4TLBA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
224
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPFDLSALIERINYAIQKYRARRVSIDPVTSVFQASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 77
structure length 224
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlbA00
2FG5A 1XMSA 3AB3A 3EPLA 5J5CA 2GKSA 2HXSA 2GWHA 4XTRA 1G4UR 2BVNA 3PXGA 2W6JD 1KTVA 4PPFA 4ESHA 3TW4A 1CXZA 3LBNA 3CR7A 5TY0A 5KO2A 4MUBA 5EXSA 2C2HA 3OZXA 4TL7A 1ZM7A 5CDFA 4NMMA 4LUCA 2E9SA 3C4JA 2MMGA 3V4FA 4C30A 1VG0B 3HR7A 3Q7PA 1L4UA 5JZVA 5BN3A 1UJ2A 1Z6XA 2ZSFA 1NIPA 4HLUA 3K70C 1CJKC 4C2UA 1CLUA 5DE3A 4TMKA 2PEYA 4NDZA 1OE0A 4LGMA 1HH4A 3TSZA 3I5YA 5JJIA 1IXSB 2J59A 2ZRIA 2NZJA 4LV5B 4OI4A 5TV2A 3GFPA 1NN1A 2ZI4A 4R98A 4C0LA 1Z0KA 1W0KD 2ERYA 4NP6A 4Q01A 5K8UA 2DPXA 4XOIA 4DC9A 4EAQA 5HPYB 5JWHA 3OIWA 4WOPA 3IIMA 1CR1A 2B8TA 4S2EA 1ZYUA 3LLUA 4AWXA 4Z8XA 4PQYA 4KITB 3ZS9A 1ZNYA 3CX7A 1KKMA 2HF9A 3QENA 4NYIQ 5EXXA 1XZQA 3O8RA 3U5ZB 2JLZA 4N0DA 1QHGA 2BMDA 3LAWA 2HYIC 1G8PA 1UEIA 3GJ8A 3SNHA 2ZI3A 2FMXA 4OJQA 2NQ2C 4C0KA 4LC1A 5DYGA 1DAIA 4EPTA 3CPHA 3QUSA 3O8DA 4Q1DA 1VCMA 3PUWA 1CP2A 2ZJ2A 1CBUA 4YMSA 221PA 2ANCA 1Z47A 5B30A 4US2R 3T1VA 2VF7A 3IQXA 5DI3A 2FH5B 2VP2A 2YZ2A 3RRNA 5E7MA 2VL7A 2AX4A 5HE8A 2GVDC 4QNMA 3FMPB 2DFNA 2OAP1 5C2JB 2R6GA 1XPUA 2JLVA 4EQ6A 2ZXUA 1W0JD 1GRNA 4D4LA 1KI6A 3L8YA 3QKTA 2VHUA 1S3GA 3K0FA 4QGHA 4JJZA 3CRQA 2R6FA 1AGRA 3BH0A 5BXQC 1JPNA 2ORWA 1E9DA 3C15C 2Z4RA 4LRWA 3VR6A 2ZRCA 3QF4A 2OXCA 4EFLA 3MWJA 3NBFA 1ZAKA 1D9XA 4G5SA 1Q1ZA 4LHVA 3EIEA 3VMFA 4KHZA 1RZ3A 1D5CA 2Z5FA 1K5GA 2ZI6A 4IDHA 3I62A 2CJWB 1W47A 2CCKA 2WIBA 1U0JA 2QY9A 3KUCA 3RYTC 1HV8A 3K70B 5CM8B 4ZCIA 3BXZA 2C9CA 1ZUNB 4DSNA 5FUVA 3MD0A 1EFRA 2H18A 3CZPA 1NG9A 4IFBA 4A8JB 5LDDC 4CYMA 3GLIA 4A1FA 1F2UA 3E70C 5SZJA 2OCPA 3LBIA 3DMDA 2ZRDA 1XNJA 1BYIA 1BS1A 2CHQA 1ZP6A 1XF9A 2OILA 3T12A 1ELOA 4DLSA 5JECA 5KNCA 1ZVQA 3ETLA 1S1MA 4PR0A 1OT3A 4LPSA 3VFDA 4E5UA 2QMUA 3U3JA 4Q9JA 3VR1A 5HKKD 1CTQA 5JS7A 3AKEA 4KAXA 5KSZA 2V6JA 1FTNA 2VHQA 4NONA 3E2IA 2IWHA 2NO7A 3FPAA 3ZD6A 2AL7A 2ZRJA 3U44A 4TMVA 3LQRA 3B5JA 1E2FA 1ZD9A 5IT5A 3RS3A 3WMEA 3THYA 4Q4JB 3BH7A 3Q3JB 3SYKA 4GFDA 2F55A 1XTJA 2ZPTX 1H8HD 4DLYA 1ZNXA 1GL6A 4HLQB 2E87A 3WYGA 4DSTA 2BBWA 2KSQA 2A9KA 4NCIA 4R71A 1KDOA 3K8YA 4LJ6A 2VF8A 1IN5A 2RMKA 3WXMA 1N5JA 5DHFA 2O8FB 1E9RA 2WKPA 3ZD7A 1E2NA 1ZNZA 2ZEJA 2BEKA 1W48A 1T9HA 3TUJC 3BRWD 3FWYA 1YZUA 1XXHB 4BLSA 1DAHA 1ZJ6A 2X19A 1YZQA 4LHWA 2ZTSA 1NY5A 2RGCA 2JLWA 5JI3E 5J40A 2PCJA 1OIXA 4BUJA 2IF2A 4Q4HB 4GDFA 4ZO4A 4CEJA 2ZUBA 4LBWA 4M1TA 2NPFA 1P7CA 2ZJZA 2WPDA 4WVFA 2HT1A 5IK2D 1G17A 3UWKA 3A4LA 4L5BA 4QGFA 3KB1A 1V43A 4XVUA 3CF2A 4M1MA 4I1SA 4Q7LA 2ZUCA 2AK2A 2WJHA 5AJYA 1Z6GA 1QHNA 3FKSA 5FTNA 2AN9A 5KUTA 4MKGA 1E9AA 2OFWA 3EPKA 5TMPA 5IHPA 1A4RA 3CR8A 3FB4A 2G83A 1AN0A 1G8HA 1FP7A 1CF4A 2A5GA 1VCOA 1XWIA 3EPJA 3WNCA 3Q72A 2CLDX 2UZ3A 4UKDA 4C2TA 3MWKA 3A6PC 4IVPA 3AP2A 4TYQA 4JLNA 4NPHA 1IAQA 2ZRGA 4MYCA 3DOEA 1VIAA 3IILA 3B13B 4PSVA 3W8RA 2QM8A 2V55B 3DVLA 1F2TA 4RVCA 1YRAA 2J45A 3R9XA 3JVVA 2JATA 1US8B 1U9IA 3EX7C 1EX7A 1R8SA 3P26A 1KJZA 1J8YF 1N0VC 3MJHA 4BRWA 5LPNA 1G7RA 1KK0A 2ZI5A 3RC8A 1GL7A 1KK3A 2J5XA 3B1VA 5CLLA 3LFUA 3DZ8A 2B6HA 1X3SA 3UATA 4ON9A 1YR7A 4HATA 2I1QA 4B76A 1T8UA 5D3MB 5G53C 2ZETA 3I8SA 5CDFE 3AVUA 1NN3A 3AQ4A 2K5UA 1RJ9B 3AH8A 2A2ZA 4C0SA 3UMRA 4B34A 4DDWA 4MDEA 2ZE6A 3K1JA 2W0MA 4ZCMA 2D3WA 2XSZA 5L3VA 1JR3A 3RABA 4JIMA 4ZI2A 1YHNA 5JHGB 2FEOA 4N0EA 3SS8A 4ITRC 2REOA 4Q00A 5DIFA 2R6DA 4UNNA 1TF7A 3EG5A 1AQYA 2AK3A 4TTRA 1W36C 4DB2A 1A5TA 2R2AA 4KCGA 2GESA 5IK2A 1P9WA 1E2HA 1N6NA 1ZUHA 1KKLA 2PZFA 1EXMA 2GJAA 3OEED 4B3CA 2E1RA 3UKDA 4DRZA 4URUR 5BN4A 1FW6A 2BCGY 1DO0A 1S0UA 2EU8A 2EFHB 3IDQA 1UEJA 3CPEA 1R0YA 3HYTA 1VECA 1KNQA 1XTKA 4B3DA 2O0KA 1KAOA 5FPTA 1KOFA 1QHYA 2V4ZA 1H8EA 1Q1BA 1WRBA 2ZS8A 4TWZA 5FBQB 3O47A 1ZD8A 1P72A 3I72A 2CL7X 1UKEA 2OBNA 4NKRA 4ACAA 4DUGD 4CRWB 1KNXA 1ZIPA 2ZAOA 3AUXA 1W1WA 3KXKA 4V0NA 4DXAA 2QPAA 3JZMA 1T4GA 1TAGA 2G0NA 4CZ2A 1L8QA 4MRNA 4K81B 3UWOA 1OFUX 3FFAA 4GP6A 4OHWA 1E94E 2VTKA 2JLQA 1HE1C 4QBIA 1ZINA 1G3RA 2VP9A 4NYMR 1NMYA 1ETUA 1P62B 3ASZA 3K9NA 2QORA 3LQQA 1QHXA 3TQFA 5BN5A 1ZM2A 5FL3A 3CBQA 1Q3HA 4P3YA 3ZQJA 2O8DA 3AVVA 2BBOA 2F43B 3MFYA 4A92A 1W2GA 1E9FA 1SXJB 3SBEA 3TAUA 3WYFA 4PO9A 2CDNA 2Z6VA 2GK6A 2VHTA 1NI3A 2FE4A 1EWQA 3WP0A 3BERA 3VNUA 4KSBA 1TL7C 4UNRA 4QBHA 3GLHE 3KQLA 3WRYC 1UM8A 4JYCA 4HDQB 4ACBA 3OE7A 4G5RA 4HDOB 4XSGA 4IKEA 1IJFA 1TMKA 1UKZA 2PH1A 5JRJA 3ZQ6A 3H2YA 4JLPA 4PSAA 5JCPA 1G8FA 5DI9A 1O87A 5L8VA 4Q1FA 4WZAE 2QNRA 2EFEB 2VSFA 1NLFA 3OFNA 4B74A 4JBWA 4JLOA 3EZ2A 3PUZA 3PEUA 2YWFA 4PZLA 4A0HA 4RD0A 4Y0AA 3KJEA 3F5FA 4M4SA 1QF9A 3IGFA 2WJIA 1XTQA 2CHVA 5JCZA 2MSCB 3T15A 2Y8EA 2ZSAA 5AUNB 4H1VA 1G291 1KMQA 4RZUA 4Z54A 1MR3F 3AVXA 2FSGA 2WTUA 1W4AA 1XEXB 3N2IA 4L9WA 4EDHA 2YINC 2KWIA 3Q5DA 2V6IA 5HCNA 1GL9B 2O8CA 1FNMA 1GTVA 1JAIA 1I4LD 3U60B 4D4KA 4DT1B 1TPZA 2BJWA 2CL0X 4OL0A 4D0GA 1DG1G 5A0FA 4PO8A 5C1BA 1XPOA 4G1UC 5GJWC 4M2LA 4V0KA 4LDJA 1CEEA 3K0SA 1K8RA 3NWJA 2JASA 4A6PA 4G0NA 4W9MC 2ZYWX 1LFDB 3GEIA 3L82B 1DOAA 2FOLA 4JSTA 3PVSA 1UADA 2FV8A 4B2LA 2J7KA 1KI7A 3KTAA 2C8VA 3LDAA 2HDNB 4CF7A 3MGCA 4UXJA 1X1RA 2EYQA 4Q9HA 2GDJA 2OLKA 3KQUA 4B3GA 2ZSEA 2XXAB 3IO5A 4WAUA 1SZPA 4EPWA 1E9EA 2D74A 1J90A 1J70A 3CIOA 4P32A 4BLTA 1D8TA 2W58A 1BIFA 1F6BA 2ZRLA 1E1RD 4FMCB 4GMDA 4QM6A 1SVWA 2ZSDA 3ZDQA 4HLUC 4OHVA 2J0VA 5L3RA 4I99A 4LV8B 1LNZA 3B1ZA 3IPXA 1NVWQ 3GPLA 1XJ0A 2WSMA 2ZREA 3L0IB 3VR5A 1RJ9A 2VA8A 2WZQA 2ONJA 2OLJA 4F38A 3X1WA 1G16A 4BFZA 4MYTA 2F1RA 4KO8A 3B60A 1OF1A 1U2RA 4GI7A 3K0CA 1W7AA 4P4SB 1N5LA 2HLDD 1S9DA 4RD1A 3U7HB 5EE3A 4CT4B 3Q85A 1JNYA 1EK0A 3HJNA 3ZIAA 3JZAA 3NVAA 1GZSA 2WWWA 4UNQA 2ZJAA 4AG5A 3QY0A 5TXGA 1T0JB 1Z63A 2GRJA 3B7GA 2ZYUX 4M1SA 1P6XA 1COWA 4GOXA 5CK4A 3K70D 4LHZA 3I1FA 3E5HA 1QBKC 4G3XA 2N46A 3R8FA 3OIYA 1CRPA 4PQRA 2MSEB 2REXB 4JZKA 2QL6A 2N42A 3LVRE 1SXJE 1WMSA 1FPMA 3SEAA 2DCUA 2FJUA 4F93B 1R7RA 3TUZC 1P2TA 3GP8A 1JQLB 5AK0A 2O8BB 4FCVA 1TEXA 1E0KA 4DCTA 4G01B 2FGJA 2CK3A 3H4MA 4Q1AA 3DDCA 4QFMA 1C9KA 1NL3A 2YOHA 621PA 2QTFA 3SBDA 4EJSC 4JKYA 1G5TA 3FGNA 4RKEA 2IS2A 2BCJQ 3JVUA 4RFVA 1OJLA 3U3RA 2WWXA 3A1UA 1T3HA 4Q66C 1SQ5A 3FMIA 5DSZA 2C99A 3X1ZA 1YZLA 2WPDD 4TLAA 2QAGA 3W5IA 2OXRA 2ZRPA 4DKXA 4LZZA 3F0TA 2GCOB 4M9SA 5HE9A 1VG9B 1HQYE 1AS0A 1XMIA 4E07A 2YC4C 4I4LA 5K8TA 421PA 2WAYA 1RRPA 1OYWA 1T8TA 2NTYC 1WA5A 2ZRMA 3A8TA 3AVOA 1E1RA 5FOUA 4DIDA 2XB4A 4GZMA 3L0PA 3F8TA 2VRWA 1XRJA 5F3WB 2NZ8A 3V00A 3I8XA 1HURA 2ATVA 2XZPA 4QGGA 3U3MA 2F1JA 3MWLA 1CJVC 2AR7A 5IRCD 1IJEA 2GBLC 4TSFD 2XZOA 3TSWA 5JEEA 5JRZA 1O3YA 3M1IA 4GMXA 1UFQA 4PPNA 4HYYA 2DYKA 4GT1A 1JI0A 4NU0A 3AUYA 3OAAA 5FR2A 3AKCA 3T35A 3IQWA 2WJYA 3Q9LA 2YWEA 1ZM4A 5SZIA 1XU4A 3IEUA 4Q4JA 1EFUA 4PO1A 1YJ5A 4BEBA 1ZCAA 3U2QA 3H1TA 4LBZA 4Q9IA 5E4FA 3V9PA 2WIAA 5ANRB 1E99A 1N3BA 3QPVA 3HDTA 1Z0JA 4L16A 1MO4A 3IIKA 1FNNA 2V1XA 1OKKA 2O8BA 3S1AA 4TT3A 1KSHA 1MOZA 3CWQA 5DN6D 1L7VC 1R5OA 2ZVQX 1NIJA 2GEUA 1E96A 4I1VA 4J0QA 2XZLA 4D26A 1YR6A 1JXMA 4II7A 3KQKA 1GDDA 4OQMA 4DSOA 1FX0A 1HYQA 2G88A 2WVJA 1U94A 4MA4A 2GJSA 1GUAA 2FDCA 4DEXA 1EFHA 5BW8A 2W2VA 4NHOA 5JLJA 1J99A 1ESMA 4JLBA 4BGDA 4DWJA 2F9LA 4HAZA 5EUMA 1VPLA 1F2UB 2I3BA 4QBGB 1Q57A 1ANKA 1ESNA 1VHLA 4MRSA 4A8JA 3FOZA 4AKHA 1ZRHA 1UBGA 2PJRA 2QI9C 1WBDA 3QKUA 5FFMA 1XB2A 1Q0UA 3K09C 2O52A 1OXSC 3H86A 2BV3A 2GNOA 4C0AC 3GD7A 4AK9A 1U99A 4EPVA 3X2SA 3TAHA 2NMVA 1Z28A 2P6UA 1D9ZA 3WYAA 3X1XA 4POAA 4Z1MA 3I73A 1BOFA 2GETA 5DISB 2HCJB 2R6AA 4I1UA 5H70A 2AKAB 5LD2C 1RPZA 4P31A 1PUJA 4LJ5A 3BK7A 3T06B 3SQWA 4RD6A 2QEQA 1QG2A 2UVQA 1AJEA 5K8LA 5TARA 4DLWA 3K0FB 3KX2A 1KI6B 1N5KA 3LRPA 2ZYVX 3E1SA 3K9HA 2H5EA 3CWZA 3KTAB 3W5JA 2OZEA 1KI8A 1ZM3A 2SHKA 4QBFA 1PVOA 4JYBA 1MRSA 3AF1A 1F48A 2WV9A 5FI0B 4DCNA 5BQ5A 1YKSA 2OCAA 4DLUA 1E2LA 3ECCA 3REGA 2XAUA 4FI3C 4CDGA 4BLPA 2RCNA 1SGWA 4MDFA 5FI1B 3SFZA 4CEIB 1EG7A 2D2FA 2ZIAA 4TLEA 1X6VA 5E7IA 2ZRKA 1N0UA 5KSOA 1PLLA 1AM4D 1U0HC 2HF8A 3A36A 3QXJA 4H9GA 4DDVA 3WHLA 1IN4A 1W36D 1OFIA 4ZIRA 4DT1A 2C9YA 2ODEA 1OXVA 1OH7A 4NZYA 3LXXA 2D7DA 2JIZD 1XEXA 3GCGA 3EWAA 5BWMA 3A1VA 2XNDD 4DCSA 4M1WA 3TMKA 5JMTA 2OBMA 1XD2B 2CVHA 3L0SA 2FEMA 3T34A 1G19A 4GZLA 4PPQA 3T5GA 4B48A 3ZZTA 1FMLA 1M1YE 1RE0A 2ZITA 1G5PA 3OFND 3TR0A 5G41A 3QKRB 5AJVB 1E4VA 4B2PA 4ABYA 2OV2A 2F6RA 2ORIA 2RGNC 1AKYA 3FHCB 3KZ1E 1TUEA 4NYJR 5KHOC 4O2LA 4PC6A 1YZGA 2OESA 2H92A 1VMAA 1MO6A 3LX5A 3SN6A 2VIIA 1KMHB 3GEHA 5HR5A 3ZS8A 1E2QA 3SZRA 5J47A 3CKLA 1FQJA 2IS6A 3DZDA 5FOXA 1KMHA 3CNOA 2W6IA 3D31A 3KQHA 1SVOA 3EASA 4MRRA 3KFXA 4A36A 3TLXA 1XMJA 3K09A 1OXXK 1KGDA 2CCGA 4D81A 1U0LA 2PX0A 3QKRA 3B2EA 4HAVA 2OUKA 4URXR 5FH9A 2IYTA 2ZRAA 4UNSA 3W6OA 1OHHD 3IO3A 1JEEA 2ZI7A 3B82A 4B6EA 4DSUA 4PC1A 5CYOA 3WMFA 2QQ0A 4PFSA 4C0JA 2F43A 2JA1A 4D82A 2FSIA 2O8DB 4GRAA 2G6BA 3A1TA 2IYVA 3MLEA 3WP1B 1WF3A 2Q9BA 2PJZA 4UJ5A 1N6IA 4TYWA 4GP7A 3TBKA 1N6OA 1WP9A 1X8KA 4PHTA 4TTQA 1VG1A 2A5DA 1MV5A 2IWRA 5B64A 4FN5A 4DB4A 2D7CA 1MABB 2IL1A 4HAXA 1UBFA 4ZIRB 2IYZA 5J4VA 1VKJA 3ZJYA 2FGKA 2BEJA 2FU5C 4M9QA 4N3NA 1OFHA 2AXPA 4NCKA 1B0UA 2W2TA 3B8HA 4Z8YA 2H7VA 1N6PA 2VO1A 1Q12A 5TVKA 3A4NA 2HXYA 3EXAA 1RC8A 2OCBA 3GLHB 2GF9A 3DKPA 4G5QA 4IDQA 721PA 3KJHA 1SVLA 1DAMA 2W83A 3KKOA 3W8NA 3FHTA 1XD8A 5FPYA 4TMZA 3FMOB 3OHMA 4LYHA 6Q21A 4AY2A 1LVGA 4MKIA 1W36B 4NYIR 4HSEA 1P5ZB 1SKQA 1GITA 1YE8A 1RYHA 2V7QD 1E1QA 1SVIA 2QENA 1KY3A 1IXZA 1VCNA 1Z0FA 1GIAA 1WCV1 4LCBA 4AKEA 3L2OB 3R8CA 2G1JA 4M1OA 3CRRA 4QL3A 2DWPA 2BBTA 4RSGA 1G41A 3THXB 1ZIOA 5DH9A 1LF0A 3SYNA 5FR1A 1F5NA 5E95A 3CLVA 2JGNA 1CKEA 3CF0A 3MWYW 1MO3A 2GXUA 4LJ8A 4OHXA 3GLGB 1W2HA 1LS6A 4JLAA 3A1SA 1N6LA 2PMKA 3ICEA 3QXHA 4TYPA 2QMEA 3RDPA 2WJVA 4WW0A 5D3MA 2O0JA 4QHSA 4M9XA 4IOMA 1T5LA 1FFHA 4IDPA 4PXAA 3BFXA 2FFQA 3RSLA 1TQ4A 3ADCA 2ANBA 4DLTA 1G1MA 3FE2A 3P32A 1XXHE 2J7PA 2WSSA 1QG4A 2FFBA 1XTSA 1U98A 2WWFA 1Y63A 2GXAA 2RGGA 3OEHA 3ADKA 4IEEA 3UPUA 4JVLA 3OESA 1X8JA 1KO7A 4TL6A 5P21A 2R44A 1HE8B 3QG1A 1Z0IA 4ZDIA 3ZVNA 4E22A 2HYDA 5GJBA 1KI4A 2B7CA 2D2EA 1RRFA 2VH5R 2VSXA 1I4DD 3VU9B 2V3CC 1R5BA 4DLRA 1Z6YA 4ASUD 2BMEA 4NBSA 4L4UA 3PUYA 3S1AB 1T0HB 1XMVA 2IC5A 3TW8B 4Q48A 3NIBA 2YJTD 2ZYTX 2IK8A 3HU3A 4TN1A 3LV8A 2FNAA 4KBFA 3BOSA 3CPJB 3OEEA 1Z0DA 2WWYA 2V9PA 4IOLA 2NG1A 5FPHA 4Q4LA 1M34E 1WQ1R 1T6NA 1AKEA 1ZBDA 1Y3AA 3BB3A 4DDUA 3U3OA 4PTLA 3U3KA 4C9BA 3C5HA 1NNEA 3PEYA 1P2SA 1T3LA 2GZAA 2ZR0A 2KI5A 1DO2A 3TSOA 2B21A 5AUQA 1H8ED 2VP5A 1VYVA 3BC1A 1G3MA 3CW2A 4XIGS 2XOKA 1PLJA 4DCUA 1GNPA 2D4HA 1D2NA 1E2IA 2DB3A 1LW7A 4JLJA 1OPXA 3KKPA 2HJGA 2WJJA 2XSZD 1TNDA 2BC9A 2QN6A 2FSFA 2ZSBA 3PUVA 4CEJB 5H68A 1Z08A 2IS1A 3ND8A 4RD2A 1RW4A 1AZTA 2DFKB 3OAAD 3CX8A 4RJLA 2FFAA 1P9NA 1XXHA 3H84A 1S2MA 2WWIA 4GNKA 1KI2A 2OHFA 1Z22A 4TLDA 1FMJA 2BBSA 2GCOA 1ZW6A 4AD8A 1SXJC 2P65A 4HB2A 4EUNA 3P4XA 3BBPA 3FVQA 4BASA 3KUDA 4R2IA 2AXNA 4QXAA 5IDVA 1MRNA 4TQ9A 5J4YA 1IY0A 3EARA 1UAAA 1GOTA 3ASYA 4FW9A 5JBQA 1DTSA 3B85A 4YMUA 2VHCA 4M8NE 1CR0A 1M8PA 1FP6A 5CIQA 4LPKA 3THYB 1OW3B 4TLBA 3MRSA 5G3YA 2ZANA 2P5TB 4QJ5A 3Q7QA 3G0HA 1YRBA 4UXIA 4CEHA 3SR0A 2IXGA 2PLFA 4NYJQ 1DVRA 1KIMA 1PJRA 3NEYA 2BKEA 4YDSA 2QUZA 3T1OA 4IHQA 1YZTA 2Z0MA 5SZKB 4WZ6A 5EE0A 3MUFA 2CCJA 1Z83A 3LNCA 5HKKA 4PX9A 1L2TA 3VR4A 3VU9A 4URZR 1HEIA 1NMXA 2IHBA 8OHMA 1XTIA 4KLNA 3RC3A 1XCGB 3NH6A 5G40A 4XSHA 1BKDR 1NJGA 1OIWA 3C14C 5FBRB 2ZE7A 3BGWA 1KO5A 3AVYA 4D25A 2ZJOA 4X8LA 1E9SA 5JJLA 2AFHE 3QF7A 2GXQA 1YR9A 4TT3D 1UDWA 4IOJA 3IKJA 5DLQC 3RWMB 5G3ZA 3LWNA 2R6CA 1WE2A 3GJXC 4P4SA 3ZZUA 1C4OA 3K9GA 4DLXA 2IEYA 4DZZA 4YMTA 5JWOA 1GP2A 4BFXA 1G5RA 2EQBA 4FMDB 3OEHD 1IY2A 2ZU6A 4TZ0A 4Q9KA 3L43A 2V8OA 4LJ4A 4Q4AA 3RHFA 4M9ZA 2RGEA 2WHXA 4BE7B 2EFDB 2QTHA 4GL2A 2CJWA 3I4LA 1VDZA 1YU9A 2IYLD 4BRUA 2EYUA 3EC2A 4NCHA 1M74A 5KDOA 4PQFA 3THXA 1I4TD 2CHGA 2BJVA 1TX4B 1XTRA 3IBYA 2V1UA 2XXAA 5EJEA 4KXFB 4O2RA 4HZIA 2JLRA 4RCZA 4QHTA 5F2EA 2OFXA 4BWYA 4MRVA 1I2MA 4ZCLA 2OM2A 3CRW1 2X8AA 1E69A 4F4JA 1UBCA 4V0MA 3NHBA 4FIDA 2C95A 3W6PA 5JJKA 1SKYE 1FZQA 1YVDA 2J87A 3A58B 1VYTA 4Z1MD 4IXNA 4TQUS 1ZU5A 1W4CA 1XJQA 3GLHA 4X8MA 2N1BA 4U7DA 1XFAA 2ECKA 4K46A 2D06A 2ODNA 3GJ7A 2J9RA 3KL4A 4ZI3A 5FTLA 3BH6A 1OXTA 3NC1C 3GMTA 4FMCF 1Q1QA 1KDTA 1NN0A 2GCPA 5FOTA 2AKYA 2V54A 3AVQA 2QT0A 4JS0A 4KVGA 4G5GA 1MABA 2RH5A 2VP6A 2ZU0C 3TIFA 4RY2A 3VNVA 2O8CB 1G9XA 1F60A 1OIVA 2BM1A 1IN6A 2PL3A 2ZE5A 2NPIA 3CB4A 4RKFA 3W3AA 1GNQA 3D6TB 3TVTA 2JCSA 1CJUC 4YDHB 1DARA 4BZQA 4A0FA 4OQFA 2BMFA 1KK1A 3MG9A 5DO9A 3QXSA 1WB9A 4W5HA 3SJAA 1JECA 4LYJA 3ZZ0A 2DHRA 4D4MA 2A7QA 2P6RA 1G6OA 4BLRA 3AP3A 4XD7D 1F3OA 4IVQA 2C9OA 3NH9A 4I81A 5EE5B 3RS5A 3A37A 2Q6TA 2Z4SA 1NKTA 4NCNA 4U02A 1IONA 3GJ0A 1YR8A 1Z6TA 4GPTA 2JDID 3TVDA 3CX6A 1TF2A 4K8OA 2CL6X 3B1XA 5EE9A 1TQDA 4C4PA 4TZ6A 3P4YA 1A7JA 821PA 2RGNA 1NY6A 3OIUA 2XJ4A 2Q0HA 3DEFA 4HUTA 1OH5A 4BLOA 1E98A 2YOFA 4TMXA 1KZGB 3B9QA 4RD3A 1SULA 4US1R 2VP0A 2XEXA 3MJRA 2ZE8A 1PV4A 4Q21A 3K9LA 3NDPA 3CM0A 2J0SA 4PHGA 3FHOA 3KJGA 4JT4A 2BDTA 1T3SA 2DWQA 4QJ4A 4HLDA 1ZMXA 3CRVA 2QBYA 2EWWA 1W5TA 1XD2A 2BOVA 1E6CA 4JBXA 4KFTA 2NGRA 3C41J 2GILA 2Q3FA 2Z43A 4BECA 2FFHA 2R8RA 4RFSA 3O8BA 4W5JA 1II8A 2IX3A 3CRMA 4YMWA 2QROA 3AP1A 4LC0A 3QKSA 3RRMA 1P75A 1GKYA 2ZAMA 4FCTA 3VTKA 4BPBA 5KPJA 2GTPA 1IN8A 3SOPA 1P3JA 4A15A 3N5CA 4S35A 3NHAA 3VR2A 1QHHB 4JVSB 4Q03A 4Q02A 5GJCA 3TJZA 1G7CA 1SXJD 4TTPA 4DUGA 3DMNA 3SJBA 2F7SA 1KO4A 2V7QA 2F1IA 1CRQA 5AJWA 1RRCA 1W4RA 2ZROA 1JR3D 2LWIA 2OG2A 3K0AA 3DO6A 4CEIA 4PHHA 3K0CC 3AF0A 4L8GA 5AWFC 4QKQA 2WICA 2DFTA 3LY5A 4A2WA 4JBYA 3LH5A 2AD1A 3QVVA 1KDPA 2ZRHA 1IN7A 2P6NA 3PV0A 4DIEA 4HZUA 1NVVR 2ZS9A 4PSKA 1YZKA 4IEIA 4XWAA 4YQFA 3EA0A 4MH0R 1R0WA 1II9A 4A0RA 4CIDA 4DBLC 2OE2A 1E4YA 2H1LA 1XD9A 2QP4A 2EFCB 2CVFA 1ONBA 2J1LA 1E2EA 1J8MF 3PEVA 1G21E 1JAHA 4HUQA 1EFRD 3EIHA 4C0HA 4DLVA 4ZV4A 1LS1A 2IYYA 2CLCX 4A4DA 1Z6AA 1AQUA 4Q19A 1GWNA 3C16C 3B1YA 1G7TA 4AC9A 4B3BA 4C0QC 2AHOA 2GAOA 4FWIB 1NLYA 2ZRFA 4XVQA 3HP1A 2QE7D 3A4MA 1OH6A 4D0NA 1M7GA 2CXXA 2G0TA 2UKDA 4OI1A 1G3IA 4KVAA 4FWTA 4I1OA 4AKIA 1D2EA 1GG2A 2WOJA 4KFRA 4ILEA 3PITA 4RZ3A 3T1TA 4LJ7A 3FFBA 1FTSA 1RKBA 4IDOA 2QPOA 3RS2A 3LW8A 3NC0C 5BYKA 3C8UA 4LJ9A 4A8JC 4TMTA 4JVMA 3UG7A 2IYXA 1ZUIA 2NIPA 2GZHA 2P0EA 5KNBA 1FX0B 5CM9C 1E0AA 1CU1A 1OKKD 1WXQA 3KDSE 2XNSA 1F2TB 1Z3IX 3AF3A 4BLQA 3KKMA 521PA 4XH9B 3VX4A 4AI6A 4P33A 2QP3A 1W49A 4XTCS 1GAJA 1KO8A 2ZRNA 1HT1E 5A4JA 3EC1A 4OK5A 1SVMA 5JS8A 1DEKA 5DNYB 1P61B 1N6KA 3GFOA 4LX0A 2GBLA 1T91A 2FN4A 2PT7A 1KDRA 5E7JA 4ZPXA 4L15A 3THWA 2IT1A 2YV5A 3RLFA 1OFTA 3HR8A 4D0LB 2AWNA 5FL7A 3GJ5A 2KJQA 3IBGA 4OI0A 4R7ZA 3QIAA 1Z29A 2QT1A 1Z2AA 3PFIA 3QNUA 4XWKA 1P60A 1E0JA 1XP8A 4IDNA 3W6NA 5E3HA 3LXRA 1AK2A 4QC2A 5AR1A 3DM5A 3SFVA 4PZYA 1UBEA 5H1YA 2JLUA 4BZPA 1KK2A 1AS3A 2QPTA 1XZPA 4A6XA 1GVNB 1E2JA 1G4AE 1UDXA 3LLMA 1V5WA 2B92A 1BMFD 3N70A 4Q4HA 3R7WA 5ELXA 2R65A 4Q7JB 2CMKA 2IXEA 4EIWA 2A5FA 1P2UA 2JIZA 2RGAA 4OYHA 4B71A 4BFYA 4JL6A 5EZ6B 1G3UA 4NYMQ 2F1HA 4TL8A 4EFNA 4AYXA 3EZ7A 2FPMA 4ARZA 3PEWA 1ODFA 1QZXA 2IYUA 1H65A 4LJAA 5CB6A 4IXMA 2AFIE 5C4GB 2AD5A 4Q1CA 2QAGB 4GBMA 3HPQA 4BZXA 1QHIA 1SHKA 1KJWA 2DY1A 2JJ2A 1Q22A 2ONKA 4TL9A 3TGPA 5EXPA 5TB5A 2PMDA 4YMVA 2PX3A 1IHUA 1DG3A 1LF5A 1QRAA 3NBYC 1XX6A 3UANA 3BIFA 5FBWB 4B3FX 2PZGA 1E2MA 1Z07A 1HT2E 2ZJBA 3AEZA 1CR2A 1JALA 3NBZC 4B44A 1G8GA 3J81k 3U44B 4U5XA 1G3QA 1COWD 1VYUA 2QAJA 1FOEB 2ZRBA 2YHSA 3AM1A 2CEAA 2KB0A 4LYAA 2FZLA 2RGBA 4PAOA 5FOVA 5J4LA 1NLZA 1NVXQ 2IUUA 5TDHA 2G3YA 2EVWX 4LHYA 1LY1A 1NP6A 1T5IA 2ZS7A 3EZ9A 4JLKA 2GF0A 4TMWA 4RZXA 3U7EB 2NOAA 5KNDA 5C46F 2G9NA 3IHWA 4TYNA 1KSJA 3EA5A 5CYPA 3SI7A 2QU8A 2QE7A 3BJIC 2GEDA 4KFUA 1KSGA 4MITA 4PC7A 5FPKA 4KYIB 4O3MA 3FDIA 2GHIA 3ADDA 4F91B 2BMJA 2GCNA 2CE7A 2HV8A 5KOYA 1JBKA 1XDBA 2LKDA 1Z5ZA 1PLKA 1NJFA 3EAQA 4ZDKA 1LTQA 3N2EA 4TQAA 3VR3A 4B43A 2YKGA 3SQXA 2VQSA 3QJYA 1ZC3A 3PUXA 2W6JA 3BORA 4AIIA 3GJ6A 5F9FA 2HT6A 1TU3A 4Q7KA 2WMNB 3UK6A 3ZVLA 2JJ1A 2RB4A 4P4TA 2FPLA 1NSFA 2BWJA 3IEVA 2I4IA 3ICQB 1Z06A 3U6KA 1NBMA 1NBME 2C04A 4X8HA 3AV0B 4QNRA 4E03A 3ONWA 2OCYC 1EWRA 4H1UA 1MO5A 3CH4B 4OHZA 4B2IA 3QF4B 4F4CA 1U8ZA 3KQNA 2HEIA 2X2FA 3HU1A 4N1AA 3AF2A 2OO7A 4M53A 3BD9A 3MSXA 1JQJC 4MGIR 4PHFA 5C4MA 1XCPA 3WY9A 3LVQE 2RGXA 2Q3MA 4LBVA 4Q1BA 3PR1A 4TSFA 1Q44A 5EUQB 1DELA 3P20A 1ZD1A 4MYUA 2QMOA 2VHJA 4F92B 2BKUA 2JJ2D 2VPPA 2ZQ5A 5L3QA 1ZCBA 5FPSA 1CJTC 3CZQA 4FXPA 3R9IA 3PQCA 3R7WB 2J0QA 1GFIA 4NE2A 1E0SA 5DI3B 1JPJA 2EFGA 4YLGA 5F9HA 3U61B 1N6RA 4KLZA 2HUPA 2P67A 4OQNA 4DJTA 1HY3A 3SJZA 3GLGE 4CGZA 4OQLA 3IPYA 1S8FA 4V03A 4EJSA 4ZDJA 1XEWY 3QPUA 3W34A 3F3YA 4JVNA 1OV4A 3Q5EA 5HZKA 1K5DA 121PA 5EZ5A 4DLZA 5JSZB 4JL8A 1DAKA 5DYIA 5DN6A 1P4SA 4HDCA 5CJ2A 3OE7D 3L8ZA 3AVWA 4MUAA 2UZIR 2WMOB 3THWB 1E2DA 1W0JA 5HCIA 1X1SA 4MGZR 2A3RA 4Y0VA 3G82C 1KJYA 2GVZC 4QG7A 1SVKA 1E1QD 3UMSA 4LJYA 3O8CA 1EX6A 2KBFA 3TKLA 1HQCA 1ZU4A 5GVRA 2OEPA 1GM5A 4AYTA 1ZM9A 4KU4A 3NEJA 4FMDF 4ERNA 1AA9A 4B6FA 1QVRA 5AJXA 1YZNA 1S3SA 3RRZA 2FF7A 2ASEA 1E9CA 2EW1A 2ZI9A 1EESA 3RVBA 1GKIA 2MSDB 2C96A 4LWZA 3QXCA 4DVGA 4P0TA 1E9BA 3IHLA 4LI0A 3RS4A 1QDEA 1JR6A 3TQCA 4Q9LA 3MMPA 2VLIA 3LW7A 4XD7A 3RRYA 2IYSA 3H0KA 4IFEA 1NMZA 4M1YA 2J41A 2YYZA 1M7HA 2J7PD 2WSSD 3DM9B 3KKNA 4LYFA 3P27A 5J4HA 2NO6A 2QRNA 4R9UC 3FYHA 2IW3A 1OB2A 2XOKD 3BS4A 1ZNWA 3GEEA 1RRGA 5CLQA 1LV7A 2PZEA 3WNDA 2JLYA 4WBSA 5CJPA 1SXJA 1U81A 1KO1A 4C3ZA 2QM7A 1CS4C 3FMFA 1M7BA 4HAWA 5HTKA 3VHLB 1OYYA 4QGAA 3TUIC 1AIPA 2OFOA 2WBLC 2WWHA 5KU1A 1SKYB 4ASUA 1KAGA 1KY2A 1SHZA 4D2IA 2XTMA 3D3QA 3OF5A 1K6MA 4EKDA 1RYFA 4O25A 4HUQB 3QBTA 1JJVA 5B58C 3WNBA 1RIFA 1G6HA 2FX3A 2GZDA 4KFSA 4Q1EA 5EP4A 3GLIE 1IY1A 2QGNA 2JJ1D 2ZJYA 4UXHA 5KTYA 3ZVMA 3EWSA 1R0XA 3W90A 1WBBA 3WHKA 1DBSA 3PENA 5FOSA 1NBMD 2GXSA 5FTKA 1PZNA 3U7FB 4Z51A 2Z83A 4HZUB 1S4QA 1XPRA 1NF3A 2FPKA 3QEJA 3RANA 1IBRA 4B32A 3RSOA 1N0WA 1H8HA 5L3SB 3GLFB 3GLFA 3FTQA 3AKYA 3NTUA 5CB8A 4JT2A 4XJXA 1NN5A 2XJ9A 2FA9A 3BAFA 4BFTA 3SU8A 5SZHB 2W2XA 3BB1A 1BO6A 4B75A 2QG6A 2QA5A 4ZKDA 3CH5A 3LD9A 1J2JA 1KZ7B 4IJMA 3KB2A 1KI3A 4JKIA 2XITA 2A5JA 2FWRA 3VAAA 2VBCA 2WJGA 1NVUQ 2QZ4A 3RS7A 1W5SA 1G18A 2ORVA 4WZBE 1YQTA 3GJ4A 1U90A 3T61A 1Q21A 1II8B 5C18A 3ZIAD 1MH1A 1R5NA 3I32A 3TR5A 3IUYA 4B73A 2B8WA 1TTTA 3R9WA 2CBZA 3QVUA 2IUTA 3QOFA 4NTZA 1GRQA 4GOJA 3LO5A 4QJ3A 1Q20A 2BHRA 2Q9CA 3C5CA 3EZFA 2W6ID 3FKQA 3QBVA 5FTMA 1W46A 2J0UA 1JR3E 1HTWA 2GA8A 5LBIA 2IS4A 1R6BX 4B35A 5M04A 2XTNA 2VSOA 3HYRA 4HB0A 4JL5A 3X1DA 3I5XA 2C98A 1GKUB 4JLMA 5JHHB 4W7SA 1HUQA 1HA3A 1US8A 5KSPA 4XVRA 3GLFE 3U4QA 2A30A 1P2VA 4OQXA 3WMGA 2JAQA 4PANA 4PC2A 5EP3A 3WBJA 2Q3HA 1S96A 5KPDA 3BE4A 5FL7D 2PLRA 3P1JA 3HPRA 3PCRB 3PG5A 1R10A 1OB5A 3AKDA 1EGAA 3VQTA 4DCVA 3ADBA 4TYYA 3T1QA 2C03A 3LBHA 3KXLA 4C7OA 4MGYR 4KSCA 5EP2A 4A2QA 3BFKA 2GAAA 2J46A 2ZJ8A 1IM2A 5CITA 3NXSA 4ZKEA 2YC2C 4LV6A 1G8YA 2RGDA 2WWGA 1TUIA 2RAPA 3BWDD 2BIFA 2WOOA 3BB4A 5CIWA 2ZR9A 2G1KA 1BMFA 2L0XA 4LSGA 2YNMA 4MKHA 5JSZA 5H8WA 2IF0A 3TH5A 5AUPB 4A0GA 1R8QA 2H16A 1G7SA 4Q7MB 3QE0A 2CK3D 1MT0A 4EJSB 1DS6A 3NDBB 1W0KA 2X77A 1Q3TA 4WIAA 2NO9A 4BFWA 1UF9A 1A82A 1DE0A 2F3TA 2YVUA 1I2DA 5FOWA 3W9YA 2CE2X 1FQKA 4QM7A 2O0HA 2P2LA 4FMBB 4QRHA 5FUWA 5UKDA 2LKCA 2Q9AA 2IUSA 5L3QB 4EPXA 2LCFA 3ZLJA 4ZDWA 1TEVA 2A5YB 1N25A 3RNLA 2IEZA 2IYRA 4HAYA 1UKVY 3QSYA 1BYUA 2EWVA 2DR3A 3BFVA 4QOSA 4KV9A 3T5DA 2JLXA 2O8FA 4D6PA 1R4AA 5F98A 1X86B 2OBLA 3LA6A 1UKYA 2B7BA 1E32A 3X1YA 2ZUDA 2JJ8A 4KJZA 1BH2A 3EIQA 4Q47A 1R2QA 1U9IC 1IXRC 1XBTA 4OK6A 5DGXA 5FUYA 3AVPA 1RFLA 1FUKA 5B2ZA 4HI0E 2ZM5A 4IW3B 2O5VA 3QI2A 4GOKA 4OKSA 2Q21A 5FTJA 3W3ZB 1N2CE 1QHSA 1DAFA 1OLOA 3AF4A 4D80A 2ODBA 5J4KA 4M1KA 5EXTA 4B33A 1FL9A 4JLVA 5CK5A 3CO5A 4BQSA 5FBVB 4Q4AB 4O0MA 4M0LA 4LHXA 4KI0A 1E2GA 2QRZA 1S9HA 3U6BA 2QTVB 1C1YA 4DEYA 1Z0AA 2MMCA 1W44A 2NO1A 2ZR7A 3EZ6A 4X8OA 3UIEA 5HZHA 2ODWA 4EPRA 2GJ8A 3SHFA 4MQBA 1TQ6A 3DKVA 4QHYA 5KDDA 1D6JA 3QQ5A 4KODA 3ZVRA 4IVRA 2AWOA 2BM0A 3TK1A 3AVTA 3NKVA 4YXWA 3KJIA 2R9VA 1TADA 2ERXA 3C7KA 4NH0A 1W4BA 4US0R 1VCIA 4LY6A 2GJKA 4V0ME 5GVSA 4DDTA 3TRFA 4B47A 3SYLA 2WKRA 1NKSA 1VTKA 4F4IA 3Q8XB 2XGJA 4XWOA 3GLIB 1M6NA 4OJKA 3WBKA 2DBYA 4CT5A 4NL4H 4HEJA 2GEVA 4JSYA 4Q5IA 4W5WA 2DFLA 2FSHA 4TLCA 1TQ2A 5IF9A 2HCBA 4G5OA 4CEHB 3CNNA 3MAAC 3QPWA 4URWR 4M22A 2WM9B 4OK3A 3AGQA 2C77A 4BFVA 4AURA 3QG5A 2OAQ1 1XCMA 1DAGA 3KXIA 4HB4A 1A2BA 4AKGA 2NO0A 4FD2A 2QQEA 1DAEA 2XTZA 2YWGA 2H8KA 2JLSA 4HAUA 1CULC 5GADl 1D2MA 3CF6R 3L0OA 4UJ3A 1U8AA 2IA5A 4URVR 3D7MA 1ZC4A 2XB2A 4RZ2A 3UMFA 1R0ZA 4Q18A 3SE0A 3CUEF 2JEOA 4ARZB 3MCAA 4A2PA 5JWRA 3HWSA 2D62A 4EQ6B 1VIYA 4PC3A 3SHWA 3KKQA 3DPUA 2QSYA 3NG1A 1B23P 1JXOA 1VG8A 4OHYA 4YONB 1E79A 1E2PA 1XEWX 3FKSD 4BFSA 1J7KA 1X8LA 2ATXA 4D4JA 1QVAA 4MGKR 3U7GA 2ZVPX 3LX8A 2VYFA 4V0LA 1SVSA 1GILA 4JMPA 2RHDA 4B3XA 4EPYA 3M4YA 4UQOA 4UNPA 1P73A 1KHTA 3KFVA 3VKGA 5GJVC 1KSFX 3QXXA 4PZZA 1XJCA 3AGPA 4LK2A 1RVDA 3M6AA 5B57C 1Z8FA 4A82A 1NRJB 2RKOA 2A78A 1TF5A 4OI2A 1IOZA 5LD2B 1UPTA 1NSTA 4C7OB 4WXRA 3SDZA 1G20E 2H17A 4F7WA 2WKQA 3CNLA 5AUOB 5A5GA 3SJCA 3B78A 2REBA 2YOGA 4ESVA 2QSZA 1JEDA 2HJVA 5AJZA 4V02A 2KBEA 3QEOA 5JEDA 3A1WA 1S1CA 2PT5A 2XNDA 2OT3B 2QMHA 1Z2CA 1CR4A 1JB1A 3RS0A 4WXPA 1NG1A 5LB4A 2RHMA 5EQTA 1OHHA 3NBXX 3ZYCA 3DL0A 3U4QB 3B6EA 2KE5A 4MRPA 5DHAA 2CNWD 4R2HA 4FCWA 5JFGA 2VP4A 3K0EA 1G64A 2FZ4A 5KSYA 3VKWA 2PEZA 4OBEA 1AZSC 2PBRA 2X2EA 1JJ7A 1II0A 2HLDA 1E2KA 5D3QA 5FUXA 3PJRA 2W0SA 2QP9X 1FUUA 2J0UB 3GJ3A 3UG6A 3DHWC 2F9MA 1U8YA 5KYKA 1DPFA 2PCLA 4MKFA 1AS2A 3GQBA 4HB3A 1EFCA 4YC7A 4YXWD 1NVVQ 4BFUA 4JLDA 4IOKA 1WDTA 2R62A 2C78A 4HLCA 3D8BA 1A1VA 3GLGA 2IYQA 3VHXA 1PUIA 3G5UA 4U00A 2O8EA 3VX3A 4KBGA 2DWOA 3THOA 1OH8A 3CONA 4JJKA 1GRRA 2G77B 1E79D 4DHEA 2GK7A 4FINA 2X1VA 3V4RA 1CJMA 2IXFA 2J3EA 3UXMA 4C0BA 4BEJA 3R20A 5FBLB 3DOFA 4PAQA 3ND9A 1CIPA 2W00A 2H57A 5LB2A 1GSIA 3RAPR 1KYIA 4PAMA 1DADA 4LOAA 3REFA 5EP1A 2QAGC 4CVNA 1AGPA 3RWOA 3K53A 4P4UA 1LB1B 1TU4A 4RCYA 2IBMA 1IQPA 3HU2A 3I92A 4LBYA 1M2OB 2GJ9A 3ZGXA 1A2KC 5L3SA 2P5SA 3M0EA 4L9SA 1MKYA 1L4YA 3I3SR 3K0AB 4M21A 1OXUA 4AYWA 4URYR 4EFMA 4A9AA 4MYHA 2IHYA 3IIJA 5K8IA 2VEDA 2I1VB 1QHHA 2C5LA 4RD4A 3PIRA 5BYJA 4CW7A 2WAXA 3B1WA 4GSYA 1GNRA 3B9PA 3TE6A 3TNFA 5EE1A 3SC3A 2ZJ5A 3QKSB 1OSNA 1N6HA 4NCJA 4IRUB 1E3MA 4WA7A 2JDIA 2QGZA 4KYUA 5JI2E 4RFSB 2OSBA 2O8EB 1XEFA 2CLSA 3EPHA 4AG6A 4PPGA 2TMKA 5KDLA 2XX3A 3ZH9B 3I61A 2QBYB 2YWHA 1KI1A 2CNWA 1VHTA 3OIVA 1KI9A 2P3SA 4E09A 1Q1EA 2IYWA 1EFTA 1P9RA 3EW9A 3GFTA 1N5IA 4V0OA 3VKHA 2F3RA 3WRXC
chains in the Genus database with same CATH superfamily
1CJCA 1SH7A 2FG5A 2GUWA 4GSKA 1LC0A 5ARDA 4C4AA 1XMSA 4BO5A 1E3WB 1G4UR 1P1RA 2BVNA 4ITUA 1K5HA 5FFNA 3VZCA 5BSEA 4WH0A 2XGOA 5J58A 1XK7A 4HMQA 1CXZA 1AVTA 5A3JA 1LKZA 5KO2A 1GGEA 2QDKA 4MUBA 2C2HA 5EHIA 3EG9A 4RA6A 3NVKI 2OB2A 4MR9A 2E9SA 1H42A 4Z0HO 4BN5A 4D3YA 1PVVA 5CR9A 2YJNA 1V7QA 2FVYA 2QW8A 1CFZA 2GM5A 4MVJM 5BN3A 2HB6A 2ZSFA 3O92A 4HLUA 4EATA 3K70C 4C2UA 2X14A 3HJAA 1TKRA 5DE3A 1PJTA 4EQZA 4S04A 1KEKA 1OE0A 5K99A 1HH4A 1E2BA 2XQJA 3QSGA 1IXSB 3QW2A 2NZXA 3DGFC 4RPHA 2NZJA 1A4UA 3JASA 4HEHA 5FDFA 3ZN2A 4YCBA 2ERYA 4O33A 1LTKA 4CR6A 4D44A 4DC9A 5HPYB 1LV8A 1NUHA 2H54A 3LUAA 2ZWAA 3UW1A 2M1XA 1U2PA 3QU5A 3ZLUA 3BQMB 3LLUA 4AWXA 5EVCA 5LQKA 2WFMA 4Y1FA 2HA4A 4KITB 3QBDA 3KUKA 1XMQB 2DTXA 4LNHA 1XZQA 2Q4TA 3O8RA 1QHGA 1RWQA 1IL0A 1G8PA 3ILVA 1SFRA 1V3VA 3GVCA 4I8XA 4OJQA 1R00A 2NQ2C 1QQ7A 5DYGA 5LP1A 1CZUA 2WV7A 1N36B 1HF3A 3GH1A 5IBPA 3O8DA 3A4TA 3HJCA 1YL6A 3FOBA 3PUWA 1CP2A 3GHHA 4QTYA 3HCOA 4PTYA 2VF7A 2IYPA 1MEJA 5ERYA 4DXDA 4ZICA 5JAMA 2QIPA 2VP2A 4OIMA 3RGWS 4XRGA 4RTMA 4EGSA 2VQEB 4H3VA 5E7MA 1YQEA 4B4DA 2AX4A 3K32A 2VPTA 1U80A 1IXYA 4JA0A 2KHZA 2R6GA 3R5TA 3K9CA 4URHA 2JLVA 4X7RA 4JODA 1FYVA 4EQ6A 3U7FB 1DRVA 5AK4A 5BWOA 1GRNA 1M72A 2VHUA 1S3GA 5JOQA 4HX5A 4RK6A 4BJ1A 1L5GB 4QGHA 1S7GA 4JJZA 1AHIA 3RUDA 1AGRA 4G4SP 1E9DA 1KVTA 3C15C 1DCMA 2I76A 4UTVA 4EJ6A 1RP7A 1UXJA 4EFLA 1ID1A 2OXCA 2ZIXB 3IPLA 4PLZA 2JBAA 3CMCO 4G5SA 3VSBA 4P5EA 1YS7A 1K92A 2OHGA 4ND4A 1CUVA 2Z5FA 1K5GA 1SY7A 3A3NA 3F9RA 3RBVA 2CJWB 1C8LA 3UJCA 3WL3A 4UUAA 5HQ3A 4UULA 1PQWA 4L8WB 2DECA 1DKPA 3K70B 3M4NA 2L69A 1QYXA 2ZYSA 5F7JA 3WFIA 3ICWA 4FFVA 5H83A 3BWXA 3ZIUA 5KNBD 1NG9A 1EFRA 4KDCA 1O9HA 5FBZA 3ZWOA 1NXPA 2QMYA 2ZWMA 4IFBA 3SZOA 1R16A 4A1FA 1F2UA 2PYIA 2OCPA 4YUZA 4G09A 3RYCB 3A31A 3G2HA 5B3LA 2NUAB 4BNLA 1EVIA 2OZLA 2QTAA 3C87A 3KYDB 5C37A 3FNRA 1WMFA 3EHEA 2CHQA 1A2OA 1ZP6A 5KNCA 5HQJA 1TQ8A 1YC5A 3BMCB 4J1SA 3WLEA 4GVLA 1H94A 3C1UA 1YI0A 3HLKA 4U3JA 2CNBA 1NNLA 2GPTA 1HQKA 4PR0A 1OT3A 4LPSA 1TM2A 4HFJA 2OO3A 5IC6A 5BQOA 5C3MA 3QKWA 2BHNA 4GLFA 3VR1A 1UOPA 4BVBA 3RG8A 1CTQA 2M9MA 4YRKA 3TEMA 3R3ZA 2FPUA 4KAXA 4FSHA 3MTAA 1CY4A 5IMBA 3E2IA 2WINI 4G0YA 3FDJA 1M0TA 1XZAA 2OCLA 1ODLA 3DEKA 3FSRA 1PGNA 1USUA 4QDUA 3SC2A 3L1IA 3NRBA 2HZBA 2ZRJA 4MJLA 2Y4OA 4TMVA 1V16B 1CY1A 3H5LA 4OHFA 5IT5A 1KPHA 3CUVA 4NFLA 3GRAA 1IQ0A 3THYA 1E1MA 4JP8A 4Q4JB 4R1NA 1EA5A 4BKPA 4HNUA 3Q3JB 3SYKA 4GFDA 3C5EA 3RQIA 1XZBA 3QIVA 1P1FA 1ZNXA 4HLQB 4BX8A 2Q45A 1JLHA 2HEGA 1UWLA 5IEJA 1G38A 3B9BA 5EWJB 4MRMB 2ZW9A 2XAAA 2W9XA 3LKDA 4BNYA 3HCCA 4RADA 5DHFA 1TO2E 2PKQP 3PHCA 4YY3B 3IP8A 3ZD7A 4J1TC 1FQWA 1OROA 3AI3A 2JFPA 3BRWD 3FWYA 1YZUA 1P1CA 4BVAA 5AKGA 2X19A 1YZQA 1IUNA 1CUHA 1RTKA 2XVYA 2PUDA 2Z6AA 2JLWA 4FYMA 3CJQA 5J40A 2F48A 3EDCA 2I33A 4HS4A 4ZO4A 4GPAA 4RK4A 4M1TA 4MP8A 4F60A 3HJBA 4N03A 4Y1RB 4Y2UA 4QQ8A 1IHPA 3WWOA 3N75A 3A4LA 2ZJ6A 3BDVA 3LGXA 3ZTTA 4C3VA 4LVOA 5I4IA 5KI6A 2F90A 2RBKA 4UTRA 3KB1A 4HL6A 1SUPA 2DVMA 2FW0A 1U3FA 2EIHA 3CF2A 3ZK9A 4I1SA 4IFTA 4Q7LA 3T3DA 3W1WA 4B3HA 1IJKA 2JFGA 2FEPA 2B9EA 3IP9A 3LPMA 3I64A 1JB9A 4AZ0B 1KJ9A 3L05A 3R4VA 5EIBC 1GUBA 4OH1A 4PYNA 5CT8A 2OFWA 4I2NA 5ADWA 3EPKA 3GFGA 4AZ3B 3UC9A 3CR8A 4K9LA 5T4HA 1G8HA 3GAFA 2W98A 1FP7A 1B16A 4K3UA 3ZHZA 4AO8A 1WSBA 3IFSA 5IDXA 3S1LA 3HB7A 1WUIS 4PFKA 3WNCA 4QQFA 3TOSA 4AO6A 3V7WA 1D2HA 1R6VA 3TFOA 4C2TA 3A6PC 1T3TA 3T3HA 1XIVA 1LRLA 2VZLA 4L76A 4R31A 3H4IA 3A1DA 2BELA 1WVMA 4JLNA 1R0LA 4NPHA 3NWEA 1UFOA 1SXHA 3EQ9A 4CM4B 2XUQA 4UQLA 5JSFA 1EXVA 2QM8A 2I6FA 2ZVJA 3DVLA 2UAGA 4RVCA 1OZGA 4B81A 3DXYA 1Y48E 1ZOOA 2I3ZA 1ZJWA 4LWQA 1Z0ZA 3JQQA 1YV9A 1XJ5A 1CUGA 1IQUA 3FTEA 5DM2A 5CVTA 3T38A 1E3DA 3HY6A 2W2LD 2X23A 1US8B 3MTJA 3FUWA 2ZKIA 3EX7C 3VO1A 4RIFA 5C8YF 2JS7A 5AMXA 1GU7A 2GYVA 1GL7A 3JY6A 3OT1A 2HWUA 4DIKA 2OGZA 3CEMA 4RCVA 4B3MB 1KZ9A 3UATA 4EGAA 4ON9A 5LBUA 4NG5A 5EWMA 4BVEA 1YR7A 2FPOA 4ZYYA 4PE5B 3NIFB 5CNIA 3PXDA 5G53C 2ZETA 3G2QA 4HNQA 3VH3A 5LIRA 1JHDA 1X7HA 1T15A 4RSHA 2XUPA 2K5UA 4M49A 1NVMB 1J6UA 4P4GA 2A2ZA 4BB9A 4Y18A 1WCIB 1EEHA 1Z4OA 2DHCA 3K1JA 4PG4A 3ZW8A 3FNIA 4J7AA 4D9EA 4DDWA 5B1YA 1VJRA 3O7WA 4QU5A 2QVCA 3CZAA 2E85A 1I3OA 2FJPA 2BGJA 1W75A 1HG1A 2ZZMA 3OJEA 2L19A 1BHSA 4ITRC 4J6EA 3VH2A 2VR1A 4WCDA 7REQB 1TF7A 4BLUA 4R1LA 4G0ZA 1YZHA 4Z99A 4DOMA 4GQBA 4TTRA 5AICA 5C5EA 4HVTA 3CINA 1A5TA 2R2AA 2R48A 2AS0A 1BRMA 1P9WA 1VKRA 1ZUHA 4FYYA 4KCGA 2H0QA 1EXMA 4LF7B 3EUAA 2FSVC 1LSOA 4TV8A 3EXIB 4UBLA 4URUR 4RDHA 4X3OA 3KWMA 3TQSA 1I7SB 5B53A 1X15A 2BCGY 1DO0A 1BEEA 1S0UA 3IAHA 3QMWA 2DY0A 3T5TA 1UEJA 3CPEA 4D4GA 3CMMA 3AL3A 1VECA 4O2BF 5KVAA 4WXEA 5IUNC 3RE1A 2VHEA 2R7AA 5KTKA 2O0KA 1KAOA 4O4LB 5FPTA 4IDCA 5D5QA 3V1NA 3FSGD 4DQXA 3H5TA 4TWZA 3O47A 1EUDB 2HA7A 2A86A 3K0BA 4DUGD 2IQ5A 2CUKA 3OZIA 1E64A 1KNXA 1ZIPA 3PHHA 3FF4A 2QPAA 1WHSB 4ZI7A 4NVRA 4BLWA 5DCWA 1XXLA 4CZ2A 3UWOA 3F3KA 4K81B 4LVUA 4V0QA 1AB5A 2ID8A 1HE1C 3SDSA 2HTEA 1AK1A 1J2RA 4BB5A 1P62B 1ETUA 3BXPA 5DP1A 3VPBA 3TQFA 2OV6A 3LQQA 2H2AA 3AWDA 1XHEA 2GLUA 2H85A 2FSUA 3I53A 2Z04A 2O9JA 3DAYA 4MWSA 2ZDHA 3TMYA 2BBOA 4TVKA 2KPOA 3G49A 2TMDA 3MFYA 2OWEA 3EVNA 5JNSA 1F0YA 2HCFA 3FD8A 3WYFA 4N7RA 5DB4A 3LC0A 1EK1A 4CV0A 2Z6VA 1NI3A 1EWQA 1VOTA 4FLMA 3WP0A 4BEVA 3KDAA 4KSBA 1TL7C 3KLBA 3GNTA 3OE5A 4K6OA 4FOSA 4ZU3A 4MUKA 2HIAA 2YRWA 3K2QA 3A9UA 4ER0A 3EXEB 1QV9A 4RL6A 4HDOB 2FXIA 2HQOA 2G4CA 3R76A 1IJFA 2X3YA 2ZAGA 1TMKA 3KLOA 4R8MA 1EXNA 1YQQA 1U6JA 2FR0A 3I0ZA 4FN4A 4EI8A 4E5YA 4O63O 2NZVG 5HIKA 3L7IA 3RVMA 1YRLA 2BMVA 4OV6B 3RW9A 5GTDA 2LE0A 2VSFA 2WHQA 4B74A 3R3JA 4JBWA 4ZEOA 2PT6A 3EGVA 1WQ3A 3PEUA 2QV7A 3AI1A 4YRGA 1XPJA 4K86A 2R86A 3PRYA 3PD7A 1H0RA 1CVRA 3BZWA 4PZLA 4WASA 1V3QE 2FN9A 1JQDA 4AG3A 3O8QA 3IGFA 3CUUA 2ZOSA 1JEQB 3ETJA 1NBAA 2CHVA 5JCZA 2O59A 2WR8A 4O2BA 2MSCB 5CNKA 3AFIA 5EKSA 4TXJA 1FP4B 3VV2A 4YAUA 4Z9XA 3PEFA 3NALA 1G291 1V35A 1P0QA 1KIFA 2NU8B 5CA1B 2CWWA 1X74A 2BFOA 2G4LA 3KSDO 3ND5A 2VTBA 1MVOA 2PUVA 1O95C 3KFLA 1NBIA 1XEXB 2GN4A 2KWIA 4F8EA 3Q5DA 3RYIB 3AUFA 2O8CA 4OHMA 5DLPA 5MFZA 1ULBA 4PGMA 1I4LD 3TE7A 4GYKA 4EEKA 1TPZA 5JO9A 5DV9A 1PKXA 2BJWA 2EJCA 4JGIA 2W37A 4HDAA 5JDCC 4D0GA 1QANA 5EUBA 4ALLA 3K8QA 2XYRA 4PO8A 3H9JA 2NU9A 3BMXA 1Z34A 3DAHA 3VPXA 2ODTX 4M2LA 1IWBB 4LDJA 2VRCA 2I5PO 3II6X 4HR7A 3W06A 5JBNA 4TS3A 2FMIA 1FLNA 1K8RA 4OSEA 3ZU5A 5FF9A 3I5AA 3W5UA 3HVKA 1LFDB 2WIKA 3VR4H 2ZYDA 3L82B 4KQCA 2O5RA 3PVSA 2IUYA 1N33B 4FHEA 1P39A 2QY6A 2Q07A 3R6GA 2LRHA 1SG0A 1H1LB 2HDNB 4L6CA 3GF4A 4CF7A 3RGGA 1EP1B 5CIYA 1X1RA 4HF7A 4DA8A 1M34B 1XA4A 4B3GA 3Q8LA 2WK1A 1XQVA 3BCHA 2CVZA 1SZPA 3FLMA 4EPWA 4H4DA 5TF0A 2WNIA 2VJQA 3EVEA 2B1IA 5DMHA 5KJEA 1J90A 1XALA 1J70A 4P32A 3AEXA 1NWHA 2YZGA 3HI4A 1B0PA 1BIFA 5EN4A 3W04A 2W93A 4C4XA 4BGIA 4E2WA 4YLYA 3UTDA 3ZDQA 4XXHA 1QLHA 2J0VA 4HRYA 4X1KB 2F67A 3COWA 1K9SA 3A9RA 4FNAA 4RA9B 4TV9B 4YEDA 3S5UA 1NVWQ 5L6LB 1JFSA 1M6HA 2JGLA 3W5BA 4C7KA 2OO5C 2ZATA 2P9EA 4PLFA 3X1WA 4G0UA 3BCRA 4AN0A 3E35A 2HA2A 5KYXB 4D45A 4GI7A 4EG8A 3GEMA 1QP7A 3FH0A 3PNBA 2HLDD 2AOTB 1S9DA 2DJIA 4KYTA 4X92A 3N2KB 1ND5A 4HNGA 5EE3A 1UPCA 4B6OA 3Q85A 4I9NA 1JNYA 5JMPA 5JH7A 4PW0A 1LDNA 3JZAA 3NVAA 2WWWA 3FWNA 4UNQA 4CR8A 2A4MA 4L0DA 1PWHA 1BU5A 1G9SA 4IGIA 4L57A 4QYSA 4R2KA 1Z63A 2Y1KA 3B7GA 3JYQA 5C31A 3EH2A 3IT1A 3JCZA 3WGOA 1F0KA 1P6XA 1BDMA 1VRVA 2VDMB 4GOXA 3L6DA 4PZDA 5CK4A 3E5HA 3WFJA 4G2TA 3R9XB 2O2IA 4J0HA 4X97A 4EJ2A 4KI7A 3FIUA 1YB2A 5LZ8A 2MT9A 2MSEB 1ICIA 3DT8A 4X24A 2QL6A 3LVRE 1I32A 1SXJE 2X6QA 1FPMA 3FCCA 2Y71A 3LJKA 4JYPA 3E8MA 4OFWA 4XM1A 5IN5A 3VO8A 4E3ZA 4E5SA 1V8PA 1V71A 3GP8A 3T7KA 3Q88A 4X20A 2HJHA 4ZVPA 5J3JA 1DRUA 3WSTA 1MB3A 2FZ5A 4ZZ1A 2X0KA 4XIYA 1FDUA 1NW8A 4G01B 2R84A 3WDMA 2CK3A 1EM6A 3C4QA 3CEAA 3H4MA 4OVKA 2YFYA 2YHBA 1IAVA 1NL3A 2XGGA 2YOHA 621PA 3IEPA 4C6TA 5HZHA 3PDIB 3UXHA 3OY2A 5CDTA 2AV6A 3MTIA 1CLEA 3ACBA 2N47A 3OX1A 5ES3A 4GKKB 3HUUA 4J0IA 4XARA 2FW9A 2CV2A 5GIPE 5DSZA 1TTQB 3X1ZA 4MVJP 3HCAA 4TLAA 1QYIA 4KLCA 1X42A 4DJ5X 3ILHA 1H2HA 4YO8A 1QO7A 3L1KA 3W5IA 1N1EA 4DKXA 3F0TA 4M9SA 2OCGA 4IV0A 3HRHA 4DPMA 4RGYA 4PQGA 3U4HA 5K7SA 1VPDA 3CLUC 1RTTA 1DPGA 4IJUA 1XA0A 1XVLA 4JX8A 1XMIA 2FK8A 5EPOA 421PA 2WAYA 4FU0A 4BB6A 2QJRA 4I6GA 4H6WA 2I3AA 5AI5A 2B5VA 2A9QA 3K72B 4G5YA 4PS1A 3RHZA 1SK8A 4XQ0A 3W6UA 1JG6A 2YXLA 3I01M 2V0GA 1JLKA 1VPVA 1TXGA 1R6DA 2Y1FA 1XRJA 3PF9A 2BTEA 5GOTA 2E37A 3Q9UA 4KPFC 2CBGA 1R4MB 4YHHB 1CQJA 2C9ZA 3ZV5A 4HVAA 1NT2A 4RHCA 1DEAA 3P52A 1SAYA 1GPNA 5JRZA 2DBVO 2DE0X 4JYMA 4AMVA 1UZAA 2BGRA 3EGCA 3PUHA 3I12A 4HYYA 3EQ8A 4GT1A 5KJCA 1DQRA 3FJOA 3LCVB 3T35A 1ZRSA 2E48A 2YIJA 2NV0A 2WJYA 3WK8A 3Q9LA 1ZN2A 2PJUA 3WYEA 3WAKA 4AXBA 1XU4A 1LDGA 1TJ3A 1VI5A 1EFUA 2PRSA 2WZCA 2G5PA 2X8JA 3IEUA 2EP5A 3PFCA 2JH3A 3G5LA 4EY6A 4WZAA 3ESDA 1VQ1A 3WBFA 5FEUA 4RYLA 3TW0A 1JQEA 5LQSA 3IV9A 4F3KA 4J16A 2PG3A 1IZYA 1OGJA 3DMPA 3PGVA 4NBNA 3GPCA 2I8AA 3WO0A 2O8BA 2WTMA 2ONZA 4Q3NA 2GSWA 1T9AA 1C4WA 1R5OA 1XSEA 1DZ3A 3CWQA 1ULTA 4I1VA 5DN6D 3K15A 2XZLA 1LJLA 2HSDA 4NMWA 1ULSA 1YR6A 4GI3A 5DX1A 5HF8A 1GDDA 3OQPA 2XR1A 4Z1OA 3DBHB 4GWLA 1TUBA 1Z8HA 4OQMA 4DSOA 1FX0A 4L78A 4L07A 4YMIA 3HY3A 2Q28A 1MC4A 3NDIA 1U8FO 2MR5A 4DEXA 1JWLA 3I1IA 1SKAA 2W2VA 3JQFC 2PUCA 4Z7NB 4JXXA 3EIOA 3OZTA 3P0FA 3HSYA 4JLBA 5JYBA 1SG6A 2Y68A 4DWJA 1WEKA 1J21A 4WOKA 4WN9B 3GPBA 1VPLA 2YWRA 1OX5A 4Y2GA 4BP8A 1DFGA 4QBGB 1QK3A 1ANKA 1NC3A 1VHLA 2P77A 2PAFA 2PHZA 4A8JA 2BGWA 1ZRHA 4QVIA 3TZEA 1T5BA 2Y9MB 4MARA 2GK3A 2A67A 2NTNA 5E6UB 2ADOA 3QKUA 4Y0NA 1CE8A 2Q5JA 2VDVE 5A7GA 3T5AA 1OXSC 1SWVA 3NOOA 2VJLA 4H18A 4RTJA 4JA2A 2GNOA 4B3IA 1UPXA 3GA7A 7ABPA 1S01A 2A0FA 1BCSB 3I2GA 1PT9A 3ENQA 1AHNA 4CV3A 5KYVA 1T5OA 4PG6A 1J8FA 5H70A 2AKAB 5LD2C 3V4SA 4P31A 4X1IB 4C6RA 1EDOA 1RPZA 1ID8A 1V1RA 3HCPA 4ODIA 2NXCA 1KQNA 3LQYA 4CF3A 1SIWA 4RD6A 1UJNA 2QEQA 2WUVA 4HH4A 5LP6C 4B8WA 1AJEA 3H9EO 5K8LA 5CLIA 3NHWA 1PT5A 3KX2A 3EZGA 3CNHA 2ZYVX 3K9HA 2H5EA 4LY0A 2C8KA 4WMLA 4R8LA 3DL2A 5DWVA 3C24A 4QBFA 4CKWA 1PJCA 4OKIA 3D8NA 5FI0B 4BMVA 3HXKA 3LPAA 2OCAA 1JHMA 2LGJA 3KUXA 4V3BA 4K0RA 2C9DA 1XRNA 4CDGA 4R01A 5JDCA 3DD5A 3GDFA 4CEIB 2F3UA 4WCFB 3M2PA 2D2FA 3MMXA 4N8SA 5FT9A 3TXAA 3BG5A 1IZ0A 4EMBA 2ZIAA 2ZYGA 1X6VA 4IJKA 3R3SA 2IV2X 2ZRKA 1SHLA 4G1EB 3IVXA 3MJDA 4KRGA 1Y98A 4HRVA 1X9HA 2BSXA 1OFIA 1EUZA 3AI2A 3FPGA 3Q2KA 2HRQA 2DLNA 2ZXEA 4Z9AA 4EH1A 1Z2EA 3N28A 4NZYA 1YHYA 4S1VA 3USCS 2I62A 4BO8A 4BEWA 1H2WA 1WV1A 1MJGA 5IKPA 1PR3A 4NK4A 4YJGB 5T4BA 5BP7A 4EMTA 2HU2A 3SIPA 4BO2A 3TB6A 2ISCA 3V32A 4BMZA 3D6HA 4IWYA 2PKYX 4P6VF 4JOBA 3F97A 4KV7A 3C74A 3ZUPA 4R4JA 2H4WA 2BGTA 1SB8A 3H9GA 5ED0A 1JU9A 1DXYA 3ENVA 1G19A 2FW6A 3G0DA 3L0SA 3T5GA 3O1LA 2MDTA 4XGRA 4EI9A 3OQJA 3PFFA 4OLJA 2J9XB 5C35A 1QGYA 2E21A 4Z9BA 4D0RA 4L74A 1Y8RB 3OFND 2MSWA 2YFQA 5CW1A 3QKRB 2H1RA 4H0FA 1F9EA 5DXFA 1Z6ZA 3BTOA 3UH1A 1ZISA 4QRIA 2JCBA 4YRZA 1GN8A 1JHOA 4CFYA 2RGNC 5CXSA 1VJ5A 3CSDA 4O2LA 1AUXA 1E5TA 2OESA 2QTMA 2H92A 4HRXA 1MO6A 3OM8A 2V59A 3GEHA 5HR5A 3P9XA 4RY9A 5K0ZA 1IBCA 5FWDA 1JFRA 3D4OA 2C4HA 2LZ0A 4BWFB 4GGPA 1KMHA 4JQSA 4YIKA 3CNOA 2W6IA 1TK9A 1RZRA 3KQHA 3D6JA 1XZDA 1P5FA 2JFXA 4MRRA 4A36A 4DQLA 4RMIA 3E9NA 4RVGA 3K09A 1OXXK 4MEAA 5K0BA 2E82A 2O23A 4I3GA 1NUQA 2K7ZA 3VXKA 3UXEA 4URXR 4JGBA 2IYTA 5DNEA 4UTOA 4DNPA 4BN4A 2HJ9A 1BWSA 5CYOA 2A0WA 3DDSA 3ZCTA 1OX4B 3IIIA 4JFRA 1I0ZA 3VPCA 3P71T 4DCPA 4PFSA 1Z8DA 2F43A 1VKHA 1FX1A 2JA1A 4PAGA 3T7CA 3ZC3A 1PZFA 5I7HA 2O8DB 3BE6A 2G6BA 5BSHA 2IYVA 2J5QA 2QD2A 3FR7A 3O8NA 4DJAA 5LFAA 5LJLA 1OTXA 3E58A 3A0RB 1A9RA 3ND6A 1BE1A 1E4EA 1QQAA 3EZNA 1U0RA 4XPIB 1X8KA 1QTIA 1VG1A 1QRRA 2BKLA 1OQAA 1GGJA 3EUEA 4KPGA 2D7CA 3WJ1A 1MABB 4KDEA 4HAXA 3DFFA 3QH4A 2OHHA 3OFVA 2PY6A 5J4VA 4IIJB 4YJ3A 3BWYA 4NE9A 4FS8A 1HL3A 1DLIA 4BP9A 2HADA 4U2GA 1RHRA 2P9JA 3H0EA 4M9QA 3DOIA 3DW3X 3V8NA 2BTQB 1YR1A 3FCXA 3EVFA 5DWDA 1B0UA 3B8HA 2OFFA 4MMXB 2H7VA 3P9PA 2JRCA 5TVKA 2BGGA 2VH2A 1L5LA 2RHRA 1Z9BA 3W5VA 2OCBA 2GF9A 2HPAA 4OJMX 4PLPA 4IIGA 3TQRA 2V0CA 4ALNA 4EECA 2O19A 5FPYA 3FMOB 3M5PA 3MT9A 3OHMA 4LYHA 1YMVA 4G65A 1GV1A 4E4TA 2O2DA 1QGUB 4KP7A 4DQVA 4DUYB 5FUBA 1GITA 1YUNA 5EG5A 1RYHA 1PQYA 2TSYB 3NZEA 3BRWA 1X77A 1IXZA 2VQFB 3BFJA 1WCV1 3AB8A 5K8VA 3AUSA 1D4ZA 1UPAA 2G1JA 4FEAA 4QL3A 4NPAA 2ZWVA 2GBPA 2ISSD 4I2VA 4TKMA 1QKKA 4JV5B 4NCBA 3ZZNA 3THXB 2FPIA 1EIWA 4UM9D 3CLVA 1K7CA 3R3VA 4MGEA 2FMFA 4UVHA 2I2BA 3MWYW 5AHKA 3F98A 3M6MD 4LJ8A 3TJMA 4YPOA 3NGXA 4HNAA 4OHXA 1SBTA 3SMVA 3UFXB 2I4RA 2W8BA 1LS6A 1KYZA 3JD3A 2P9CA 2BH2A 4KRYA 1ZUD1 4JLAA 1XRMA 3QXHA 4L2IA 4EY3A 1PFKA 2E0IA 1YFZA 5FYQA 2WU1A 2FZEA 2WJVA 2AJTA 1V6CA 2VDPB 4I1IA 4QHSA 4WW0A 5JCJD 2PU5A 2B20A 5LQUA 2O5CA 2C20A 2P3OA 3U5TA 1ZA2A 1MIOB 1TQ4A 3JTMA 3N8KA 1A9ZA 4DLTA 5DGCA 3EIXA 2XE7A 1UK6A 3K6SA 1OJ7A 1PCXA 3ST7A 3D8UA 2J30A 2QRLA 3IUJA 3OEHA 3T99A 4JVLA 3IDOA 3AINA 3U3ZA 1HTTA 5DHTA 4DCOA 3LCJA 3GIWA 4MEBA 2DU8A 3WG9A 5H80A 5FUMA 1XK6A 1XQ1A 1KI4A 2B7CA 2AYZA 2MSNA 3C43A 3GJRA 3I2JA 2VNSA 3P4UA 1QUEA 1RRFA 4W1QA 1MHPA 2VSXA 1YASA 3DT6A 4XFDA 1GSHA 2DFPA 2H1CA 3IBTA 3SS9X 2HMVA 1JFFB 1V2HE 2BMEA 4PNHA 1NJ5A 1R0SA 1YDMA 2CDBA 2QSJA 4JJGA 4WNAB 4AFNA 2J4DA 2VQ3A 3OO1A 1XMVA 2IC5A 4NG4A 3GMDA 4PEVA 4Q48A 4XB1A 4Y2XA 2YN0A 3IR7A 4YCAA 2IK8A 3LV8A 4DG5A 5KOJA 3A1FA 1EDBA 2W4QA 1JQ3A 3QTBA 5GIOE 1MVNA 2UZ1B 5JE8A 1WAMA 3C6KA 3ED1A 5FPHA 1N8KA 4Q4LA 1V5GA 3ZY3A 1U1DA 1ILWA 2ZBGA 3M70A 5KTSA 3HDVA 1DWOA 3U3OA 3S6JA 3C5HA 3TW6A 5ALXA 2QRKA 4ZJUA 2IEAA 2BR3A 1JKJB 2I2FA 3WRWA 1H8ED 2H3EA 3HLYA 3IAM6 4UARA 2VPIA 4XIGS 1C3XA 3U4DA 3F7OA 3UN1A 5ECGC 4DCUA 3NAZA 5CNMA 1D2NA 3GZTB 1PWXA 6YASA 3ER8A 1HWYA 3KKPA 1MVLA 4WWHA 4YACA 2AOUB 3ACDA 2ISQA 2RG1A 4MV1A 2P4HX 2QL7A 4B45A 3ABIA 5ALTA 1QTQA 1LXCA 2QN6A 1IMJA 3PUVA 4CEJB 3P9ZA 1Z08A 3B51X 1ILEA 3L6OO 3AESA 4M7OA 3DCNA 1JG4A 4MR7B 2AQKA 4B4KA 3I5MA 3MGBA 2FFAA 2W7TA 1ITZA 1XXHA 2WHPA 3S1SA 4WGGA 3IBFA 4GNKA 1XL0A 5CXQA 1Z22A 2Q3DA 1FMJA 1RAGA 4GYYA 4TKZA 4Y2JA 3UA4A 2GCOA 3RIMA 5EYPA 4U0KA 3R77A 4ZU6X 4LF4B 3CVWA 2WD9A 5IKEA 3P4XA 4ZZ0A 2Y27A 1T9BA 3BBPA 3KUDA 3ABRB 4RK5A 3SSNA 3HP7A 4M98A 1IIBA 3BA1A 3J7TA 4QXAA 1QP8A 1MRNA 4RDIA 4TQ9A 1IY0A 3EARA 4Y2PA 5IDVA 3ZI4A 1GOTA 3ASYA 5EIEA 4IHJA 3AERB 3B85A 4YMUA 2VHCA 4M8NE 1M8PA 1ODCA 5CIQA 4LPKA 4RORA 1UXOA 3LBAA 3H2KA 4B7XA 4DIMA 1FXWA 3MRSA 1KEEA 3N2GB 3ZOKA 3PLAE 3HUEA 1TVMA 2VDLB 2PLFA 3O83A 1KFBB 1V1MA 2BHLA 4NYJQ 1OOEA 2OORA 3MS7A 4RH0A 2Z6QA 4JYAB 4YDSA 1QF6A 2E55A 2QUZA 1JDSA 1I7QB 4IUDS 1O7JA 3IMEA 1R74A 4YN3A 3W2GA 1NPTO 1BH6A 2EJBA 1BXKA 1Q92A 4Y9TA 2FDXA 1Z73A 5TT0A 1H6DA 2X3FA 4IHAA 4PX9A 4CM9A 1DTWB 3LC2O 1I51A 3U48A 1NMXA 3HDHA 4RTSA 3EEQA 4E88A 1XCGB 4LNUA 3TN7A 2JZCA 5J2UA 3A6LA 4Y9SA 5HMMA 3ZWCA 1ENOA 3C85A 5BWLA 4P7BA 1BKDR 3C14C 5H16A 5KWSA 3H04A 3BGWA 3AVYA 4D25A 3ANYB 2WEKA 2PD6A 4FBMA 1E9SA 1EG2A 1VGQA 2AFHE 4KQMA 2GXQA 4S05A 5SY9A 4BO4A 4IOJA 4P7KA 4GUDA 5HGXA 5DLQC 4P82A 3RWMB 3CG0A 3LWNA 3GJXC 1CRZA 1JXAA 4DZZA 5CB4A 5LP6F 1P7VA 4QTZA 4PLWA 3NWPA 1G5RA 1NM5C 2EQBA 4BFXA 1LZKA 2L82A 4YH1A 4WCVA 3FLBA 3B5EA 5ALFA 4B5LA 3SZGA 3N0WA 4PR3A 3GPIA 5BMVF 4Q4AA 3GEGA 1NFRA 2AMJA 2O0LA 2XDQB 4AULA 5T6MA 2A1TR 4CIVA 1P19A 3ESYA 4HDKB 1YJXA 2Z2YA 4TTJA 2BFEB 5EFZA 2QTHA 4TKVA 2ADFA 1LI4A 4G37A 4RAQA 2OD9A 2IYLD 3PRHA 4BRUA 1UK9A 2FX5A 3L93A 3EC2A 3ITDA 4NCHA 4P83A 1C9MA 3O0TA 4PQFA 2CHGA 4RHTA 4KQGA 3O82A 3U7QB 2DHDA 4OY3A 1UMDA 1WTCA 1EHCA 3DZHA 4JCCA 2YJ4A 2V1UA 4ALKA 3KTDA 1T36A 4UZFA 1Z45A 4DDMA 5F73A 1W87A 1XQWA 1GFWA 3O2QB 1I2MA 2R8YA 1I7PA 3CRW1 1KMMA 4LKRA 1EBFA 4MTCA 1K3UB 1UL1X 3NHBA 4EMUA 4FIDA 1RLOA 2CJYA 3KAQA 1SKYE 2X5OA 1YVDA 4Z1MD 1WB4A 1ZBQA 4F3NA 4IXNA 3N76A 1W4CA 4Q3DA 4RZHA 4CMAA 5IVHA 4G63A 5CVJA 2F2TA 2F3SA 5DBGA 3OY7A 2ZSJA 4U7DA 2CKMA 2VDJA 4RH3A 1U7XA 4GD3Q 4BFLA 1TT5B 4K46A 3RNOA 2D06A 2ODNA 2LW7A 4RULA 1APBA 4Q34A 1YL5A 2VCHA 1JIIA 5EWLA 1OXTA 3HM9A 4PLCA 2CFRA 1NVBA 1VBNA 2GCPA 1NAIA 1IY8A 2O48X 2PKQO 4G5GA 1N1GA 3QLUC 3TIFA 4FYVA 2YN4A 3UMVA 3BE8A 4CI0B 1G9XA 3I2FA 2V03A 2HHCA 5L9AA 5THQA 4FFNA 5B55A 2XTJA 3QVTA 4RKFA 4I8DA 4WDRA 1GNQA 4I14A 1WNTA 2XV1A 4U2FA 2Q3JA 2O2HA 4L3WA 1DARA 1WTAA 5ICMA 3D7NA 4YUXA 5AVXA 3FVRA 2EHDA 3OZWA 3VU1A 1EWVA 2DAPA 3CLRD 3WLFA 5DO9A 5C8YB 3MZ0A 3FWHA 5KJ1A 1U6KA 2EZ8A 3KSZO 3EFBA 4OAQA 1M1NB 3C8MA 1WU8A 4KOAA 2IDZA 1QVZA 1E18A 2XMQA 6REQA 2E89A 3SEAA 3SXPA 4XUGB 2C9OA 3FI0A 4G4JA 3N6VA 5JASA 1NKTA 5K2MA 4U4AA 4CM3A 4BO6A 3MJFA 1IONA 2P4EA 1YR8A 3OZBA 1FTQA 2PWAA 2Y93A 4GPTA 4S3MA 4PGGA 4R1PA 5C1PA 1MT3A 1Y1SA 4IDGA 4YS6A 3L84A 2JD2A 4C4PA 5G0TA 3HFJA 1A7JA 1EYZA 5M3BA 4HUTA 1AMNA 1EI9A 2E6UX 4BLOA 4X41A 1OH5A 2YOFA 4JELA 1VHQA 3EDQA 1P4JA 4TMXA 2NUTA 2P5UA 3COVA 4I4NA 1KXZA 4WBXC 3ND7A 1XCOA 2XEXA 3MJRA 5KJFA 1T9GS 1PV4A 1CZNA 2C8LA 3WNZA 1IRXA 3OFJA 5I01A 2OPBA 1JEAA 5G4KA 4PHGA 2GD0A 2ZIEA 3H97A 3PTLA 1ISRA 2JFUA 2DWQA 4QJ4A 3A7EA 3TLCA 4EW1A 5BW5A 1DIOB 1OA0A 3F2VA 3Q7IA 4OEHA 4CKEB 5DW0A 2V8BA 3ESZA 3JARA 3UWSA 4IJQA 1XD2A 2BGLA 1E6CA 2BOVA 3HM2A 3TL6A 4G67A 1L7XA 4O4HF 3ZU3A 1KRWA 4DUPA 3N3AC 4H3SA 2YMQA 2Z43A 3CX4A 2R8RA 3H5RA 3RIXA 4DY4A 1II8A 1TPYA 1SBCA 1BOOA 2IX3A 3AP1A 1DXHA 2F3PA 2HV9A 3QKSA 1ZVKA 1GKYA 2XF2A 2YJ5A 4HQ6A 4X0EA 3GW8A 5A4FS 3AHFA 3G2JA 2JIPA 3F9IA 2Q5IA 4Y1EA 3IAFA 3E9YA 1HDRA 1BDBA 3D4LA 3QPDA 4BO3A 1L5FA 2IPOA 2OKGA 4JVSB 4Q03A 1PT7A 1QGED 1YZ3A 4Q02A 5FLEX 2CHFA 1ZMRA 2X58A 1G7CA 3TJZA 1IOLA 3WHPA 3WLTA 2BGNA 2H9YA 4DUGA 1WOYA 4FEYA 5HXAA 1KGSA 3NOXA 3OCUA 1KFJB 2PLWA 1YULA 3H5WA 4MW1A 1CRQA 2OHXA 4MTLA 4O29A 5AJWA 1JR3D 5BRNA 4ES6A 1RRCA 5EIFA 1P3DA 4Z7QB 2YXEA 1F51E 5U4QA 4OX9B 3LH5A 3LUCA 2AD1A 3QVVA 1JKFA 4H7FA 4DIEA 2DHQA 3C1TA 4CR7A 4D5GA 4XEHA 1A9OA 4DKJA 1ESEA 4XWAA 3EA0A 4YQFA 3ZGYA 2B1JA 4HDMA 1R0WA 3O73A 1II9A 2BLLA 2OE2A 4EHLA 3OOYA 1VHWA 3JQFA 3ONFA 4O4LF 1CRWG 4LJKA 3UZUA