4TL9A

Crystal structure of n-terminal c1 domain of kaic
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
236
structure length
220
Chain Sequence
EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPFDLSALIERINYAIQKYRARRVSIDSDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 77
structure length 220
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl9A00
2CNWA 3I73A 1RRPA 1SVSA 2XITA 2QQEA 2FDCA 2AD1A 1G5RA 5EXTA 1AGRA 3MFYA 4AK9A 2VP6A 4V0KA 1IAQA 4N1AA 1US8A 4C0QC 1XEXB 3VR5A 2G1JA 2X1VA 2QZ4A 1OHHA 3M0EA 2HLDD 4PSVA 5FL3A 3X2SA 3G5UA 3TJZA 1G64A 4JLAA 3VX3A 3MD0A 3ND8A 2AX4A 1AK2A 4Q01A 4OQMA 2O8CA 3T15A 1Z6TA 1AGPA 2WTUA 1ZC4A 2VQSA 4HLDA 2GETA 2OV2A 2G0TA 3KTAA 1II0A 3OZXA 1AIPA 4HZUB 5DIFA 1YRAA 2WSMA 1Z0DA 4DLRA 4ESHA 4OBEA 4C0BA 2OAP1 1CBUA 3HPQA 2GCOB 2NZ8A 4B73A 3FPAA 621PA 1JB1A 4PQRA 3GCGA 3WYGA 5FL7D 3K0SA 3GJ4A 1S9HA 4PTLA 5C18A 2XTZA 1O87A 4O3MA 3MCAA 4DT1A 4LV8B 2ONKA 4FD2A 3W5IA 3BORA 4GZMA 4HZIA 1QHGA 5EE9A 4ERNA 3LH5A 4HB3A 1FNNA 2EW1A 1OW3B 2WV9A 4TMVA 4D4LA 1XTSA 1SZPA 4MKHA 3DMNA 4US0R 4LYFA 1W48A 5FBRB 2D74A 4D26A 2V8OA 4DXAA 4EPVA 4HUQB 1BKDR 2HLDA 3LFUA 5KDOA 4AIIA 2J0SA 2AL7A 3CKLA 4OQFA 4QG7A 3D7MA 5FFMA 1DAFA 4TL9A 3U61B 3B1YA 4JSTA 1N6OA 1RW4A 4GBMA 1P5ZB 1RJ9B 2OBLA 1VCMA 1CIPA 1XEXA 1GKIA 4Z51A 2DFTA 4O25A 3KUCA 4L5BA 4OK6A 4URYR 3D8BA 3EIHA 4LHZA 3WNCA 1RRCA 1W49A 4PANA 2VPPA 2WIAA 2CLSA 5DGXA 1KDOA 1G8FA 1FL9A 4GP6A 2P3SA 3BERA 3E70C 2RGDA 5DISB 2VHQA 4KODA 4Z1MD 4M21A 3I8SA 1SVKA 2XNDD 2FU5C 4PC2A 5J40A 4CEJB 2IS4A 4P3YA 3ADKA 4KU4A 5CLQA 4HB2A 2VEDA 1EX7A 1W36D 4DDTA 1IN4A 4IFEA 2BDTA 1XXHB 3UWOA 2OCBA 2GWHA 4QHYA 4TYPA 2HF9A 2VBCA 4OHXA 4KITB 4JS0A 3SJZA 5IT5A 3I8XA 2O8DA 1JR3E 1N6NA 4CYMA 1JECA 3NIBA 4DBLC 3LNCA 1KI9A 5KSPA 2CMKA 1E9DA 2GZDA 3NDPA 5BN3A 2AKAB 1S8FA 1Q1EA 4CF7A 1VDZA 3PXGA 4AURA 2WJJA 4A82A 4B3FX 4BUJA 3EA5A 3TVTA 2WAXA 1N2CE 4BQSA 1N5JA 1JPJA 1ZP6A 3QJYA 3U7HB 1OIWA 2R6CA 3DVLA 3I4LA 2RGXA 5EP3A 1DAMA 5JWRA 3HU1A 2O52A 3VU9A 2QBYB 2O8BA 1W5TA 4WZ6A 1G17A 1II9A 1ZJ6A 3KB2A 5J4KA 4MH0R 5AUPB 4US2R 1CP2A 4C0SA 2C9CA 1OH5A 2ATVA 1CJTC 2WJVA 1ZCBA 4C0LA 3ZZTA 4TSFD 5DI9A 1IBRA 2FMXA 1C4OA 2J1LA 3GJ7A 2XXAB 1E6CA 4JT2A 5FTLA 2CHVA 4B3DA 1Q44A 1MOZA 1LNZA 1Q22A 2FA9A 4GMXA 4JZKA 3KQNA 4Q7MB 1WA5A 5GJWC 1JQJC 3ZIAA 4BFVA 5TY0A 1E2PA 2O8FA 3AV0B 2OT3B 1EFRD 3GJ5A 4KVGA 2JJ1D 2QSYA 1G3IA 4E09A 3N70A 1G8PA 4V0OA 3RYTC 4CEHB 1SVOA 1R10A 5DSZA 4HLUA 4NYIR 2YNMA 5IK2A 3TQFA 2QRZA 2WM9B 4HAYA 5EP2A 4HAZA 5SZIA 3GPLA 4P4UA 2WSSD 2HV8A 1U9IC 4M9QA 3KKPA 4QHSA 3ZVRA 1Z07A 1S2MA 2BBSA 3TAUA 1SXJE 2B7BA 5JI2E 4RJLA 4P4TA 2ZUCA 4HAXA 1SVWA 3S1AB 1U9IA 2OM2A 3IBGA 5JZVA 4U00A 4JLKA 1CR4A 1P60A 1Z83A 4ASUA 2ZM5A 1GVNB 1XEWY 3GLGA 2IX3A 1NVVR 2ODWA 1KMHA 2ZPTX 5EUQB 3OESA 2BBTA 2VF8A 4DSTA 4DHEA 4EFMA 3EW9A 4I1VA 1KI8A 2F1HA 3NEYA 2CE2X 4QJ5A 1RYFA 2JLRA 2UZ3A 5AJWA 4C2TA 5FR1A 4DDVA 2A5DA 3OHMA 1XMVA 3ICEA 2Z5FA 3GLHE 2AWOA 4Q1AA 2P5TB 1QHYA 3DKVA 4TYQA 4G5RA 4X8MA 1YVDA 4C3ZA 4OYHA 1NSTA 1KO4A 4B76A 1PUJA 5TMPA 4BEBA 2I1VB 4XIGS 2WBLC 2J59A 1NMZA 4AG5A 2F9LA 2IL1A 3EZ9A 2FZLA 4I81A 3E5HA 4WZBE 1IN7A 1W2GA 1E9AA 4B44A 2DYKA 4Y0AA 1NRJB 3O8DA 1TF2A 1FNMA 2DHRA 3QPVA 4ZV4A 3THXA 3NEJA 2NO0A 5DH9A 4OI2A 3FTQA 1Z22A 5EE0A 1TX4B 4GRAA 2WWXA 5LD2C 2VSFA 2CK3A 3RS2A 3K70C 5FI0B 1IXSB 1Q12A 2QNRA 2NO7A 1N5LA 2DY1A 4UNNA 3MAAC 5FPYA 3V4FA 4QM7A 2DWOA 1QVRA 5BQ5A 2GXAA 1IN8A 4BECA 2D4HA 4CW7A 1W4BA 3U6BA 4HATA 2QM8A 2QMUA 2DR3A 4R71A 4TWZA 1N0UA 4JVNA 4I1SA 1IHUA 4QBHA 2R6AA 2J7KA 1E9RA 3KZ1E 3DO6A 2HCBA 2ZE6A 2X2EA 4GP7A 1I2DA 2GZHA 2O8EA 4QL3A 5E7MA 1E3MA 4LBYA 3THYB 1A2KC 3SE0A 1XJ0A 1Z08A 4NYJQ 1EGAA 5FTJA 1E79D 2GCPA 2EFCB 4PC7A 1IJEA 1G6OA 3CBQA 2RH5A 1CKEA 2BOVA 2XSZD 2Q6TA 1BO6A 3VR2A 4DLXA 1ZU4A 1N6HA 4D0NA 1P7CA 2UVQA 3FMIA 4QJ3A 2F9MA 2HDNB 1GUAA 2VHCA 5JEDA 4Q02A 1SXJB 2IW3A 5KPJA 3S1AA 3WBJA 4NCJA 1LY1A 3L2OB 3TSWA 3KX2A 1DVRA 1DE0A 1Z0IA 4EPRA 3EZFA 4OJQA 4NTZA 3REGA 4PC1A 5TV2A 1ETUA 1E0AA 2BM1A 4U02A 1P9NA 1VG0B 2AK2A 3EZ2A 1ZM7A 1IJFA 4TMZA 2J0UA 2CBZA 2QU8A 4BRUA 2PT5A 1BMFD 3BH6A 2QT0A 2IS1A 5GVRA 1E2JA 4A6XA 4BLPA 4RVCA 1S96A 2B92A 4F4IA 1CRPA 3HPRA 4Z1MA 2ONJA 5FR2A 2OZEA 3WHLA 1PUIA 1L2TA 1GAJA 3B78A 4BFZA 1CS4C 1SHKA 2B6HA 4MKIA 2PBRA 1NL3A 1R8SA 3P4YA 1JQLB 2RGEA 2XSZA 3GLHB 3GFTA 3OIVA 2WVJA 4LJ8A 4XTCS 4OL0A 4ZDJA 1JEDA 4IOJA 4LBZA 1G21E 1UBGA 4RKFA 2N1BA 5DI3A 5JMTA 1UKZA 1G7RA 2GK6A 1VCNA 2JASA 4NP6A 4Q18A 2IXGA 5KYKA 5C4GB 1E1QD 2RHMA 2IA5A 4A8JA 1CJUC 3ZQ6A 1UBCA 2XJ4A 5FBWB 1JR6A 4F7WA 3TSZA 4YMWA 3EWSA 3HP1A 4MKFA 1XMJA 4LSGA 4B74A 3GP8A 1OH6A 2ZREA 5IF9A 2VYFA 1KO1A 3VMFA 4JLOA 3CNLA 2WMOB 4N3NA 2H16A 2QMOA 1KNQA 5FH9A 1E9FA 1KSGA 2RB4A 4LV5B 1F3OA 1E4YA 4BRWA 4M9SA 3FMOB 2FX3A 1IONA 2BKUA 2RAPA 1UKVY 5G41A 1KTVA 1MRNA 4J0QA 2GBLA 3A4MA 3RHFA 4LCBA 3PITA 1HUQA 1OT3A 4M53A 1NNEA 2W6IA 1MH1A 1XPRA 3CRMA 3Q7PA 1J8MF 2GJAA 1CEEA 2FPLA 5FTNA 3IGFA 3TUJC 3UXMA 4A0HA 1M6NA 2QT1A 4YQFA 2W6JD 3THYA 2WWYA 2WJHA 2JLWA 2NIPA 4F4JA 4YONB 5BYKA 721PA 3THWB 1OH7A 3Q5DA 4A2PA 2CE7A 2D7CA 4HUTA 5AUNB 1QHHB 2QPTA 1F2UB 2CCJA 1N6PA 1KNXA 1IXZA 3CM0A 1XB2A 3K0EA 3RSOA 2QY9A 3RRYA 4BZQA 2IWHA 3TUZC 1YE8A 1KJWA 1P2UA 2VF7A 4M9XA 3GLHA 5SZHB 4YMVA 3MLEA 3EPJA 4PZZA 1HH4A 1D9XA 4WXPA 1BYUA 5AUOB 3LBNA 1TU4A 2QTFA 3LWNA 1V43A 3DDCA 1G4UR 1HE1C 1TQ6A 3KJGA 1CR0A 3DM5A 3LXXA 4B33A 4UNSA 4QOSA 1C1YA 2BJWA 3N2IA 1FQKA 1U8YA 2FWRA 4KLZA 3QXHA 4GZLA 4RCYA 4EFNA 3SBEA 3TMKA 1LFDB 2ZRNA 5GADl 3SR0A 3PCRB 3F0TA 3CWZA 1XD9A 2IS2A 2CCGA 4TLDA 4OJKA 5CLLA 2F43B 3UG6A 2XTNA 4KSCA 4QM6A 1ZD1A 2J0VA 2E1RA 1UADA 5HE8A 1DO0A 1UJ2A 5DHFA 2ZVQX 4Q7JB 2P2LA 4UQOA 1IM2A 5KUTA 1NBME 1OJLA 5KSOA 1LW7A 1KMHB 4PO8A 1GSIA 2VTKA 1U0JA 1FW6A 4CGZA 4FWTA 3FKQA 2O8DB 3BJIC 1FPMA 1P2SA 2W00A 5F98A 4LJAA 1GRQA 4KFSA 3O8RA 4F92B 3P27A 1YZGA 5L3SB 5CYPA 3SFZA 4JBXA 3K0FA 3G82C 3AM1A 3K9LA 3K9HA 4Y0VA 3IQXA 2GK7A 1VG8A 3EAQA 2XB2A 2NMVA 4XVUA 1R0WA 2Q0HA 4PAOA 1GZSA 1CRQA 1RYHA 4OHYA 1RC8A 1ZYUA 1WMSA 1X3SA 1TF5A 1D2MA 2XZLA 1XMSA 3NHAA 2H92A 1CULC 1W5SA 3MG9A 4D6PA 2RHDA 4ZCLA 1XD8A 4PAMA 2WWWA 4AG6A 3LD9A 4UNPA 1J90A 2FZ4A 1XJCA 3B1VA 3RC8A 3REFA 4NYJR 1QHNA 3GJ8A 3PEWA 2B8TA 2HEIA 3CZPA 4LHVA 3ADDA 3F3YA 4JVSB 1KZ7B 2ASEA 5J5CA 2KJQA 3MGCA 2XXAA 3IIJA 1XTJA 1G5TA 4KXFB 3JVUA 4LJ7A 2ZYWX 2ZAOA 1OF1A 2ZE7A 1OIVA 4LK2A 4BFXA 2IUUA 2XTMA 5SZKB 1K5DA 4IJMA 1MRSA 1RVDA 4KBGA 1S3GA 1OHHD 2FSHA 5JHHB 1GWNA 1RE0A 3I32A 2F1RA 2HJVA 2R8RA 1NBMA 1II8A 1KO5A 3OFNA 3P20A 3W90A 5K8TA 2AWNA 1E2LA 1XCGB 1XXHA 1XZPA 4QFMA 3WYAA 3W3AA 3AUXA 4BWYA 3PUZA 4LJ9A 3CRW1 3THOA 2FSFA 2VL7A 4JYCA 4UXHA 4MDEA 1G8HA 3VX4A 3WP1B 4U7DA 3QKSA 2FG5A 5EXSA 2H1LA 1N3BA 4B2IA 1EK0A 5JWOA 4JIMA 4PZLA 4DKXA 3T35A 5FOVA 4LYHA 1MO4A 4BLTA 4EPXA 4WVFA 3Q8XB 2O0HA 2R6GA 3ZVNA 2PZFA 1EFTA 2CL0X 4MRPA 3WRYC 1GP2A 4HDOB 1G3UA 2KB0A 4M9ZA 2QTVB 4HB0A 2VHTA 2R2AA 3TK1A 4KV9A 3MJRA 1FQJA 1QF9A 3WMEA 3OIUA 2C2HA 3PUWA 1OIXA 1LB1B 2KSQA 2V54A 2LCFA 3MWJA 4JLDA 4NL4H 1B23P 1YZKA 1QG2A 2GA8A 3UANA 2XEXA 1KK3A 4DB2A 3RRNA 3QXJA 5JSZB 1ESMA 2F3TA 3OFND 4Q1DA 1ZM2A 1QHSA 1DO2A 2ZJBA 5CIQA 4Q4JB 3B1WA 1QHIA 2P5SA 2QENA 3K53A 3GLFA 4PHGA 521PA 3SC3A 1M74A 4Q03A 1HE8B 4TQ9A 3AVWA 2A5YB 2YJTD 4II7A 3SHFA 1KAOA 3BS4A 1XF9A 2I3BA 3LBHA 4B47A 2GJKA 1AKEA 2G9NA 4MUBA 5AJZA 1UKYA 1X1RA 3KQLA 3SU8A 2QP9X 5E7JA 3FHCB 5FPKA 5JHGB 4B35A 5H1YA 4ON9A 3AKDA 3LLMA 4LJ5A 2ZQ5A 1OB2A 5DNYB 3QG5A 4B6EA 1FTSA 3CX7A 3GFPA 3P4XA 4IEEA 3BIFA 4IKEA 5GVSA 3BE4A 1NVWQ 1J7KA 4YMTA 1KI6B 2FFHA 2IUSA 4G1UC 2O8BB 1HQYE 821PA 3KKMA 5HCNA 3AVOA 3GEIA 5H68A 4OK3A 2OSBA 4OQNA 4EJSB 2O8CB 3CF0A 1XNJA 2VH5R 4F38A 4MITA 1CR2A 3T61A 4YXWA 4HDQB 3B9PA 1SGWA 1JXOA 2OCPA 4NYMR 3R7WA 1T0HB 1MR3F 1LV7A 1BIFA 3NBZC 3WXMA 4ACAA 3ZS9A 4DVGA 1QBKC 3RSLA 1D6JA 1T91A 2QPAA 1G9XA 2DFKB 2GCOA 3TNFA 3U2QA 2KBEA 5KPDA 2BJVA 4R98A 2AFHE 3K9GA 2QE7A 3Q3JB 1P9WA 4GOJA 3BC1A 2DPXA 2OLJA 4V0MA 4A0GA 2GKSA 5HR5A 1E4VA 5LBIA 4GT1A 5HPYB 4QRHA 5TDHA 1ZW6A 3QKSB 5J47A 4IDHA 4M8NE 2IBMA 4RZXA 3L0OA 3LAWA 3UMRA 1JAIA 5L3SA 2Z4SA 4TSFA 3KFXA 2ZVPX 4RD0A 2YVUA 1KY2A 3L8YA 4PFSA 5G53C 3CRQA 4TZ6A 4LI0A 2IEYA 2CL6X 5FI1B 2Q9BA 3ZD6A 3DHWC 4PC3A 1OYWA 2CHGA 1T6NA 2OXRA 5GJBA 1NMYA 3CF2A 1DAGA 2QAGA 3PFIA 5E95A 3WRXC 2EYQA 4US1R 1FTNA 4DLWA 1HY3A 1UDWA 4QHTA 2PH1A 5CM8B 1SKQA 3K0AB 4LZZA 2A5GA 5DE3A 5CK5A 1X6VA 1L4UA 3SI7A 3PJRA 5FUXA 4B6FA 2HUPA 2D06A 4AKIA 1C9KA 2VP2A 1WRBA 1KDRA 4LOAA 3NBYC 4JBWA 4D0LB 1W0JD 1OH8A 2Q21A 3AUYA 1ZD8A 3DOEA 3I72A 3NBFA 1TQDA 1SULA 1VHLA 2OO7A 3LBIA 4Q1CA 2FPMA 3R8CA 2CL7X 3K09A 4L8GA 1CLUA 1TAGA 1EWQA 4CRWB 1XX6A 4FI3C 4NCHA 1GL6A 4LBVA 1GTVA 2YOGA 4GNKA 3IDQA 2QN6A 2RGCA 4XVQA 4DSNA 3GLFE 3TIFA 1RRGA 2QP3A 2GXQA 1FFHA 1V5WA 2MSDB 2QP4A 2WOOA 2YOHA 3BD9A 3U3KA 3GLGE 2X19A 1W36C 1TADA 1VCOA 1E2HA 2H57A 1XTKA 4NYIQ 5FUYA 5CJPA 4TMTA 1HA3A 2FFQA 3ZD7A 4L9WA 2BBWA 5JWHA 2VSXA 3PVSA 1G3RA 4D25A 4GSYA 1OXTA 1YHNA 4MRVA 1NN0A 3Q7QA 4NHOA 1SXJD 1RZ3A 1XP8A 3ZYCA 1I4TD 2VRWA 4O0MA 5FBLB 3L8ZA 2OHFA 4A1FA 1R5OA 2H8KA 2HXSA 1UBFA 4KFUA 3RNLA 4Q1EA 4BZPA 4W5WA 2ZYTX 4BFSA 1XXHE 1KK0A 1R5BA 2Y8EA 4YC7A 4Z54A 3RS5A 2G83A 1T8UA 2PZGA 4FINA 2XGJA 1Q0UA 3HR7A 5JI3E 1L4YA 3QF4B 4PR0A 1EFHA 4OHZA 5LB2A 2FEOA 2J45A 3A37A 3VU9B 1X86B 1ZM9A 4MUAA 2QBYA 2O8EB 3L0IB 2ZRKA 4LPSA 4DLZA 4LHWA 1T3HA 4JBYA 4AWXA 4PO1A 1NSFA 3FOZA 3SQWA 4DCNA 1CJKC 2MMGA 2HXYA 1E2QA 5AUQA 1E2KA 4B71A 1FMJA 4FIDA 1OFIA 3CWQA 1W4RA 2F1JA 3CPHA 4NU0A 2ODBA 2LWIA 3RWOA 3AVYA 2ODEA 1AS3A 1P2TA 3KXIA 1OB5A 1TEVA 1UPTA 1SVIA 1S3SA 5H70A 4CEJA 2WPDD 2ZI3A 2CCKA 4EJSC 2QMHA 1UFQA 5P21A 3V00A 4N0EA 4K8OA 2AXPA 1KYIA 1K5GA 1VIAA 1XDBA 4KI0A 4AKEA 3GFOA 2B7CA 4BE7B 2FNAA 3SZRA 3EX7C 3GQBA 4Q5IA 2Z6VA 1E0SA 3TUIC 1E2NA 3B5JA 2C9YA 1E0JA 1N0WA 1EFRA 4KFRA 1W1WA 3PG5A 2DBYA 4EPTA 2GCNA 3H0KA 1UF9A 2V9PA 3CB4A 1NF3A 1U99A 2KI5A 2YWGA 4RKEA 2XX3A 1F48A 2ORIA 1L7VC 4WIAA 3UIEA 4DLSA 1AJEA 2YC4C 2ZRBA 3CR7A 1GL9B 1OPXA 2FH5B 1Z0AA 2BV3A 2IT1A 4B3CA 3TGPA 1XBTA 1KJZA 1Z0FA 3H84A 4DCVA 4V0ME 4MYHA 2G88A 4LBWA 3K70B 2YHSA 2AHOA 3OF5A 1YR6A 4HLQB 4W7SA 1ZNZA 4QGHA 3GLIB 1X8LA 4NCNA 3H86A 3QOFA 4PPFA 3CRVA 5E4FA 1KDPA 3U44A 2ANCA 3QVVA 3U44B 2OFXA 4IHQA 4TT3A 4KSBA 4PO9A 1W44A 2QGNA 2VP4A 3CPJB 4R9UC 3W6NA 2KBFA 4A4DA 5KDLA 1EWRA 1YU9A 4B32A 1TUEA 5D3QA 2A3RA 1QHXA 4G5SA 5EE3A 4M1WA 3TW4A 4ARZB 4ZDWA 3WYFA 4EQ6A 3A1VA 3QXXA 1GRRA 2J9RA 2KWIA 4DC9A 5DYGA 4IDQA 4OI1A 1LF5A 1KK1A 2ZI6A 3M4YA 2YYZA 3QVUA 1XFAA 2BEKA 1D2NA 1W4CA 4JMPA 1Q3TA 3UMSA 1EFCA 4G01B 2ERXA 3VHXA 3QKRB 4JJKA 3U6KA 3T1TA 1KAGA 3D3QA 1Z2AA 1AS2A 5CM9C 2GTPA 4W5JA 1UDXA 2EWWA 1GOTA 1IY0A 2LKCA 1R4AA 2ZR0A 3QI2A 4M1MA 1OFHA 3MMPA 2J7PA 4G5QA 3AQ4A 2FF7A 4PSAA 4TLEA 1EXMA 2WJIA 5CJ2A 5ELXA 1XEFA 2FJUA 5CIWA 4IVQA 5CB6A 1GIAA 3KUDA 4RFVA 4FMCF 1JALA 4URUR 2IYZA 2AKYA 1QHHA 4RD4A 5J4YA 3TAHA 3B60A 5C1BA 1T8TA 2Q3MA 3OIYA 1E32A 1NY5A 1KDTA 1UKEA 2Q3HA 4UJ5A 2VIIA 4XVRA 3W6PA 4LPKA 3D31A 4HEJA 2W0MA 4IVPA 4NPHA 3KKOA 5KHOC 1IXRC 2WHXA 4QNRA 2W6JA 2VP0A 3AF0A 4DLYA 2OE2A 3FMPB 4Q4LA 4Q4AA 1E9EA 1I2MA 3HWSA 4A8JB 2E9SA 5UKDA 2RGBA 4CEHA 5L3RA 2QPOA 2BBOA 1CXZA 3FKSA 4JLNA 1G20E 4DEXA 4U5XA 1F60A 5J4LA 3VKHA 1MABA 4MA4A 5KNCA 3DL0A 2ZS7A 4UKDA 1E94E 1DS6A 3QKTA 3BB3A 4LWZA 2ZSDA 4EAQA 1SXJA 1M34E 4NZYA 3BGWA 4JL8A 5JCPA 5L3QB 1KSJA 4YDHB 4TYNA 3PIRA 1NKTA 4LUCA 3LVQE 4S35A 4NCIA 1GNRA 3NTUA 2C78A 1BMFA 1G3QA 1VECA 4B34A 2FGKA 3X1DA 3A58B 4P33A 5B30A 3BFXA 3W6OA 4C0JA 3TR0A 3NKVA 5JSZA 1P6XA 4HLCA 1E0KA 1Z6GA 5HZHA 5FL7A 2GESA 3QF4A 3K70D 3TW8B 4V02A 3ZIAD 4E03A 2BC9A 5J4VA 4KLNA 4ZIRA 3DOFA 1Y63A 3SEAA 5FBVB 3W34A 1G5PA 3LV8A 2ZRJA 1SKYB 4RCZA 2A5FA 3X1XA 3U7GA 2HF8A 1U8AA 1TNDA 2G77B 2OEPA 2X77A 4A9AA 3CX6A 3R9WA 1OXUA 1A7JA 2NO6A 4WA7A 3UK6A 2FGJA 2GRJA 5TVKA 1N6RA 1FOEB 4CEIB 4MYTA 2EVWX 3C41J 4ARZA 2R44A 1ZU5A 4LJYA 2GHIA 5HCIA 1D9ZA 3NG1A 4DWJA 2ZSEA 4ZPXA 1ZM3A 4DLUA 1OYYA 4P4SA 1P62B 3THXB 4PPQA 1P73A 4QC2A 4DLTA 4AC9A 4LHXA 4LYAA 2JLYA 2F3RA 2WWGA 3IILA 3PUYA 3TE6A 3OAAD 2PLRA 1NIPA 3I62A 3CF6R 3GJXC 4HI0E 1DADA 2DWPA 3BOSA 3E2IA 4HAVA 3A1SA 2NPIA 4MGIR 3H1TA 3WMFA 1JBKA 2CJWB 1NN1A 4PPGA 4Q7KA 1QRAA 1Q3HA 1JJ7A 3FGNA 4IW3B 221PA 3W5JA 2HJGA 4XTRA 5KO2A 3UPUA 3U4QA 5B2ZA 1WB9A 1H8ED 4D4MA 5BWMA 4ILEA 3QEOA 1CF4A 1NIJA 4L16A 3VR1A 1LF0A 2K5UA 4DJTA 1PV4A 1OFUX 4I1OA 3AP1A 1TPZA 1Z06A 3B13B 4ZIRB 2XNDA 3X1ZA 3QSYA 1G8GA 3CH4B 4OKSA 1S0UA 2JJ2A 5HKKD 3NC1C 2NG1A 4BLOA 4AY2A 3FYHA 1KMQA 1XU4A 3KXLA 3BH7A 1DAHA 2C95A 3O8CA 2FOLA 3OEHD 3QNUA 1WE2A 3FE2A 4D4JA 3EARA 1SQ5A 5GJVC 5TARA 3ND9A 3EPKA 2ZU0C 4GMDA 3FKSD 2A78A 2GILA 4RY2A 4B2LA 1G1MA 3ECCA 4PXAA 3NWJA 2PJZA 3N5CA 3PEVA 1MT0A 1J70A 2QGZA 1G3MA 2O5VA 3W3ZB 4H9GA 1KHTA 1ZNWA 1GKUB 3QPUA 3EPLA 4LV6A 2JAQA 2IYTA 3AKEA 3MWYW 5DO9A 4B3GA 1OXSC 2BIFA 2C04A 2V4ZA 2CLDX 2RGNC 2V7QD 1KK2A 3LW7A 4JVMA 3B1XA 4JYBA 2PMKA 1IN6A 2Z43A 1PJRA 4PHHA 2JEOA 2V55B 4MRRA 3ONWA 1Z3IX 5AR1A 3R7WB 3VR4A 4UNQA 4Q9LA 2GVZC 4PHFA 1T5LA 5BW8A 2ZR7A 3KQUA 1W0JA 4RD2A 3IIKA 3GMTA 3LDAA 1KI4A 3RS4A 1QZXA 4FW9A 1P61B 2OCYC 3MUFA 3WHKA 4URXR 4UXJA 4H1UA 3AVUA 5BXQC 3R9XA 1QDEA 2WAYA 4TT3D 5JCZA 1VYUA 4Q9HA 1NLFA 3WNBA 3ZQJA 1DARA 1F6BA 1N25A 1NVXQ 421PA 4A15A 2IHBA 3OIWA 1QG4A 1AKYA 4K81B 4M1TA 4QGFA 2C98A 3U3RA 1YZQA 3I61A 1KI7A 1NG1A 2FSGA 3QG1A 3VFDA 3R9IA 3IHWA 4FCTA 4KFTA 2AD5A 4IFBA 2GF0A 2QA5A 2QAGB 1ZINA 1OV4A 1Q1BA 1FP6A 2RCNA 3PUXA 1AM4D 5KDDA 5FOWA 3K0AA 4G3XA 4DRZA 1P3JA 4C9BA 4Q47A 3I5YA 2HT6A 3KJEA 5JLJA 1Z0KA 2ZJOA 3AF1A 1E2DA 3RS0A 3TBKA 2IYQA 3BFKA 1ZIOA 1LVGA 4XSHA 3KQHA 1XPOA 1J2JA 2C8VA 1M1YE 2QROA 4NBSA 1FUUA 4I1UA 4XSGA 4Q1FA 5FOSA 1WBBA 1VPLA 4NKRA 3SYKA 3T1VA 2FPKA 2WWFA 3LW8A 4XWOA 2PZEA 3N2EA 1E2IA 4DIEA 3CPEA 3FWYA 4PHTA 2IYLD 3UKDA 5LPNA 4UJ3A 2YKGA 4DUGA 1VHTA 4W5HA 3OEEA 3I1FA 3IEVA 1CR1A 4POAA 2JJ2D 2VA8A 4TL7A 3PEUA 4RD3A 1N6KA 4CEIA 2J3EA 2IK8A 2P0EA 4ZDKA 3GD7A 4L15A 4D80A 2FV8A 1S1MA 3EZ7A 4IOKA 3GLIE 1DELA 5CB8A 5DN6D 1M7BA 5JEEA 2WICA 4JLBA 1N5IA 1DG1G 4GOXA 2ZI9A 4M1OA 4NMMA 4OHVA 2JA1A 3AVPA 3K0FB 3FFAA 2FSIA 2OXCA 2ANBA 4HB4A 4QXAA 2NGRA 2BM0A 3B6EA 1VYTA 2J41A 3R20A 4FCVA 3WNDA 1ODFA 1WBDA 1IY1A 4NYMQ 1SXJC 4LJ6A 2I1QA 2ZETA 1KJYA 4ESVA 2R62A 3T12A 1ZVQA 2CVHA 1E1RD 2W2TA 2XOKA 1ZC3A 1A4RA 2L0XA 5B58C 2ZUBA 4FMDF 3ADCA 3EIQA 2PCLA 3EZ6A 2Z4RA 3K0CA 4QNMA 5EXXA 3AF2A 1YZNA 3IBYA 4F91B 1W0KA 4DT1B 1SVLA 4XD7A 4LHYA 1O3YA 2QSZA 2W6ID 4FMBB 4M22A 5FPHA 4EIWA 5C4MA 2CDNA 3B2EA 4TTRA 4V03A 4BGDA 3I92A 1KIMA 3LXRA 3T1OA 1JJVA 2W83A 1GFIA 1ONBA 4NCKA 5BN5A 3WBKA 4C0HA 3T1QA 2QTHA 1E96A 2GDJA 4QKQA 4BZXA 2ZRPA 1I4DD 2GZAA 3AB3A 1N0VC 3JZAA 2ZXUA 1JXMA 1J99A 4ZKEA 2HYIC 4E5UA 1NG9A 2R6DA 2JCSA 4AI6A 1P2VA 3TKLA 1G4AE 3MWKA 4DZZA 1W4AA 2N46A 4TL8A 2ZAMA 4W9MC 4I99A 2EFGA 4X8OA 3SNHA 1PLLA 2IYRA 4JLMA 4OI4A 4MGKR 4BLQA 4WZAE 1NBMD 1H8EA 4C30A 4IOLA 3A1TA 1XPUA 4E22A 1G16A 3SYNA 3I5XA 4IDNA 3PEYA 3DZDA 4NDZA 3HJNA 4TQAA 1E2EA 3QY0A 3MWLA 1XMIA 2F6RA 3KKNA 4WBSA 4Q48A 3LA6A 5LB4A 3GJ6A 3VNVA 1EG7A 1A2BA 2OFWA 4DCSA 4CZ2A 3CH5A 1XEWX 1X8KA 4TLCA 4G5OA 2ZRIA 3KJHA 1XTIA 1JR3A 4IXNA 5G40A 1YR9A 1U94A 2H7VA 2VSOA 1E69A 3QENA 3SN6A 4HUQA 4XD7D 4TMXA 2ZJYA 1GITA 1II8B 1YKSA 5CK4A 5DYIA 3TH5A 4DDWA 5A5GA 2GAAA 3HU2A 3IUYA 4HAWA 4A92A 3QIAA 1R5NA 1Z6AA 5EP1A 2ZJZA 3VKWA 2OESA 1UEJA 2C99A 3FVQA 5JS7A 2E87A 2MMCA 2H18A 3UATA 4BEJA 1BOFA 1MV5A 1T3LA 1RJ9A 5CITA 2W58A 5M04A 4TMKA 4PQFA 4JVLA 3C7KA 1CTQA 2F7SA 2JLVA 5LDDC 3LVRE 4OQLA 2CEAA 1W46A 2OCAA 1F2TB 4JLPA 1U90A 3U3MA 4B75A 2IYYA 2ZRAA 5FOTA 4BASA 2G6BA 3Q85A 4P0TA 2ZSFA 5EE1A 1DEKA 2IXFA 1LS6A 4NH0A 3QKRA 1QVAA 4GPTA 3VNUA 1KKMA 1NI3A 2A30A 2RKOA 4C4PA 5B64A 2JDID 3SOPA 3ZJYA 3EC1A 3W9YA 4JLJA 4OHWA 2A5JA 2REOA 1Q1QA 3CONA 4XH9B 2XZOA 2O0KA 3ASYA 4FWIB 1TEXA 1XD2B 2RGGA 1GDDA 2ZYUX 1JNYA 1HV8A 3K9NA 4R2IA 2IS6A 1U0LA 1SHZA 2PJRA 1CJMA 2VHUA 1KI3A 1GKYA 1N6LA 4P31A 1JEEA 3AGQA 5FUVA 2Q3FA 2Z83A 3LQRA 2IUTA 4X8LA 2BCGY 2P67A 4B2PA 3U3OA 2FN4A 3KL4A 2O8FB 3H2YA 1M2OB 2JATA 3B7GA 3QXSA 1ZBDA 1XTRA 1R6BX 2ZE5A 1M7HA 3ZZ0A 1XCPA 2R6FA 2CK3D 2CHQA 3NH6A 1R2QA 3Q9LA 3VAAA 4OI0A 5H8WA 1DBSA 1X1SA 3T5GA 4A2WA 3HU3A 2J0QA 5DI3B 4MDFA 4RZUA 5EJEA 3AF4A 3UMFA 4Q66C 2FFBA 3B1ZA 3FB4A 2XAUA 1G6HA 3CX8A 1MABB 2XNSA 5K8LA 2MSEB 4RD6A 3AVXA 3SJAA 3VHLB 2B8WA 2YWEA 1U8ZA 1KO7A 4QBGB 1XWIA 2ZRFA 4AYTA 5EZ5A 2QAJA 3NXSA 1KI1A 2AXNA 4WW0A 4KHZA 4B3XA 1JI0A 3Q5EA 2JLSA 4EPWA 4IOMA 3Q72A 1EFUA 4AYWA 4C0KA 2WSSA 2PX3A 3FHOA 3ZVLA 4BLSA 3CLVA 1KI2A 1I4LD 2OBNA 3AP3A 1P72A 2JIZA 2AR7A 1FMLA 2TMKA 3C16C 3E1SA 4IDPA 4YLGA 3GLIA 1U2RA 4Q9IA 4A2QA 1HEIA 1Q57A 2PMDA 1RFLA 1P4SA 4B3BA 4JL5A 1Z8FA 4TYWA 1AZTA 4JJZA 3P26A 3TRFA 4ZCMA 3EPHA 3CO5A 1W2HA 5KOYA 4AKGA 3K0CC 3RLFA 5TXGA 2ERYA 3OE7D 1ZRHA 4MYUA 2YOFA 2H17A 2ZJ5A 2WKQA 2ZI7A 4UXIA 2V3CC 4URWR 1GNPA 2GEVA 2V6IA 4EQ6B 4MQBA 3DMDA 5AK0A 4ZO4A 1KY3A 4KAXA 1NJFA 2RGAA 3I3SR 3V4RA 1HT1E 5L3QA 3NHBA 2DFLA 5K8UA 3QF7A 2REXB 1R0XA 4A0FA 4C7OA 4ACBA 1ESNA 4ZI3A 1KOFA 4B43A 1AS0A 4B48A 4UNRA 2OILA 2QM7A 3PUVA 5BYJA 1IY2A 4RSGA 3EC2A 3PV0A 1T3SA 3IQWA 3KXKA 5A0FA 4TLBA 3SQXA 4N0DA 1UBEA 2QUZA 3FHTA 3LQQA 4FN5A 2JIZD 1A5TA 1E2FA 2GBLC 3A8TA 4JLVA 2A7QA 4WOPA 2GJSA 4QJ4A 1XD2A 3BRWD 1WP9A 4PZYA 4HDCA 2PLFA 2IEZA 4AKHA 4MYCA 4R2HA 4HAUA 2UZIR 2ZRDA 3PENA 4GL2A 2V1XA 4HZUA 3HYTA 3OAAA 3ZZUA 1COWA 3SBDA 2J5XA 3L43A 1SKYE 1UM8A 2EFHB 3O47A 4A8JC 2VP9A 1B0UA 1YZUA 4LY6A 3AEZA 4WAUA 2G3YA 1T5IA 3AKYA 1G19A 2C9OA 1WQ1R 2IYVA 3A4NA 1OXXK 2D62A 3SJCA 4G5GA 4Q00A 3UWKA 2ZI5A 2NO9A 1CU1A 2PEZA 1S1CA 3BAFA 3QQ5A 1ZNXA 2IYXA 2PCJA 2PT7A 1J8YF 2YV5A 1S4QA 5DHAA 4Z8XA 5C46F 2DWQA 1G7SA 1U98A 2XJ9A 5TB5A 1EX6A 3ZLJA 2BCJQ 2I4IA 4JSYA 5FPTA 5B57C 3U7EB 4C7OB 1N6IA 2NTYC 3L0SA 1R7RA 1SVMA 3PQCA 1NJGA 3RRMA 1VCIA 1NVVQ 1IQPA 3K8YA 4NE2A 1RPZA 3OE7A 3RS3A 3M6AA 1JPNA 5J4HA 2HT1A 1XZQA 1DAEA 2YWHA 5IDVA 3ZH9B 4LDJA 3CIOA 2JGNA 2ODNA 2ZIAA 2NQ2C 3A4LA 4RFSB 1XJQA 4D82A 121PA 3TLXA 3MRSA 1Q1ZA 3H4MA 1H65A 2WJYA 4TYYA 1F2UA 4XJXA 2V1UA 4I4LA 3SDZA 2A9KA 3IKJA 4DDUA 5KTYA 1Q20A 2ZS8A 3WY9A 5EUMA 2QG6A 2JLXA 5D3MB 3KKQA 2VLIA 3X1WA 5D3MA 5FTMA 1FZQA 1E2GA 2GEUA 2RGNA 3DKPA 2G0NA 4M1YA 4EKDA 2QI9C 2ZSAA 3KQKA 1A82A 2GJ8A 1ZCAA 4CVNA 2CNWD 4DLVA 3ETLA 1R0ZA 3HDTA 2W0SA 1OLOA 1Z28A 3QE0A 1HQCA 1KSFX 5DLQC 2VP5A 2EFEB 3DM9B 1A1VA 4LYJA 4LX0A 4TTPA 3RDPA 3GJ3A 5CDFA 3UG7A 4IDOA 2GXUA 1NMXA 1US8B 1ANKA 1D2EA 4FMCB 4NONA 4D0GA 1HYQA 4DCUA 3EIEA 1NP6A 4PPNA 1DPFA 1BH2A 4FCWA 5FBQB 2KE5A 2F55A 3AVQA 3IHLA 2C96A 2ORWA 4Q9KA 1TF7A 1BYIA 1U0HC 3NC0C 2QRNA 2DFNA 2XB4A 4EFLA 1XTQA 5L8VA 2OLKA 2ZRMA 2A2ZA 3G0HA 6Q21A 2V7QA 2IYSA 1E2MA 1P9RA 4L4UA 3GLGB 1NY6A 1Z2CA 4IRUB 4PSKA 4DB4A 3RAPR 2Q9AA 5KSYA 3R8FA 2CXXA 5AJXA 1YR8A 2GAOA 3VQTA 3V9PA 1COWD 2AK3A 2P6NA 3NDBB 1IN5A 5C2JB 4M1KA 4A36A 2QL6A 4EPYA 2YWFA 1AA9A 1W7AA 1TUIA 4QBFA 1H8HA 1S9DA 1N5KA 4BPBA 1LTQA 1OXVA 3K09C 4M4SA 2FEMA 4KYIB 4BFWA 4DUGD 3GJ0A 2ZYVX 3J81k 1LS1A 3TSOA 4MKGA 4XWAA 2ATXA 2ZJ8A 1D8TA 1RIFA 3U3JA 3A1UA 3ZDQA 4V0NA 2V6JA 5EXPA 3L0PA 1VYVA 4F93B 2PX0A 2BMJA 2R9VA 4ZDIA 4Q7LA 3RANA 4YMSA 5EE5B 3BB4A 4TN1A 3U7FB 4D81A 4RZ3A 3SS8A 2D2FA 4GOKA 5LD2B 3HR8A 3B85A 3IPYA 3CNNA 4A0RA 4MRNA 1UAAA 4FMDB 4PAQA 4OK5A 4IVRA 4GI7A 2J87A 3AP2A 2P6UA 2JDIA 2QAGC 4PC6A 4X8HA 5CYOA 1UEIA 1T9HA 4LJ4A 3ADBA 1P75A 2ZI4A 2JJ8A 3P1JA 1JR3D 4KCGA 1ZNYA 2ZEJA 3QEJA 4Q1BA 1VIYA 3DZ8A 3QBTA 3EWAA 4YXWD 2AFIE 1TQ4A 3VTKA 2WIBA 2Z0MA 2P6RA 2FE4A 3A36A 1PVOA 2REBA 2QEQA 3C15C 4TLAA 1X8JA 2J7PD 1RKBA 4MRSA 5L3VA 3RABA 4HLUC 2AN9A 1HURA 2JLUA 2QQ0A 1E79A 1R8QA 1W0KD 3LO5A 3C8UA 4Q4AB 4PQYA 4BFUA 2UKDA 1XCMA 4TTQA 1AN0A 4TL6A 4AD8A 2PL3A 2WWIA 4H1VA 3CR8A 1Z0JA 3AKCA 4KVAA 4FXPA 5KSZA 3THWA 3NH9A 4F4CA 2QORA 2P65A 2SHKA 2EWVA 3RRZA 5KU1A 1OFTA 2BMFA 4MGYR 3JZMA 2C03A 1PLKA 1OKKD 5FOUA 3D6TB 1ZM4A 3VR6A 3BH0A 5EQTA 4CIDA 4JKIA 1PZNA 1K6MA 2EU8A 2JLQA 4Q21A 1GM5A 2CJWA 3F8TA 2NPFA 2FFAA 2ZITA 3QKUA 3ASZA 5JJIA 4ZI2A 1Z5ZA 3VR3A 3AGPA 5FPSA 5G3ZA 3IO5A 5JJKA 1EESA 4EUNA 2DCUA 2ZSBA 5DN6A 1G7TA 4O2LA 3W8RA 3O8BA 1G18A 1G8YA 1NLZA 1KKLA 2IYWA 3A1WA 3BXZA 3TVDA 3FFBA 3MSXA 3WMGA 1MO3A 2IC5A 2X8AA 1M8PA 2EYUA 2NZJA 2EQBA 4M0LA 1ZUIA 3HYRA 3QPWA 4OQXA 4URZR 1E98A 3IO3A 1HTWA 2R65A 4S2EA 3T5DA 2GJ9A 1KSHA 2IXEA 1ZAKA 3LX8A 4KBFA 3C14C 4A6PA 2BMEA 4C0AC 2IYUA 4WXRA 1IOZA 3C5CA 3SJBA 2O0JA 4D2IA 4TZ0A 4GFDA 2X2FA 1H8HD 4JL6A 3RC3A 4M1SA 1G7CA 1E1QA 2DB3A 3P32A 5AWFC 4Q4HA 1Z63A 1MO5A 3FMFA 4QBIA 1MKYA 2GNOA 2JJ1A 3VKGA 2ZE8A 2XZPA 4P4SB 2ZRHA 2C5LA 2ZRCA 3IIMA 4R7ZA 2ZRLA 1TMKA 2ECKA 1TU3A 1F2TA 5ANRB 1TL7C 5FOXA 1MO6A 2GXSA 5FUWA 1XRJA 4ZCIA 2GEDA 3ZS8A 2H5EA 2WPDA 1OKKA 1E1RA 2D3WA 2XOKD 1YZLA 2Q9CA 4DSUA 1T0JB 1VTKA 4RD1A 5IRCD 2F43A 4KYUA 3EA0A 5F3WB 3RS7A 1YJ5A 1ZMXA 1VMAA 2OAQ1 4BFYA 1GL7A 1TTTA 1R0YA 4BLRA 5AJYA 1E9CA 1Z29A 3LY5A 3W8NA 3U4QB 5JRJA 1HT2E 2HYDA 1AZSC 2WWHA 4AYXA 4RZ2A 2WKRA 2IF0A 3ZGXA 4L9SA 1WDTA 4LGMA 2ZRGA 3RVBA 2ZS9A 3GLFB 5KNBA 1WXQA 5E3HA 4RFSA 1YR7A 1W36B 3F5FA 2J0UB 1W47A 4ASUD 2YINC 3GEEA 4CT4B 1VG9B 1E9SA 4ITRC 3C5HA 3BWDD 2BEJA 3KDSE 2BKEA 1ZUNB 3DEFA 3OEED 3B8HA 3DPUA 3EASA 3EG5A 2ZR9A 3X1YA 1M7GA 1VG1A 3ICQB 3OEHA 5HE9A 2CLCX 3WP0A 2PEYA 1FX0A 2ZANA 3PR1A 5SZJA 4EDHA 1NN5A 3BK7A 5HKKA 4DSOA 4YDSA 1AQUA 1E9BA 5IK2D 1D5CA 4P32A 4HYYA 3LRPA 4XWKA 3U60B 1FP7A 1OE0A 1ZIPA 2J46A 3NVAA 1ZD9A 3KFVA 3AVTA 5F2EA 1VKJA 2IF2A 2WZQA 4O2RA 3CUEF 3LX5A 1JAHA 4DIDA 4EJSA 2BMDA 2NOAA 1DAIA 1WF3A 3B82A 4MGZR 3ZVMA 3K1JA 2IWRA 2QMEA 2NO1A 4IEIA 1BS1A 2EFDB 2BVNA 2W2VA 2ZTSA 4K46A 4KJZA 4HSEA 3KTAB 4Q9JA 3CW2A 5HZKA 1F5NA 2ZJAA 2JLZA 2BWJA 5EZ6B 1GILA 2D2EA 1PLJA 2N42A 2BHRA 2C77A 2WJGA 4M2LA 3FDIA 4QGAA 5JS8A 2VO1A 3T06B 4DEYA 1GRNA 1ZUHA 2GF9A 3TQCA 4G0NA 3KB1A 5CDFE 3CNOA 1AQYA 1DAKA 2ZJ2A 3IPXA 1DOAA 3CRRA 2G1KA 4JKYA 1Z6YA 4QGGA 2D7DA 4YMUA 4LC1A 3AH8A 4C2UA 2WOJA 3A6PC 4Q4HB 3SHWA 2IHYA 3L82B 4V0LA 2ORVA 2ZU6A 5AJVB 4Q4JA 5EP4A 3BBPA 3M1IA 3T34A 5GJCA 3JVVA 4TMWA 4E07A 3QBVA 4URVR 1L8QA 3KJIA 1YRBA 1RRFA 2CVFA 3BB1A 5JECA 1KI6A 1WCV1 4LC0A 8OHMA 1OSNA 5K8IA 3TR5A 1DG3A 3CZQA 4IXMA 1TQ2A 3AF3A 2MSCB 4Q19A 4GDFA 3QUSA 1E99A 3MJHA 1G41A 3QXCA 5FTKA 3BFVA 5IHPA 1FX0B 1G291 2GVDC 1Q21A 4D4KA 3AVVA 3B9QA 4DCTA 2WKPA 2YC2C 2F1IA 1KGDA 1Z47A 2VHJA 1NKSA 3GEHA 2LKDA 2WMNB 4BFTA 2ZROA 5E7IA 3C4JA 1YQTA 2OBMA 2W2XA 1Y3AA 4ZKDA 2OG2A 1NN3A 2B21A 4JT4A 2QE7D 1NVUQ 4ABYA 3U5ZB 4Z8YA 5G3YA 1GNQA 4TQUS 1YZTA 2RMKA 2OFOA 5JBQA 4CDGA 5A4JA 3SFVA 3SYLA 2YZ2A 4KO8A 4CT5A 5JJLA 3RWMB 5F9FA 4LRWA 5JFGA 2ZUDA 3IEUA 5BN4A 2OUKA 3LLUA 1NLYA 1KZGB 3NBXX 5HTKA 1CJVC 5JRZA 4PX9A 5KNDA 1FUKA 1KO8A 4XOIA 1T4GA 5F9HA 1GG2A 1ELOA 1DTSA 1U81A 1Z6XA 2HCJB 3EXAA 1K8RA
chains in the Genus database with same CATH superfamily
3EXEB 2LDXA 1DO8A 1PT5A 2ZUFA 1RRPA 2PZJA 4UHFA 1G8KA 5HBGA 2QQEA 2P30A 3JQ9A 2AD1A 3TG8A 3UWMA 1AGRA 1ODSA 2Y3IA 3WQBA 4ALMA 1ZGHA 2YH2A 1XQVA 3BMQA 4E46A 2W6MA 4C0QC 3GU3A 4J0JA 3VR5A 1XTVA 1SB9A 1CV2A 4HWSA 1OHHA 2B8EA 1SPXA 4KXYA 4WI1A 1Y8ZA 1GA4A 2HLDD 4PSVA 5FL3A 2QJRA 1PS9A 3BWYA 1MFZA 1J9ZA 4DANA 3LGXA 3G5UA 2A4KA 5MF6A 1QGOA 2AOUA 3K6JA 1ODIA 1PVVA 3EGEA 3ND8A 4UUMA 1WB4A 2P3LA 4Q01A 3ROZA 1YI8A 2PN1A 3T15A 1AGPA 3P19A 5JD6A 3I0ZA 5FBKA 2GETA 1NA5A 4Y9SA 1II0A 3UXYA 1QG0A 1RPAA 2V4MA 4B3MB 1H2RS 2ILTA 3K5PA 1Z0DA 4ESHA 3D9QX 3LUAA 2XMGA 4C0BA 2QMZA 3NAZA 3RRFA 2GCOB 4MCJA 2NZ8A 4RWZA 1CWUA 4B73A 2CVQA 2RGWA 3FPAA 4MVWA 4BWGA 3FCEA 4EI2A 1X7ZB 2JH8A 4Y2GA 2HLNA 5JSQA 2XTZA 3PTLA 4JJ8A 1JXAA 2ONKA 5HX7A 1WXFA 3SC2B 4MZDA 2ESRA 4FOPA 4WDQA 4LOKA 1NXVA 4FIZA 5EE9A 5HOEA 4ERNA 3HLTA 3T7TA 2CFSA 4KN8A 4Q9NA 3BCUA 1USGA 2QLLA 4E5NA 1OW3B 3C85A 2WV9A 3TZCA 1NYTA 2O07A 3AR7A 2BKXA 3OD5A 4BRUA 4LMAA 4D4LA 4YAUA 3RTDA 1DCFA 1ZGZA 1PJBA 2FVXA 2CWWA 2Q8NA 4LHEA 1UP6A 2QL5A 4OBWA 4UU7A 2HZBA 4ZI7A 2R4UA 4WXEA 3ZWXA 4J9UE 2X1HA 1H5NA 4R0VA 3L4JA 2J0SA 2V6FA 4MWTA 4QG7A 2GBGA 4OQFA 2C7GA 3GNTA 3N58A 2QW8A 3TNJA 4EG7A 1E3TA 2FP3A 3ZWDA 4DPMA 3UMMA 2A0UA 2G09A 4PBSA 2OY0A 2Z3VA 2VF5X 2BEWA 1HMYA 4NZ9A 4EG1A 5DX8A 2MIIA 4C2AA 4ZU6X 4Z4EA 1V11B 4JSRA 1LQUA 4KTVE 4RIGA 3S40A 3UXEA 3FTNA 3KUCA 3WGHA 1MX1A 3JD2A 4OK6A 5KQGA 3D8BA 1IBCA 2TMDA 1OTHA 4PXYA 1QPZA 1W49A 1OAKA 1I1HA 3L7YA 2AOVA 1NE7A 2QJWA 2WIAA 1ACLA 2UUOA 2WT9A 5FFFA 4ZGGA 4Z53A 2Z8XA 3JR7A 2I7XA 1KDOA 3E4CA 3OQIA 1UJ4A 1FL9A 4IXDA 4DLNA 1SBZA 2P3SA 3DNFA 2FPGA 2VHQA 1GN9A 4RA9A 4BCBA 3D7SA 1EUZA 1R16A 3EDMA 3NWEA 3SKVA 4YUXA 1K7FB 2FU5C 4CEJB 4M8IA 2C82A 4D8VA 4LFAB 4IIDA 1VPTA 2OQRA 1EX7A 1Z7WA 1PFUA 4X44A 3L1VA 3I8OA 5KOJB 1P3DA 3UWOA 2OCBA 1KQOA 2EG9A 1ZJ5A 4MR7B 4JGBA 4KITB 2V7TA 4FS3A 3SJZA 4EZIA 1ZXLA 4NE9A 3W90A 4R1MA 2EQ5A 2O8DA 1JR3E 4OYLA 4CYMA 4DBLC 2IEBA 5JY6A 1KI9A 4R5MA 1ZDMA 2L82A 4TS1A 4HH3C 5BN3A 5JYCA 4QWWA 4F9FA 5J4VA 3SICE 2Y71A 1K1EA 1Q1EA 4CF7A 1VDZA 2VK1A 4A82A 4EVIA 3C6YA 2XRMA 2G5GX 2VCEA 3EA5A 4BUJA 4O5OA 2FW8A 3G0IA 3L41A 2FPOA 4XWGA 4GWKA 4R6XA 3WQQA 1POXA 3PJFA 2P2ZA 3E05A 5IFKA 3GDGA 4QSMA 3PDWA 4L07A 2X9GA 1QYXA 1P81A 1F1JA 4C4OA 2JHCA 4WADA 2GAIA 3HU1A 1MQSA 2GKGA 2SCUA 13PKA 3AETA 1A97A 4LVOA 1QX4A 2O8BA 1QAOA 1ECPA 3INGA 3T5TA 1V11A 1SD1A 2VAPA 4CM5A 1ZJ6A 2OD7A 2PX8A 3KB2A 4MH0R 1BX1A 4DLAA 4KX5A 5CUQA 1PCXA 3ORRA 2XUQA 4EHFA 1QAQA 3NEAA 3FTFA 1CEYA 1YHYA 5DM0A 4PLVA 3QUTA 3RTCA 4C0LA 5LQJA 4TSFD 3FD8A 4JI0B 1HLDA 1DDOA 1FYXA 4L1KA 2I6QA 3GJ7A 1NUHA 3MGBA 3F78A 2QRJA 3DJYA 4B3DA 1TDJA 2I6FA 3AW8A 4FDVA 1GNVA 5JJ5A 3KQNA 5GJWC 5LOVF 2BAGA 1JQJC 1Q2UA 2ZJ4A 4IF6A 1PQYA 4FFVA 2F00A 3OG9A 4ND2A 2FN8A 3AV0B 3VO8A 1UPAA 4KFCA 4LVNA 2C4UA 3AYXB 3GJ5A 4HCJA 4OX9Y 4UREA 2JJ1D 4JITA 2QSYA 1UPXA 2XR1A 1D6MA 1QOZA 3N70A 2Y0BA 4KTTE 1AGNA 1IYZA 5DZSA 3RYTC 4E6EA 4CEHB 2NV0A 3V32A 5DSZA 2YNMA 5IK2A 4DMKA 4NMXB 4F4DA 3JQAD 4XX0A 3Q2IA 4MHSA 4NWIA 1ZN7A 4BFCA 4N76A 4MIEA 5EZYB 1A8UA 3BMQB 6REQB 4LOIA 4C76A 4P4UA 4DA4A 4CJXA 1U9IC 1THMA 1YNOA 4DBZA 1GQ2A 4R31A 4TX1A 3E23A 3HBNA 5JH7A 1Z07A 3QFSA 3TAUA 3KOMA 1SXJE 3LQ2A 2FN7A 1XZAA 2H5LA 2WB4A 2K7ZA 1MBZA 2ZUCA 3F67A 3IS3A 3OY7A 2QR3A 3VYVA 1N8NA 4PLWA 3H2BA 3T7JA 1SKBA 1ZH2A 1U04A 3I5UA 2W42A 2O5CA 4U00A 3MT0A 3WOHA 2CNDA 4GBGA 3P2KA 1CR4A 4P3OA 4ASUA 5DMHA 4I5IA 1YDEA 1ZWKA 4BQEA 1AGXA 2EFYA 3STYA 2BBTA 4IDGA 4DHEA 1PE0A 2ASVA 1AT1A 3EW9A 3P9IA 1KI8A 4I1VA 3NEYA 5FADA 2CE2X 3R09A 2UZ3A 1FFWA 2VJLA 4QJ5A 2HHJA 5FR1A 2A5DA 3BL6A 1XMVA 3KYDA 1EDDA 3OHMA 1RE1A 2O3TA 2P7HA 1Y1PA 4JR2A 4YJ3F 3IKTA 4N5IX 4XOUA 1SAYA 1Z62A 2BRUC 2GARA 5TPWB 2OVFA 4O4IA 4DGQA 3IESA 4UEWA 5BWCA 2PMWB 2FG6C 4F1JA 3S2EA 2R751 1VPDA 4MYDA 4BEBA 2FEXA 4N7BA 2J59A 1OC2A 2F9LA 2IL1A 3OUUA 5C5EA 4J94A 1WKVA 3KHTA 3LPMA 4UHEA 1Z12A 3SFTA 2EJTA 1E9AA 5EIEA 2DYKA 4UBMA 1L6IA 3KZMA 4LC9A 5AIBA 3NAGA 3EWIA 1UC4B 2C2YA 5C3UA 2V59A 4E13A 2DLCX 1PR9A 2GPWA 2VZEA 1OWLA 1TF2A 3ET5A 1FNMA 5BQOA 2DHRA 3QPVA 2CLHB 1MFPA 1Y5LA 3NEJA 4NF2A 4OHPA 2NO0A 3ZE6A 4OI2A 3TQRA 3HTXA 4MJLA 1X42A 2ZT6A 3EIWA 3D2LA 4GRAA 4K0RA 2QNIA 3AJ9A 4GPZA 4YP9A 2BFDB 5LD2C 1P3Y1 3K70C 2PLNA 1RWXA 5CW2A 1N5DA 4FOTA 2LPMA 4UNNA 4AICA 1KA9H 3VGPA 3VU3A 4G1CA 3KLOA 4W8OA 2C5BA 4F8YA 3X1JA 3WLOA 3DV2A 1Z74A 1QVRA 1GV0A 1LA2A 1T0UA 1U5CA 4YUAA 1GZ4A 3G49A 4ZXFA 1VL8A 1KMMA 4X1KA 5CFOA 3JVEA 3H97A 1UOQA 4F46A 4CM4A 4AMUA 4BTVA 4EHKA 2QMUA 2XDWA 2DR3A 1C0KA 4P0QB 3E9NA 3K1YA 2KHZA 1VKHA 3RD5A 1NW6A 1T1JA 4G0YA 3V2HA 2Q1WA 1SXGA 2PNJA 3QMMA 4I1SA 2D5BA 2W2QA 4BO7A 8ABPA 1WZNA 2FJ0A 3N2KB 1T1GA 1REQA 1PYOA 2R6AA 1KYZA 2J7KA 1J23A 2DQZA 1A7UA 1L7AA 2HCBA 2X2EA 4GP7A 2GB4A 3CJTA 3DW3X 1SQFA 4FS8A 4J4HA 1E3MA 3CUVA 5TGZA 3CN7A 1NHGA 5CPBA 3THYB 5EEGA 3SE0A 4NYJQ 3FCXA 1RACA 3AFHA 4MVJG 3AJAA 3QV2A 4PC7A 4WBNA 3JASA 3BVPA 1VMIA 4CKYA 4RE6A 4QLBA 1CKEA 1E3JA 2BOVA 2JD2A 2GLXA 4YROA 3PHGA 5AI8A 1ZU4A 1N6HA 4YHHB 1IBSA 1P7CA 2F9MA 2NZWA 5HIJA 2HDNB 3OE4A 5K09A 4R1SA 3WHPA 2C92A 5JEDA 1MD9A 1EG2A 2CBGA 2FMUA 2IW3A 2PJUA 4MQFA 3RROA 2Y1DA 5JAUA 4D8WA 4X97A 4K2HA 4KN9S 2BZGA 1UPBA 2RBKA 4YRPA 3DBHB 1UBJS 2WWRA 1JDVA 2C4KA 2C5FA 3DBLB 4L6CA 4OJQA 1ISSA 4NTZA 5IAGA 5A4IS 3G5AA 1E0AA 2BM1A 3NAQA 1SJ9A 4IO0A 1P9NA 4U02A 4U7TB 2NVUA 2ZOSA 3N5KA 1JU3A 1TO1E 2V6BA 2JHPA 4D56A 1FUYB 2QZ9A 2VKTA 3HJRA 3B3QA 1QLJA 2IDMA 2WEKA 2I2WA 1YQEA 3B1JA 1E2JA 2V8BA 1TA9A 4LZJA 3SLRA 1DAPA 3VAYA 4A6XA 3BK2A 2M98A 1SOWA 1VKOA 2ONJA 3GJZA 3HNRA 2X0FA 3B78A 5BSMA 1KFJB 5EJFA 1YBMA 3FVVA 4BFZA 1SHKA 4IP0A 3LBAA 4MKIA 1NQAO 1R8SA 3L0BA 5BSHA 2WT8A 1CRLA 3MINB 5A1JA 5AVWA 3GFTA 3K96A 2FKAA 2EBWA 3I28A 3SZOA 3O2QB 4K7JA 4GGPA 2AJ8A 1G21E 2ZG6A 2N1BA 1W6RA 5DI3A 1JEAA 1Q0PA 2C84A 2CFIA 4L74A 1VCNA 4P08A 2XNKA 1HDEA 4NFYA 4QNNA 3F7NA 5AW5A 2IXGA 4RESA 5KYKA 2IA5A 1AUQA 3EVTA 3R0IA 1CEQA 2XJ4A 1DXYA 1JR6A 3TSZA 4MB2A 1B4DA 1Z7EA 1XMJA 4LSGA 5LLTA 3GP8A 3H1PA 3B7WA 2YW9A 2G7ZA 2ZYSA 4K9RA 4YP1A 2WMOB 2HBQA 4N3NA 4JN6B 4LDRA 1WF6A 3B38A 1XDZA 1E4YA 3DDUA 4M9SA 4ZRMA 3BWVA 4MQFB 2I2BA 3TOVA 1CB0A 4HWPA 3UW3A 4NEQA 1K2VN 2CW5A 1ABEA 3K4QA 4ZVVA 4EEXA 1QGYA 3FDXA 3FWNA 1KTVA 3REOA 4EO4A 4EITA 4J0QA 3A4MA 3RHFA 4DMLA 4MO9A 5B12A 1ADFA 1HUQA 1OT3A 2PSHA 2WPNA 4BZZA 4RQUA 4LMRA 1NNEA 2NXWA 3D2CA 1TVMA 3DBRB 3NVDA 4UW9A 2QD3A 3JAMA 4PCVA 3IMFA 2XBMA 1J8MF 2MHCA 1AKRA 1NONA 2NVUB 3IGFA 4A5OA 4DPLA 3ZV3A 5AVRA 4RDHA 3UXMA 5KS2A 2VZLA 3HSKA 1X1EA 1AUPA 1FA9A 1JSZA 3BULA 4M89A 4ZV7A 4DLLA 2JLWA 2OSVA 1OI3A 1ESZA 2F3SA 3OZUA 4MR8A 1M2VB 1PR0A 2H8GA 4QFCA 3Q5DA 1A5SB 2CE7A 3O7WA 4CLHA 1CZUA 1LQ2A 4E5PA 3D6HA 4EUFA 3E03A 1IXZA 1FS6A 1XB2A 4JP3A 3RRYA 4D9KA 3TUZC 4E32A 5K0LA 3WQHA 3H3JA 2R3SA 3GFRA 4HDMA 3MLEA 4P2GA 5F4ZA 2CBXA 4CQMA 1D4ZA 1HH4A 3DFZA 5BR1A 2FEKA 1D9XA 1BSVA 2FX5A 5AUOB 5KVSA 3SXPA 2IXAA 1JX6A 2XT9A 3DDCA 1TQ6A 1KFEB 1RKUA 1CR0A 3KJGA 3DM5A 4UCQA 3KPYA 5KOHB 4UNSA 4IQFA 2F62A 1OD6A 3K2EA 1EDOA 1U0BB 3N2IA 3NUGA 1U11A 2J9FB 4KH0A 4ID3A 1GVHA 1O5IA 4RCYA 3K7EA 2ACWA 3GGOA 3TMKA 2ZRNA 4KV7A 1KYWA 5GADl 3WYNA 1NASA 3DC2A 3F0TA 4G1FA 2G1AA 1V1RA 1PD1A 2WJPA 4FQ7A 3SR0A 4U39A 3IUMA 2FPRA 1FZTA 5FP0A 1OVGA 4C5CA 4AX4A 3AJ8A 4D43A 2XTNA 1OBOA 4DR5B 3NVKI 3NYIA 1L4EA 2Y67A 2GH1A 3FHLA 3OMXA 2J0VA 4YDRA 4CM4B 4FSHA 1N2EA 4C08A 3BMOB 1ES9A 5CH3A 4KQKA 5LNK1 4RYDA 4TMFA 1IM2A 1WDKA 1CIVA 2C2ZA 2TECE 5ES3A 5KSOA 2DQSA 4PO8A 1KMHB 3OQOA 1GSIA 1FXUA 2DTXA 2NTVA 3BXFA 1B8UA 2A0WA 3DAYA 5DIZA 4FWTA 4GH5A 1E4EA 3IPLA 4M83A 2O8DB 3M4ZA 3TCNA 2RONA 2OA0A 3HQ4O 2JFNA 4J0KA 1WZ2A 1QU3A 4YAKA 1J0BA 4S1VA 4GW3A 3D8SA 4JB8A 3R44A 2LRHA 5CYPA 4JBXA 4TS4A 5TPWA 1ULBA 1IBKB 3G82C 3K9LA 3N07A 1OGYA 4NJEA 3K9HA 4GMGA 4Y0VA 1NXPA 3L8CA 4MWDA 2WU1A 4YX9A 2QTAA 1MN6A 2ENUA 2Q0HA 2WD7B 1RHRA 4RJTA 1R3UA 1CRQA 1RYHA 4UHKA 4W9NA 3Q9UA 1WMSA 1Q77A 4RF5A 5D01A 2CN1A 1D2MA 2WA2A 3TGLA 2QM0A 2YNMC 1EFPA 2ZSKA 2P90A 1GZ6A 2YWDA 1VRWA 2AYZA 4KJXA 3QVLA 5KOHA 3G2KA 4RULA 4G85A 1K75A 1UJNA 5AW0A 1CLEA 1QZTA 2RHDA 2R2GA 4AG6A 5KAPA 1WV1A 2Q8PA 1O97C 3LD9A 4I50B 4UNPA 3V2GA 3REFA 3TL3A 4CQJA 4LHVA 4ZYUA 3F3YA 3SC2A 3ENZA 4Y6LA 2GF2A 1RVV1 3ZNNA 4EFDA 3EH2A 3KVNA 5C32A 1LXCA 3IIJA 1N32B 1V4NA 3TQSA 1FXSA 1WLSA 4KXFB 3ZE9A 1WHTA 2ZAOA 1OF1A 4HH4A 5LU9A 2P77A 1OIVA 2ZE7A 4LK2A 3VHRA 3NNNA 2IUUA 5AW4A 1N34B 2ROQA 4EKEA 1K5DA 4WLNA 1VBMA 2I6UA 4XI9A 1S3GA 1SIOA 2XVYA 1KPGA 5JHHB 1GWNA 1U7DA 2F1RA 2HJVA 2XYHA 1II8A 1KO5A 3LQYA 1EFVB 4KUGA 3RU9A 5LIRA 1XNQB 1XCLA 1XCGB 2EJUA 3N7UA 3OTIA 4HAIA 4QFMA 3WYAA 4B6RA 4CW7A 4ER5A 5KTSA 2B2NA 3WGKA 1MNAA 3PUZA 3UMVA 5KMGB 1RI1A 2QXTA 3CRW1 1PS8A 3MLAA 4GOLD 2VL7A 3G23A 5E6UB 4MDEA 4CF6A 2LD4A 3EG9A 2Y4OA 3OOYA 5J2TB 3H5OA 2FR8C 2VJDA 3VR5H 1N3BA 3A6FA 4ANFA 5BORA 4IEFB 1YZYA 2HTFA 5JWOA 3GD5A 3T35A 1TVEA 3QUQA 2DUUA 4LYHA 4FB5A 1MO4A 4Y0NA 5HIMA 3B2QA 4KDEA 2XKKA 1MXFA 2R6GA 3LSTA 1E60A 2PZFA 5F73A 3UBTA 2VXOA 2CL0X 3OD1A 4GZ6A 4PG7A 3FMGA 1JDUA 3FZEA 5IANA 1FX1A 2PGAA 1PWEA 3K20A 4ZYVA 5EHZA 1VI5A 2IUFA 1QF9A 3OIUA 1H3FA 3N0XA 3QGMA 1LB1B 2W8BA 3KEGA 4RTMA 5TF4A 1ORRA 5GM2A 1QG2A 2FLKA 3UANA 5LLSA 4EL0A 1KK3A 3RRNA 2QK4A 3OZTA 2R1VA 1KU0A 1YJCA 4RANA 1YOBA 1P1FA 3U7JA 2F3TA 1ZM2A 1QHSA 5ESXA 2FOIA 3DAFA 3PEEA 2RB5A 3NO4A 3RYHB 3L7IA 4OFXA 1QHIA 2P5SA 3JYOA 4X00A 4CR7A 5TQ0B 1FDOA 1Z56C 3LHIA 4L7QA 4CMIA 5C80A 1A2QA 4GX5A 3L4SO 3TSCA 1LBTA 1M6YA 4PFJA 1DZIA 3USCS 4J0GA 4ZQBA 2ZQYA 2D5LA 3BS4A 3NBKA 2NO4A 1P80A 4B47A 2P40A 3MNFA 1R0BA 5HF6A 4DREA 1XQWA 5HF8A 1USUA 3KQLA 3SU8A 2DAPA 2QP9X 4WESB 5CFZA 5IH3A 5FPKA 4QREA 2CDBA 3AKDA 1VPEA 5JY1A 1H4VB 3BE5A 1OB2A 1KJJA 5J58A 4JI2B 1AH2A 5DNYB 1BWPA 2WVHA 4B6EA 4Q12A 4HSGA 4DOMA 3GFPA 1YDFA 1QIJA 1R6TA 4IEEA 4IKEA 2BCEA 2WM8A 4WWHA 1NVWQ 5LXTF 1CUHA 5DP2A 4YMTA 1YL6A 1QH0A 2UYQA 2VDPB 3M70A 1NW8A 1C1DB 3FYTA 3MLBA 4IHKA 4J0CA 4TUYA 2C2MA 3PUIA 4BPBA 1U1IA 5H68A 1FXWF 3DTNA 3SQDA 4CGYA 4F5YA 2OSBA 4LNUA 1KYYA 1AY0A 1XNJA 3I45A 3IHKA 4MA5A 4X6YA 1CR2A 3T61A 2R84A 1GGHA 1RYDA 3F6PA 1JXOA 4CI0B 1IMJA 2OFPA 3CZ5A 4NYMR 1L4HA 2E5LB 1MR3F 5BSTA 1BIFA 4ACAA 4N6GA 2JBAA 1HORA 2WZCA 4TS3A 3WXMA 4EFKA 3ZXXA 5U9CA 1G9XA 5K2OA 2GCOA 2YUTA 3L01A 3RBVA 3TNFA 3U2QA 1DKUA 3LYLA 2KBEA 5J9FA 3TTUA 4EY7A 1NBEA 5KPDA 1MV8A 3K9GA 4PGFA 1A9PA 3QPBA 2FP4B 3R3WA 3S29A 5T5QA 2FUG1 1DX6A 4TRRA 3T3EA 4TQGA 4L73A 4OLJA 1DWQA 1XHFA 2DPXA 4MVYA 4YI5A 2WIKA 1Q95A 5DSXA 3RM3A 3DGFC 1BE1A 2PWPA 3ZW7A 2O6HA 5HR5A 3WK7A 4EB0A 5JC8A 5KYXA 1E4VA 4JBLA 4UAGA 5HPYB 1A27A 1ZW6A 4DJAA 3QKSB 2A58A 4GAEA 4EY8A 2E6UX 2IBMA 4RZXA 3L0OA 3LAWA 3WI7A 4PE5B 2Z4SA 4TSFA 5F23A 5KNBH 1TO2E 3BMNA 5C8DA 3WLPA 3OH8A 5E6SA 4AG3A 3FN4A 3K4PA 4HMOA 4CCSA 4PFSA 3KYCB 1ULZA 1Y7IA 2RC6A 5ENDA 3PDCA 2IEYA 4LWQA 5FI1B 2Q9BA 3WZLA 2IEIA 1RWKA 4YRMA 4DV1B 4DARA 1CVIA 1OYWA 3I3OA 4G09A 4JNCA 4FPXA 3VR2D 4ZJPA 2WD7A 1NMYA 3T99A 5E95A 3RR2A 4US1R 1FTNA 1P2BA 2CJPA 3V1LA 3ZNPA 2YJGA 3JYNA 2PH1A 1W85A 1SKQA 3NOQA 4LZZA 3JQ9C 4JHLA 5DE3A 4LZOA 4RUKA 3FJ1A 1L4UA 4FJ1A 3TZBA 5FUXA 3V5NA 4DDMA 3OCCA 3QMWA 2XMCA 2C3MA 4K1XA 3FSEA 4R81A 5HCUA 5IUKC 1XZEA 4GYKA 2X5KO 4JBWA 3TDMA 3TLGB 3NTQA 1KARA 3AUYA 1ZD8A 3OQBA 3I72A 5GIOE 1TQDA 3RTBA 1VHLA 1IMOA 1GFWA 4EF4A 4JUBA 3R8CA 1IRXA 2CL7X 4LXXA 4D42A 3AY7A 3SS9X 1EWQA 4HD8A 3NFYA 1XX6A 2YQ5A 4RMHA 5BUQA 2V7GA 2WSLA 4YP5A 4YACA 3COJA 3NAMA 1GTVA 1MAUA 1RWNA 2I8LA 2QLBA 1DC8A 2ONCA 2IPMA 2QTTA 2RGCA 2BD0A 4B3IA 4TVKA 2QVYX 3ZX4A 4C78A 1H4TA 3G2NA 3HB5X 1SUEA 4I1YA 3U3KA 1VJ0A 3QFCA 4LZLA 3RC9A 4YT8A 3ZV6A 5C81A 3M6UA 5FWXA 1W36C 1TADA 1VCOA 1FNBA 2H57A 4PONA 4NYIQ 5EQDA 5FUYA 3V46A 4F3CA 4FZVA 1H6CA 3WO1A 2H7CA 1HA3A 3MHPA 4DQVA 2FHPA 3CT6A 1XOIA 5JD5A 2BBWA 5JWHA 5E4JA 4MWBA 3SNKA 1C80A 1V47A 5LZ4A 1P8AA 5IMBA 1G3RA 4X45A 1SU6A 3KTOA 2B25A 1X1QA 3LZCA 3N7TA 1CUWA 3L6BA 4MUJA 4MRVA 4AS2A 1ZUWA 1SXJD 1JS1X 1GYRA 1RZ3A 1L7QA 3BSSA 4P81A 5BW6B 1I4TD 1K9SA 3LT4A 3HS3A 2W6CX 5JCXA 5BRAA 2BHLA 2H8KA 3RB8A 1UBFA 1M5RA 1P17A 5FULA 2VXBA 4XDYA 4IHJB 4W5WA 2ZYTX 5K03A 1YDHA 1KK0A 5E1MA 2C4NA 1BDHA 3KBBA 3QKIA 4K6HA 3RS5A 1T8UA 1QR6A 2PZGA 4KLRA 5BQ3A 1EFAA 4ZRNA 4J6FA 1EFHA 1KQNA 2J45A 3P94A 1DX9A 3A37A 3Q2KA 5FPPA 2O5RA 2WDPA 1WD5A 4INOA 3LP8A 4U8HA 4BNGA 3DE6X 3HBMA 5EQFA 3Q7TA 3UBMA 5ULLA 1C4KA 2NZUG 3WRVA 5ITSA 3FOZA 2MMGA 1XAIA 4ZOLA 1J1UA 1E2QA 4GD3Q 4JUDX 1GPH1 5CT8A 4B71A 1K88A 2WNIA 3HEMA 4UEKA 4TTAA 3X1MA 5EQJB 3V80A 3HR4A 4EVQA 2ODBA 2D1YA 3RWOA 4N3AA 1IL0A 2FTKE 3HUFA 3VV3A 1TEVA 3RT9A 1ZOLA 1OB5A 3N0VA 4GLOA 1S3SA 5H70A 3PBKA 1R9NA 2F4NA 2WPDD 2ZI3A 3ELBA 3EBOA 2WYHA 1Y8AA 3FAZA 1MX3A 3FGPA 2EL9A 4ML3A 2YIVX 7REQB 2YV1A 1JDBB 3DVAA 4KI7A 5IP5A 5P21A 4BV3A 3GT3A 4LDQA 1Z15A 1XDBA 2X8JB 4AKEA 2VTBB 1G9SA 3K16A 4TLCA 3GQBA 3EOZA 3SZRA 3SSOA 4BKUA 3EX7C 4UMEA 5HMLA 1IFXA 2ZB2A 4TWAA 2Z6VA 5ITZA 1E0SA 3VSDA 4I3HA 1IHOA 1K7CA 1EFRA 4KFRA 2WZBA 3QLUA 5EHNA 3JVDA 4CUJA 3PG5A 1QH1B 2QLJA 2DBYA 4X41A 3VYWA 2JZCA 3H0KA 5DRTA 1GCOA 1NF3A 1FU4A 2YQ4A 1WOMA 3RSGA 1DXQA 2IYEA 2YWGA 5J23A 2I80A 3M81A 2XX3A 1WXDA 1L7VC 3ZDFA 2YC4C 4Y98A 3CR7A 3OF2A 1OPXA 1QP0A 1Z0AA 3AR9A 1UH5A 4KGVA 2AS0A 1P1KA 3H84A 3V8MA 3PQ2A 4MYHA 2G88A 3H2KA 4LBWA 1VRVA 2GGSA 4ES6A 3MCVA 3V7FA 4ZQFA 1YR6A 1CUAA 4UBOA 5C5IA 1M1NB 4BNUA 5B7NA 4B8WA 3ACCA 4BGVA 3CEJA 3AERA 4KO3S 4ECAA 3QOFA 2IV3A 4RXMA 5I4KA 3NGLA 3WL6A 6PFKA 2XCUA 1HE2A 5ARCA 1QG6A 1XF1A 4F71A 3TLJA 4EA8A 3AUTA 4WLOA 4AJ4A 4OHKA 3W2GA 1K06A 1K8YB 1SN7A 1W44A 2VP4A 3OMLA 4KSBA 4R9UC 2N3ZA 3RVMA 4QTYA 4YCSA 1HFWA 1GLVA 2BGIA 3EVNA 1SOVA 1JHRA 3OU2A 1X7XB 1YU9A 4R16A 5D3QA 3VJRA 2A3RA 1QHXA 2FW6A 4JB3A 4ARZB 4EQ6A 1PJAA 2PHZA 1GRRA 2KWIA 4LGVA 3TMYA 4DC9A 4PS0A 1CDOA 2Q5HA 4PYRA 4OI1A 2GZ2A 3NANA 3EY9A 3QVUA 1TC2A 1D2NA 1GGFA 1Q3TA 4N8DA 4G01B 2ERXA 3P96A 1TGVA 2O23A 2P79A 2BTQA 3AF6A 4FSXA 2P68A 1KAGA 2NNWB 3U6KA 4N12A 2PZLA 1AS2A 3TMAA 1KETA 2AIRA 5CM9C 1J2YA 3ZLTA 2EWWA 4Q3BA 2IGTA 3TXAA 4XX0B 1R4AA 3PP8A 4H7DA 1WOYA 3HB1A 3EMKA 5TT0A 3TOSA 4X85A 1QIMA 5CLHA 5ERGB 2I4NA 3TKYA 1OFHA 2NX2A 2Q0SA 3MMPA 3FLAA 1FSZA 4RVOA 3IQEA 5JD4A 3VDXA 1M2FA 5BRNA 3AFMA 4QVGA 2FF7A 4TLEA 4TXHA 5ELXA 2FJUA 2GN4A 4IVQA 5CB6A 1EVZA 4G65A 3HDQA 4RFVA 1C4WA 3TLMA 1OWOA 2Z98A 1JALA 4URUR 2X5OA 2WINI 3DYVA 3H9CA 2AKYA 3SIWA 1WEHA 1XQ6A 3UQYS 2Q3MA 3RFXA 2FMHA 3OIYA 4XCQA 2PNFA 1J22A 2Q1XA 4UJ5A 2D2XA 4RLFA 2FAXA 3LGSA 3W6PA 3HXLA 4EARA 3I76A 1BJRE 3ANMA 3IA2A 3D31A 4EA9A 3GRFA 4MWSA 4HEJA 2PWBA 2W0MA 2BFOA 2E5WA 3H13A 4MV5A 4YAFA 5AKGA 2WHXA 5ER9A 2HA3A 3AF0A 3KUKA 4KIUA 5A3RA 4D4IA 1MT3A 2OE2A 4Q4LA 4F2PA 1T43A 2Q0QA 1SIUA 3NONA 3VMMA 2D8MA 3WGQA 1JR2A 5TX7A 4BEWA 2O2CA 3W5HA 2NO5A 3PQEA 4G86A 3VPHA 4MROA 1KZHA 3DEAA 1TUGA 4Z4QA 3WAGA 1HO3A 1GTRA 5D7BA 1BDBA 3P8ZA 3T3DA 2O7NA 3QU2A 4I9FA 4U5XA 2FYTA 5H81A 5F7XA 2E4UA 4FDMA 4BKRA 5J4LA 1MABA 3PI6A 1VLJA 1EPUA 2D3TA 3DL0A 1GYPA 1W8IA 1EQAA 5CFPA 3OY2A 5BN3B 3IERA 1JILA 2ZSDA 1SXJA 4OL9A 3TYXA 1JIUA 2IZOA 2JGJA 5IYZB 2Z6AA 1L1FA 3ASVA 4U3JA 2G40A 1G5FA 3PIRA 1L7MA 4LUCA 4YDHB 4N48A 3EC7A 1M2KA 2O3QA 1SUBA 1KAMA 1DBPA 2DQYA 4QECA 3HYNA 4ITUA 1DC7A 1ODJA 1OXBB 3VNRA 2FVYA 3W6OA 4KLCA 2ZZNA 1P6XA 1HT0A 5ILGA 1Z6GA 4FE4A 4YQZA 4RPLA 2GESA 5KU7A 3CY6A 3QF4A 1RWWA 4HS4A 4V02A 4CLRB 1GXSA 2DT8A 2O8NA 4HTFB 3DVRX 4KLNA 4M76B 5FBVB 3SEAA 4PCUA 3K31A 4TXLA 3U1VA 1SKYB 4J8PA 2C5AA 1GFZA 4RA6B 1ADCA 3I6YA 3HMKA 2X77A 4B9AA 1OZHA 3IAUA 2Y1KA 4MKXA 3CX6A 1TRKA 5AVOA 4BMVA 3DQPA 1Y4DE 3CW8X 1A7JA 4IQ8A 3VZDA 3HCBA 3UK6A 1SG9A 5CGQB 1VMDA 3I53A 3HB7A 4DZRA 2GRJA 5TVKA 1CSEE 3HMQA 3K9QO 4MYTA 3ENWA 2WJWA 1E66A 4UZEA 3RF6A 1LD3A 4E2ZA 5HQ3B 2CKMA 3URKA 3QM1A 1JIXA 3R77A 4HJXA 2V74B 4ZJUA 2I4TA 1M8FA 2JPDA 4HQ0A 4RVSA 2NU8A 5CCEA 4AM8A 3NHZA 3QY9A 4CQLB 2RK4A 3S2UA 3QVOA 4J03A 5KQSA 3THXB 1JSRA 1A9YA 4MS3A 1P73A 4QC2A 5CT9A 1RRKA 2PPLA 3NHJA 5JCOA 4LHXA 1KR5A 2AR0A 4ENPA 2F3RA 3D3JA 2WWGA 3SHOA 1ZK4A 3IILA 3PUYA 1F3LA 3Q11A 4DPKA 4ER0A 1NIPA 1DC5A 5YASA 4FFBA 4URHA 2GCEA 4ZOCA 4HI0E 4UFNA 3BOSA 3E2IA 3A1SA 2NPIA 3B12A 2AUNA 1Z4KA 2PK3A 4B3TB 2WYVA 3EYAA 2JHAA 3WFIA 3H1TA 5HF9A 4WUVA 3EDYA 3MMXA 1DJQA 1NN1A 1N8KA 2Z30A 4AZWA 2NU9A 5REQB 3EEFA 2Y05A 3FBGA 3O3NB 5JD3A 1J0AA 2RAUA 5LA6F 2C2WA 1WB9A 1H8ED 4CM9D 1T9AA 4D4MA 3QEOA 2Y76A 1C0IA 1PU2A 2WJ6A 4YO8A 5EUBA 4X60A 1XGKA 3RV4A 2NPOA 4MAAA 4WT7A 5CFMA 3NYWA 4JJ6A 1ZH8A 3VR1A 1NC3A 5AI5A 1P4GA 3WYEA 3ZY3A 5IT0A 4D9HA 5BMVF 3TEJA 4DMGA 4NAHA 1C8LA 4ZIRB 3ANNA 2EJWA 2EP7A 4YVFA 4B5LA 3G0DA 5BYBA 5BVGA 3BSWA 5BVGB 5JCJD 1OMOA 1NKVA 3JASB 3BH7A 2C95A 2R00A 4ZGBA 5KWJA 3F3MA 2HFJA 3OEHD 3BQ9A 3FMVA 1P5HA 3GFQA 1ZICA 4IQ4A 4D4JA 4C1NA 2EHDA 1X7XA 3LDHA 4BE4A 4TV8A 3HB9A 1J24A 5HKAA 5BT9A 3PICA 2J08A 3UAZA 2ZAIA 2ATIA 3VYRB 5I7FA 3H5RA 2BDEA 3RT7A 2G1PA 4GMDA 1X94A 4JP1A 1QPBA 2CHFA 2O20A 2WLTA 2JFPA 2A78A 3WC4A 1G1MA 3ECCA 1XV5A 2FPXA 4GL4A 2WJZB 1PSDA 5IKPA 2XUZA 3OF3A 4DCJA 1QMPA 3GMIA 5BV0A 2GVNA 2Q62A 4P34A 3KR2A 3P9SA 3MHTA 2AG0A 2VDLB 3EZXA 2IYTA 2ZIGA 3LT1A 3QWBA 3DSRA 4JODA 3U39A 3ZY2A 2BTOA 3R4VA 1FVOA 2C04A 4K0KB 2RGNC 3ZWKA 5KVVA 4JYBA 1DC6A 4CMGA 3FW1A 1IUNA 1YFZA 3ICWA 3VUEA 3RAGA 2V55B 4GLFA 3GC6A 2VR1A 3DV0B 3H2HA 4HN4B 4KK3A 1XUOA 1RRMA 4E08A 2GVZC 4PHFA 3VBCA 4ARCA 2BLNA 1T5LA 1CX9B 1F14A 2J6CA 2ZR7A 3AUAA 3IIKA 4DV7B 2W4IA 3G6KA 1KI4A 1I9CA 3E22B 3RS4A 2VC2B 3FYDA 4FW9A 4IWNA 1XMOB 3JQBA 3C3DA 4UXJA 3WK6A 3C5VA 1VYUA 3NTVA 2PA0A 2ETVA 2HIMA 3OLCX 5HG0A 4QELA 3F6EX 1O03A 2BUBA 1FYDA 3KU4A 1N25A 1NVXQ 1HLPA 1PYGA 2DC1A 4UUPA 1KZYC 2IHBA 1U7TA 2PBZA 3HDJA 2I2AA 3B5IA 3OIWA 1T9ZA 4RY0A 1AKYA 1WAMA 5BUCA 4JLSA 3VYTB 3LUFA 3GAZA 3HV2A 3O83A 4K81B 4M1TA 5C0OE 4QUGA 4DV4B 5ALSA 3QEMB 2ZCJA 1K89A 3I61A 2I9KA 1NG1A 1VB3A 1N7GA 3R9IA 4FCTA 4YJ2F 3ZG6A 4EP1A 5GWXA 1R6XA 4IFBA 3GX1A 4KIJA 3H0CA 4GI1A 1NVEA 3CU5A 4G0MA 1EFKA 2PY6A