4TLEA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
218
Chain Sequence
EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPDLSALIERINYAIQKYRARRVSIDSACSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 78
structure length 218
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tleA00
1E79A 1XMJA 2I4IA 3GFTA 5AJXA 1QHHA 4S2EA 4FWTA 4PAMA 3BH0A 1PLLA 1NN5A 4XTRA 2P5TB 2CDNA 3THWA 3LDAA 3V4RA 1ELOA 2IYYA 4RZUA 5F9HA 1HV8A 4M1MA 1N6OA 1BMFA 1LFDB 4PQFA 4Z1MA 1Z83A 2P65A 1G3MA 2ATXA 4HUTA 5CLLA 2GZDA 4KCGA 2BDTA 1LTQA 4LBVA 4D26A 1XTKA 1F2UB 3EZ9A 2NTYC 4OQNA 1NSFA 3LO5A 2O8BB 2GJAA 1NVVR 4F92B 1E9FA 3CB4A 1KHTA 4YXWD 4D2IA 1U9IC 3C8UA 3CRRA 5A0FA 1KNXA 3OEHA 5EJEA 5KYKA 3QKRB 3L0SA 1WDTA 4PC7A 1V43A 3A1WA 3GLIE 1OIVA 2QN6A 2W2TA 1KO1A 4LJAA 4RJLA 1CRQA 4Q1AA 3MLEA 1P9RA 4DSOA 4HUQA 4TYNA 2QA5A 4C2TA 5KSYA 1GNRA 4QNMA 3FMIA 1E96A 3EX7C 4N1AA 4NZYA 4BE7B 4LX0A 2WMOB 2RGDA 2ZYVX 3K0FB 2PCLA 3GFOA 2QT1A 4WA7A 3FDIA 4E07A 3KXLA 1MO5A 2ZYTX 4BWYA 3WBKA 2X77A 4LK2A 3ADDA 3QXHA 1AM4D 1G8FA 3AV0B 3C15C 4L15A 3L0OA 3M4YA 2GEDA 4DVGA 2LWIA 1XPUA 2W2XA 1OIWA 2J7KA 1J2JA 3VHXA 1QHIA 1Z2AA 3AP2A 421PA 2I1QA 3X1ZA 4NONA 4Q19A 2QAGA 2A7QA 2IYXA 4K8OA 4NH0A 2QUZA 1FX0A 1KJYA 4QHTA 4TT3D 1RKBA 4CRWB 5IK2D 1AN0A 3TUZC 1OXSC 3IIMA 4M8NE 3LBIA 3RC8A 1KMHB 3AVOA 3TR0A 2JLXA 1L2TA 3KXKA 4HAUA 4O0MA 1BS1A 1KMHA 3IKJA 1RJ9A 3GLHB 2IA5A 1WMSA 3H2YA 3U3RA 4M1OA 4DEXA 3R8CA 2QORA 1T5IA 2ZJBA 1S0UA 3IQXA 2JAQA 3ZIAD 4Q4AA 3LD9A 1KO4A 2J0VA 3ZLJA 1G7RA 4TL6A 5FTKA 3IBYA 1S1MA 3IHLA 3VQTA 3QQ5A 4A82A 2J3EA 1ZW6A 3W5IA 1L4UA 2PBRA 3CRMA 5FTJA 3UKDA 2FGKA 4PC6A 3B2EA 4TSFD 5FPKA 3U7GA 3G0HA 1XMSA 2IEZA 2R6AA 3IQWA 3NHAA 3I62A 1GKIA 3HP1A 3NBXX 1S1CA 3LBHA 3CPHA 2R8RA 2QZ4A 3SEAA 2PLFA 1ZCAA 2IS2A 4ASUD 4BEBA 1X8JA 3C7KA 1ANKA 4C0JA 3C4JA 2CCJA 1MO3A 3SJZA 1WRBA 2VSFA 2DFNA 1W2GA 4NDZA 1CKEA 1R0YA 4LY6A 3DO6A 4RFSA 4UJ5A 2B6HA 2C78A 5FPTA 1R0WA 3K9NA 1ZMXA 2DBYA 1M2OB 1HQYE 2OBLA 4RFSB 5DIFA 3H0KA 4MDFA 2J9RA 2F9MA 1GDDA 4O2LA 3OEHD 4QHSA 1SXJA 2NO7A 3LXRA 2R6GA 4V03A 3OZXA 2ONJA 1WA5A 2H7VA 5HZKA 3W3ZB 4OQMA 1HYQA 4JLBA 1JPJA 5DYIA 2AHOA 4BECA 3BFKA 3QKRA 2OFOA 3PEUA 3O8DA 4I1OA 2WV9A 3SE0A 4M9ZA 5C4MA 2D2FA 1XEFA 4A6PA 3R8FA 1PJRA 4Q4HB 2RAPA 2GJKA 4US0R 4DHEA 2GETA 4MRPA 5K8LA 2J46A 4AG6A 4UNSA 4B3CA 1TQ6A 1Z5ZA 3OE7D 1XJ0A 2QE7A 3QVVA 1M74A 4PC1A 5DN6A 4CT5A 4URYR 5AR1A 3THYA 2J0QA 3TAHA 1FL9A 2CNWD 4Q9JA 5AUQA 4AYTA 4KVGA 4OK5A 4ERNA 1II0A 5TARA 2FEMA 1AQYA 1HY3A 3BXZA 1DARA 3A1TA 1AA9A 1M34E 1XEXA 1UKYA 2YC2C 5KNCA 5F3WB 5GJBA 1N0VC 2ERXA 4WXPA 5IK2A 3WBJA 1E0KA 1Q1QA 4KO8A 5IHPA 2REOA 4TLBA 1KSFX 2Z4RA 1LF0A 1D2NA 1XTRA 4Q9KA 2KWIA 4RKEA 2ORIA 4BRUA 3ADBA 1COWD 1SVMA 3AVQA 1XMVA 2FSGA 4KSCA 1JEDA 5HE8A 2A9KA 2C8VA 2RGGA 5LB4A 3LVRE 3KFXA 4P3YA 1IBRA 3AVUA 3VKHA 5BN3A 3ZS9A 2Q3FA 1IOZA 4LUCA 2VF8A 4TLAA 5CIQA 4LGMA 1TADA 2JLWA 4JIMA 3C5CA 2JJ8A 3B1ZA 4GBMA 1NMZA 4IVPA 2JLQA 1DAGA 3THWB 3BGWA 1HEIA 3MCAA 1Z07A 2X1VA 1XCMA 3RS4A 3X1WA 1UF9A 4A0FA 4ZCLA 4XD7A 2KBFA 2SHKA 3X1DA 4NMMA 4ZPXA 2ZI5A 3QPUA 2AN9A 4Z1MD 1NN1A 3BRWD 4D4LA 2ZTSA 3OIUA 2V4ZA 5JCPA 5D3QA 3TIFA 4BLOA 4QG7A 3Q5EA 4NU0A 2ZXUA 3W34A 1JBKA 1W49A 4QBHA 3FFAA 1E2HA 1BYIA 1P60A 1XCPA 3ZVRA 4OQXA 3FHOA 3WP0A 5JHGB 5EE0A 3R20A 4HLDA 4PPGA 3WMGA 1ZM3A 5FFMA 2ZJOA 2F1HA 1E94E 2QMHA 1JR3A 1W0KD 1NBME 2C9CA 3S1AB 5JWRA 1Z6TA 3FWYA 4O3MA 1Z6GA 1VPLA 4R9UC 1UKZA 4O2RA 2QG6A 2FGJA 1RRFA 3WMEA 1Z6YA 4G5QA 3BERA 3GLIB 1TX4B 2FSIA 1YR6A 2WOOA 5EE3A 3FTQA 2ZVQX 4O25A 2R6FA 5EZ6B 5FUWA 5GJWC 1KSGA 1YZKA 5EP2A 2H1LA 2ZS9A 2ODBA 2YINC 5JCZA 4ZIRB 4L4UA 2FSFA 3BC1A 4QL3A 3EZ2A 1E1RD 4D0NA 1MT0A 2QMUA 2DWQA 1E6CA 4FD2A 5DI9A 3L0PA 2XJ4A 3Q3JB 2IYTA 2FDCA 1FW6A 4JT4A 4AKGA 1HE8B 1XEWY 3W90A 1CRPA 3SHWA 4LYJA 3C14C 4IFEA 4PX9A 5KU1A 4TLEA 1WBBA 3DHWC 4YMVA 4UXHA 4PPQA 3JVVA 4BLTA 3DOEA 4PSVA 4DT1B 4GFDA 3HU1A 3OF5A 2CHQA 2LKDA 1IN6A 3K0CC 2V54A 1S3SA 3PUZA 4RD3A 3MAAC 2BKEA 5A5GA 4Q1CA 2RGAA 1PVOA 221PA 3N2IA 3RSOA 5CYOA 5GJCA 2TMKA 4G5SA 4IOLA 2C99A 2ECKA 1RFLA 3ZIAA 2C9YA 3QF4B 1GVNB 2HUPA 2WAXA 5TV2A 5KUTA 1CJUC 2WIAA 1CTQA 1NVXQ 3SOPA 5C46F 4NYJR 1KJZA 2PL3A 5LB2A 1G4UR 2GA8A 1G7TA 5JS8A 1E1QD 2FE4A 3ZZ0A 1RIFA 3OFNA 3QI2A 3PV0A 2R44A 1K5DA 1F5NA 1KAGA 1NN0A 3I73A 3PUYA 2OAP1 4DC9A 3SU8A 1SHZA 2FH5B 2WAYA 1UBEA 2ZJAA 2V1UA 721PA 4BGDA 2WWHA 3CM0A 1Q57A 3SZRA 4M21A 4UQOA 3NC0C 2VP9A 5K8TA 2JEOA 4XVUA 1CF4A 3PCRB 4KU4A 3IBGA 2G9NA 1Z47A 3AM1A 3VR1A 1FTNA 4GZMA 3S1AA 4F38A 1W4AA 3GJ3A 4IEIA 5FUYA 3GLHA 4MITA 2GZHA 3K53A 2HV8A 2K5UA 3TBKA 2OZEA 3ETLA 3UANA 1K8RA 1U94A 4II7A 1FQJA 4QBFA 2FU5C 1GAJA 2Q3MA 4IDQA 1G18A 3K70D 3KQLA 3GEIA 5EP3A 3FMFA 4ZDJA 3PEVA 5JWOA 3BH7A 1CR1A 2DFKB 3VR4A 1JXMA 4LV6A 4TTRA 5B2ZA 4BQSA 1E2EA 4M1WA 1NVWQ 2ZE5A 3RANA 4MYCA 3U60B 1AZTA 1VDZA 4L5BA 3EA5A 1P75A 1QVAA 2F3RA 2WWIA 2BJWA 2ZU0C 4UNRA 4L16A 1VCMA 4LBZA 5B30A 3H86A 2A5JA 1YZQA 1WP9A 2UVQA 4NYIQ 1VHTA 2BMFA 3MMPA 3SN6A 4IW3B 1VG9B 3P1JA 1E1RA 3KJEA 4D25A 2RGCA 3DKVA 3ZD6A 1U8ZA 2FPMA 4DSNA 1XJCA 2ZI4A 1H8HD 1G8HA 5FPYA 3TAUA 2NPFA 2ZIAA 1E4YA 2BBTA 4NKRA 2F3TA 4YLGA 3SFZA 1NN3A 4A0GA 2CE2X 3E70C 4ITRC 5CB8A 5JSZB 3I5XA 1W0JD 1GKUB 3HR8A 4DSTA 3QSYA 4JLKA 4QBGB 3KB1A 4FIDA 1KOFA 3QVUA 3WY9A 1I4DD 4Q9HA 2X19A 4QJ4A 4HZUA 4QGAA 4B3DA 1E9RA 2OT3B 3QXXA 4D4KA 1E2JA 5SZIA 3A1SA 4A9AA 4DIDA 3QNUA 4NE2A 4HLUA 1T0HB 1DAFA 3B5JA 4LJ5A 2JCSA 2VLIA 2YZ2A 4HYYA 3CNOA 4GMXA 4IOJA 5DH9A 1N5LA 1QRAA 2ZPTX 4HAXA 2HT1A 3L0IB 2ODNA 4M9SA 4Q1FA 4CZ2A 4E5UA 5AUPB 3NEJA 4JLAA 5JFGA 1U9IA 5CM9C 4DLXA 1WBDA 3EW9A 4PHTA 4M9QA 1VCNA 2VP2A 1D5CA 4JL8A 1D9XA 5AK0A 4EPTA 5FUVA 2F1JA 2OAQ1 4R98A 1R7RA 2C95A 1OT3A 1E1QA 1P6XA 3SJBA 1GRNA 2ODEA 2MSCB 4LSGA 3REGA 3P4YA 4A0RA 1GZSA 1XD2A 3LAWA 2YOHA 4H1VA 4TT3A 1IHUA 2XEXA 3F3YA 3KKNA 2ZE6A 2ZITA 5CDFE 3UG7A 2FSHA 1R5NA 2WHXA 1N6HA 1A5TA 1U0JA 2YV5A 1GTVA 2PJRA 1II9A 1E2DA 4B73A 4AI6A 1D6JA 1XTJA 3PR1A 5BYKA 4JLJA 1LW7A 2YWHA 1SHKA 2JLZA 4Q03A 3VMFA 2G83A 3ASYA 4G5OA 2GCNA 2ODWA 2W6JD 3WP1B 4ACBA 4B2LA 3GLGA 5DGXA 4FCWA 1QDEA 2XTZA 3NC1C 3WNCA 1XD8A 3HPRA 4GDFA 1FUKA 4D0LB 5IDVA 3QKSB 4DDVA 1F2TB 3Q8XB 5L3SB 1UDWA 2QROA 2QAGC 2ZRJA 3VU9A 1Q1EA 1QHHB 4Q7JB 1DEKA 1NIPA 1AQUA 4EUNA 3GJ4A 5B64A 1QHSA 4NHOA 1MH1A 3H1TA 4DDTA 5DSZA 4B74A 4HLCA 1KJWA 1US8B 4PSKA 2DY1A 3U6BA 1E79D 1MKYA 2PEYA 1JEEA 1B0UA 2R9VA 4Y0VA 3ZDQA 2BBWA 5JEDA 4ZCMA 1AIPA 1NY5A 1D2MA 4LRWA 2F6RA 4ABYA 3BE4A 3L43A 5FBLB 4FN5A 3V9PA 2XZOA 3F5FA 3NH6A 1DELA 2OXCA 3T5GA 8OHMA 2H57A 3TGPA 3VR6A 5G3ZA 1CXZA 1KI1A 4TQ9A 2O52A 4RZ2A 1G3UA 1W44A 4I99A 4JBXA 2WWFA 5GVSA 1GIAA 3TKLA 4DLSA 4A36A 3EASA 1A7JA 1Y3AA 4W5WA 3T1QA 4X8MA 1N6NA 1TUIA 1Z08A 4Q48A 3BAFA 3GD7A 4NPHA 1RYHA 2GCPA 4UXIA 5FBQB 2C2HA 2JA1A 5FPSA 1X8LA 4DJTA 3HR7A 2BV3A 4GOJA 4B48A 4JVLA 1BOFA 2BBSA 4TYPA 3MRSA 4BZQA 3HDTA 1EG7A 2GBLC 1VECA 3WRYC 1IXZA 1XD9A 4JSTA 4TLDA 4KVAA 2IS6A 2ZI6A 2AKAB 3AEZA 2FWRA 4D6PA 3FKSD 3LA6A 4JT2A 1CJTC 2H5EA 4GI7A 5SZHB 1F3OA 1SXJC 1G21E 1AGRA 5J5CA 3LY5A 5CB6A 2AFIE 4KBGA 5L3QB 2LKCA 1R8SA 3QBVA 2R6CA 4JJZA 3CRQA 1Z0AA 4DUGA 2PH1A 1NKSA 2G88A 4GT1A 3PENA 5DHAA 4DLZA 1GL9B 1RVDA 1K5GA 5G3YA 2GVDC 1JQJC 4NCHA 4JLNA 3UWOA 3C5HA 2IX3A 1AS3A 1ZM9A 1SVOA 1XF9A 2OEPA 3DM5A 3HPQA 4B3GA 2GCOA 2OHFA 5KDDA 3KB2A 3I1FA 2WWWA 1IN4A 1FNNA 1EK0A 2QM7A 1TL7C 4JVMA 4XD7D 2X8AA 2VP5A 1OPXA 4G1UC 2AD1A 2YWEA 4GP7A 4M9XA 2OCPA 5BN5A 2ZR9A 5FI1B 5KSPA 1MABA 4PFSA 3CX6A 2OILA 4LV8B 2O8DB 2BEKA 1I4LD 1SVWA 2OXRA 3B78A 1GL7A 2DYKA 2VHTA 1G4AE 3HJNA 4KYIB 4Q4AB 4TLCA 1NLFA 3RWOA 4RD6A 1Z06A 1GILA 2EFEB 4TL8A 3UIEA 4LC1A 1G8YA 2VA8A 5C2JB 5JI2E 5HPYB 2RHDA 3VKGA 5KSZA 2CCGA 4B75A 2GAOA 4OHZA 1S96A 1U2RA 1ZM2A 2D4HA 3CLVA 1U0HC 2GEUA 2GVZC 4D80A 1WE2A 2EVWX 4FMCB 2XOKA 1W0KA 3C41J 4C3ZA 2RCNA 2PLRA 5JS7A 3QKUA 5BWMA 1KI9A 2C9OA 1ESMA 4KFTA 3U7EB 2YJTD 1JNYA 1OKKA 3HWSA 3QPWA 4HAZA 2QGZA 2R2AA 5KO2A 3CUEF 1VYUA 2QQ0A 5AJVB 4DCTA 5H68A 4FCVA 3AB3A 3N70A 3K0SA 1T5LA 1A2BA 2Z6VA 2RGNA 3PVSA 4LJYA 3PUXA 1WQ1R 1N6RA 5J40A 5FH9A 1NLYA 4AIIA 1OSNA 1A82A 4Q01A 1G3RA 3IPXA 2NZ8A 2A30A 5HCNA 5LDDC 1ZNYA 1HTWA 2QTFA 2YC4C 1VIYA 2W6IA 2VHUA 1WF3A 3GLHE 4DZZA 1EFTA 2ZSFA 4TMXA 5TB5A 4DXAA 1L4YA 4W9MC 2JASA 1CULC 3QKSA 2CK3D 4EPYA 1E2QA 1J90A 4Q4HA 2A5GA 5FL7D 3BB4A 1E9SA 3LWNA 3BK7A 4N0EA 2AFHE 4CDGA 1L8QA 3IDQA 4RZ3A 3GFPA 5G41A 3ADKA 4FMDF 4LV5B 1KZGB 2V9PA 4DDWA 2O0HA 1JB1A 1G41A 5ELXA 4TYYA 4WZBE 1DADA 4M1YA 2CLSA 5GADl 4HLQB 2C96A 4TN1A 1N5JA 1Q1BA 1NNEA 4BEJA 2E1RA 2FZ4A 3U3MA 1R0XA 1T3SA 2WKQA 1N6PA 3ZS8A 2RH5A 4HDOB 5FI0B 1W48A 1G9XA 3MGCA 3QF4A 2XNDA 3FVQA 4JLMA 2CNWA 1W2HA 3UMRA 3D3QA 1RRGA 3K0AA 1X1SA 2G6BA 2NZJA 5FBRB 6Q21A 1OXUA 5EZ5A 5EP4A 2WIBA 4I1VA 5EXTA 1AZSC 3LLMA 4RZXA 3KTAB 4P4TA 3CH5A 1XTSA 1NMYA 2QI9C 4HEJA 2WJVA 4URWR 1OFTA 2FEOA 5FOXA 4L8GA 4LI0A 1XDBA 4M2LA 5CLQA 4KBFA 4Q7MB 3TMKA 1S8FA 4LBYA 2VHQA 2ZR7A 1DO0A 4PANA 4UNQA 5AUOB 5KSOA 4WXRA 2O8DA 5E7JA 1BIFA 2QAJA 3DZ8A 3K0CA 4YMWA 4YMTA 2GK7A 2CJWA 3RS7A 2V6JA 1ZCBA 3TH5A 2R6DA 1M8PA 2NO6A 1JR3E 3O8BA 4B6FA 3T1TA 2YWGA 1NBMA 4PZZA 2J7PA 2AD5A 3CPJB 2J45A 2XX3A 2AK2A 4KAXA 1G7CA 5SZJA 3LW7A 3V00A 2E87A 2BKUA 5C1BA 5KPJA 1TQDA 3X2SA 4GOKA 1AJEA 4MGZR 4FMCF 2OESA 4OQLA 4QXAA 4XWAA 1MO6A 3WYFA 3ZZTA 1ZP6A 4PPFA 4BASA 2BC9A 4C0QC 1P9WA 5CK5A 3ZQ6A 3LVQE 3RVBA 2FJUA 5FR2A 2G77B 2FFHA 3I32A 3LXXA 1EFCA 2B21A 2RGXA 4WZAE 3KKOA 1UEIA 2ASEA 2PZEA 3ZZUA 4F4IA 5IT5A 4PC3A 2VRWA 3O47A 4EJSB 5J4LA 4B34A 4N0DA 3A1UA 2VQSA 3QG5A 1IN7A 3KL4A 4I81A 4M1SA 1CLUA 3FKSA 3H84A 3T12A 2HJGA 1FZQA 2WBLC 2Q9BA 3CW2A 2GJSA 4J0QA 2HLDD 1P61B 3W5JA 4B76A 3P27A 4HB2A 2BWJA 2Z0MA 1I2MA 4YC7A 1VG8A 4BFVA 3UK6A 3DDCA 3GJ0A 1E2MA 1H8ED 821PA 4DSUA 2VPPA 4MRSA 1A1VA 1HA3A 2FF7A 2KSQA 1R6BX 2XXAB 4ON9A 1QHGA 3ND9A 4ILEA 1M7BA 3EWAA 5EE9A 2IYSA 4DLWA 4Q5IA 2D74A 3VR5A 1N5IA 4HDCA 1S2MA 3E5HA 1KK0A 1VTKA 3BBPA 2KB0A 3FE2A 4Q7KA 1M1YE 4CEHB 4A92A 1SKYB 4US2R 2QSYA 5H1YA 1DTSA 3VTKA 3AVYA 2ZRBA 1XEWX 1BO6A 2GK6A 2GXAA 4X8HA 4A8JB 2A78A 3FMOB 2ZRHA 2IHYA 3K70B 1T6NA 3CONA 2ZRDA 4MYTA 4RY2A 1D9ZA 1N6KA 3AUYA 2OE2A 1TEVA 3OAAD 2FX3A 1KIMA 4OYHA 1ONBA 2QRNA 2H17A 4HLUC 4TMZA 3TE6A 2J0UA 2JJ2D 2IS4A 1UAAA 2JDIA 2W83A 3HYRA 2VSXA 1P2TA 1KZ7B 2BEJA 5EQTA 4NYIR 3C16C 5KNDA 4ZDWA 1OXVA 4QGFA 2RHMA 4WVFA 2JLVA 4JS0A 2IYQA 3U2QA 3SQXA 1JAHA 2QPAA 4DLUA 4A2PA 1WXQA 4Q02A 3GLFB 4U5XA 1L7VC 1KSJA 3R9IA 4CW7A 2H16A 2IUSA 2JGNA 1ZD8A 3RHFA 1XPRA 5E7IA 1E9AA 1GITA 2GDJA 4BFTA 3K0AB 4KITB 4RFVA 4P0TA 4P33A 1KAOA 3DMDA 1N6LA 1CU1A 2IYZA 4A1FA 3W8NA 4RVCA 4CEJB 4AYXA 4GMDA 2XZPA 3PIRA 3FFBA 3G5UA 521PA 1DAIA 3U61B 1R0ZA 4XSGA 4GP6A 5H70A 1YQTA 2QPTA 5DHFA 4C0HA 2F55A 3OIWA 2VH5R 1ZBDA 5JWHA 4AURA 1ZNWA 3GJXC 1UBFA 1JALA 1YR9A 1TQ2A 2ZUCA 3GJ6A 4TYQA 4W5HA 1YU9A 1EX6A 2J0SA 2WZQA 2O8CB 4B47A 4G0NA 5P21A 1XU4A 3LQRA 2Z83A 1E2FA 4QM7A 1O3YA 5FPHA 1NVUQ 2QENA 1T8UA 2OBNA 4WIAA 1E4VA 1Z8FA 2QGNA 4R2HA 1M7HA 3D8BA 3Q7PA 4IVRA 3CF0A 3AUXA 2IW3A 3AF3A 4Q1DA 2GRJA 1ZD1A 2VP4A 4X8LA 2MSDB 2B8WA 4B44A 2JATA 4TL9A 1Z22A 1YR8A 4XVQA 4KSBA 1UJ2A 3U3OA 1YE8A 2ZE7A 2FV8A 3A4NA 2QTVB 2B8TA 4QKQA 2WICA 5EE5B 3WHLA 4JL5A 1Y63A 3GQBA 3NWJA 2GAAA 1X86B 1RW4A 3THXA 5JMTA 2WPDA 2N42A 3NBZC 4OI2A 1E98A 1TF5A 5C4GB 3CRVA 4I1UA 4A6XA 5KDOA 1J8MF 2J59A 2IEYA 3OEEA 4AKIA 1E2GA 5CJPA 1P72A 3I72A 2Q9AA 1P7CA 2GCOB 4YMSA 2HXYA 3T15A 1VKJA 4RD4A 3GJ8A 1E2KA 4DWJA 1NP6A 4CYMA 1ZUNB 3UATA 3ZQJA 4GZLA 1XZQA 1EFHA 1R4AA 2O8FB 2WJGA 2ZAMA 4IXNA 2J7PD 4UKDA 3V4FA 3ZVNA 2GBLA 5F2EA 1M7GA 5CITA 5J4VA 1SVSA 4PO9A 2P6UA 4URVR 1FMLA 3EIQA 3UMFA 3GLGB 2PT7A 2ZAOA 3KTAA 2DWPA 2NO1A 1NJFA 2ERYA 5FTLA 2A5DA 2XOKD 4CEIA 5J4KA 2AWOA 2WSMA 2XB4A 1N6IA 2V7QA 1MOZA 2QP4A 5LD2B 1G64A 1ZVQA 2XSZA 4JLDA 3QUSA 4MQBA 1TTTA 3QENA 5FR1A 3FPAA 3ICEA 1EESA 3SJAA 1GL6A 4KFSA 3DPUA 3NIBA 1A2KC 2W6JA 3GCGA 4XSHA 3SBDA 3EPKA 2ZETA 4Q66C 3K09A 4N3NA 3FHCB 4AKEA 4BFYA 1ZUIA 4EIWA 1KO8A 3VX3A 2OCYC 4Q7LA 3PG5A 4FCTA 4C0KA 2B7BA 4KODA 2F43A 1F2UA 3ZH9B 2YWFA 1KI6A 3R7WA 1CJKC 3K1JA 4TMKA 3UPUA 1T8TA 4CIDA 1Q44A 4C30A 5B58C 2CHVA 2WTUA 1J99A 2ZQ5A 4FXPA 2IYLD 3RLFA 1PLJA 3A4LA 5E3HA 4XWOA 2QT0A 4K46A 3DOFA 1MV5A 3BS4A 1N25A 3TSWA 4DCSA 4C2UA 1KDTA 3X1XA 4KI0A 5AWFC 2QP9X 3CH4B 5F98A 2EFCB 3MWKA 2CCKA 2JJ1A 2ONKA 4NL4H 5GVRA 5KOYA 4IFBA 3G82C 2HF9A 1PUIA 4Q9IA 1G17A 1NSTA 2D06A 1SKYE 2PMKA 2PMDA 1KI3A 2G3YA 3RC3A 4F4JA 2Q21A 5EP1A 3AF4A 1Z0FA 2RKOA 4BFZA 5KPDA 4PO8A 2GJ8A 2ATVA 4Q47A 1UEJA 3CF2A 4HZUB 3QEJA 3TR5A 3BORA 1E9EA 4XWKA 3EPJA 1NKTA 2CK3A 4EFNA 3WMFA 4EQ6A 4NBSA 2A5YB 1WCV1 4P4SB 3TRFA 1VYVA 2OSBA 4CEJA 3DMNA 1II8B 3NBFA 1DOAA 3GLFE 1GUAA 1OYYA 4HI0E 5JECA 1COWA 4KFRA 1KK1A 5BN4A 1CIPA 5L3QA 1IXSB 2V55B 2RGNC 4D4JA 1T3HA 3ASZA 2GF9A 4JVSB 3WNBA 2DCUA 2NG1A 1YKSA 2FNAA 4ZI2A 5JEEA 2V8OA 3A4MA 2QMOA 4Q4JB 3GPLA 3HU2A 1PLKA 3NHBA 4H1UA 3REFA 3K8YA 4ZKDA 1WB9A 1W47A 1GRQA 3OIVA 4UNPA 3K9LA 2IUTA 4DBLC 1S4QA 4MRNA 2FG5A 1U0LA 3KX2A 3ZGXA 4TL7A 3VU9B 2L0XA 2W58A 4B35A 1CR4A 4G5GA 2D2EA 1V5WA 2WVJA 3ZVMA 4ASUA 3QIAA 4DLTA 4MUAA 1W4BA 3LH5A 1W36D 1U8AA 1CJMA 4IDPA 1HE1C 4MA4A 5BYJA 3AKEA 621PA 3SQWA 1NG9A 3MWYW 1OH7A 2VEDA 1G5PA 2NO0A 2IT1A 2QMEA 3EA0A 4KXFB 4TYWA 1OJLA 1DG3A 3NDBB 3T5DA 2O8FA 1GSIA 2C5LA 2IK8A 3WYGA 3NDPA 5BXQC 1FX0B 1AGPA 3JZAA 2IL1A 3D7MA 1GNPA 5JI3E 2IF2A 2ZREA 5L3RA 5TY0A 2IXFA 4TSFA 2ORWA 4BUJA 4ZI3A 4Q21A 3RSLA 3EZ6A 5E95A 5L3VA 2ZSAA 1RRCA 4OL0A 4OHWA 3AP3A 1EWQA 1EFRD 4MUBA 3KXIA 5HR5A 1C9KA 3LBNA 2Z43A 3M1IA 1HQCA 2JJ1D 1IM2A 4PTLA 4MKIA 4W7SA 1W46A 2BMEA 2WOJA 1ODFA 1TNDA 2W0MA 5EXXA 2ANCA 2C98A 2AX4A 4GOXA 3AH8A 3SYKA 4XTCS 5A4JA 1IQPA 1AKEA 2JLUA 3RS0A 4POAA 1OB5A 4HAYA 1XXHE 2FOLA 1S3GA 1Z6XA 3QKTA 4XVRA 5JRZA 1OH8A 2OO7A 2XITA 4FW9A 5LD2C 4V02A 1ESNA 3ONWA 1LNZA 3OHMA 2QRZA 4NCKA 3UWKA 2X2EA 5CYPA 3GJ7A 2W6ID 3W6OA 1RC8A 3QJYA 4PSAA 4QFMA 3LX5A 1VYTA 1XP8A 2BMDA 5CM8B 1KI4A 2OFXA 2ZANA 2ZRPA 2GILA 3KUCA 2WWYA 2P6NA 3CIOA 5GJVC 4AWXA 2VF7A 4Z8XA 3SR0A 2R62A 3JZMA 2REXB 4A8JC 1CP2A 2R65A 2EYUA 2QEQA 4JLPA 4ACAA 4JYCA 4MYHA 3PEYA 4EDHA 3T35A 3TNFA 1XX6A 4BFWA 5KHOC 1ZU5A 4RD1A 3KDSE 1VIAA 2Z5FA 4LCBA 4GNKA 1OXTA 5L8VA 3VAAA 1SQ5A 4PR0A 2W2VA 1IJEA 4P31A 4URUR 4LYFA 1QZXA 1Z29A 3OAAA 2WSSD 1S9DA 4B33A 3FYHA 1MO4A 1XMIA 2QL6A 1F60A 4Q1BA 1XRJA 3A1VA 1EGAA 3R9XA 1KK2A 3B7GA 1E2PA 1SGWA 1OLOA 3UG6A 1Z2CA 3W8RA 3QXJA 1ZM4A 1US8A 1XCGB 1FTSA 1CR2A 3SDZA 4ZIRA 4BLSA 4QM6A 3OESA 4PXAA 4ZCIA 5LBIA 2H8KA 3CNNA 4B43A 1OFHA 3EPLA 1N5KA 1KO5A 3MD0A 2BIFA 4DCVA 3NG1A 4HAWA 4LJ6A 4CF7A 1YRAA 2DPXA 2NPIA 3CPEA 2GWHA 3KKQA 3KKPA 4LPKA 4BRWA 4PZYA 1E99A 1G8PA 4G3XA 2IHBA 2KE5A 2BM1A 4HSEA 4JKIA 3W6NA 4TMWA 1TEXA 4URZR 4OKSA 4PO1A 2PZFA 1KI2A 1Q3TA 4LPSA 3VNUA 2HT6A 5E7MA 2ZRCA 3EIHA 1NJGA 1GP2A 3PUVA 3CR8A 5FOUA 4HB4A 3RWMB 1NBMD 2IF0A 4KJZA 4NCJA 4HDQB 2OG2A 2IC5A 3EC1A 4G5RA 4E09A 2HDNB 1HT1E 2Q3HA 1Q22A 4NYMR 3AF0A 3R9WA 3QG1A 3RRNA 3FKQA 2IYUA 4FINA 1EWRA 3AF2A 1AKYA 4B32A 1P2VA 1QHXA 2XTMA 1SXJE 2VHJA 1NI3A 2W00A 5DLQC 2KJQA 1E3MA 4TQAA 2WJJA 3W6PA 4ZV4A 5TXGA 4FMBB 2Q6TA 5JLJA 4TZ6A 2D62A 2BMJA 4EPWA 2YKGA 3KQUA 3PFIA 1JQLB 2VHCA 1N3BA 4OK3A 3Q9LA 2QU8A 1W7AA 2J1LA 3CBQA 3ZYCA 2ZJZA 4M53A 5DI3B 4ESHA 4JSYA 2OBMA 5EXPA 2ZUBA 1RE0A 2A5FA 4DIEA 4ZDKA 1DG1G 1U99A 1P3JA 2KBEA 3MG9A 1W36B 2CVHA 2OUKA 3SI7A 4M4SA 2HXSA 2DR3A 3TW4A 1VCOA 2GXQA 5JZVA 1UDXA 1TU3A 3RS5A 2CVFA 2PX3A 1UKVY 4D4MA 3K70C 2GKSA 3D6TB 3K0FA 2OLKA 3AF1A 5J4YA 3L82B 4LHXA 3WXMA 1DS6A 2BOVA 2IWRA 1H8EA 4DLRA 5K8UA 2WWGA 1LY1A 2XGJA 2FPKA 2ZEJA 1SVIA 3IGFA 1YZNA 1DO2A 2GNOA 2YHSA 3I8SA 4P4UA 3N2EA 3CKLA 1T9HA 1XBTA 1PV4A 1JECA 1TU4A 4ZO4A 4C4PA 2VP0A 3MWJA 2QY9A 1IN8A 4JBWA 3VR3A 3IILA 1VCIA 3MFYA 3T1OA 5E4FA 2OLJA 3UXMA 1CEEA 1PZNA 5EUMA 1ZUHA 5HKKD 4G01B 2QQEA 3NKVA 3DM9B 4LHWA 2XTNA 2HCBA 3B13B 4IVQA 1JJVA 3LFUA 3LV8A 4AKHA 4PAOA 4CEIB 5JSZA 1DPFA 1U90A 4M22A 5L3SA 2RB4A 4D82A 4QC2A 4OK6A 1CR0A 3B85A 4MGIR 4XIGS 1TF2A 4UNNA 4V0OA 1G16A 3WRXC 3QE0A 1C1YA 2ZSDA 2ZRIA 4IKEA 1OF1A 2P3SA 3EZ7A 4Z54A 2ZROA 4F7WA 4W5JA 3LX8A 1GWNA 2AWNA 3KJIA 2ZRAA 4QOSA 3VFDA 5JHHB 3AKDA 2C04A 4Q4LA 2A3RA 1G8GA 1II8A 2BJVA 3NEYA 5TMPA 4FMDB 4PC2A 3RAPR 2RGEA 3Q72A 1M6NA 1KI8A 4OHYA 2AK3A 3T34A 3FMPB 2OCAA 2QNRA 4DDUA 2G1JA 3TQCA 2ANBA 1NF3A 1FP7A 1AS0A 3IIKA 4DCUA 3A37A 1B23P 4KLZA 2XXAA 1OB2A 1GKYA 1W4CA 5JJIA 3FOZA 4BLPA 1XEXB 1Z0IA 2ZRKA 3GEHA 2F43B 1E69A 1IN5A 3TVTA 4IXMA 2W0SA 5BW8A 1TPZA 1GRRA 1KY3A 4FWIB 1OHHD 4OI1A 4OHXA 2YVUA 4RCYA 4IOMA 2FFAA 3KJHA 1W5TA 3MJHA 4OJQA 1JJ7A 2CL0X 2XNDD 4HB0A 1H8HA 4LJ4A 3K09C 1P73A 3DL0A 1E2IA 2ZE8A 4MGKR 1E0SA 3BB1A 3MJRA 3BOSA 4MH0R 3KJGA 2FMXA 2JLRA 2RGBA 3DKPA 1DBSA 2WKPA 1G5RA 1YHNA 2LCFA 3AVPA 2BHRA 4Q9LA 1QBKC 2WSSA 5AJWA 4CGZA 4JMPA 1IXRC 1E2NA 1W5SA 1OH5A 2EQBA 4DLYA 2AXPA 4LOAA 1E32A 5D3MB 5IRCD 4DB2A 5J4HA 3WHKA 4DRZA 2CHGA 1J7KA 4V0KA 1FOEB 1FFHA 2EYQA 1E0JA 2GXSA 1YVDA 2F7SA 5M04A 1F48A 5HKKA 4BZXA 3KQKA 5FL3A 3FHTA 1G6HA 4F93B 2VO1A 1MRSA 3U7FB 1VMAA 4WAUA 4K81B 3SBEA 2XB2A 1ETUA 3EIEA 5CIWA 2CEAA 2ZSEA 3CF6R 4BFSA 4BZPA 1XPOA 1KDOA 3PITA 2VSOA 4UXJA 4PHHA 1BYUA 1LS1A 4EKDA 4V0ME 5DE3A 4BLQA 4YONB 2J0UB 4XOIA 4F91B 3H4MA 3LQQA 5JRJA 1SZPA 3U3KA 1G6OA 3CNLA 4DEYA 3BWDD 1BKDR 3BJIC 4LBWA 2IUUA 4IDHA 3UMSA 1YZLA 2BVNA 4IRUB 2I3BA 4A0HA 3SYLA 5FUXA 1IJFA 3GP8A 4URXR 3P26A 2ZRGA 2X2FA 2H92A 3DZDA 2PCJA 3QEOA 4DCNA 1ZNZA 2VBCA 1EFRA 1O87A 3U4QB 1T3LA 2YOFA 3B1VA 3TK1A 2OM2A 2B92A 2P2LA 4LHZA 5BQ5A 4EJSA 2D7DA 1XXHB 2JLYA 4E03A 2GTPA 1Z3IX 4F4CA 4LYAA 2JIZA 2O5VA 2BM0A 1FNMA 1LB1B 1UBCA 4Q4JA 3QBTA 2XZLA 4A2QA 5H8WA 1XNJA 1DAMA 5LPNA 4LDJA 3SNHA 3RS2A 2FN4A 4D0GA 2NIPA 2VP6A 1QF9A 4GRAA 3RDPA 4B2IA 1OHHA 3FGNA 1FMJA 4IDNA 4JYBA 5FL7A 1I4TD 1Z0KA 1JR6A 1J70A 1ZU4A 2BBOA 2ORVA 2GEVA 4ARZB 1NG1A 2C03A 3CWZA 3GLIA 2NGRA 2PX0A 3TSOA 3NTUA 3A6PC 4C7OA 4CT4B 4C7OB 5J47A 3IPYA 5AUNB 1ZD9A 4TQUS 3BIFA 1XJQA 3IEUA 2N1BA 4EFLA 3ZD7A 3QPVA 4KV9A 2ZR0A 1Z0JA 1KYIA 2PZGA 5TDHA 3GEEA 5KTYA 2A2ZA 3AKYA 4MKFA 4YDSA 1T4GA 2P5SA 1XTQA 4AG5A 1KSHA 1UKEA 1KNQA 1Z6AA 4FI3C 4JVNA 3LW8A 4OQFA 4MDEA 1Q21A 5FTMA 2DFTA 3THOA 4TTPA 2IXEA 2VL7A 3SC3A 1C4OA 4XH9B 3U44B 3IUYA 1OIXA 2KI5A 4R2IA 3THYB 4JZKA 1NVVQ 1G3QA 1W1WA 2PT5A 3TVDA 2EFHB 2HYIC 1HURA 2AR7A 2UZ3A 4EPVA 4JJKA 1FPMA 2D3WA 2HF8A 1ZM7A 3NXSA 4EPRA 4TZ0A 4QGHA 2QTHA 1ZAKA 3AP1A 3B82A 1UADA 1E2LA 3EG5A 1NL3A 1KGDA 1KO7A 1W4RA 1N2CE 4Q18A 5FTNA 2WMNB 4JLOA 4PHFA 3DEFA 1KY2A 4QGGA 3T06B 3EWSA 2XAUA 1A4RA 1GM5A 3NVAA 3BD9A 3NH9A 1D2EA 2VIIA 3Q5DA 3ECCA 1OFIA 1XB2A 1T91A 3E1SA 4A8JA 4OI4A 3K0EA 1OW3B 3RYTC 4B6EA 4GSYA 1IY1A 3IHWA 2PJZA 3CX8A 4WW0A 5K8IA 4EAQA 2AXNA 3EC2A 4IOKA 3RRYA 1Z28A 4LJ7A 1U8YA 1Q0UA 2ZJ5A 1K6MA 2MSEB 3AVXA 4PAQA 3B9QA 2C77A 4C0BA 3GLGE 1GOTA 3B9PA 4XJXA 2EWWA 1MR3F 2RMKA 1LVGA 1XD2B 3QF7A 3MUFA 2EFGA 1SVLA 3RRMA 1RJ9B 1TAGA 5C18A 1EFUA 1Q1ZA 1ZINA 4RD0A 2P6RA 1J8YF 3F8TA 2Q9CA 1DVRA 4R71A 1XXHA 3SYNA 2WJIA 3TSZA 4L9WA 1DAKA 2J5XA 3BB3A 3VR2A 4BFXA 1X3SA 3M0EA 5HE9A 3Q85A 4C0SA 1NMXA 1P62B 1QG2A 4U00A 2IYVA 2J41A 2H18A 4M1TA 4IEEA 3ICQB 3K9HA 1RZ3A 5DN6D 4KHZA 1X6VA 4TMTA 3KQNA 1ZNXA 2CXXA 1E0AA 2GHIA 2HEIA 3IEVA 1N0UA 2YNMA 4LZZA 4AD8A 4L9SA 2GESA 5HZHA 3T61A 5HCIA 2ZVPX 3TJZA 2ZI7A 5EE1A 1P5ZB 1Z63A 2VYFA 1U98A 4A2WA 2UZIR 2IWHA 2WPDD 5KNBA 2YYZA 5JBQA 3AKCA 2O8EA 1RYFA 2F9LA 3AVVA 2HJVA 3CX7A 1NY6A 1IAQA 3AVWA 2YOGA 1HT2E 4HATA 5JJKA 3WYAA 4ESVA 5G40A 2CL6X 3ZJYA 3AVTA 2NOAA 5EUQB 4YQFA 4IHQA 4OHVA 4US1R 1XWIA 1Q12A 2FZLA 4WOPA 1DAHA 4PQRA 2GJ9A 5TVKA 1TUEA 3ADCA 1RPZA 1G19A 3ND8A 4KYUA 3KQHA 1P2UA 1IY0A 4IDOA 2MMCA 1LF5A 1ZC3A 2ZRFA 3B1YA 4C0AC 3L2OB 3U3JA 3NBYC 2REBA 1ZC4A 2DFLA 3F0TA 1R2QA 1OFUX 1QG4A 4E22A 4ZKEA 1KDRA 2JDID 1QHYA 4OBEA 3I8XA 3X1YA 4TWZA 1QHNA 2ZYWX 5FBWB 2CE7A 1BH2A 2CMKA 3B6EA 4PPNA 4Q00A 2WWXA 2ZS8A 4RD2A 1YR7A 1NIJA 1SKQA 3JVUA 2FFBA 2WJYA 3IO3A 1MRNA 3L8YA 2QBYA 4H9GA 5FOWA 1E9BA 5AJZA 2CL7X 5CK4A 1EXMA 5DYGA 4LYHA 3LRPA 5FOTA 1YZUA 1KI6B 4NYMQ 3R7WB 3WNDA 2ZUDA 4GL2A 2NMVA 1JPNA 1E9CA 2DWOA 5DO9A 2O8BA 3K9GA 3CWQA 3PXGA 3W9YA 2FFQA 4M1KA 2AL7A 1NRJB 4Y0AA 3BFXA 2JLSA 3B8HA 4WZ6A 3PQCA 4YDHB 3RABA 4B2PA 3PEWA 2ZU6A 1SULA 3A8TA 4Q1EA 3TUJC 1YJ5A 4JKYA 2GF0A 3SFVA 3SJCA 2G0TA 3B1WA 3DVLA 4RCZA 1YRBA 1SXJB 1P9NA 1F2TA 2Q0HA 4PZLA 4IJMA 2Y8EA 2ZYUX 2V1XA 1LV7A 1QVRA 1VHLA 4V0MA 2DB3A 2O8EB 1SXJD 3I61A 2BCGY 3PJRA 4C0LA 1R5BA 2J87A 4MKGA 3VNVA 3W3AA 1X1RA 4PQYA 2OV2A 3VKWA 2F1IA 1ZIOA 2QBYB 2WKRA 4OJKA 3Q7QA 5EXSA 2I1VB 2P0EA 4QHYA 1HH4A 2OFWA 4EQ6B 4OI0A 4RSGA 3RNLA 4QRHA 5CDFA 3EPHA 2ZRNA 3QOFA 1R5OA 4YXWA 3KZ1E 1IY2A 2ZSBA 4JBYA 4B3XA 2ZS7A 2XJ9A 4HB3A 4QBIA 3RRZA 1KKLA 2O0KA 4PHGA 1ZJ6A 4BLRA 1KTVA 3T1VA 3AQ4A 4U02A 2IYRA 4U7DA 1OXXK 3O8CA 3PUWA 3OE7A 2NQ2C 1YZGA 1GFIA 4DLVA 1OYWA 2EW1A 4HUQB 1YZTA 3M6AA 1E9DA 2EWVA 3RS3A 3OFND 5DNYB 1HUQA 2V6IA 2OCBA 2QSZA 4HZIA 4AK9A 5B57C 5D3MA 4GPTA 3LNCA 3AGPA 4B3FX 2EU8A 1EX7A 1GG2A 1KMQA 3GMTA 1AK2A 2XNSA 4JL6A 1UM8A 2CJWB 4LWZA 1DAEA 2AKYA 3KFVA 3J81k 4TMVA 3TUIC 5ANRB 1G1MA 5AJYA 2ZI9A 3ZVLA 1ZYUA 2B7CA 4LJ8A 2G1KA 4DB4A 3THXB 3P32A 4DUGD 2BCJQ 1GNQA 2QP3A 1XFAA 5IF9A 4NP6A 2IS1A 1TMKA 4X8OA 1KK3A 1IONA 1Q3HA 2GXUA 4TTQA 4AC9A 4CVNA 4QJ3A 4DT1A 5F9FA 2V7QD 1CBUA 2XSZD 2GZAA 3CR7A 5CJ2A 1I2DA 4HAVA 3BH6A 2FPLA 1Z0DA 2QPOA 4RKFA 3I4LA 4V0NA 2HYDA 4LJ9A 3A36A 3MSXA 4AYWA 4NYJQ 2MMGA 1D8TA 1DE0A 2JJ2A 4KLNA 5G53C 3VHLB 4A4DA 1U81A 4CEHA 1CS4C 1G291 1TQ4A 2P67A 3TW8B 2DHRA 4YMUA 3SS8A 3I3SR 1ZRHA 4ZDIA 2UKDA 1OE0A 3CZPA 1OV4A 4BPBA 4Z51A 1BMFD 1KI7A 1P2SA 4R7ZA 2F1RA 1W0JA 1N0WA 1JR3D 2ZI3A 4MGYR 4QJ5A 3KUDA 2EFDB 3TLXA 5DISB 2NO9A 3VX4A 4M0LA 3EXAA 1Q20A 1JXOA 2D7CA 1PUJA 4MRRA 2JIZD 1OKKD 1W36C 1R8QA 3U7HB 2CLCX 1TF7A 2G0NA 3HYTA 2CBZA 4P4SA 3TQFA 1KDPA 1X8KA 3BFVA 3CO5A 5UKDA 3P20A 3I92A 4ARZA 2V3CC 2IBMA 1VG0B 3GLFA 4I4LA 5FOVA 3O8RA 1JAIA 4EFMA 1OH6A 4QNRA 5SZKB 4D81A 3P4XA 2HLDA 2ZM5A 4MRVA 3A58B 4LHVA 3SHFA 2VTKA 3GJ5A 4WBSA 4Z8YA 4B71A 1G5TA 4S35A 3U44A 4P32A 1XTIA 4NTZA 2Z4SA 5FOSA 4EJSC 4MKHA 3U5ZB 4BFUA 4C9BA 1CJVC 3CRW1 4KFUA 2IXGA 2WJHA 3E2IA 4AY2A 3B60A 3KKMA 1KKMA 4NCIA 4I1SA 2WM9B 1LS6A 4MYUA 1UBGA 3QXCA 2QE7D 4B3BA 1F6BA 5JJLA 3EARA 4V0LA 5FBVB 3FB4A 2O8CA 1VG1A 3B1XA 1G3IA 1FQKA 1NLZA 5HTKA 1P4SA 4JLVA 5KDLA 3U4QA 2FA9A 4DKXA 3U6KA 3EAQA 4UJ3A 2O0JA 2ZRMA 3N5CA 2PEZA 1H65A 4EPXA 1S9HA 3I5YA 2E9SA 2ZRLA 3IO5A 1XZPA 121PA 3L8ZA 2ZJ2A 3HU3A 3MWLA 3D31A 2ZJYA 3LLUA 1MABB 1SVKA 2IYWA 1ZIPA 2ZJ8A 1JI0A 2HCJB 1AS2A 1FUUA 3CZQA 2QAGB 4A15A 3OEED 3AGQA 3OIYA 4LC0A 1R10A 1G20E 4NCNA 3EZFA 1UPTA 2QM8A 5DI3A 3QY0A 3QXSA 1UFQA 1FP6A 1RRPA 4LHYA 2N46A 2CLDX 1G7SA 1T0JB 3IIJA
chains in the Genus database with same CATH superfamily
1D2RA 2M1XA 3DTNA 2WE8A 2L42A 1ZL2A 1CUZA 1YT5A 4XSVA 1PLLA 3M34A 3WMWA 3BTUA 3KYBA 4FKZA 4YPVA 4FEAA 4UMDA 3R0QA 3THWA 1YMVA 4M0MA 4J7AA 3ZWKA 1ELOA 4CWAA 4RZUA 2K4MA 5LIPA 1YTUA 5F9HA 5DNUA 1HV8A 1BFUA 4M1MA 4O02B 3RRJA 2X0JA 3TI7A 1HRKA 4C3VA 5CLLA 2QD5A 4I5IA 2QL5A 4BS9A 4BVKA 4Q16A 5J2UA 1OC4A 4QLOA 1F2UB 2NTYC 5G2OA 3W1VA 3UT5A 3BM5A 3LO5A 1U0GA 2H07A 4ZP1A 5JDCC 2CJPA 4A2CA 1WY7A 2FPUA 1WDKA 4J9VA 5FLXA 2R8ZA 3MMNA 4RAQA 4HLNA 4D2IA 3C8UA 5JISA 3HCNA 4F9FA 1ZESA 4L6IA 4A3SA 3ZWCA 2JZNA 2I7VA 2ZSJA 5KYKA 4N65A 2W2LA 1I7QB 2C2OA 2RB5A 1O1YA 1WQ4A 5L6LB 4P58A 5AFSA 2FHPA 1EGMB 1EQUA 1YS2X 4WJZA 3PFKA 2I29A 1OIVA 3BSSA 2QN6A 4MSUA 3F4BA 3M81A 5F52A 1JQAA 4ZZ0A 3RHSA 5FD8A 2OQRA 3IULA 1IYZA 1XK6A 4C6TA 5CDTA 1GNRA 2X8JA 4TV9B 4QNMA 3FMIA 5I8ZA 2V96A 2JFUA 3G9ZA 4YWJA 3K6SB 4EKGA 5A06A 5B7PA 4HNRA 5DYNA 3IXLA 3EFEA 1C4XA 3GAZA 2IP4A 1WXDA 2XYPA 2FQQA 1NR7A 2EXXA 4QU8A 4ZEVA 1SA0B 2GTIA 1TM2A 2ZYTX 2DWUA 3RYHA 3ZDBA 4LK2A 1XCJA 2R8BA 3TCXB 4L15A 1UJ6A 4DJAA 1KY5A 3L0OA 3M4YA 4Z1OA 2IDJA 2DUJA 1ULAA 4Q37A 3DZBA 4DVGA 3D6MA 4KQJA 1ODSA 1XPUA 3DG9A 1OIWA 4DNOA 1J2JA 3CSSA 5BVGB 1SZJG 3LT4A 3AP2A 4G1FA 4YAEA 421PA 3BGDA 2PD4A 1PT9A 2OXFA 4KGXA 4X84A 1UZNA 1GA6A 1IPEA 1M9NA 3RYFA 5IW8A 2A1TR 3GHYA 2XMZA 5H59A 1QMGA 3JD0A 1D4OA 1XT6A 3LKDA 3RC8A 4BQFA 1KMHB 1SCDA 1L2TA 1TRHA 1WCIA 2DG2A 4CFSA 2HA6A 5JQWA 4JXXA 1E1YA 3IUPA 1J0CA 1PGJA 1QZTA 3GFGA 1ECPA 3PK0A 4MLPA 4E15A 8ADHA 4TV8A 4M55A 4Y2QA 2CBGA 3G17A 3HO8A 3TRDA 1R0LA 1DFGA 5FUQA 4DV5B 2NZVG 1B0ZA 1F14A 1PQ4A 2QORA 1UOEA 2XW6A 3IQXA 5EJ7A 3AR5A 4FEEA 3LD9A 3ZLJA 2J0VA 1G7RA 2IHUA 1PT7A 2BRUA 4OJTA 3IHLA 4IDEA 3QQ5A 4TL6A 1G2OA 2J3EA 4ZAWA 3P2KA 3U80A 3ZV3A 3MYRA 3KP1A 2ZRQA 1L4UA 1ZGCA 2P4QA 3MTBA 4RACA 4H6XA 5C1IA 1E5DA 4TRJA 2M1ZA 1XQ6A 1XQ1A 4E2ZA 3U7GA 4ZAYA 1E1LA 2CMFA 3G0HA 1XMSA 3M1YA 2W11A 3IQWA 4XM0A 3RSQA 3SHVA 1PD0A 3HP1A 3BQMB 3I62A 2B78A 4HEQA 4XUGB 3SEAA 3RKRA 2Z2KA 4L5CA 2HRDA 2IS2A 1QUFA 1X13A 2RAUA 3B8EA 5BQOA 4C0JA 5BQPA 1HKHA 2CCJA 1MO3A 2X6RA 5EL0A 1WRBA 1E3EA 1N8NA 2VSFA 4K2AA 4C7KA 1H1LB 2QRMA 3K0KA 4HADA 4HO1X 4LY6A 1VI5A 1BFKA 4RTQA 2DHCA 1QLWA 4BL5A 4DMRA 5K0EA 4RFSA 3AF6A 2B6HA 2NZWA 2I99A 4RIFA 1M2OB 1HQYE 2D1YA 2CV0A 3BE5A 4Y2TA 5SY4A 3QHPA 2J9RA 1NW9B 2F9MA 1IUPA 3RV3A 1P7YA 2FSVA 3NJRA 1WW8A 2QRJA 2BTQA 3QQPA 4I50B 3TTSA 2JLWA 3LXRA 1XZLA 2LZ0A 4L57A 1QH0A 4PXYA 4RHEA 2R6GA 5JO0A 2PXAA 5TQJA 4FNOA 2Z9BA 3WQSB 2V7GA 2DY0A 3ZHXA 2H7VA 3W8EA 1YS7A 3TW8A 3SJUA 3TLZA 4EA9A 5LIRA 3C3EA 4JLBA 3RS8A 2YYSA 3ZJVA 3BFKA 4RVSA 3QKRA 1XLWA 2ZIVB 5DWVA 4I1OA 4X61A 1FLAA 1FTYA 1A71A 1ICIA 4MUKA 4CKCA 3U4DA 1IUNA 1H6DA 1P1CA 1XEFA 5CFNA 3RGGA 2E5LB 1XDDA 3F98A 3H0CA 1PEDA 3P19A 4NSNA 2DU8A 1CQZA 4XQCA 3WLFA 2RAPA 3U4MA 2BFEA 3AL2A 4F1WA 3WB0A 2PLAA 4XFJA 2GETA 2Y27A 4AJNA 3PUHA 3HB1A 4KXMA 4RMHA 6GPBA 1CPYA 1GTSA 4KMOA 4AG6A 3CNEA 3TQOA 3LYUA 3QVVA 4OQYA 4OMFG 2CSUA 2XVAA 4URYR 5AR1A 2GFHA 4Q9JA 4AYTA 4JMLA 5FO0A 5B2FA 1RC0A 4ERNA 4FFPA 1Y48E 1AQYA 4ONEA 2EHJA 4GYKA 1EUCB 4K9KA 3BXZA 2R1TA 2I66A 1AA9A 5CGZA 5JS6A 1UKYA 1Z26A 2IPXA 5DT9A 4OYYA 5F3WB 3HA3A 4WXPA 2NP6A 1E0KA 1Q1QA 1RWXA 4S24A 4MV0A 2A1TS 1KSFX 3AJDA 3MTIA 1D2NA 1XTRA 2JVIA 2VKQA 3GLSA 4O2BF 2G17A 3ZWBA 4D79A 1IC6A 1COZA 3BTSA 1RT9A 4GXRA 1W8DA 3ZU2A 2RGGA 5LKRA 5LB4A 1H85A 2Y9PB 1W93A 3KFXA 3QKWA 4MK4A 1E3JA 2X4IA 3LUBA 4ZZ3A 4JIGA 3MWGA 3PQ3A 2MYTA 2Q3FA 3ZS9A 3VKHA 1IOZA 4LUCA 5FPQA 1BX3A 2QXTA 2R68A 2X3UA 4LGMA 4EW3A 3E1KA 3Q88A 4GBMA 4RK1A 3NTLA 1YS6A 3M6IA 3OEYA 4IVPA 4XOUA 4E5NA 1HE2A 2IPLA 4LSZA 1ZI9A 2IPMA 1HEIA 5F3DA 5F35A 4Z3OA 3HI6A 2ISQA 2LCQA 1FDIA 1U3CA 1XCMA 1Z07A 4INAA 3RS4A 3SXPA 4YJKA 4GZ5A 1T4BA 2F1OA 4XD7A 1RWOA 2KBFA 2SHKA 1I6MA 1C8KA 1SUIA 1RR6A 1YACA 3LUDA 3QPUA 3X1DA 3LCUA 4Z1MD 4D4LA 3ER8A 1V8ZA 4P9NA 2CV1A 2F3SA 2XUOA 3EXFA 3Q1KA 3UMBA 1TC1A 3ELUA 3AUFA 4NBLA 3BRQA 4CDMA 2JK0A 4QUJA 2H65A 2O48X 1O94D 4J1TA 4WCFC 3U49A 4QG7A 3HP4A 3UCEA 5A3RA 5ICCA 4QBHA 2EHDA 4N0QA 1LSJA 4J0KA 1P60A 1PSZA 1KVSA 1WDMA 1DRKA 3FDXA 4R51A 2JIMA 5G0VA 4X1IB 3PD1A 1V4BA 5JHGB 4NCBA 4II2A 3L7IA 5CHYA 2O07A 1H0SA 5EMNA 1ZONA 4EOGA 4OQ4A 1V71A 4HH1A 5IYZF 5BSFA 1W0KD 4BNWA 5JWRA 1HMYA 1LV8A 3QV2A 1BXZA 4O3MA 4Z3KA 2PUFA 1UKZA 1YOVB 2FGJA 1CWUA 3F74A 3WMEA 1GGFA 4L75A 1Z6YA 2FPRA 1H1LA 1M73E 1TFUA 4JUBA 5BV8A 3GLIB 4DR1B 1YR6A 2AFIA 2EP8A 2LTAA 4BJ5A 1NSYA 2EV9A 5FBHA 3T4PA 1EUDA 4XPIA 3UA3A 2ZG6A 5EP2A 3DBLA 4ID3A 5JXWA 2ODBA 1LW6E 1Z12A 2BI8A 2EX4A 4RF5A 4ZIRB 5JCZA 2CUKA 4LDRA 1SWVA 4F8EA 1Q50A 3KOUA 4MXDA 1LSOA 1VP3A 2QMUA 4EHLA 2DWQA 1E6CA 1V8FA 3V2GA 2JIBA 3Q3JB 1T2VA 1FW6A 3ASUA 3FR7A 4IX1A 3W90A 3AI3A 3NTVA 1M6EX 5DGHA 1E1NA 2GGSA 1CRPA 4UFNA 3CNBA 3LUKA 4OATA 3C14C 2JD1A 5KU1A 3DLPX 3JAKB 4IIGA 1ML3A 5FWXB 4YMVA 4IZIA 5EIHA 4PGHA 3COYA 2PBZA 4PPQA 3JVVA 5FWXA 1Z6PA 3DOEA 3ZW8A 2IOFK 4BLTA 4DT1B 2UZ1A 1T9ZA 4N6NA 2LKDA 1J5PA 4CMCA 3ANTA 2V54A 3NGMA 4RD3A 2XCOA 4FDLA 3MAAC 4M0CA 2BKEA 4HNUA 1B8OA 3C74A 4Q1CA 5CDYA 2RGAA 2C7QA 2AQKA 2XQFA 3VZCA 221PA 2WM8A 4HGRA 4IO0A 5D3KA 3N2IA 3RSOA 1Z35A 1N5MA 1DV1A 2P35A 3OQNA 4U2EA 3C6XA 5BV7A 1X14A 3PF9A 4G23A 4DWOA 2EX1A 1DT5A 1NVGA 4KE6A 4XUDA 2VHYA 1TM5E 1ISJA 5KUTA 2C2BA 2WIAA 2Q4EA 2V7WA 3CVXA 1D1PA 1FRQA 3PQ2A 4EUHA 2J9XB 2R1TB 5C46F 1KJZA 2PL3A 5LB2A 1NBOA 3JRWA 1Y8AA 2I3AA 1ZOSA 3RV4A 1T1EA 2FE4A 3L92A 5EWJA 1XTPA 2BGLA 2DQSA 2VUSA 3D8SA 3RK0A 3TNLA 1QRTA 1U1FA 3F90A 5KQSA 1K5DA 1NN0A 3FYUC 4P83A 1XEAA 4LKRA 5AKIA 1FBTA 1UBEA 2ZJAA 2Q0QA 3KJZA 4BGDA 3LZ6A 3R3WA 2WWHA 2R7MA 2IIBA 1NBAA 2D1QA 3NC0C 5HDQA 1Z3CA 3IELA 3ZVKA 2JEOA 3BE6A 1CF4A 3PCRB 4KU4A 5E2AA 5G1NA 1SQ6A 3E5NA 3AM1A 4GZMA 3S1AA 2HB6A 3LQYA 4IEIA 2ACVA 2C2KA 3NIWA 3CEHA 4GVLA 1KVTA 4YAJA 1S89A 5ARCA 2GZHA 1GZVA 3TL6A 3UANA 2HDOA 1GSAA 1RHUA 2FLVA 4H3SA 1KU0A 4OD0A 1U94A 3P9SA 4RSMA 1FQJA 3IC5A 3NHZA 4QDTA 5JY6A 1AO0A 4RE5A 4XJVA 1M0EA 4KG7A 4LF9B 2UYYA 1U3FA 1SG9A 3VR4A 4NK4A 1O97C 4LV6A 4TTRA 4J1SA 4F3YA 5BSWA 4FZ5A 4RYDA 3M4JA 5DGDA 2CNLA 1MTOA 3OUUA 4DLBA 4QGBA 5JCJA 1Z4JA 4I6JA 1M2KA 1AZTA 2A58A 1VCHA 4KRXA 4PINA 5EKXA 1XL1A 1W29A 2C0PA 2YW2A 3U09A 3EDYA 2KQUA 4NQRA 3A2MA 4RVDA 5C53B 4L16A 3ZDCA 4LBZA 5B30A 3TX2A 4HBGA 4NYIQ 2CD7A 3TSAA 1YS9A 2CZCA 3L05A 4C4YA 4H0NA 1UEXC 1VG9B 2HPVA 1E1RA 2E4UA 3DOHA 3FROA 3L02A 3H97A 1H0HA 4HOYA 4C5CA 4DA7A 3ZD6A 5M3BA 1WZCA 3S2FA 1LSSA 1IOVA 5LMUB 2Q5HA 1G8HA 2JH3A 3AJEA 3BZBA 1TLLA 2BBTA 4HX5A 4NKRA 3SFZA 2GASA 2G9VA 1TZCA 2XKJE 3G13A 3E70C 3ROQA 5AVYA 3I30X 3K2BA 1CNFA 3FPHA 3GLVA 1YC5A 3QSYA 2M32A 3KB1A 4CR7A 3WY9A 3QVUA 4Q9HA 3G2QA 3U4CA 1NVTA 3CURA 2YMMA 3H1FA 5BR8B 3AFMA 4B3DA 2OT3B 3KHUA 3F7MA 3H3JA 2PZJA 5BO5A 2WHPB 4XEUA 5A1TA 4KQKA 3FGOA 3GIWA 4RF3A 3WWYA 3ZU5A 1T0HB 2AG5A 3L04A 4IOJA 3ROMA 3PHCA 1N5LA 1QRAA 2WABA 4C05A 4Q1FA 1DBIA 1SK8A 5JDCA 1E60A 2GHRA 3C1UA 3NEJA 1P0PA 1NP3A 4V3BA 1U9IA 5CM9C 4B3IA 4DLXA 2JAOA 3E03A 3P2OA 4GX0A 3RU9A 1WMBA 3PA6A 3DHEA 1D5CA 1ST2A 4B81A 1ZK4A 1K7XB 4QQKA 2FOXA 2CKMA 2F1JA 2NV0A 3FHJA 4JP8A 1EUZA 2W98A 4OYRA 5C8YA 1P6XA 3HDJA 5D01A 5EJFA 2MSCB 4C0XA 4C4TA 1PJZA 1XD2A 3LAWA 1WO8A 4H1VA 3T7TA 3V7FA 2XEXA 1PX2A 3Q8KA 2ZE6A 1RWVA 1R5NA 5DCUA 3FIUA 2PNFA 2UVPA 2W7TA 1PJ2A 1N6HA 2AN4A 3H1BA 3KOOA 2OC4A 4LGVA 4LJKA 4HUTA 5DIZA 4BLVA 3TXYA 1DIAA 3IR5A 2PJRA 1PNOA 3SQNA 4WK4B 5KX5F 1QCYA 3FPLA 4G4SO 1VP9A 3F78A 4DGQA 4NECA 4EHHA 1LFAA 5CD1A 1M6YA 3WZ2A 4I1PA 5IT9A 4YQZA 4OXKA 1DDGA 5EZQA 5I4KA 1T0IA 3F3SA 1VXRA 1YQGA 5IJXA 4CGYA 5ITZA 2X41A 4Q03A 4EHKA 1BSVA 2G83A 4B3TB 3WJ7A 2GCNA 1JVNA 1X7WA 4WK0B 3MOIA 3EZLA 2ODWA 2W6JD 3CN9A 4R1TA 3OCCA 3WP1B 4ACBA 4B2LA 4UDYX 3OX3A 4MW0A 2PK3A 2Z8ZA 1L5OA 5DGXA 4FCWA 3WNCA 3NC1C 2ORED 1XD8A 4ZJYA 1JFFA 3HPRA 1WD7A 5FWDA 3LQ2A 1FRZA 1KEPA 1R9MA 3P7MA 3QKSB 1F2TB 5IDVA 3WGMA 4W6QA 2QROA 3VU9A 4PM4A 5DTQA 1E66A 2PH7A 3TLAA 1IQUA 1ZEJA 3H7IA 4R1UA 2XUGA 4UE2A 2C57A 3H1TA 1EBFA 3P9QA 3QNMA 1YB4A 5ILOA 5LNK6 1G59A 4L8WB 5F21A 1E1KA 5IP5A 4GPBA 3U6BA 2BONA 2EKBA 2PEYA 1U2PA 2GZSA 3OJEA 4HK4A 1U63A 2R9VA 5CM2Z 4TRRA 2VAPA 4LRWA 4K9NA 3NBKA 3V9PA 2NPOA 4UFPA 1J42A 3JALA 3LOQA 2D13A 3TGPA 3QHQA 3ZXXA 3B2QA 1WNFA 3COVA 1IQ0A 1CXZA 1UODA 2UZ0A 1AC5A 3DTYA 1BNCA 3J7TA 5FNVF 3WTBA 3FPJA 4CFYA 4EA8A 1ISPA 3S1LA 2Y1XA 3SP1A 4YRQA 4B7ZA 1G3UA 1W44A 1EH5A 1P9OA 1Y7HA 2AG6A 4JBXA 4U0JA 4U6QA 5K0CA 2WJAA 1A98A 3IEMA 1A7JA 1Y3AA 2Z4TA 4QATA 4TUYA 5LFAA 2H3EA 1Z08A 4HYEA 3VSEA 2ATIA 4HEA1 3H0EA 3QU4A 5E2IA 1TD9A 3NKLA 3Q9NA 4IIEA 2GCPA 4WEQA 3FWHA 2LW7A 3UENA 2OCDA 4KXLA 4TOIA 4GOJA 4B48A 4JVLA 1EFVA 1Y9ZA 4JJIA 1YWGO 1BOFA 1XHFA 4LXQA 1U0FA 2BBSA 3MRSA 4KGVA 1ONSA 4NF2A 4OHRA 2KHZA 2WA1A 4IF6A 3K0HA 4LCJA 3BMNA 3WL7A 3HVIA 3WRYC 2VXBA 4TLDA 4KVAA 3HA7A 1G98A 1RBYA 2O2IA 2O57A 1KZ9A 2AKAB 3AEZA 2DUWA 2FWRA 2ZDQA 4Y2VA 3COSA 4WGFA 4BB9A 2CXNA 4BO5A 3IDZA 3B38A 5AM3A 4TWBA 2FF5A 2Q2OA 3TFWA 4A8PA 4JC0A 2VF5X 3SC2B 3LY5A 4HNVA 5CB6A 1ESCA 3TF5A 4G1CA 1ZHFA 1QOQB 2NSYA 4BLUA 4RMJA 1CJBA 7ADHA 4MHTA 1ADFA 2O3QA 2R6CA 3CRQA 3TOVA 4FGWA 2HR1A 1LTKA 1NKSA 2ECOA 3HACA 3OM1A 5L4LA 1GUZA 3RJTA 3LG2A 1GL9B 4DLZA 1JQJC 4KTTE 4NCHA 4Q9AA 3P0EA 1VLHA 3WO0A 4J0CA 4BGVA 1TXGA 1GGVA 2IX3A 1P91A 1B0AA 1ZM9A 2OEPA 4B3GA 1J56A 5KDDA 1P74A 3I1FA 1IN4A 3V3TA 1FNNA 1EK0A 2CFOA 2CBXA 2ZULA 4JVMA 5A3VA 3WIBA 2VP5A 4GP7A 3EAGA 1NZFA 2C3MA 1P5RA 3BHNA 3PNLA 4FJ0A 4I3FA 3LDUA 4LE2A 1QG6A 3SIXA 5JPDA 4ZCTA 3PF8A 2ZR9A 3LJKA 5KSPA 4AUMA 1Y3HA 4ZJZA 1K8QA 5E1OA 2F00A 2FR0A 1ECBA 3K9FC 1JHUA 4PW0A 2BEKA 1I4LD 2OXRA 3OHPA 4XFKA 4WKCA 2VHTA 5AVZA 5I7OA 3CE6A 3KT8A 3RWOA 5EIFA 4DLAA 1Z06A 3UIEA 2J32A 4ZAXA 1G8SA 5KAMA 3DO8A 5HPYB 3L6CA 5KSZA 2CT8A 4RWEA 2Z6AA 4ECAA 4OHZA 5DJ5A 3K32A 1S96A 1ZM2A 4GXTA 5CIYA 1S6YA 3LVFO 3VZRA 2GEUA 3F2IA 3H5IA 3MWEB 5TGDA 4BO0A 4D80A 1WE2A 4RESA 2CHFA 2XOKA 4C3ZA 1KFBB 3C41J 5H80A 2VDWB 1BFDA 4QASA 1JIJA 4JQOA 1JT2A 2SKDA 2BFOA 3IERA 1FBNA 2CLOB 1KI9A 2WFZA 2C9OA 1ESMA 1C9MA 2LGJA 4KFTA 1Y1KE 2HA0A 3U7EB 2YJTD 3JW8A 1SUAA 3QPWA 5IYZB 3WDKA 2XD9A 2CZQA 4HAZA 2QKYA 2QGZA 3AEQA 1ORDA 2GHTA 3NP7A 3DMPA 3QNWA 5KO2A 3VKVA 2JI8A 2AEEA 3MINB 4L0DA 4MVJD 3G2MA 3MJEA 5H68A 3K0SA 3PX2A 1YMUA 4AZVA 2AW5A 1KRWA 1RI1A 1G20A 1T5LA 1P44A 2AI2A 3KKZA 4MWSA 4F85A 6LDHA 5K01A 3MWDA 1VKZA 2XDAA 3B1KA 5T6BA 1O58A 1LK7A 1OSNA 4C78A 3GRAA 4Q01A 1G3RA 3IPXA 2GLUA 2NZ8A 5THKA 5JBIA 3LGSA 3BZUA 4LF6B 2YC4C 2I67A 3GT4A 4R6WA 3FJYA 3DAFA 2A0YA 1WBJB 2AMJA 3UV6A 1HDIA 4TMXA 1JDUA 4IVNA 2CNKA 2WE7A 5CG1A 4QRIA 4YRBA 1R50A 3HY3A 2Q46A 3TQQA 4BGUA 1E2QA 1E1CA 2A5LA 2QX7A 2R4TA 1BVRA 3H8WA 5DLDA 3JATB 3W9BA 2JFNA 5K3FA 1XK7A 1M34A 1J2EA 5AXCA 3K71B 2I3DA 2FPIA 3BB4A 5LA6A 1ODKA 4EUKA 4N0EA 2A0KA 1DC8A 3CINA 5HF6A 3IDQA 3LCJA 4YIHA 4FMDF 3I04M 2IBTA 1KZGB 4CCYA 3DOCA 4FBLA 1YQ9A 1JB1A 4TYYA 3Q7TA 3OTQA 4WACA 2CNOA 1TZMA 1C1DA 1QGUB 3HZZA 4RIIA 1Q1BA 3OFJA 3RYIA 4BEJA 1IG0A 2E1RA 3QLVC 2FZ4A 2LUOA 2HIMA 4IMRA 4DARA 1TQHA 4B80A 4RZQA 1MQ9A 1UDAA 1W48A 3MGCA 4BMNA 2P79A 3M1LA 4UE3S 3I6BA 5ERXA 2XLBA 1U3GA 5WRFA 2CNWA 4CLOA 5IH7A 2IP1A 2FZWA 2WUGA 4IYJA 2QTVA 3K0AA 4LN1A 2G6BA 5LOVA 5I7UA 3HUUA 3VISA 1LSUA 6Q21A 1Y5NA 4U7GA 4EQZA 4O29A 2L2QA 2WIBA 1AMNA 1NOJA 5F1YA 2HHHB 5LP6A 1T0BA 1JSZA 3PPIA 1R27A 2QI9C 2BF4A 4HEJA 1RI5A 1BN6A 2VI5A 4URWR 5JZ9A 3RCBA 4D3SA 1O4VA 1IZZA 2HMUA 1YJQA 3W6ZA 1CFZA 1YHYA 4O2BA 5CLQA 1JSXA 3B6MA 1QX3A 3LPCA 4E7PA 3AJ9A 4LBYA 3V7WA 5BURA 1DO0A 1XPJA 4INZA 5ALPA 3CXRA 5KSOA 3MLBA 4AZ3A 4WXRA 4I2VA 5E7JA 2QAJA 3E15A 4LZLA 1WVMA 4DMCA 3LBYA 3L6EA 3HCOA 3DDHA 2I7XA 3VA7A 2WILA 4ZV9A 3RC7A 1QH1A 4TTAA 4BVHA 1M8PA 2NO6A 1JR3E 3D43A 1DWUA 1GPJA 2YWGA 1R6AA 4QUAA 3AR9A 3GGSA 4ETWA 2AMYA 4DY4A 4AP9A 3CPJB 4EYKA 3EMKA 3H5RA 4DIUA 5SZJA 3V00A 2JHAA 3FNHA 4TN5A 1MTZA 1ZK3A 1NTRA 2I2CA 2K7ZA 4MGZR 1LK5A 3EISA 4QELA 4QXAA 5H5JA 4IQFA 1NJ6A 3LLCA 1L5HB 4TMFA 4ALKA 3H9JA 4J0HA 1ZP6A 4UAJA 4OHFA 1X42A 4TV8B 1VPWA 4YFVA 3KEOA 5CK5A 1JEJA 1R0CA 3K6JA 4V39A 4RZIA 3VC1A 3ZGOA 4K88A 4CQMB 3PHLA 1IZ8A 3TRHA 4DA4A 1PE0A 2VJMB 1BE8A 2P78A 2ZIXA 3KDPA 5AVRA 1Y81A 2HSGA 3B3JA 3DLCA 3HBAA 3LXXA 2GNAA 1X74A 2Q62A 1CVIA 5E6UA 2XT9A 2QUAA 4P0QB 1EFCA 1A88A 4L0MA 1L5KA 4DA0A 4ZWNA 1M1NB 2XCUA 1AT1A 2GRAA 4R5HA 3O47A 1GTG1 2QJOA 2CB0A 4N0DA 4B34A 4M1SA 2IITA 2ROQA 2XGGA 2BFMA 3H84A 3T12A 4ZO7A 3DE7X 2HJGA 1LPAB 1X2BA 3V2HA 2I71A 5I48A 1LCIA 2OZLA 4YBRA 1P61B 2DE0X 4EG0A 3IJPA 4MV5A 3W5JA 1KQNA 4NS1A 1J9ZA 1N2OA 5JQGB 3C2QA 5FO1A 1G60A 2Y2VA 4CKEB 3LKZA 3UK6A 2QZPA 1H2EA 3O7WA 821PA 1RBMA 4CKEA 4CV1A 4KW7A 4A6DA 4F8YA 1R6XA 2FF7A 1KMIY 2R5WA 3G0GA 3QM1A 4ON9A 3ND9A 2AFVA 3IDAA 4BMXA 4ILEA 4EGSA 1M7BA 4ZANA 7REQA 1BXRB 2F4VB 4ZEMA 3G1UA 5C32A 1Z4QA 3DAPA 5AJTA 4RA6A 1TA9A 2E1PA 3O4GA 4HNQA 3HGMA 1D7AA 4YS6A 1GFSA 1SU6A 3NWEA 3R9XB 5J59A 5K8CA 1BHJA 3GLUA 2KB0A 3FE2A 3ILVA 2WU8A 2WT8A 1U8XX 4Q7KA 2J5KA 5ALZA 2DOKA 3SIWA 1SKYB 1JQ5A 1VJDA 1YD7A 1W88A 5LZ5A 1NVAA 1GA4A 2BM9A 2MSLA 2WZCA 3D0RA 4L22A 3UB2A 4D57A 3AVYA 2P3OA 3EVCA 2O2EA 2OO5C 2CDRA 1G4HA 3B1FA 4TS1A 3JQBA 1L4MA 2GK6A 4J0FA 4QUBA 4X1KB 4Z0NA 3UJ7A 1HDGO 3PC3A 3V8QA 4JP2A 3ITDA 4OM7A 2A78A 2DT5A 2I2FA 1U7HA 1ZITA 2ZRHA 4JP1A 4IIBA 5AVJA 1VJRA 2ZYHA 2IHYA 5F2OA 2FUG6 2ZRDA 5JQGA 1D9ZA 3CKKA 2G1UA 3U7IA 2AYYA 2VT3A 4L8YA 2AJCA 3BMCA 2JJ2D 2CHEA 2G4VA 1YDFA 3JASB 1YQXA 4Y1EA 3HYRA 5GZ6A 5HIJA 2XXBA 3JD2A 3Q0EA 3AERA 5TS2A 5LA6F 4DYDA 2Z3WA 5EQTA 4DNPA 3B2NA 3LC7O 4JEHA 4NYIR 3JY6A 2JFOA 4ZVNA 3R3ZA 1W59A 2GCIA 1WXHA 1OXVA 4X7MA 1NPDA 4HRAA 2XOEA 2IEBA 1HDCA 4JS0A 5K5EA 2Y9MB 2G0AA 1IRIA 1N2ZA 3SQXA 1AKRA 1JAHA 4EW1A 1U8EA 2BTQB 4EGCB 1Z16A 1WXQA 3FRJA 4M0UA 4K2HA 2JI6A 4Q02A 3GLFB 3ETDA 1L7VC 3A1DA 2X58A 1R18A 1VMKA 3V4ZA 3KQSA 3KYDA 1KQPA 4PLHA 5JYDA 4W5OA 1Z68A 2P40A 3MFQA 5E7IA 3RE1A 1GITA 3ORQA 3RTCA 4D9FA 4BFTA 4RFVA 4J6EA 3ND6A 1N6LA 1CU1A 2IYZA 3WO1A 3W8NA 4ER0A 4RIHA 1C3LA 4AYXA 1UMBB 3GH1A 3SFTA 4E94A 5ALKA 2VPZA 3QBEA 1Z5VA 4U9HS 3TTXA 4BJ1A 4F84A 4M7WA 4XSGA 5H70A 2F55A 1YQTA 1M54A 1UJNA 4YK7A 2VH5R 1ZBDA 5FIUA 5JWHA 3VJLA 1ZNWA 3GJXC 3SQMA 3UF0A 4AURA 1YC2A 5A03A 5TRTA 1J1IA 1GSHA 2ZATA 3VBCA 4B47A 1FFWA 2IYAA 4MPDA 3F46A 3HZRA 3BFPA 1JKIA 1PJ8A 1PRYA 2QQGA 3NCHA 4I55F 4NZZA 5P21A 4MRAA 3ZHZA 4GRDA 4XLTA 4CUZA 1O3YA 1KF0A 2IHJA 4RETA 1JFVA 1AXEA 1NVUQ 1O5TA 3DTTA 5E8RA 3ZK9A 4BQIA 3RJ9A 3T4XA 3DVAB 2VT6A 1Z4KA 3D8BA 5KI6A 3FFTA 5CBKA 2QLLA 3A6GA 1E5LA 3CF0A 2IW3A 3JVEA 3GRCA 2P2GA 3BBLA 5AHOA 5JSHA 3IV9A 2GRJA 1VSQA 3QVXA 4X8LA 4C1BA 3ROXA 2MSDB 1DUSA 3STHA 3PIDA 5C5EA 2OCLA 1EQAA 4B44A 3T3EA 2JATA 2ZSKA 5IBQA 5LVAA 2ZBUA 5EG5A 4RPHA 3U3OA 2C97A 3VMMA 2JANA 5FFNA 1Y4UA 1NGSA 1YFKA 1NVDA 3A4NA 2C4VA 3EF3A 3T9FA 3FVRA 4GPD1 3VYUB 2RI0A 1GPLA 4KKXB 4LRQA 3VU3A 1VJ0A 3R7SA 4E5KA 2CXQA 5TC4A 2PS0A 2QTMA 4IMJB 1MFZA 2V4MA 3GQBA 3GA5A 3DBOB 5EC8A 4ZTUB 1WOMA 2FWNA 2VUHB 1RW4A 2AC2A 5DSXA 4FJ1A 5F4ZA 5KMGB 3CUYA 4BN0A 2WNSA 1QHFA 3T0FA 3QEMA 3CRVA 4I1UA 4A6XA 1ZJZA 4ZYYA 2J59A 1PFKA 3DV2A 3MXTA 4AKIA 3DFFA 1G8MA 4HHEA 1JH9A 3I72A 1BGXT 2Q9AA 2AHRA 3RVNA 1EUCA 4ZICA 3TOCA 4CCYB 1T34A 3R6DA 4X7PA 1YIDA 2Q49A 5C34B 1B74A 4YMSA 3T15A 1EVYA 2W6QA 2Z57A 3PHJA 4YGXB 1VKJA 2R66A 1UP7A 4LQDA 4CYMA 1ZUNB 5A2GA 4EB6B 1E7YA 5IUKC 2A9QA 5JNRA 1XZQA 4OB7A 4OLAA 3G79A 4X63A 2O8FB 3KVOA 1U8FO 1UWKA 5A3SA 2GRUA 2Y77A 1JJAA 4HN2A 4PG7A 3WSWA 2CLHB 1T8PA 1CHDA 3L7NA 3R7DA 5J4VA 1M67A 1SVSA 4NJMB 3CN7A 1RADA 4PO9A 2GM5A 1FMLA 4MR7B 3UMFA 2QXYA 4DAEA 1TLFA 4AECA 2ZAOA 1MCZA 1G55A 5I7FA 3H9BA 3IJRA 2YMQA 3FY4A 2G06A 3JQGB 2ZJ1A 4ZYWA 1TFRA 1PGNA 4KQFA 2XB4A 4Q3EA 3FNRA 2V7QA 4B6QA 1WTCA 3CGWA 1E7MA 4GEGA 4OB6A 3V48A 2R84A 4TKUB 1X7ZA 3FPAA 3ICEA 1JZSA 3P9PA 3MTDA 4GX1A 4MB2A 1XIVA 4KFSA 4OB8A 4U3JA 3NIBA 1A2KC 3GP5A 3SBDA 4EELA 3EPKA 4O3FA 1XP5A 4NAUA 1X70A 3O1JC 3AFOA 3FHCB 3PJFA 3CFYA 5E4TA 1ZUIA 2BEVB 4EIWA 2BFBB 2V7UA 1DQSA 3M6WA 3OKFA 1JHQA 1SNYA 3QVOA 5ELMA 1Y1TA 3RRXA 1F2UA 1DMSA 1JBQA 4JX8A 2X8BA 3PC2A 4WD3A 4Y6LA 2VN8A 1CJKC 5CVUA 5KVQA 4DRXB 3UPUA 1A3CA 3TI9A 1Q91A 3OT5A 3FBTA 4L28A 1I9GA 1Z56C 2NADA 2PHZA 2O1WA 4FXPA 1OTHA 1ULBA 2VC2B 3RLFA 3A4LA 4LNUA 3EE6A 5E3HA 4XWOA 1J39A 2GWRA 2PX2A 3DOFA 3MM4A 3EIFA 4UEWA 5LBUA 5CA1A 1EQ2A 5AWFC 3CH4B 3IT1A 2RE8A 5CW2A 3QPAA 4C7BA 4NL4H 5CCBA 4IFBA 3GGJA 4DQ0A 1TAQA 4RJTA 3QRWA 4WV3A 4EO4A 1XMQB 1DPGA 1NVFA 1PQYA 3B5EA 5F64A 3RIXA 2AKEA 3MJFA 4MYSA 2HNKA 1URPA 5EP1A 3A6DA 1NQOA 1SBHA 1T5DX 3JQAD 4PO8A 4RF2A 4UUPA 2IYOA 4KLAA 2W2LD 5DCLA 5KPDA 3H5AA 1KJNA 2HI0A 3TJRA 3C6ZA 2H85A 4NI5A 5B3JC 4XWKA 1VIDA 4NOMA 5IJZA 1NKTA 3VV3A 2BI4A 1XKXA 1ADYA 4DNFA 3VNRA 3CC8A 1FFCA 1F8XA 1DXHA 4IS3A 4NBSA 3HCWA 3U1BA 1KTIA 4MR9B 1K0UA 4P4SB 3TRFA 2OSBA 2IYFA 3Q10A 4M86A 2QZZA 1D6SA 1WX1A 2O2ZA 3C0KA 3NNDA 4UM5A 3VNAA 1RZVA 3QTBA 3FPKA 3Q9SA 4MTLA 2PWYA 3JALB 2AW3A 2RGNC 1L7QA 3MJSA 3NT5A 1IXKA 2PUBA 3IKMB 3O9MA 2GF9A 2ZW9A 2QRLA 2DCUA 2JFXA 2NG1A 1YKSA 3ELYA 4Y6OA 1G6Q1 3WLJA 3ET5A 1DX4A 2RH9B 3HU2A 4H1UA 4EFKA 4F2DA 2D5LA 3AHEA 1GRQA 3OIVA 3OUTA 3CLSC 3K9LA 3H8SA 3SSMA 1E5QA 4Z4FA 2AG0A 2AJBA 3OFKA 5EXDA 1L8OA 4C5AA 1GPKA 1H0RA 1U3WA 3AIOA 5CEFA 4ND7A 2PBLA 3GRUA 2L0XA 3SX0A 1CR4A 1I24A 2P9BA 1TIBA 5AKHA 4JEIA 1AQLA 3ZVMA 4OREX 5EMLA 2WG1A 4Q0MA 2NWQA 4EK9A 2BFAA 4TS3A 3GYBA 4IDPA 1HE1C 621PA 2DM6A 3AKEA 3TD6A 4GPIB 5I9IA 3E3LA 4EW2A 1HNWB 1Z8HA 4PQEA 2C54A 4DMHA 3EA0A 2WYIA 3FZEA 1BA2A 4R1QA 1T8WA 4KXFB 1B6SA 4IJUA 3COPA 2RI6A 3VYVA 2VDLB 3IH5A 3NDBB 3X3HA 4R0VA 1GSIA 5JH7B 2O8FA 3O2QB 4BQNA 1SU4A 2C5LA 3I53A 4WOKA 4YRPA 5A05A 1RXVA 2G4CA 1V9SA 3WYGA 2Q45A 3NDPA 4H35A 5HBGA 4ZTBA 4FU0A 4NAVA 4IUCS 2HLHA 2IL1A 3JZAA 4NV1A 1OWMA 1XF1A 3T95A 4DTCA 7AT1A 4YAOA 1H2AS 1IEQA 1GNPA 4RLHA 3TG2A 5L3RA 4HFNA 1Q1AA 1WOYA 4R9VA 3UAYA 2YXEA 3F5SA 2H08A 2I87A 4TSFA 3WIDA 3O73A 4D8WA 4L0CA 3FVWA 4ZI3A 1XHEA 5K3OA 4ZU3A 2ZSAA 3MJCA 5AXBA 1Y4AE 2X8JB 1JFSA 4OHWA