KO1A 1P6XA 4TLAA 3R9XA 1NKTA 4TTPA 2IA5A 2W6JA 3TSWA 1OFHA 2EFDB 4RVCA 4GL2A 1VTKA 1G17A 2GCNA 3I72A 5CM9C 1ZJ6A 1XWIA 3B7GA 2ZTSA 2CHGA 3AVOA 4JLJA 1GILA 1BMFD 2WIAA 4UNNA 1G3MA 2OM2A 3ASZA 1XZPA 2QAJA 3PUXA 521PA 4UNRA 2EFGA 4N1AA 4DDTA 3ZVRA 2W58A 3QG1A 5LBIA 2CNWD 4ZCLA 5BXQC 1G3UA 4BASA 3WYAA 2H1LA 3R9IA 4JJZA 3KKQA 2ZYTX 4V03A 3KJHA 3RC3A 1ZNZA 3ZZ0A 1CRQA 4LHZA 3TR0A 1VYVA 4QL3A 4XTCS 1TQ4A 2HV8A 1KMHA 5DNYB 1IN7A 1KDTA 3AM1A 3H84A 5CK4A 1CXZA 4BEBA 2FDCA 4JVSB 2BJVA 1OFTA 2AN9A 1G1MA 3LQRA 4GBMA 2VPPA 3SU8A 2CCJA 3ZH9B 1NL3A 4B35A 5DIFA 2ODBA 1Z8FA 3P20A 5KPJA 1PLLA 4I99A 4QBIA 2CCKA 2EVWX 2MSEB 2WIBA 4LX0A 2VO1A 5TMPA 4EDHA 3KJIA 4DC9A 1BO6A 1L2TA 3ZYCA 2NO9A 1CJVC 1QHYA 4DDUA 1N6NA 1YRBA 2NTYC 2V4ZA 2PBRA 1R2QA 4D4MA 4BLOA 4HUTA 2HT1A 1EXMA 4P0TA 4H9GA 1F48A 2IS4A 3OEHA 2IS6A 3GLHE 4JSTA 1Z29A 1RRFA 4IXNA 4H1VA 2BBTA 3HYTA 3T1QA 1YHNA 3A36A 3L0OA 1F6BA 3MWLA 2D74A 2PT5A 5CLLA 4XWAA 4Q7MB 3SYNA 1ZD1A 2XZLA 3DOEA 3VX4A 1OSNA 1XTQA 1P75A 4ACBA 2V3CC 1N6HA 2HYDA 2CL0X 4HUQB 3FWYA 2ZAOA 4DSUA 3CM0A 2OFWA 1KGDA 5M04A 3FHCB 2Z4SA 3W5JA 4OHXA 4C0BA 4MKHA 1M74A 4DLRA 5H8WA 3EIHA 5TDHA 4D25A 5JZVA 5TB5A 2EQBA 2IL1A 1JJ7A 1QVAA 1NN1A 1C1YA 3GLHA 4TQUS 1N0VC 2IYYA 4UKDA 3T61A 4URXR 1W1WA 1SXJE 5EXSA 2GBLA 1DO0A 2CE2X 1AM4D 4IOMA 4PC3A 1II8B 2WJIA 3LRPA 2V7QD 2IBMA 2H5EA 3KQUA 2DBYA 1XTSA 3PVSA 1N5IA 2RGXA 3PIRA 4NCJA 4BLQA 1Q12A 4B74A 3BB1A 2ZVPX 3AP1A 4Q01A 3CR8A 2IXGA 2PMKA 2XNDA 3A58B 3EZFA 2AXNA 3Q5EA 4LHVA 1DAKA 3SEAA 4KYIB 3TQFA 2F9MA 2PLRA 1NVVQ 1K6MA 1Z2CA 2XXAB 3K0FA 1JQJC 4PHHA 4M1OA 4GP7A 5BN4A 3EXAA 1KI1A 2CE7A 2XTMA 3IIJA 2XNSA 2CDNA 1CIPA 3TR5A 1BS1A 3Q8XB 2J3EA 2X77A 2D2EA 1T0JB 4RKEA 3T5GA 2F1JA 2DB3A 3FDIA 1CEEA 5KUTA 1ZIOA 4AYWA 1OFUX 2FSGA 3GLGB 2RGCA 3HP1A 3AF2A 2IYZA 1KI7A 4QM6A 1X8LA 5KDLA 3WHLA 3A1UA 2QTHA 4DUGD 2ZRNA 5JI3E 1P60A 5J4HA 1ETUA 1US8A 4RFSA 1VPLA 3LQQA 1I2DA 2VL7A 2IWRA 2ZETA 4P32A 3O8RA 2IUTA 2OXRA 2UZIR 3K9GA 3TVDA 1KSHA 3J81k 3R20A 4ZO4A 1RZ3A 2ZSAA 2JJ2D 4W5HA 4K8OA 4CEJA 3OAAD 5FPYA 3QE0A 2JLVA 1DG3A 2UVQA 5IRCD 4BUJA 3PEWA 2QMUA 2YOGA 2IHYA 1N6KA 3GJ7A 1KK2A 5FBWB 1AJEA 3GEIA 4IOJA 4MRRA 5LB2A 3LXXA 4DSTA 4GOKA 4XWOA 4Q1EA 4DKXA 4Y0AA 1YRAA 5J4LA 3C5HA 2NO0A 2D06A 3KKNA 2OUKA 2BVNA 2IUUA 4C0KA 1GITA 2QPTA 5AWFC 1OYWA 3KFVA 2YKGA 4HLUA 4Q7LA 1A1VA 4A1FA 2XXAA 5CLQA 1JNYA 2XOKD 2AXPA 2JLUA 5SZIA 2DFLA 3PQCA 3ADDA 2CL6X 1FTNA 2V9PA 3L8YA 1YZGA 4Z8XA 2I4IA 2J41A 4XSHA 4A2QA 5F2EA 5IHPA 3C8UA 3NBFA 2J0UA 3M4YA 3QBVA 4IDPA 4BE7B 3KB2A 2O8CB 421PA 3X1WA 3KUCA 1XMIA 2F43A 2QU8A 3DDCA 4Q4AB 1IQPA 5DN6A 5FOWA 3ZJYA 2FJUA 4RFVA 3V00A 1GNRA 1E2JA 4ZI3A 4M21A 3GLHB 4PQRA 3LW7A 1KZ7B 1X8JA 5HE8A 4M8NE 3JZAA 3U3KA 4PHTA 3VX3A 1WDTA 3E5HA 1XPOA 5KPDA 1KKMA 5A5GA 2XTZA 2H16A 1C9KA 1L7VC 2GKSA 1G9XA 2J7PD 1E4YA 1IY2A 2VEDA 1DAEA 3QPUA 3LDAA 1MABA 4DLWA 3H0KA 3MSXA 4ZDKA 2QP4A 4TL7A 4XVRA 1W2HA 3CF0A 3BFVA 5KNBA 5CJ2A 1II0A 2O8EB 4QFMA 3TUIC 3WNCA 3ZVNA 3L0PA 4LPSA 2QI9C 3B60A 3HJNA 3LO5A 5DYIA 3GFPA 3KQHA 1U9IA 3TBKA 2QN6A 3HR7A 1Q1QA 1DELA 4KODA 1WMSA 3CRVA 2DFNA 4FIDA 3AH8A 4NYJR 3LX5A 2DY1A 2KJQA 4GOXA 6Q21A 1EG7A 3I3SR 1CJUC 1P72A 4IKEA 1KSJA 1BOFA 2FSFA 3PFIA 4KJZA 2ZXUA 3AVYA 1UKEA 4OHYA 1HH4A 2D3WA 3QOFA 2GTPA 4OQFA 2XB4A 4Q1CA 1ZM9A 1KO4A 4Q1AA 4TN1A 4BFXA 2PEZA 4BGDA 3MWKA 4KVAA 1VMAA 1X1SA 2WM9B 2CLSA 2ZVQX 4WA7A 1GKIA 2J46A 4U7DA 3D7MA 3B1WA 4X8HA 1HTWA 1P73A 3WBKA 3R8FA 2O8DA 4BECA 3LY5A 4WZ6A 4JS0A 2V55B 1E79A 4US0R 5FL3A 4D0NA 2NPFA 2FH5B 3BD9A 1L8QA 2FNAA 2KBFA 5HCIA 2ODWA 4B6EA 4OI1A 2YWGA 1TEVA 4ASUA 3R7WB 2GVDC 4HUQA 4PX9A 4D4KA 1Z08A 3LLUA 4URYR 4AI6A 1N2CE 1IY1A 4D4JA 2B21A 1OF1A 4QG7A 3X1DA 3IBYA 1S9DA 3CZPA 4WXRA 1Y63A 2IYWA 2QTVB 1CLUA 1N0UA 3GJ5A 5AJWA 3UK6A 2JA1A 3SNHA 3AUXA 3AVQA 4DBLC 1PV4A 1P2SA 2IYTA 2WV9A 2ZI7A 2BM1A 2ZEJA 1NLYA 3IQXA 1EK0A 5AJXA 1WP9A 3QSYA 4Q9KA 3CWZA 1ZC3A 4ESVA 3C41J 3WY9A 1E2MA 1AA9A 5JBQA 1XRJA 2CLDX 4CEIB 1D8TA 3HU1A 1I2MA 1Q57A 5GJWC 1O87A 4JZKA 4UNQA 1E9BA 4CT5A 1E9CA 1G8PA 2ATXA 2IYXA 1XEXB 3QPVA 3EARA 3MAAC 1S8FA 4JLBA 2G9NA 3RVBA 3NH9A 5GJBA 1SKQA 4FINA 1P2VA 5BWMA 3T1VA 1J99A 1RW4A 2J5XA 3PUZA 4B2IA 2A5DA 5E7IA 4ARZA 1XCMA 3VR4A 3RWMB 2A5YB 4Z8YA 1XMSA 1F3OA 3P4YA 2IYVA 4B34A 2P5SA 2H18A 2QENA 4HDQB 2Z0MA 5HTKA 2Y8EA 2VHUA 1KHTA 2EW1A 4KFSA 3EG5A 1E1QA 3UWKA 4B48A 3JVVA 4WZBE 1YZLA 2HF9A 3FFAA 2ZJYA 1JB1A 1ZYUA 1IXZA 4Q47A 2MSDB 2WWYA 1DS6A 3TGPA 2FZ4A 5BYKA 1AKEA 2GF0A 3F0TA 2XOKA 4FN5A 2O0JA 4TMXA 1XBTA 1DARA 2QP9X 4TMZA 2J45A 3AKYA 3B9PA 5TV2A 1E9SA 4PC2A 2LWIA 5CYOA 1D9XA 5D3MA 4E09A 4F4CA 1COWD 3DKVA 4NCKA 3TW4A 3W34A 4B2PA 4PANA 1FOEB 1KK1A 3EC1A 2ZJ5A 4FMCB 3NEYA 1E79D 5E95A 1E9EA 2O5VA 1SQ5A 4R2HA 3K0SA 3CNLA 4PSVA 1G21E 5JMTA 2H7VA 3GLGE 3AVWA 5CIQA 1QHXA 1GVNB 3QKTA 1R0ZA 2ZE8A 4M9SA 1EX6A 3FPAA 4MKIA 4BQSA 3MJRA 4M1WA 2QG6A 3SFZA 1W47A 3KDSE 4KBGA 1GM5A 2ZITA 4TT3A 3W90A 2PX3A 1KSGA 1Q22A 2JLRA 4ZKEA 4A4DA 2GNOA 5FBVB 3EPLA 4MRNA 4TLBA 2VP0A 4URUR 3IEVA 1OE0A 2PCJA 4WIAA 4CDGA 1NP6A 3BORA 4MA4A 4AK9A 4XSGA 1WE2A 5FBRB 3UMFA 4IDQA 1ZINA 2RGNA 1NVUQ 4LBYA 4Q9JA 4D4LA 2VSOA 2YINC 221PA 1W48A 3VMFA 1FW6A 4LWZA 5SZHB 5DH9A 5GVSA 2QSYA 1RRGA 4P4SA 3TRFA 4QHYA 4OQLA 1U0JA 1KI9A 5BN3A 1OJLA 2XZPA 1TUIA 2O8FB 1EX7A 4M0LA 5FL7D 1M7HA 2CVFA 3LD9A 1E2LA 1NN3A 1YE8A 2IWHA 5CIWA 1LS1A 1P7CA 2F7SA 4KO8A 2AK3A 2D62A 2GXQA 3X1XA 3QKRB
chains in the Genus database with same CATH superfamily
2LDBA 3W6OA 3I04M 4ZYZA 4LSMA 5MHTA 4ZOBA 2DPLA 3CW8X 3KB6A 4D9BA 2P1ZA 4CW7A 4D9IA 3PWZA 1GT91 1XALA 3PDUA 4UREA 4IWNA 2JZNA 1J1IA 3FR7A 4Z0NA 2IYAA 3VI3B 2PZ8A 2ZT8A 1RC1A 1G64A 2HA3A 1ZA1A 4OVKA 2IIBA 3B9BA 4Q4AA 2QXTA 4FFVA 4HQ0A 1XHFA 4JB2A 1G41A 5AD1A 4XLLA 1VB3A 4M0CA 4EAAA 3VAAA 1WTCA 2ZJ8A 1RPAA 1ZRHA 3M81A 4HWSA 2K4MA 3FDXA 3B5JA 5GJBA 2DKNA 4CYMA 3JAKA 4R1QA 4A6EA 1JHXA 1SKBA 2IYPA 4LQDA 2XBUA 2O3QA 4PPNA 3W5HA 1IMOA 1MTOA 1JXQA 2UDPA 4XR9A 3VSCA 1WR8A 3EXIB 2E6KA 1A5SB 1I1HA 3OZGA 1U80A 1SVNA 3HU2A 1SUDA 1DWOA 4IXMA 5IJ9B 3NUZA 3QJYA 5ER9A 1WXFA 1WXWA 2BFEB 2VA9A 3G2LA 1JDPA 3PXGA 2ZPTX 1QQ5A 3F6EX 4IJWA 1A8HA 1GYRA 3KT6A 5BN5B 1V5WA 3PG5A 3WL6A 1UK6A 1UIMA 2AKYA 4FDAA 2FFBA 2ZRBA 4NRDA 4EPYA 2D1SA 1VGRA 2YYYA 3OCZA 4CLRB 1Y37A 3BC1A 4NZZA 4P2BA 1J8DA 3T7TA 4XWWA 3KQKA 2B2CA 1N32B 1P9OA 5DHTA 2O5RA 4JX9A 1TF5A 1ZBDA 1XCJA 1WCWA 1XF1A 1Y5MA 1W0JD 2P0YA 2ZR8A 2PCLA 1WRBA 2GSWA 3HADA 2RC6A 3R3WA 4XTRA 2AYXA 3T1NA 4B8ZA 1OZAA 2BDTA 2NUTB 1AKVA 4XD7D 1HG0A 3UQYS 4R8SA 4DLUA 6NULA 1L5LA 4M87A 4RHYA 1ZBQA 2XVMA 4EJ0A 1V1JA 4YXWA 1M1NB 4FFLA 4FU0A 3PRJA 2YH2A 2OO7A 5C7IO 3O4HA 4JI4B 4BC1A 4BOYA 4OREX 1A4UA 1U65A 2D0OB 2PMFA 1Q6ZA 1I3CA 4A73A 4YP0A 1H2RS 1RWNA 3KYDB 5HKLA 5HFJA 3GJQA 3FY4A 4QPJC 2C4HA 3L0IB 3N86A 1NPYA 1YZFA 2GT1A 1U7OA 1E9FA 2BZSA 1G8SA 2OCXA 2QTCA 2W8ZA 2XADA 1Y8QB 2DM6A 1EE2A 2DT5A 2XUPA 3NAZA 3DAOA 3O2JA 2KE5A 4BBJA 5HKAA 4O4IF 2H2GA 3CKYA 4ZYXA 4HGZA 3VU8A 2AN5A 3NDRA 3UJAA 2QZ4A 3QMPA 1E7YA 3JWJA 2A35A 3GLIE 4KVGA 2VP6A 1F2TA 1NC1A 2O2CA 3A70A 2VRCA 4M4SA 2CV1A 5HFNA 3I1FA 4EA8A 4JI1B 4CL8A 4YMVA 4QNRA 5B2FA 1NBHA 1Y4AE 2I34A 2NYVA 3AZPA 3DUWA 4JQCA 2HLDA 2QX8A 3SE0A 1SBTA 4HBZA 4FCWA 1JEYB 3VJKA 1HORA 1WV1A 3A9SA 1PS0A 4M9CA 1DXQA 2JCSA 2H6EA 4ZVTA 4Q9HA 1PK8A 1V43A 4JFRA 3SZMA 5JEDA 2VTBB 1QGYA 1OVGA 3V1UA 1RWXA 5JAPA 3QOWA 3HY4A 1FNNA 4GOJA 1E2BA 2ZUSA 3PDIB 2IYLD 5T3UA 1WPXA 2VA8A 3TI9A 1RHKA 1L1EA 2GZHA 1AQIA 5DNDA 3Q7PA 3DKPA 2FOXA 2QLLA 2XDWA 2FG7C 2XEXA 4XDHA 1SOAA 4UNPA 2Q99A 5K3CA 4D82A 3J80A 5IUNC 4BZZA 2OQIA 1N2ZA 3HXTA 2D0DA 3KZMA 2FR0A 3ZGNA 2OXFA 2MSNA 1UEXC 3GWGA 2X6TA 4OAPA 5JISA 5GJVC 3I01M 5DX8A 2I7CA 2IY9A 2D59A 5H1YA 5LDDC 4BO7A 2H29A 4I08A 3NT4A 3TD2A 4TQGA 1YC2A 4PZ0A 2H51A 3CS3A 1LF5A 4O4HA 1UJBA 3SR3A 3SYRA 4EQZA 2FZVA 2FKNA 3REGA 1CZOA 3MILA 4RV9A 3HB7A 3A14A 3DKIA 2CXOA 3BG5A 2AUTA 4XVQA 5GM2A 4K0RA 3O93A 4PLVA 2IHBA 2Q0XA 2PZEA 4YNBA 5AOCA 5FI3A 4KSCA 4LECA 2C2BA 2XMDA 1XRNA 4P7FA 5CB6A 5GGXA 5B30A 3OIWA 3FOEC 1X1RA 4ZVPA 3UHFA 3T3HA 1NJGA 1RPJA 1UBTS 1ZSVA 2FZWA 2GJ4A 1N2HA 4NNOA 3VTKA 1UPTA 1XDSA 1ZY2A 1PWZA 2RGAA 3MTJA 2X8LA 3MJDA 3SR0A 1MRZA 1OXKB 3HV0A 3VKUA 4NBRA 4MW7A 2XZDA 1URPA 2O4CA 3DNFA 4H1UA 3VU3A 2IDZA 4BP3A 1I2CA 2Q2OA 2IDJA 2V7PA 2ZJOA 2FWPA 5BNZA 5FYQA 2B69A 4Q18A 3ZU3A 4EDFA 4J3FA 1VYUA 4NDNE 4OF4A 2YVAA 3QKSB 4R8KA 3TW8A 1FP6A 2WINI 1UPFA 4ZVMA 1E64A 1BOOA 3KOWA 1RIFA 1MLDA 3KZ1E 3U7EB 2IGBA 5AVJA 2HCBA 3L8EA 2QROA 1YIAA 1JKFA 4G6ZA 3EVDA 1GWNA 1BEUB 4HAYA 5MGNA 4RVUA 1OYOA 4JT9A 4H0FA 1QC5B 3EH1A 1T9GS 5A04A 3R7WA 2XNKA 4DYDA 1AKYA 2XNHA 3QXJA 5JO9A 1UJ6A 4UULA 2PX0A 1X1CA 1U6JA 2WJ4A 4PZLA 2C88A 3I2KA 4YP9A 2J0UB 4J90A 2VF8A 3GEMA 3H5RA 4WXEA 2II6A 3OOWA 4LFAB 4KQMA 3I2YX 4LHXA 4RX1A 4WCFA 2Q0SA 3QYJA 3UT5B 1CRLA 1EINA 2WNIA 1D4OA 3HUUA 3I2JA 4IFEA 3HUTA 3SDBA 2GEKA 5G40A 2CJFA 1V1MB 5DFAA 1E3IA 4YLEA 1G4HA 1VIVA 3BL5A 3RUFA 1HNXB 4A3SA 1WNFA 4IJUA 4L8VA 5GONB 1OAOC 1K68A 2CLIB 2FK8A 4RPCA 1OIWA 3NP7A 4ZAWA 4QDKA 3CR7A 5D3KA 3ZH2A 3GQBA 4L4UA 3WMGA 4L4ZA 1NX6A 1P9NA 1C8BA 1TEHA 1FTYA 1Z6XA 3SZGA 2J59A 3THYB 3P4UA 1E5XA 2AVNA 5LBUA 4HRYA 1NI3A 2QN8A 4L7QA 4XJSA 3ZWAA 3N2NA 4BO9A 4BZQA 1QB8A 4RZ2A 2AW5A 5L3RA 3QQ5A 1GRVA 2QDKA 3N59A 4C06A 4DREA 4LPKA 4Q1FA 1GQSA 1VJGA 2O3SA 2QTRA 3ZHTA 5F76A 4DJ5X 2QMOA 2GFHA 3GRFA 3EEFA 3GCGA 1A71A 5HZKA 3MXTA 3EVCA 1VXRA 4IDNA 1FX0B 1N3IA 3OF2A 4JVNA 4O2RA 3SQOA 3U3OA 3HXOA 1Z0JA 3JALA 1WD7A 3EGXB 1E99A 2FP3A 4E5YA 3CGGA 2JW5A 3E27A 1SC4A 4WBNB 3NV9A 1IMJA 4EKDA 4ZJUA 3RS2A 1XAGA 1PYOA 4P2GA 2R62A 5GJCA 2AW3A 2PXXA 3PPIA 4AKHA 4US1R 1NF3A 2OESA 1KDRA 5EWLA 4YJ2F 2CUTA 1UBRS 3WMWA 1YE3A 3IC5A 2OGWA 1CJTC 4AMUA 5I45A 1ZCJA 2J9GA 4DMRA 2GN6A 3B6ZA 3C3AA 1N2CA 2I80A 3E82A 1AKTA 3L7JA 2Q5EA 5HA5A 5IJWA 3EZYA 3WGKA 3VSAA 1OYVA 5E4JA 4TL8A 4MDEA 1XB2A 2AJDA 1KSFX 2XMZA 2ZU6A 3RADC 2Z6VA 3TTYA 1BHSA 2X2PA 3FDZA 1PG2A 3OM8A 1VG1A 3EOBI 2NSYA 3HO8A 4HYYA 4ZI2A 1YCHA 4MW1A 4O4HF 3UOGA 3KO8A 2IXDA 1NLZA 3CN9A 2C96A 5A6SB 1PJLA 2C5LA 2AEEA 2HTEA 4C0WA 1PYGA 2P6NA 1E6UA 1GTZA 1P33A 2Z1MA 1NQ5A 2RHLA 2YWEA 1WV0A 3K1JA 4GEGA 4P33A 4YQZA 3SQDA 3ZZUA 4TLEA 3K0CA 4IIYA 2H06A 5EWMA 1OV6A 4O2BB 4RO0A 5AMXA 3KYCA 4GLFA 1BE0A 3ZLUA 3NM5A 1ONOA 4GLOA 4PAGA 3ND9A 4J0EA 1ZR4A 4DHEA 1G20B 3SHTA 2GPSA 3BH0A 3H11B 1QUFA 3U3JA 1CVIA 1FXWF 3QUTA 1N9GB 4EENA 3QLUA 3ESYA 4IHAA 1X38A 4Q4JA 2PGLA 4BMXA 5KNCD 1VLQA 1Y7LA 5C8YA 1Z5GA 3SKVA 1NQAO 4ZU1X 1AU9A 4CG2A 4CXMA 3JX9A 1AT1A 1XZCA 4DG9A 4LRXA 3Q6NA 4P82A 4RW0A 2B1QA 2FF7A 3N87A 5F5LA 5LQRA 4C07A 3UMSA 3C15C 1N2SA 1D4ZA 4IR7A 4CU2A 4LX8A 1QAMA 1B23P 3UENA 5IABA 4LZJA 3G8BA 5JWOA 2X7JA 3DZBA 3E9ZA 2ZJ3A 3LLSA 4KK3A 1FXSA 4LDNA 3N6XA 3DHEA 2R97A 2OQ2A 4PFSA 4C4ZA 4EJSA 1XWFA 4S1VA 5D84A 2QJTA 2NQ8A 3X1MA 2X0KA 4BN4A 1KVSA 4IZHA 2IUFA 4LY9A 3UCFA 4AJOA 2GDJA 1KGSA 1PWXA 1UP6A 1GL7A 1NMZA 3DYVA 1RJFA 4FLEA 4Q7EA 3V9AA 2LPMA 2G6BA 2FQ1A 3G2QA 5DNEA 4Y2XA 5EP3A 4FKMA 3R7LA 3T35A 1DIBA 4HGYA 1QVRA 1PL0A 4MGZR 1TFUA 4G8JA 4DQ0A 2GR9A 5KNCH 4YJGB 5K8VA 4HWOA 5KTOA 3LDHA 2HKIA 1QE5A 4A7PA 4I4TF 2WP8J 2QN9A 3UM9A 4OP3A 3ULKA 3QENA 1RXSA 1RCFA 2QV0A 1LK5A 3DLPX 4CTKA 4EVIA 5HJ7A 1C3OA 5E6UB 1N1EA 4HX9A 2IYEA 1IN4A 2WA2A 3PHHA 3UIEA 1JKIA 2WIGA 2AJLI 4BO5A 2PZAA 4N6NA 3DNMA 4DMKA 4Q15A 4CKWB 4E5MA 4D9NA 2GEDA 5JZVA 2OP1A 2V5AA 2YX1A 3RHZA 1VKNA 2NX2A 5CA0F 3THYA 1QV6A 1G8FA 1OT5A 3GFSA 3A3OA 4BVFA 2Q3EA 3LCUA 2A9KA 4E5PA 1PJAA 4GMKA 3LLCA 1DCMA 1TADA 3AB3A 2ID8A 3DGFC 1B8PA 1KJYA 3TSYA 3ZIDA 2IX9A 1MPTA 1U9IC 1FFSA 3FOCA 1NP3A 2GK7A 2OD2A 1EDOA 2Q3FA 1HQDA 3CVJA 1VM6A 4ZOLA 1IJBA 3T7DA 1G18A 4NMMA 5H02A 2HLDD 1C4XA 4R71A 4CL2A 2WUDA 3TZKA 1KAQA 1E2KA 2BKUA 4HEHA 4J3NA 3L8GA 3TRDA 5AVYA 3LMKA 1COZA 3PLAE 4CI9A 1MX5A 3A37A 3PXEA 4OQDA 3U7HB 2YHIA 4JELA 4X8LA 1VKRA 2AX4A 5IXSA 2JK0A 1EE9A 1UAYA 3GJTA 2J0SA 3BXGA 3PFKA 1IAQA 2PL9A 2R86A 4HAVA 3IQZA 3OU7A 4FGWA 4UU8A 4WNCA 1EYZA 3RUEA 1WU8A 2INGX 3VYWA 1XNQB 3SD7A 3I6BA 4D0RA 2OV8A 3R3XA 4RLHA 2H4HA 3FTCA 2ERXA 2XAUA 4YH1A 4RGQA 1YGPA 4D45A 3OF3A 3ETDA 3OQPA 1H1DA 1SIBE 4DG5A 1OPXA 1Y5IA 3ZWYA 3PNQA 4ITVA 4I66A 4EUFA 4MW9A 3VDNB 1T4MA 3NV7A 4E1BA 5BPFA 4KNYA 3AL0C 2QM3A 1JLLB 3JCZA 3N3BC 5A2GA 1MQSA 4GRIA 5IBQA 2HQSA 2XB8A 3ZDYB 5IEJA 4PG7A 1F2TB 3N6RA 1JVBA 4LHYA 1ZLYA 3ZKWB 4PTYA 4QOIA 3HZRA 3O3OB 4GX2A 1TZKA 2WFMA 2A1UA 5DK4A 2R68A 3GLGA 4KAAA 1XRSB 1LRJA 2VKQA 4N49A 4IUDS 5IC6A 1FZTA 4CUJA 3AG6A 2REQA 1RXYA 3HACA 5H4GA 3C6QA 2QUJA 1L7RA 3KJGA 4KP7A 4MUEA 4WN3A 2C2KA 1BJRE 2PGDA 5H16A 1H2AS 1DZIA 3ROPA 1QFZA 3CX4A 4I6GA 5CFQA 3B8HA 3AEXA 1IEWA 3P94A 3RK1A 1CKEA 4R8LA 5ALLA 4LJ7A 1GLNA 2J7PA 2G08A 1S89A 3AR5A 3DHWC 1YOVB 1NBOA 2EJTA 2NQ2C 2RCNA 3U80A 4C0LA 5CFMA 4IO0A 3I9LA 4BFCA 5ITZA 5C1IA 3HEMA 4A8JB 3VC1A 5A0TA 1Y6ZA 5J4VA 3V7WA 2VPTA 3HFGA 1T4BA 1F5NA 4NHOA 1O6GA 4B2LA 1GRNA 1AN0A 2P7HA 2A4KA 2ANCA 1Q1BA 1VPVA 4D26A 2OBXA 1A82A 3BFJA 1H69A 3ETJA 3I09A 5HOQA 2PSDA 5LNK1 1V2HE 4ABYA 2GARA 2R7NA 1PR1A 3ACDA 3PLRA 4UUQA 4LGCA 2X4LA 1OXUA 3MRSA 5JPCA 2AZMA 1L4MA 4KMOA 1AE1A 5ECYA 2VHYA 3P0JA 2QRPA 1DCTA 1UXJA 4JCCA 4C1NA 3HXMA 1YZKA 5F7ZA 4IDEA 4RD2A 1R0WA 3BWYA 1Z2PX 4PC6A 5JFOA 4XOIA 4EPXA 1QOQB 3L1KA 3M9LA 2NPOA 3NDPA 3W9SA 3D2CA 5EIFA 3KDPA 5D01A 2OGZA 1XR3A 4OH7A 4RPLA 1UBOS 1G5RA 4EHHA 2NVBA 4EZBA 2HW8A 3LC0A 3WYBA 3FPGA 4RY9A 5HK8A 2BUAA 5CDGA 3U5ZB 1TYCA 1EHYA 3BJIC 1DT3A 1MRSA 2Q3HA 3L4BC 3OFSA 5JDCC 2QUAA 1EAMA 4PQYA 3S1LA 4LKOA 5BRAA 1Y8QA 3MJVA 3OIDA 3QV1A 1M5TA 3RK0A 3V8EA 4B4VA 4HSEA 1EJBA 2ZVJA 4TV9A 4UEQA 4UMFA 4D98A 2OV2A 3TLMA 2RAPA 1OXVA 3GI1A 2IEZA 1H1TA 4TMYA 2Z3VA 1P0CA 4J16A 4AJLA 2IP2A 1H4QA 3ETHA 3JS5A 5LFAA 1KC3A 3H83A 2HSZA 3I45A 1HOTA 4JLPA 1AIPA 1RM4A 3KKEA 2B37A 4Y0VA 4FS8A 3CWQA 5EP4A 5IKXA 2D13A 1M1NA 3FMOB 4MWCA 2C83A 2QN1A 3K8ZA 4HNQA 3PRKE 4LXUA 4UMVA 4YLGA 4YUYA 1FFYA 2HR1A 4K81B 2RGDA 1NFFA 4QGAA 3RRMA 2P8JA 4A92A 5KOYA 1TK3A 3V80A 2XCLA 3CSUA 3UA3A 4AJHA 4IHQA 3IKVA 2H2WA 3MYYA 2WAYA 4GPAA 3RYFB 4W5OA 2QA5A 2FLKA 1VYTA 1RIIA 1ZGCA 1JILA 3H5NA 3R7AA 5CB4A 3NHWA 2X1VA 3H1AA 4HYQA 4IICA 3R7NA 2H0QA 2OENG 4IVQA 4NMHA 3E7FA 1YDEA 4QJ5A 5DBFA 2UYCA 3CHYA 4NCXA 4OYHA 4WUTA 1GA1A 1WDKA 5AUQA 4JN6B 1BU8A 3KK0A 3O7MA 3PD0A 4JL8A 5FWNA 1AN9A 3BXEA 4HJXA 4IV5A 4PM4A 1KARA 4MPDA 3QA3E 3HNOA 4X6YA 1MOZA 2VQEB 1TU4A 3X1ZA 4I36A 4TUYF 4G0NA 1JFLA 4QBFA 4U1RA 4LSWA 2BN4A 4YRLA 3EXIA 4ZIRB 4Z1MA 2NVUB 5BUQA 2K6GA 4MVJD 1S2OA 4F93B 4PXAA 3FNRA 4XQ9A 1JEEA 3GLFA 1THMA 2QL6A 1ULBA 1W36D 3C43A 2PQ2A 1Z7YA 4KQGA 4M46A 3EZ6A 4CL3A 1U1FA 4ED9A 2VPZA 3C3BA 2OA0A 4UVGA 5LQSA 3DEKA 4R16A 2VSFA 3ICPA 5AXBA 4F5YA 1NYQA 2DKFA 5LSAA 4E4RA 3DMNA 1XL0A 5LUBA 4YONB 5EIAA 3F7MA 2R44A 2RGUA 4PAOA 3WA6A 5AIAA 3HKCA 2HWKA 5DMHA 2VBFA 1ISHA 1E3EA 1B3BA 1NPTO 1X14A 2V1XA 3W3AH 4FR5A 3N8HA 4PE5B 4HQNA 3NQ41 3DC7A 1ZW1A 1QP8A 4WFKA 2GXUA 3FKJA 1OREA 2JIDA 3E0QA 1S7GA 5ESWA 1GZUA 4NCAA 4M49A 3VNSA 1NOJA 1G3QA 3FFWA 4OXIA 1R10A 3DTVB 4UZSA 2R751 2DZDA 1US8B 2IUSA 3ESCA 5L3ZA 3R23A 2RMKA 4W4TA 1OGJA 4RPIA 5KMGA 4KPEC 2BFCB 1AQUA 1EE1A 1LUAA 1OT3A 1TYZA 1YK0A 2EKZA 1AZTA 2MOKA 1AS3A 2OLEA 3A9RA 3CE6A 3IUNA 1ESZA 3QU2A 2KBEA 4H6WA 4KZPA 5GINE 2PWAA 4CT4B 4NOKA 3ILSA 3ZCXA 2XRZA 4J7XA 1BSVA 1FS5A 2HF2A 3PHJA 3V48A 3KEGA 3B5EA 2PK3A 2EJUA 3G79A 3W4IA 5LQCA 3A1TA 4HTFB 3CLTC 1NX9A 2W2KA 3JQAB 2GBGA 1KKUA 2IEIA 3KSRA 3PWKA 2Y1LA 1RBYA 1I1OA 4KIWA 1U2GC 2DHEA 4S35A 4XM1A 2QLBA 3V5NA 4XVCA 2HF8A 5DVZA 5IHXA 2O8FA 2Q21A 1KEVA 4Y2VA 5BSUA 2HRCA 2Y1CA 2B34A 3Q3VA 1OR8A 5FTKA 1FMTA 3K9BA 5BWLA 1TGVA 1A2KC 4TXNA 1N6IA 2FX5A 3BWBA 4TL9A 2G83A 3PRYA 4OYYA 3BXOA 2NO4A 3ZD6A 2C92A 1RZUA 5E3HA 4NH0A 4U5XA 3VC3A 5KQGA 3A9CA 3H65A 2J6CA 5JUWA 1I7NA 1P1HA 4UXIA 2YJ3A 1U6KA 3BT7A 4QUHA 1OZGA 2QRZA 4E11A 3ASUA 3EASA 4EAQA 4AKGA 3F1LA 2ZWOA 1E61A 3PDHA 1FFWA 2R4QA 3RBVA 1J00A 2GESA 3H8JA 4WI1A 1UDRA 3TLXA 5D3MB 3V2UA 1Q1NA 3EZLA 4HDAA 4FGUA 4MGEA 3U3MA 1UAAA 3RVQA 2ZBUA 2I7TA 3Q2IA 2JAUA 4W9NC 3NCTA 4S2UA 4B2YA 1MC1A 4EG1A 5AVTA 3HCPA 4I6JA 3UC9A 5L7YA 3RU7A 1UJCA 1MMFB 3ZWOA 1VMDA 3ITDA 1O94D 3TIFA 2AIRA 2BBSA 2CNOA 3T3PB 4BKQA 2J3QA 4EKGA 2X6QA 1RQXA 4LHEA 3H2GA 4ZJZA 3GW8A 3H9JA 3DBRA 2QT0A 3P96A 4ZYVA 1V8DA 4P7BA 4G3XA 2WWGA 1ZIYA 3TQCA 5BORA 2CFIA 2IP4A 2HFJA 2RD2A 1DOZA 1VBKA 3GELA 4QTZA 4EI8A 4I0WB 1ZIXA 1W581 4NE2A 3GCXA 4BN0A 1EA5A 4I7EA 2XUJA 1YTUA 2B25A 2O1XA 2FPRA 4E94A 4Q39A 5CCEA 3T99A 1A8PA 2VDOB 4QD3A 1WVMA 1IHUA 1L4KA 2BEWA 2C3PA 1H3NA 3FIJA 4IEFB 2APJA 3R3YA 4P3XA 2F1HA 3A2NA 5EXPA 4BNLA 2B6NA 5IVIA 3HCDA 4G9BA 5ARDA 4F46A 1XTTA 3W7AA 3ONDA 2GEVA 2ZUEA 1LPSA 4F3NA 3MRVA 1JR4A 3WRXA 3QLVC 2HBYA 3MD0A 3DTVD 1J4AA 4ZHQF 3BL8A 3GVXA 1GGEA 5F12A 5HK9A 4MV8A 1NNSA 1SU8A 2WMDA 2SCUB 4PW0A 4F72A 1OU0A 3DL2A 3AM5A 3B1KA 4Q93A 5HIAA 3TTXA 7YASA 1CJMA 1L7PA 2D7CA 3ZR4B 3UQZA 1N2CB 1WMBA 4ZC8A 3WYDA 4IIJF 1RRPA 2PQ6A 3DW1X 3VH4A 1T5TA 1W6RA 1W46A 1OB5A 3HGTA 1ID1A 1VHJA 3LH5A 2G0NA 4GT1A 1C2TA 5SYNA 2GD2A 1G5TA 4JD5A 4LXTA 3WSTA 4HRAA 3UYKA 9ABPA 1A5BB 1Z5ZA 2YFKA 5KVSA 5DP1A 1DBVO 3N58A 4X66B 4I19A 4UUAA 3DR5A 3IDZA 2ZBGA 1JIUA 3GFOA 5JQGA 1JWLA 5JJIA 3OKFA 4Y9DA 1ZUIA 2AC2A 2WJAA 5CT5A 4CIVA 2J87A 4G0WA 4H3HB 5FNZA 3GPLA 3T7EA 2XWQA 1Z0AA 2XWPA 4WECA 1MUUA 4X8OA 4C6SA 1KEEA 5J4YA 4UZEA 1YFJA 1ICEA 4K9LA 1WSWA 5HMMA 3YASA 4E08A 1XZQA 2ZK7A 3GMSA 4Z0TA 4BTLA 5L8VA 4G0QA 3QJGA 1VSQA 3IVGA 3NHFA 4LJKA 3TXAA 3OJFA 1O77A 5E0OA 5B1EA 2YYSA 3KXLA 3F2IA 4JY7A 4C0JA 1AV7A 1JVNA 1RVDA 2VP9A 2Z4RA 3FMPB 3LTEA 4OQMA 2JVIA 2NO7A 3IO3A 4Y2TA 5AI5A 3W2TA 1DV2A 3KKLA 3OZTA 1KJ8A 2GXSA 2YYAA 1YKFA 3KB8A 4WZBA 1MU0A 4PLTA 1KI2A 1RS0A 1I6LA 1UFOA 1XCLA 1XQYA 2F48A 3I34X 3QX8A 1YVUA 5JV5A 4O1IA 2RI6A 1F9EA 3NOVA 3F49S 4GYKA 2Q4RA 4WFQA 4BFVA 4UXHA 1HEYA 3I28A 1A9OA 1TVMA 1H2HA 2FZCA 3BE4A 3HCNA 3QOXA 2WIFA 4MVWA 4Z2AA 1OYYA 2WWIA 3L01A 3QEMB 1HDIA 1T2EA 2CNNA 3URKA 1O9GA 1TEXA 3WYNA 4WZAB 2AQIA 1GKKA 4E1VA 5TXGA 1VE1A 5FR2A 5D51S 2WHPB 2IZ1A 4A8JA 4EF6A 2MT9A 1QRRA 4RJ2A 2H2AA 1Y3CE 1ZM4A 1HQCA 3EGDA 1L8OA 4GKKB 3H5VA 1FVOA 1DKRA 2GILA 1H2YA 4RWEA 3LPAA 1P7ZA 3CR3C 3ABIA 2B82A 3EXEA 4TWRA 2DTDA 1DTSA 4IF4A 4LC9A 2HCRA 1U2PA 4A8HA 2RCYA 3Q2KA 1GQFA 1SFRA 4RKRA 4JA0A 4BX3A 1OIXA 2HJVA 1KVTA 4QRHA 5JSYA 2R6ZA 3K1AB 4PTLA 2O0MA 2VR1A 3EPPA 5KYNA 1FRFS 1NONA 1JIQA 4MWEA 2UVPB 1IOZA 1L7XA 4K3VA 1C3OB 3KPVA 2JFFA 3C14C 1B93A 2R85A 4K6FA 2AX3A 2J3MA 4I55A 5E9JA 2TYSB 4PG5A 3WB0A 2PPVA 4QPDA 1DZ3A 1NVKA 5DISB 1Z8HA 3GB9A 4HATA 5KOHB 1QTNA 3AUSA 2AEFA 1FQOA 2XRFA 2AKEA 3K92A 1IPHA 1Z3CA 1N2XA 2XRYA 3GYBA 1WETA 3IVCA 1H23A 2VDNB 5K5EA 1OASA 2ZYAA 2SKCA 4AJIA 4I5GA 4HL6A 1HDYA 1XEWX 4XB6B 2QL5A 4DMMA 3EZGA 4B3GA 2XUDA 4ISCA 3FAZA 4IIVA 2DWQA 2WD9A 1NVTA 4D41A 4E46A 1Y9DA 1NFQA 5HFAA 3Q0EA 3P0HA 3ITEA 1WBJB 1GTG1 3JQ6A 3O3NB 4Z49A 4ZDWA 1NOKA 2H59A 1SVOA 3AGPA 4BNFA 1KNXA 4XD7A 1QH9A 2A8YA 2OXCA 1THGA 3DEYX 1SB8A 1HLGA 3M9WA 1JQAA 3IDAA 2VDWA 2J48A 2CBGA 3P32A 2D5BA 1WXGA 4M86A 4CM9D 3BCSA 7ABPA 1N5LA 4HAZA 1JTFA 3W2EA 4V1CI 4DGSA 3ZHUA 4N39A 4K6GA 1SXJD 4QNNA 3ZCPA 1X8XA 3EIFA 2ZRHA 3QF4A 4DM7A 1K3UB 1BROA 2KW5A 1WXXA 3LOUA 3BMOB 1KI8A 3AVPA 1IK4A 4RLQA 1QIGA 5L3QB 3SLKA 3ZEAA 3TIVA 2FEOA 3H1BA 3QKUA 3UVEA 3DC2A 4HQKA 4Z4IA 2W2LD 3GP3A 1U2EA 1Y1KE 3IR7A 2JGIA 3ZQ4A 3WQHA 1J06A 4IILA 2YV4A 3DZCA 3WRYC 4PFJA 1ECCA 2REXB 1MC5A 3IHLA 4WCDA 1U98A 4GECA 2M6LA 1JA0A 3DE4X 1EFHA 4JA2A 1ESEA 3ZV6A 1XTPA 1YA4A 2V4MA 3IV6A 3KKOA 3EFHA 3BWDD 1XLVA 2B0CA 2ZI9A 4OO3A 1MHPA 4H4EA 4TOIA 1A5AB 2ODNA 3Q6IA 5AM5A 3OCJA 1NBMA 4W5QA 3AGQA 3DQQA 3FCXA 3MT7A 1E6MA 1T4DA 1YS9A 2VDWB 4B6FA 1PZEA 2WJYA 2UUCB 3F6YA 2J6HA 4DADA 2DFTA 2PLFA 4F2GA 2C1EA 1P0PA 3DCJA 3CJRA 2BGTA 1FLVA 1K8YB 4WKGA 2JHAA 1OH5A 2NMVA 1QRDA 3JSXA 2CFOA 2HB6A 3B3GA 3KU1A 4JMPA 3QITA 1NRJB 1U9CA 1PG5A 4MHOA 2XQVA 2QSJA 3KUDA 4M9ZA 4W8OA 3ZWXA 2ATVA 3R3HA 3PNMA 3B6KA 4JODA 2QTNA 3T15A 3L0CA 3NT2A 3RYTC 4BLTA 1NQWA 3AZOA 3DOIA 4BTVA 2PZJA 1P8JA 2PM8A 2OSBA 3EJ6A 3M6VA 5P8WA 5CBPA 1MDBA 4CKEA 2Z5FA 3U7GA 1N6LA 1PNVA 1COWA 2BGUA 4Q0MA 3CRZA 3HU3A 3KAPA 3NDBB 1OV4A 1TYBE 4JWKA 3BJRA 3VO2A 1GTRA 1EMDA 2C7PA 1CTQA 4OKSA 2V6JA 4HFRA 2G1JA 4WNAA 4JLDA 3AWDA 1XRMA 4PZCA 4RADA 2AG1A 4R1OA 5IUKC 4YV7A 4Z7QB 2BKEA 1Q7CA 2FMFA 2ZR9A 2DPHA 3AVVA 3BRWA 3G02A 3PFBA 2I71A 4JUIA 3QBJA 4MWSA 1WSDA 2C04A 5IK2A 2EKDA 1FMLA 3C3MA 5FV7A 3M5CA 3C6MA 3B82A 1RI5A 3MFYA 4JLWA 3D0OA 2B92A 1J2JA 4B3XA 2JHGA 1Y3HA 3F67A 3WL4A 5LKAA 5LQJA 4GUDA 3HWSA 3JVIA 2GCEA 5K2OA 2N1BA 4HDSB 5FPSA 2LE0A 1VMEA 3CEJA 3W06A 1T0UA 2P3SA 3O31A 4DSZA 5I47A 3V8QA 1QF6A 1O95D 1DEAA 1WW2A 1CZKA 2YHIB 3TE6A 5FUQA 1KS9A 1I3NA 1SELA 4EHNA 1PQ4A 3A1WA 5KNDD 1V1MA 5E2IA 3DL4A 1P5FA 1JA9A 1WXQA 1GZ6A 3QKIA 2A0XA 4P5EA 5FI1B 2BFFB 4RF2A 2B0JA 2SICE 3VV2A 4XYEA 3ZHCA 5FPKA 1ZESA 5A06A 2FVXA 1P2TA 2WPDA 3B3AA 1R0BA 3AONB 2XDYA 4YX9A 2VPXA 1Y81A 4HX2A 2UXBB 5KC9A 1ILWA 1Y9ZA 2AJCA 4F9FA 3LUDA 3OT1B 4D4IA 1CHNA 5EFOA 5FOXA 4MROA 2C8JA 3W2FA 3DUFB 1MV5A 4R1NA 1G19A 4C7OB 4BUCA 2GI4A 1PZXA 4L57A 4YDQA 2GZSA 3B7PA 4B40A 3WK7A 1SCKA 5HS6A 2ODEA 1QIJA 1A9XA 3B3QA 3LV8A 5C1BA 4LF9B 3E2PA 1YR8A 3PJGA 4KAXA 4EECA 3RIGA 3QUSA 4F4DA 1RP7A 4BNXA 1JHDA 5L3SB 5A3RA 1D6JA 2HN9A 4H08A 3WSVA 5IUJC 4PAQA 5AO9A 4XRGA 1Y0BA 4YQYA 1ML3A 3FMGA 2XTJA 5DEIA 2A3RA 2CB0A 2O52A 3LUCA 4M7WA 2IXFA 3UKOA 3P9PA 1JHRA 3L6RA 4Z0HO 3WV4A 1GN8A 4ENPA 4WJLA 5D2CA 3JZMA 3EDCA 2YJ5A 2NUAA 1H1LB 3MCZA 3B3FA 2GZ2A 3L1VA 1J21A 4JXKA 5I7FA 1RZRD 1A95A 2FG6C 4KI7A 4FSXA 3QBEA 5J59A 3ZY6A 1N8KA 1Y3FE 1NXOA 4KE9A 4RAQA 2Q4EA 3R5JA 4AP5A 3L0BA 2B30A 1UEJA 4JR1A 4LYGA 4PONA 2NPIA 3D5EA 1PFWA 3O8DA 5K0NA 1FSGA 2ZXFA 4QQRA 4FDVA 1NI5A 4INJA 1L9XA 1L7DA 3W7BA 2Y99A 4PO8A 2FQQA 1NF8A 3QTTA 2QP3A 4XH9B 1UUFA 2A78A 3Q2OA 2PKYX 3PCTA 1DC8A 4KX3A 1K5PA 2N75A 3FYDA 4F4JA 3GU3A 3OLZA 2VSYA 4OHWA 4BMYA 3T54A 3ABOB 2XUIA 3L0ZA 4J0CA 1A97A 3D1LA 4IYJA 4DLNA 4BDTA 5IXYA 4LJ6A 5AW8A 3OM9A 1X7DA 2F3SA 3ACBA 3EHEA 4H1TA 2ZBVA 5BQ3A 3HDVA 5CG2A 3NLLA 2PE5A 4TZTA 3SKXA 1D6SA 1W9HA 4M1YA 3V8PA 5C1PA 2XT0A 4YBZA 4UHBA 3SJUA 4OEHA 1HR0B 5FWXA 4L73A 4P22A 3C45A 5HRUA 2IGTA 4TQ9A 2W2MA 2ZJ7A 4BCBA 3AHIA 5EZYF 1LV8A 5HDBB 2JFYA 2C8KA 3ZDCA 2RHWA 2PV7A 4F60A 5IH7A 2V97A 1KIFA 2HSJA 4F38A 3G89A 5CH3A 2CHUA 1EUCB 3KEMA 1OMOA 3P5BA 4DJJA 3ZJUA 1OXMA 1T1EA 2FE4A 2SNIE 2VUIB 2XNJA 4FE7A 5F2OA 4BO4A 2WUWE 3LU1A 2LUOA 1UM9A 3O83A 4URZR 1C7ZA 4N4AA 4WFIA 4CM8A 2PH7A 3WBFA 1YR3A 3HJTA 4CHGA 4PZAA 2QKYA 1K4KA 3NVDA 5JQGB 1F3LA 4RGYA 1ILEA 2FFRA 5LJIA 2XVXA 1IJFA 2AR9A 2A1IA 5A3JA 1G8YA 3AFIA 4BX2A 1P4HA 1MOSA 2JFUA 1KVUA 2SCUA 1W4BA 1NZDA 2XSZA 2VXBA 3DE2X 3OPYA 5DKFA 4WESB 3C3XA 2WUEA 3KELA 4OLFA 1D07A 3GEHA 1TZ2A 2YNMA 5DLDA 1JXOA 2I3ZA 1IG3A 4LUCA 3P9YA 2J9XB 5DIZA 4PLFA 3C3KA 3T3IA 3I83A 1WLYA 3EIQA 2OBYA 4G89A 4WEOA 1ULHA 2CXNA 4B6QA 3KLMX 2O2EA 2VJQA 1ZOSA 2W2VA 3OJOA 4K9QA 4PQFA 3ZQ6A 4C3OB 3I8OA 5HP4A 2Q1UA 2Q4DA 3GG2A 4ZQFA 4ZPXA 1S1MA 3VV3A 1IRXA 1M34E 3KPJA 1OH7A 1YDFA 1N6PA 2H00A 3DO8A 3HJRA 1X80A 2BR4A 3TMAA 3OWHA 3L7MA 3GEEA 2GM4A 1LLFA 1TK2A 5JYBA 4DV7B 2CLFB 2XTNA 4FEEA 2I8AA 4A91A 5JOQA 5KNLA 4FHCA 1TW3A 4AKEA 3P0FA 4ESEA 1W88B 3AV0B 4HBGA 3H2ZA 2PMDA 4D96A 2PJZA 3IE2A 5ULLA 4Q24A 4YT2A 1IM8A 4ZK6A 5A4AA 2B7LA 1OC4A 4NU8X 3UKDA 2ZS9A 3VHXA 4DE5A 4AS3A 2FQYA 1PI3A 2OBNA 2OV6A 5CB8A