4TLEA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
218
Chain Sequence
EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPDLSALIERINYAIQKYRARRVSIDSACSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 78
structure length 218
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tleA00
1VIYA 1FZQA 4DIDA 2VEDA 4PSKA 4EDHA 1YRBA 3W3ZB 1GUAA 1XX6A 4ILEA 4TMZA 5C2JB 1YKSA 1Z6YA 2QQEA 1E9DA 1Q22A 1FTNA 4UXHA 6Q21A 2AKAB 5J4YA 4RCYA 5B64A 3UKDA 2ZRNA 4EFLA 4KAXA 3Q5DA 3FMIA 3VKGA 2RGGA 1ZNWA 2OHFA 3ADKA 1W44A 3PUVA 1W49A 2G6BA 3K0CA 1E0AA 4R2HA 4BFXA 2IYSA 4KVAA 2VLIA 3CRW1 4HLUA 2PZFA 1NN0A 1FFHA 1G6HA 3KJHA 4HEJA 4CEJB 1TNDA 3B7GA 3AKYA 4RD3A 1EFCA 3T15A 2OBMA 1VHTA 3AVTA 1XEWX 1XWIA 2D7CA 1GTVA 1XTRA 2UZ3A 3SQXA 1DOAA 2ZRJA 1QVAA 1U98A 3DL0A 4WAUA 1GL7A 1LW7A 1H65A 4QHSA 4DT1B 2O8EB 2KWIA 4TMTA 2F7SA 2NQ2C 4DUGA 2IXGA 4NCHA 3OFND 1XB2A 1LFDB 5TV2A 5KPDA 4YMSA 1AGPA 4XSGA 1WE2A 2CE2X 2QQ0A 2V1XA 1K5GA 4MKIA 5CB6A 4C0QC 1NLYA 3QKSA 4JJZA 4LJYA 2VHJA 1MABA 3AUXA 4OQMA 2BBWA 2WWWA 4DCSA 2EWVA 4P4SA 1N6OA 4CW7A 1ZC4A 2OEPA 5KSZA 3CM0A 4RZ3A 2GAAA 1GILA 1YZQA 2Q0HA 1QHIA 4TL6A 1XEXA 5HCIA 4CT4B 5KHOC 3ICQB 4HLUC 1UJ2A 1T5IA 4V0LA 3TQCA 3MGCA 3ZD7A 3PV0A 5IF9A 3EIHA 4PO8A 1ZIOA 3C8UA 1I4DD 2Z43A 2QPOA 1GNQA 2CHQA 4QC2A 3T1QA 4EPRA 2CL6X 2J9RA 1Z8FA 2QA5A 3W8RA 1XXHA 2VYFA 4YXWD 2ECKA 3C7KA 3T5GA 5J5CA 3Q3JB 4JYCA 4WOPA 4ZCIA 2R6AA 1M74A 5BXQC 2Q9BA 1NVWQ 2VF8A 3SJAA 1EFRD 4URUR 3DMDA 3REGA 3PEWA 4DLSA 1JAIA 5CYPA 1OLOA 2ZUDA 4GMXA 4I1UA 1MABB 3K53A 4WBSA 1U90A 3L0PA 4BECA 1NBMD 3DMNA 3RNLA 2ATXA 1GDDA 4QBGB 2LKDA 1KK0A 1P2UA 4K81B 3THXA 4OJQA 1P7CA 4KI0A 3VU9A 4HUTA 2EFGA 1P75A 1W4CA 1EG7A 1XMJA 5FOWA 4KFUA 2AR7A 1EWRA 2CLDX 3M1IA 4IFEA 2VPPA 2BDTA 3CLVA 3I73A 1K8RA 1IJEA 4ZDIA 2ZJZA 1M7BA 4L9WA 4A92A 1FP7A 2ZU0C 1UKVY 4FMDB 4IW3B 1E2QA 4Q66C 1EX6A 1N5JA 4BLTA 2ATVA 4G3XA 4I4LA 4TYPA 4BFZA 1N6NA 1RE0A 4JJKA 4LGMA 4A82A 1RJ9B 1QHGA 2XGJA 2F55A 1G7SA 2ZJBA 4IXNA 2RGBA 2ZAMA 1JPNA 3CWZA 2QI9C 2D06A 3FKSA 3H1TA 2QE7A 4ZCMA 5L3SA 3ADCA 1MH1A 1E79D 1E9SA 2BC9A 3G5UA 4IDPA 1ZNYA 1IOZA 2YVUA 4BRUA 5DYIA 2BKUA 4ON9A 4BFWA 1J2JA 4NE2A 1CRQA 5TB5A 5A4JA 1G4UR 3PVSA 1DAGA 1TUIA 2GXSA 2RGAA 1MT0A 4HZUB 2VP2A 3M4YA 4FMCB 4QFMA 3A1VA 2ZAOA 3IPXA 1A2KC 1UDXA 3SEAA 1Q1BA 4HAZA 2F43B 3FYHA 2ZRBA 2ZROA 3QPWA 2YOFA 1Z5ZA 3QXSA 1P9NA 2OV2A 3FMFA 3C15C 1TQ2A 1F5NA 1KK1A 4MA4A 4DRZA 1GL6A 1S96A 1NI3A 1E98A 4RKEA 3LLMA 3A4LA 1SXJD 4PSAA 3L8ZA 3W90A 1ZD9A 4ZDKA 1VCMA 3BS4A 1IN8A 3GFOA 2HT1A 4Q9JA 4LV5B 4A2QA 1XD2A 1WA5A 3K70C 1M7HA 3U2QA 1N25A 1AS2A 2HJGA 4HB3A 4U02A 1R10A 2ZRHA 3NHAA 5K8LA 4PTLA 4BLPA 2DWQA 1S1CA 3FGNA 4NU0A 4FWTA 1XP8A 1HY3A 5FUYA 3QJYA 4OI1A 1IN6A 3W3AA 1KI9A 2AKYA 3DPUA 1NN3A 1EESA 3RRNA 3VX4A 1E2LA 1QHYA 1GZSA 1R8SA 2YJTD 3K0SA 4FMCF 3HU3A 1XTJA 2CL7X 5KUTA 2C2HA 1BH2A 1QG2A 3DO6A 4W5JA 1G8FA 1OPXA 2ZRPA 5B57C 5EE0A 1FMLA 1R7RA 3WBKA 1GOTA 2H17A 3B82A 3LAWA 5L3QA 1IHUA 5HZHA 5C4MA 3C5CA 3ZDQA 1N0WA 2G3YA 2PT7A 3TE6A 2QMEA 2ZS9A 2BCJQ 4PZZA 1YR7A 2P3SA 1KI4A 2PCJA 5BYJA 1OIWA 1PVOA 4OHVA 4V0MA 3RDPA 5EXSA 1W0KD 2W6JA 3EZ7A 1GFIA 3WBJA 1W0KA 2PEYA 3B1XA 3MUFA 5G41A 2YZ2A 3VR1A 4HUQB 4DLUA 2VSOA 2XNDD 1CS4C 2WWYA 1E4YA 4C2UA 1FNNA 1HURA 3TKLA 1DS6A 1KJZA 2DWOA 4QGFA 4MYHA 5G40A 4FCTA 4LK2A 3TMKA 2EQBA 5JJLA 3PITA 5FBLB 4L16A 2H5EA 3P1JA 3RRYA 1TQ4A 2AD1A 3O47A 5E4FA 1P2TA 1KAOA 3AKEA 3TUZC 1R5BA 4B73A 2QG6A 5DI3B 2ERYA 1EFHA 4AIIA 2JLYA 4JKYA 2G88A 1VG1A 4QM6A 2N46A 1NVUQ 2VP5A 2ZJYA 3CZPA 1T9HA 2ZJOA 4QXAA 2FFBA 3V9PA 2F3TA 4OI0A 2QMOA 2RGNC 4NYJQ 5CK4A 4CEHA 1P73A 3WNBA 1OSNA 2OILA 1JJVA 1Q1EA 3I8XA 5D3MA 4D80A 3LQQA 1XTIA 2F1JA 2ONJA 1KGDA 3FB4A 5GJBA 5C1BA 1GITA 1N6LA 4HYYA 1DG1G 1HA3A 4P4TA 1X8LA 2IF0A 2QP9X 1CTQA 1TTTA 3AVPA 3WNDA 1VG0B 3CNLA 3IEUA 4HLQB 4GPTA 2Z83A 3L0IB 2IBMA 2QTVB 1JB1A 1G17A 1UEIA 3GEHA 4UXIA 4PAQA 5CK5A 5DI3A 5FH9A 5FTNA 1SZPA 1Q12A 4OQFA 5KTYA 1IXZA 2Z5FA 2QUZA 3DHWC 1OHHA 3NWJA 2QTHA 4TSFA 5AJXA 5KO2A 4PC7A 4A0GA 1AN0A 1L4YA 3KFXA 4W7SA 3V00A 1FPMA 4IDQA 3K0FB 1VCOA 4YMWA 4YONB 1G3RA 2BM1A 2JLRA 1DAIA 5D3MB 3SZRA 2BMDA 5J4KA 4A8JC 2Q3HA 1WXQA 1UBFA 4IDNA 3AVVA 4B75A 1SVWA 4LX0A 1KSGA 2R2AA 4IKEA 2ZYWX 4NYMR 1N6KA 4RZUA 3CKLA 1KTVA 2GJKA 1E1QA 3MAAC 1W4BA 1R2QA 1IONA 2YYZA 2AWNA 2GNOA 4GT1A 4TL7A 2GESA 3UWKA 4EPWA 1GNRA 3ND9A 3QPVA 3RS0A 1Y3AA 2GTPA 3FMOB 4LPSA 1G7CA 4GZMA 4MGYR 2FPKA 5JS8A 4PQYA 521PA 1XMSA 2HEIA 5B2ZA 3D8BA 5DGXA 2FNAA 2P65A 2ZRKA 3AF1A 3OE7D 4UXJA 1W36B 2BV3A 4V02A 1U0LA 4Q4HA 5UKDA 1BMFD 3GJ6A 3LWNA 3RSOA 1EGAA 1E2KA 3AVQA 3DKPA 3WYAA 1SXJA 1OF1A 1FUUA 4CGZA 3KTAB 1U8ZA 4POAA 4HLCA 3W6PA 1CJKC 3PUZA 1SVMA 3FDIA 3B60A 3AVYA 1ZD8A 2V8OA 2WMNB 3ICEA 4DVGA 4JLDA 2WKPA 2QZ4A 4FCWA 2IT1A 4HB2A 4B35A 1E2JA 4KYIB 3NBYC 4M1SA 2CMKA 3HR7A 2J3EA 2ODNA 4FI3C 1M7GA 2J46A 3NC0C 4NP6A 5CM8B 4P4SB 3L2OB 1KDTA 1ZCAA 1XPOA 2GVDC 1BYIA 2EWWA 2WPDD 4NCIA 1DO0A 3FOZA 3GLHE 3B13B 4KYUA 4M9XA 4C0BA 2PT5A 1M2OB 2Q3MA 3SHFA 1IJFA 1NMZA 4N1AA 2CNWA 1OH6A 1W0JA 2ZUBA 1Z28A 4DLWA 1E9AA 2VHUA 4Y0AA 3ZH9B 1E6CA 1U94A 3QG5A 2PCLA 1KI8A 2QP4A 3I72A 4X8OA 2J0SA 2XSZA 2CE7A 3X1DA 3CRQA 4WXPA 4NKRA 1NVVQ 1TF2A 5BQ5A 4LJ8A 3IBGA 4AKHA 1XCMA 3HU2A 5FOSA 3CH5A 1RFLA 3K09C 1AZTA 5E3HA 4OKSA 4JBWA 4MYCA 2W6JD 4TWZA 4TL8A 2ODEA 2F1HA 5CJ2A 1G3IA 2FX3A 3WYGA 2PZEA 3GFPA 2FMXA 1ANKA 2CVHA 2ZSAA 2REOA 2OT3B 3EPJA 3SOPA 2IXEA 2OSBA 2JDID 4KFRA 2GKSA 1ZNZA 2UVQA 4V0OA 3L0OA 1BOFA 5H1YA 3B8HA 1GAJA 3RWMB 3V4RA 2BVNA 4PSVA 4LZZA 2J59A 3GJ4A 4IVPA 1CR2A 4Q21A 4IFBA 2JCSA 4JLJA 5GJCA 1OFIA 1QDEA 4JYBA 3U6BA 4JKIA 1G18A 2IC5A 1KI6A 2VP9A 4PZYA 1G8HA 1NN5A 5FBRB 1AK2A 4IDOA 4KJZA 4GP6A 2CCKA 1BO6A 2ASEA 3K0AA 1KSFX 2VHTA 3BH0A 2BJVA 2FSFA 4FW9A 4CZ2A 5JCPA 3AUYA 1XPRA 4Z51A 3PR1A 5CJPA 3LXXA 4YC7A 3PFIA 2RGCA 3RHFA 4PHGA 4M9SA 1OH7A 1KNXA 3O8RA 3DM5A 2QE7D 1Z6GA 4HAUA 4IEIA 2Y8EA 5BN3A 3HDTA 4HAYA 3BGWA 4PANA 2PX3A 1XRJA 3KZ1E 2WMOB 3VNUA 2JAQA 2WBLC 1WBDA 3I3SR 2JLZA 2C04A 3UG6A 4LYJA 2D74A 4YDHB 1X3SA 2OCBA 2GF9A 3QUSA 4OK5A 2IYWA 3KL4A 4G1UC 3WMEA 4U00A 2OXRA 3C16C 2QNRA 4M1KA 4B76A 1VTKA 1Z6XA 1X8KA 4BPBA 3TRFA 5LD2B 1SULA 3FHOA 2FOLA 1NMYA 1P9WA 4DSUA 2CK3A 3LX8A 5IDVA 1E1RD 1RZ3A 1PZNA 3R7WB 2D2EA 2DBYA 2ZRGA 1U99A 3NBZC 5JWRA 1KMHB 1ZYUA 4IVQA 2G1KA 1QZXA 4Q4JB 3LH5A 3LRPA 1WMSA 2OAP1 3RS4A 1OFTA 1XXHE 2A5JA 2IYQA 4D82A 3LD9A 4H9GA 3LBIA 3I1FA 3CPJB 2X2EA 1U8AA 3NIBA 3N2EA 3EPLA 4BUJA 4IJMA 1SKQA 4HDOB 4PX9A 4DKXA 4M4SA 5DLQC 1A1VA 2OBNA 2CBZA 3ZVMA 3S1AA 1ZC3A 2CLSA 2GRJA 3MMPA 121PA 1W5TA 4B43A 2VF7A 2F6RA 2J87A 4E5UA 2JLUA 1TAGA 1TPZA 2QSZA 2UZIR 2ZI5A 2QBYB 3OAAD 1NBME 2IW3A 3VMFA 1YRAA 2FGJA 2A3RA 4MUBA 2C9OA 1OHHD 3NXSA 4JIMA 4PXAA 3MWLA 3CH4B 2GF0A 1E2EA 1F2TA 1BIFA 3C5HA 1AZSC 3B2EA 3LXRA 1I4LD 3Q7QA 3EAQA 2WV9A 3A58B 1NJGA 2ANBA 2H8KA 3U7GA 5HKKD 1D6JA 1TQDA 4DSTA 4Q4LA 2OAQ1 4DHEA 1P72A 2ZR9A 1XJQA 4JBXA 2HV8A 4XVUA 3GLGA 1V5WA 1UAAA 3QOFA 2ZRCA 1XF9A 4JBYA 1ZNXA 3L43A 3F5FA 1II0A 1UKYA 3EWSA 4M2LA 3U4QA 5FOVA 4A8JB 1CJMA 2ODBA 1CULC 1VKJA 1KNQA 1G6OA 4NONA 1NG1A 4H1VA 3QY0A 2FSIA 1O87A 2W6ID 3U61B 4X8HA 2WSMA 2C5LA 2ZSFA 4JZKA 4QRHA 3X1YA 3T61A 3VR5A 3ZVNA 4M1TA 2JLQA 2BBSA 2ZSDA 4PC6A 2FWRA 2RAPA 2VHQA 3K0CC 4GBMA 3THWA 2ZE7A 2FE4A 2QAGC 4TLBA 1T4GA 3QF4B 2HUPA 2RMKA 1JEDA 3J81k 2DFLA 2H18A 1EWQA 1FNMA 4A2WA 2ZITA 1PUIA 1X8JA 1Z6AA 1E3MA 4XWAA 4QJ3A 4E09A 2QT1A 2FA9A 1ZJ6A 4AG6A 3GEEA 1S2MA 2PEZA 3KB2A 3BC1A 4MITA 3AVXA 2ZR0A 1VCIA 4AKIA 1VG9B 2FZLA 1UKEA 1X1RA 1MR3F 2W00A 3FE2A 2P67A 3LV8A 1GVNB 3W9YA 5CDFA 1HEIA 5HZKA 1G5RA 1ZVQA 1J7KA 4JVMA 4TYYA 5FBVB 4DSNA 4DEYA 4DDTA 4LHXA 5EZ6B 2H16A 5EE3A 4C0AC 3ZQJA 4FWIB 2ZE5A 1VECA 3BERA 1CU1A 1PLJA 5P21A 3I92A 4D4KA 2R6CA 1P60A 5TY0A 1PLKA 2ZQ5A 1P5ZB 5FOXA 3GJXC 4LBZA 3LNCA 3T34A 2QN6A 3W5JA 1G3UA 4OQNA 5HKKA 1E32A 4D6PA 1ODFA 2GWHA 4M53A 2E87A 3A4MA 3JVVA 2WSSA 3RS3A 1E9CA 3LO5A 4V0ME 3SDZA 1E2DA 4A4DA 3QNUA 4LHWA 1FQKA 5TVKA 2ERXA 3T1TA 4A0RA 4BFTA 1W2HA 1RIFA 3BH7A 1JR3D 4IVRA 1KKLA 3EARA 3D6TB 3T1VA 2VHCA 4TN1A 1M8PA 1NVVR 1CR0A 1HT1E 2OE2A 1LVGA 3AH8A 4B48A 4MDEA 4Q4AB 4NH0A 4XVRA 4ZV4A 4EPTA 4Q03A 5DN6A 4XSHA 4AYWA 3O8DA 2CHVA 5JHGB 1KYIA 1G5TA 2E1RA 4IOJA 2FSGA 4WXRA 3SJBA 2DY1A 2ZREA 4Q4HB 4BEJA 1OFHA 2MSEB 1HT2E 4G5GA 1T0JB 3ASZA 4BLQA 1EX7A 1HQCA 2FJUA 2ZE8A 4WZAE 5F98A 1G5PA 2IYVA 3GLHA 1YZGA 1OKKD 2ZYUX 1I4TD 4TMWA 1BMFA 5SZHB 1IM2A 3CR8A 5KNBA 1E79A 4QJ5A 2WHXA 2O8FA 1WF3A 2OZEA 4LI0A 5FTLA 4XH9B 3RABA 2D4HA 4GZLA 3IBYA 2LWIA 5JLJA 3GJ0A 4RSGA 5JI2E 1JAHA 3CRMA 2D3WA 1Z0AA 3GJ8A 1GWNA 4RZXA 1G8PA 1JR3A 4ASUA 5GVSA 1AQYA 2GJSA 2X1VA 5EP3A 2VSFA 4L8GA 2D7DA 2XB4A 3B9PA 3LVRE 2QP3A 1II8A 3NEYA 3A1SA 3SN6A 4P32A 5AUQA 5EP1A 421PA 2W2VA 1E0SA 5TDHA 1TUEA 2FEOA 5H68A 4JLMA 3B6EA 2QEQA 3BORA 2EVWX 2QTFA 3OE7A 1E99A 4AURA 4AKGA 4QNRA 2D62A 3HR8A 3LY5A 5JFGA 4N0DA 3T12A 2GILA 1UBGA 4EJSB 1T3SA 3L0SA 4GSYA 1UEJA 3DZDA 2YC2C 5BN5A 4MDFA 2W2XA 2GBLA 1G8GA 2NZ8A 3A6PC 1MO5A 1E9BA 1FL9A 1GG2A 1VHLA 2OFOA 2QM8A 4MYUA 3SFZA 4ZI2A 1RJ9A 4MKGA 3DDCA 3WYFA 5J4LA 1CR1A 2NZJA 2GZAA 2XEXA 5FR2A 2RH5A 2WTUA 2ZYVX 2J1LA 5KOYA 1E2IA 1II8B 1TADA 3ASYA 3QBVA 5FI1B 2AWOA 3SBEA 1HV8A 4EAQA 2A30A 3HP1A 2WOJA 2G83A 3K8YA 3EW9A 3AF3A 3G82C 1U9IA 1Z0FA 5JI3E 3GLIB 5TARA 2C8VA 2GCPA 2EW1A 2Q21A 1C4OA 1Z3IX 4MRVA 3TH5A 3U7EB 4IOLA 5FPKA 5FUWA 3MJRA 1T91A 4HZUA 3AVWA 2I1QA 2ORVA 2XNSA 4G5RA 4LV6A 1K5DA 2V55B 3JZMA 4V0KA 4EJSA 1VCNA 3B1ZA 3TSOA 4EQ6B 1N6PA 4ZDJA 3MWJA 3TLXA 2P5SA 2VIIA 2EFDB 3ZVLA 2E9SA 2ZI3A 4GRAA 4IOMA 2HXSA 3ETLA 4KVGA 1AS3A 3ECCA 3OAAA 5A5GA 2CNWD 2HYDA 4DLXA 3MWYW 4Q19A 2G9NA 4QHTA 4MUAA 3Q5EA 4Q1CA 4H1UA 2YWEA 3JZAA 4Z8YA 3NG1A 3UANA 4DXAA 1OH8A 4Z1MA 3SYKA 3VX3A 2KJQA 2VTKA 4OI2A 3Q9LA 1TU4A 1DG3A 3DM9B 4TT3D 4JL8A 2C78A 1MV5A 2WZQA 1OT3A 4JT4A 4BWYA 1DTSA 2CHGA 5JECA 1W5SA 3NVAA 3ZS8A 3IIMA 1NKSA 1R0WA 4IDHA 3PXGA 1OE0A 1NRJB 4RCZA 2FFHA 4FMDF 3RYTC 4HLDA 3IQXA 2SHKA 1Q44A 4YLGA 5EP2A 2X8AA 1XDBA 1TF7A 4LHYA 3PIRA 1DBSA 1C9KA 2ZIAA 2IYTA 3CRVA 3KXIA 5EZ5A 3R7WA 2XXAA 2GXAA 3RLFA 1KZ7B 2B8WA 1KMHA 2HLDA 1TF5A 3QKRB 4G5SA 4ACAA 1KDOA 2YWFA 2PLFA 3U6KA 3EG5A 3ZGXA 4BASA 4Z8XA 1KZGB 4D4MA 4L4UA 4EUNA 2OBLA 3MWKA 3LLUA 2GZDA 4DLYA 4KHZA 5GADl 1PV4A 4KITB 3TQFA 3LX5A 3MLEA 5DH9A 5FOTA 4BLSA 1XFAA 5FBQB 2O0KA 2HXYA 2NGRA 2NPIA 2NO1A 4X8LA 1G291 3U3JA 1Z22A 3BK7A 3BBPA 2RHMA 3SYNA 1ZUNB 4B6FA 3VKHA 3MRSA 3S1AB 2ZE6A 3KKNA 4TLCA 1LB1B 2J7PD 4AY2A 4NHOA 3THOA 4HUQA 1ZU4A 2YV5A 2IL1A 1CJTC 1HQYE 3A1UA 2BBTA 3RRMA 1G21E 4PO1A 5SZIA 2XXAB 1UDWA 5F9FA 4M1WA 3QEOA 5A0FA 2W0SA 1X6VA 1MO4A 4BLOA 1SVOA 2VQSA 3QKRA 4UNSA 5HE8A 1OKKA 4YMTA 3AP1A 4B6EA 2ZSEA 1XTQA 2ZRLA 1Z06A 3KB1A 5DO9A 1NN1A 5EP4A 3PEUA 4F4IA 3VNVA 2ZR7A 3Q72A 4QGGA 1KSHA 5CITA 4B71A 2Q9CA 3WP1B 2V54A 1LF0A 4CDGA 1P9RA 3EZ2A 4NYJR 4MRRA 4E07A 1GL9B 2ZI6A 1V43A 2NO6A 4KCGA 1NIJA 4EPXA 1EFRA 3GLGB 1XCPA 2F9MA 3AKDA 1E2HA 5FFMA 4KU4A 1E2NA 2GXUA 2TMKA 3QXHA 2QL6A 5EUQB 1XMIA 5KNCA 5M04A 1E2MA 4D0GA 1CLUA 2FH5B 3U4QB 1YJ5A 4YMVA 4A8JA 4NL4H 1DEKA 1TU3A 2JJ2A 2ONKA 1ETUA 1Q21A 4F4CA 4CF7A 5TXGA 3KFVA 5HPYB 5IK2A 1R0ZA 5FPSA 1KO8A 3CX8A 1N6IA 2CXXA 3HYRA 4P3YA 3EX7C 1XTSA 1IBRA 1JI0A 3DKVA 1CR4A 4KFSA 4M8NE 1KK2A 4ZCLA 4JMPA 1RRCA 4GL2A 1FOEB 4OK6A 3BD9A 1AS0A 2FPMA 4PPNA 3EIEA 4F38A 3KQLA 2HCJB 3R9IA 1UFQA 4NYIQ 3EZFA 3PJRA 3THWB 1G8YA 2OM2A 2DB3A 2X77A 4LJAA 2REXB 3QF4A 4DDVA 4I1VA 3H0KA 4K8OA 3IDQA 1HUQA 5KYKA 4BRWA 1XZQA 4EPYA 1KY2A 2WAYA 3LDAA 1SKYB 1P2SA 4C0JA 2A5DA 1W7AA 3BB1A 5C4GB 5C18A 4KLZA 2WJYA 2JJ2D 1GRNA 2ZVQX 1TX4B 2QGNA 4DB4A 4DT1A 4ERNA 4BQSA 1CKEA 1GNPA 4LY6A 5DHAA 1QF9A 1CP2A 5BWMA 4Q1AA 4AI6A 1S9DA 4Q9HA 2ZSBA 1F2UA 4QNMA 2ZEJA 2ZS8A 1W36D 5G3ZA 5F2EA 2W83A 3WXMA 2QRZA 4HATA 2DCUA 3UMSA 2WKRA 1YZTA 4AK9A 2JATA 4PQFA 1X86B 2Z0MA 1S9HA 3SC3A 3ZYCA 3BFXA 1ZW6A 2D2FA 1GKYA 4TMKA 1XCGB 1DO2A 1N5KA 1Z0IA 1DE0A 1UM8A 5L3VA 4JT2A 4JVSB 3PG5A 4LWZA 4PO9A 4WW0A 3T06B 5JEDA 1JNYA 2BOVA 4LC0A 1JQJC 4S35A 2GEVA 4TYNA 3SR0A 1N5IA 2XTZA 2W0MA 3BB3A 2JIZD 3MJHA 1RC8A 3Q8XB 2LKCA 5FL7A 1RVDA 1RRGA 2C77A 3AB3A 5CYOA 4PFSA 2MSDB 3CWQA 1F2UB 2OCPA 3SI7A 1YR9A 4C7OB 2JGNA 3NBXX 5DI9A 3SFVA 1W4AA 3H84A 4RFSA 2IEZA 2YNMA 4UKDA 5JBQA 3RWOA 4C0LA 1LTQA 1XD8A 3ADBA 1Q0UA 1YHNA 1WDTA 5JWOA 3LFUA 1XJCA 2ORWA 3OEHD 5DNYB 2GEUA 3THXB 2W2TA 2VP6A 3I5XA 1G20E 3GJ5A 4A0HA 4MRPA 5FL3A 2WKQA 3KQUA 5E95A 2REBA 1XPUA 3VHXA 2XJ9A 3B1WA 2A5FA 3EA5A 4BFSA 2CVFA 2HT6A 3UXMA 2BKEA 1DAFA 4C4PA 3OFNA 2IK8A 4C7OA 1A4RA 5KU1A 3QENA 3RS7A 4F93B 4AC9A 1YQTA 2AHOA 5HCNA 2IHBA 2R9VA 3K9HA 4ZKDA 1UKZA 2IUUA 4BE7B 3FKSD 5AJYA 1G9XA 1BKDR 4PQRA 2RGNA 4RD1A 2J0QA 3KKPA 2WAXA 1XEXB 4EPVA 4O0MA 1S1MA 4B2PA 1N5LA 4PC2A 1COWD 2L0XA 2WICA 4B2LA 4A15A 3CNNA 4YDSA 4TZ6A 3Q7PA 2IUSA 4M1YA 3FVQA 2FV8A 2G0TA 2KBEA 3GLGE 2J41A 1N0VC 1XXHB 5EE1A 4DDUA 1DELA 2CL0X 3CIOA 3LA6A 1EFTA 2O0HA 3PEYA 4TZ0A 1CJUC 3FFAA 3C14C 1NLFA 3CONA 5K8UA 4G0NA 2QT0A 3FMPB 1DAMA 1A82A 1T8UA 3U60B 1W4RA 1E2FA 1D9XA 2RHDA 1VDZA 1NBMA 3AEZA 2HYIC 4A9AA 4O3MA 2ZJ5A 2A5GA 3SJZA 5JHHB 4W5HA 4KXFB 2V7QD 1AM4D 2JLWA 1ZM9A 5EQTA 3KUDA 4EKDA 2R44A 2ZI9A 1ZM3A 2PL3A 2XAUA 1Q3TA 1SHZA 3U3KA 2ZETA 2WIAA 3IGFA 2PLRA 4LJ4A 2O8BB 1FQJA 5DYGA 5CIQA 2GCOA 3BIFA 3QXXA 3GLIE 2P0EA 4PPGA 1BS1A 2ZRAA 4IXMA 1I2DA 4XOIA 4JSYA 2GJ8A 2CJWA 2PMDA 2JJ1D 4PC1A 3AQ4A 3BXZA 3P20A 4AD8A 4L15A 1AQUA 1P2VA 2YOHA 5G53C 3ZZUA 3CPHA 2P2LA 1ZUIA 4A36A 3AF4A 3M0EA 4FD2A 1B23P 4KLNA 4DCVA 4NMMA 1NL3A 3VR2A 2ZANA 4LBWA 1TQ6A 3DOFA 2ANCA 4LHZA 4QM7A 1L8QA 5DSZA 3R8CA 1YZUA 3JVUA 3RANA 2Q3FA 1P4SA 3E1SA 4QHYA 3W34A 2XZLA 3CNOA 3OF5A 3HYTA 1E9EA 3ZD6A 1XJ0A 1OYYA 1GRQA 2EYQA 3EWAA 2OG2A 2ZTSA 1T8TA 5E7MA 5TMPA 3H4MA 2CCGA 4NCKA 4B3FX 4BLRA 2O5VA 3IHLA 1ZIPA 3AP3A 5LB4A 4B3XA 3F8TA 1JR6A 4Q9LA 2OO7A 1A5TA 3GLFA 5BYKA 4QJ4A 2HCBA 2RGXA 4RKFA 2HDNB 5KDLA 2J0VA 4D2IA 4CEIA 5AUOB 4I81A 1FMJA 2EFEB 5LBIA 2ZVPX 2DR3A 2JJ1A 1A7JA 5KSPA 4NBSA 4HDQB 2QBYA 1GRRA 1UBCA 3RC8A 2IUTA 3IUYA 1JECA 1US8A 221PA 3VR6A 1XD2B 2V6JA 4B47A 1F2TB 4LDJA 1DADA 2V7QA 4I99A 2O0JA 3OEEA 3QKUA 3QBTA 4R71A 2O52A 4Q1DA 5F3WB 1J99A 3GEIA 5JZVA 2HJVA 4B2IA 4XJXA 4D26A 2F1RA 2ODWA 1NSTA 2V4ZA 4FN5A 1RYFA 3K09A 3BAFA 1Z0JA 4U7DA 3KDSE 2B6HA 4A6PA 5JEEA 1IY2A 1FP6A 2WJVA 2VA8A 1Q1QA 2GDJA 2IYUA 4IHQA 3MSXA 3QVVA 3W6OA 3W6NA 4EFNA 5H8WA 1NMXA 1CIPA 5EE5B 1KSJA 4DCUA 2HF9A 2IYXA 3ZQ6A 1US8B 2XZPA 3B5JA 2XTMA 2XOKD 5AJWA 1OB5A 3CR7A 1E0KA 1EFUA 3BJIC 4DIEA 1E2GA 2IWRA 1GIAA 821PA 2IS4A 4ZIRB 2RCNA 3K0FA 4LHVA 1OXSC 2YHSA 4NCNA 3L8YA 2KBFA 4HZIA 2NG1A 4LSGA 4OI4A 1IXRC 2IA5A 1Q1ZA 1VYVA 2IWHA 4XD7D 3BOSA 4OBEA 1I2MA 3N2IA 1VG8A 3ND8A 5DN6D 4UJ5A 2ZM5A 1N6HA 1EK0A 3OHMA 2QAJA 3P4XA 1XD9A 4M9ZA 3D7MA 4PPQA 4DLRA 4EFMA 3FWYA 3NH6A 4DDWA 3K70D 3AVUA 2VP0A 4URZR 1SGWA 4G5QA 3E5HA 1YU9A 4RD0A 3GLFE 3OIUA 2O8DB 2RGEA 4M1MA 4L5BA 4US2R 1NY6A 3U3MA 2A7QA 4XVQA 4UNQA 2I4IA 4NDZA 3CUEF 1P6XA 5IT5A 1YR8A 2J0UA 2GA8A 4ZIRA 3AP2A 5J4VA 2ZU6A 1Z83A 2G0NA 3AV0B 1H8HD 2J7KA 4LJ7A 4TSFD 3RS2A 3PENA 4JS0A 4DWJA 4R98A 3SJCA 2AFHE 2JASA 4R9UC 5FTJA 1R6BX 1W36C 1SXJE 3VQTA 2ZJ2A 4TYWA 1G3MA 1E1QD 2BCGY 4DZZA 4QBFA 3ZJYA 4LOAA 3A1TA 4OHXA 1CRPA 2V6IA 1IY0A 4URYR 2EU8A 3RC3A 1KHTA 2KE5A 4NTZA 2P5TB 4M0LA 1KK3A 2CEAA 4Z1MD 2ZRFA 2GHIA 3THYA 1Z08A 2WJJA 5C46F 4GOKA 4O2LA 4QL3A 5G3YA 3WMGA 1NF3A 4D25A 1PJRA 1QHSA 4B44A 2IS1A 4Q7JB 4I1OA 3ZZ0A 1ZM2A 1PLLA 3TAHA 5FTKA 3RVBA 2J0UB 1Z07A 2H57A 2WIBA 4OQLA 1K6MA 3WHKA 1IXSB 2FF7A 3WP0A 1FW6A 1KO4A 4PZLA 5AK0A 1OYWA 2ZJ8A 3KJGA 5SZJA 4CEJA 2NO0A 5KNDA 1OH5A 2FG5A 4HB4A 1TMKA 4S2EA 2JEOA 3K0EA 2FSHA 4RZ2A 1KO1A 1CJVC 2F9LA 3QE0A 1NY5A 2QMHA 4NYIR 1XZPA 1BYUA 1OXVA 3CO5A 4AKEA 2JLXA 3FHTA 1ESMA 3MCAA 3QPUA 2B7BA 3CBQA 3THYB 4JVLA 3GJ7A 2QRNA 1GKUB 2QGZA 3OIWA 5ELXA 4A0FA 5CIWA 1OW3B 2Z6VA 3LBHA 1GM5A 1Z63A 2IYZA 4GMDA 4HI0E 2GEDA 4FINA 4PPFA 1J8MF 1YR6A 1OXXK 2Z4SA 2GBLC 4RFSB 3CPEA 5FUVA 3TW8B 4P0TA 4BFYA 4BZXA 5L8VA 1U0JA 4ZKEA 3R20A 4WZBE 5AUNB 5IRCD 1G4AE 1TEXA 4KBFA 2XB2A 2ZI4A 5EE9A 5FTMA 3SU8A 3NKVA 2OCAA 3VR4A 3ZIAA 5DISB 3A1WA 1QHXA 2V3CC 1KJYA 2NO7A 1ZM7A 3IO3A 1DAKA 3BWDD 2N42A 2WOOA 2ZUCA 3B1YA 3I4LA 4RVCA 4GI7A 4M21A 2V9PA 2BM0A 5DE3A 3QI2A 4G5OA 4F91B 2PZGA 4JL6A 5JJKA 4J0QA 5B58C 1G41A 1KJWA 5EXXA 3VAAA 4Q18A 4Q7LA 3GP8A 2NO9A 4D4JA 3U5ZB 1KDPA 2R6DA 2PJZA 4KO8A 2B8TA 3DVLA 3T35A 2C99A 1ZUHA 2R6FA 1RRPA 4TT3A 4B3BA 3U7FB 3EC1A 1IAQA 1W48A 2C98A 3SS8A 3VTKA 2A2ZA 1UBEA 1UF9A 3H2YA 4LJ9A 4B33A 3U7HB 3RSLA 3ZZTA 3FPAA 1CF4A 4P31A 3GLIA 1R5OA 4LV8B 4LYHA 3ONWA 3EC2A 5HTKA 2EYUA 4C0HA 3IEVA 1X1SA 4JLBA 1F3OA 2JDIA 3TJZA 4B32A 2QAGB 3U3OA 1S4QA 1W46A 4TLDA 5K8IA 4OK3A 4JLVA 2XZOA 2F3RA 1P61B 4MRSA 4MGZR 4Q5IA 1G19A 1M1YE 3TNFA 1SHKA 4LCBA 5EUMA 4WVFA 1S0UA 1DVRA 3SNHA 2C9YA 4CVNA 4Q1BA 3HPRA 1ZM4A 4Q1EA 1MO6A 1WB9A 5GJWC 1G7RA 2AFIE 4RFVA 3QQ5A 4A1FA 4TMVA 1E1RA 5EXPA 3TUIC 2AK3A 5L3SB 2WWGA 2FFAA 4LBYA 1Z0DA 4LJ6A 3KQKA 3NH9A 3NTUA 4URWR 2B92A 5AJZA 3TSZA 4YMUA 3AGPA 1XNJA 2ZJAA 2G1JA 3E2IA 4Q4JA 1RYHA 5J40A 3AM1A 3TAUA 1WCV1 4RY2A 4B34A 2C03A 3M6AA 1G7TA 3HJNA 4C3ZA 3CF0A 4W9MC 1CEEA 2B7CA 4RJLA 1NG9A 3PCRB 2O8BA 3CZQA 2WWXA 2QU8A 4F4JA 2ZS7A 3L82B 2PX0A 2JA1A 4C0KA 3B85A 3LQRA 2IYRA 1KO5A 4C2TA 1KI6B 5KDDA 1WRBA 2YWHA 4TYQA 5BW8A 1LS6A 1KO7A 2QORA 1B0UA 1ZRHA 5JJIA 3CX7A 3A37A 4ZDWA 2NMVA 3K0AB 3R9WA 5GVRA 3EASA 5IHPA 1NSFA 3UWOA 2QPAA 1GSIA 1N6RA 1IN7A 2XSZD 4DLVA 1WQ1R 2GZHA 1D2NA 3BFVA 4OL0A 3WMFA 2CK3D 2ZPTX 1R8QA 4FXPA 2X2FA 1T3HA 3TBKA 1KKMA 2VBCA 2RKOA 1DAHA 3PUXA 4TLAA 5CM9C 2YWGA 4K46A 1O3YA 4HDCA 3A8TA 4IEEA 4DCTA 1D2MA 2FU5C 3ZLJA 4U5XA 3NDBB 1N0UA 2HF8A 2JIZA 3EA0A 3W5IA 4D4LA 3GCGA 2VL7A 2P6UA 3KUCA 3F3YA 1OFUX 3FFBA 4CEIB 2GXQA 1IN4A 1KI2A 2IYYA 3V4FA 2QM7A 4HAXA 4US0R 2CCJA 4TTRA 1AKYA 4KSBA 3IPYA 2LCFA 1E9FA 3H86A 3AF0A 3EPHA 1SXJC 1JALA 1J70A 2GVZC 2W6IA 4ACBA 1QRAA 1KI1A 3UMFA 5L3QB 3TIFA 3K9NA 4BZQA 1RPZA 4TL9A 4F7WA 2OCYC 5FI0B 3N70A 1Q3HA 4Q7MB 4QG7A 4M22A 2MMGA 4Q1FA 3GQBA 2WVJA 3IIJA 4P33A 4RD2A 3T5DA 1RKBA 1JPJA 3QVUA 3K1JA 2NOAA 2H92A 4OHZA 4EIWA 4DLZA 2FEMA 4N0EA 1ONBA 3Q85A 2BMEA 2WWHA 4GOJA 4DUGD 3GPLA 3I8SA 1NP6A 3GMTA 1R4AA 4MKFA 3W8NA 4ASUD 4AG5A 2QPTA 1JEEA 4O2RA 2UKDA 5JMTA 3NBFA 5IK2D 4X8MA 2BBOA 1UADA 5FBWB 3WRXC 4FMBB 4XWOA 1D8TA 4MGKR 2R6GA 3PUYA 2X19A 4BFVA 1ZMXA 5JS7A 4PHFA 2BEJA 4NCJA 1L4UA 5FPTA 3PEVA 3WY9A 2IEYA 1AIPA 1AA9A 1E69A 4IOKA 4ESHA 1P3JA 4C0SA 1U0HC 1SVSA 1Z0KA 3X1ZA 3IQWA 4DBLC 3AGQA 5JWHA 3UG7A 1LY1A 2RGDA 4CEHB 1RW4A 1HE8B 4JL5A 3SQWA 1N3BA 3KKOA 3QF7A 2NPFA 4MKHA 4JSTA 1HYQA 1MOZA 2AN9A 1E96A 1U2RA 1A2BA 4GP7A 1LF5A 1QVRA 4JLAA 4E03A 2Z4RA 1ZU5A 4KV9A 1OIXA 4F92B 4UNNA 1G16A 1FX0B 1QHHB 1COWA 1XEFA 4ZI3A 4V0NA 1NJFA 1ELOA 3K70B 2C96A 5E7JA 3KX2A 2FN4A 2IXFA 3EZ6A 3OZXA 3WHLA 5EJEA 3P27A 3OESA 4B3DA 2OLJA 4CT5A 1C1YA 721PA 3NDPA 3OIYA 5FOUA 1II9A 4LYAA 2QENA 5E7IA 3VR3A 1XMVA 2GJ9A 3TW4A 4CRWB 2BMFA 1QHNA 1H8EA 1Y63A 1Z6TA 3ZS9A 1E9RA 3UATA 3QKTA 3KKQA 4RD4A 2ZRIA 2WM9B 3AF2A 5FUXA 4BZPA 3KXLA 4PHHA 5J4HA 2J45A 2BHRA 4II7A 4I1SA 1YZNA 3A36A 4D0LB 3MD0A 1Z2CA 5LD2C 2YC4C 3UK6A 4JLPA 2XOKA 2PJRA 4B74A 1FX0A 1QHHA 3R8FA 2O8FB 1E4VA 1F60A 4OYHA 3ADDA 4B3GA 3KJEA 2O8EA 1E94E 1LV7A 1W1WA 2OESA 3K9LA 4NPHA 4PAOA 3SE0A 3QSYA 2FFQA 3OEED 1OV4A 3FKQA 1NLZA 2BIFA 1R0YA 1OXUA 1GP2A 2IS2A 1T5LA 3KXKA 2MSCB 2P6RA 2IHYA 1XBTA 3KQHA 5LB2A 3QKSB 1W47A 4DCNA 4HAWA 4PAMA 3NHBA 1R5NA 4HB0A 4LRWA 4ABYA 4GNKA 2BWJA 1DAEA 1HTWA 2KI5A 1MO3A 4Q01A 3EIQA 3K9GA 1F48A 3NC1C 3NEJA 2DFTA 4UQOA 2G77B 3LW8A 1P62B 1SXJB 1KI3A 3DZ8A 4Q9IA 1M6NA 2H7VA 3KTAA 4DB2A 4MRNA 1J8YF 4WA7A 1L7VC 4QBIA 4GOXA 4ITRC 5K8TA 1SVKA 2DFKB 4LPKA 3BRWD 2AK2A 4M1OA 4A2PA 4MGIR 4D0NA 1JQLB 5ANRB 5CB8A 1D5CA 1XU4A 4Q4AA 2CDNA 4Q02A 3E70C 1LS1A 2IX3A 2QROA 1J90A 1KMQA 1JBKA 3B78A 2VO1A 3WNCA 2WWIA 3SYLA 2BJWA 4Z54A 1PUJA 1HH4A 2ORIA 5HE9A 3I5YA 1Q57A 4LUCA 2ZYTX 2PH1A 5H70A 2GAOA 4JLOA 3X1WA 2J7PA 3VU9B 2J5XA 4MQBA 1ZCBA 1YE8A 3B9QA 1T3LA 3GLHB 1KAGA 1WP9A 4CIDA 4GDFA 2QSYA 1JXOA 2I3BA 4QBHA 3O8CA 4OJKA 1DPFA 2BMJA 5AR1A 1IY1A 1H8ED 1XEWY 3BH6A 1H8HA 2W58A 1MRSA 2OUKA 2DHRA 5LDDC 4Q00A 5L3RA 4KBGA 3C4JA 4TTQA 4C30A 5BN4A 1OIVA 3TK1A 3UIEA 3GD7A 3C41J 4XIGS 1SVIA 2GETA 1HE1C 2NTYC 2HLDD 4B3CA 4MYTA 1VYTA 4TMXA 3P26A 3R9XA 5EXTA 2XNDA 1D9ZA 2DFNA 1F6BA 4N3NA 2OFWA 4TLEA 3F0TA 4C9BA 4AYXA 5DHFA 1G3QA 1DARA 1YZLA 3EXAA 3IHWA 4PHTA 1OB2A 2QAGA 3KKMA 3D3QA 2GCOB 4OHYA 2OXCA 2N1BA 3D31A 4G01B 3TUJC 2FGKA 4BGDA 1AJEA 1W2GA 4ARZB 1JXMA 2CJWB 3SBDA 2DWPA 2AXPA 5KPJA 2RB4A 4EJSC 4R7ZA 2JLSA 3REFA 3A4NA 5J47A 1VMAA 2F43A 2EFHB 3OEHA 4LC1A 2AD5A 3TGPA 1E0JA 3IO5A 2VRWA 2KB0A 8OHMA 3CRRA 4NZYA 1E2PA 2GK6A 2A9KA 5D3QA 5JCZA 2BEKA 2NIPA 3IIKA 2C9CA 2Q6TA 4HAVA 1U81A 4YXWA 1ZINA 4UNPA 1OXTA 4URVR 1RRFA 3KJIA 4LBVA 1FUKA 1S3SA 3DOEA 4QGAA 3SHWA 2XITA 2AXNA 4FIDA 1FTSA 1SVLA 3QXCA 4ZO4A 1VIAA 5KDOA 4V03A 4JLKA 5HR5A 2AX4A 4QGHA 1NIPA 4Q9KA 1IN5A 4DJTA 4QOSA 4JVNA 4NYMQ 3I62A 5AUPB 4P4UA 3TVDA 1U8YA 3N5CA 4ARZA 1S8FA 4EQ6A 1YVDA 5KSYA 3RS5A 1KIMA 1OJLA 2FZ4A 3AVOA 3X2SA 1VPLA 1QG4A 1W0JD 3CW2A 3IILA 2R65A 3P32A 4Q7KA 3GLFB 5DIFA 1Z2AA 1ZP6A 2DPXA 3CB4A 4TQ9A 5CDFE 2C95A 4CYMA 2WWFA 3BE4A 5AWFC 4DEXA 3I61A 2EFCB 2QMUA 3ZVRA 2YOGA 2WSSD 1R0XA 2K5UA 2FPLA 5LPNA 3G0HA 1AKEA 2YINC 621PA 1IQPA 2GK7A 3QIAA 2ZRDA 2A5YB 1JR3E 1QBKC 1JJ7A 4E22A 1KY3A 5B30A 1N2CE 1KOFA 3QEJA 4US1R 4OQXA 1ESNA 4JLNA 4XTCS 1ZD1A 2ZXUA 3EZ9A 3HU1A 4WZ6A 3LW7A 4DC9A 5CLLA 1SKYE 3GFTA 4O25A 2GCNA 2IYLD 4RD6A 4OHWA 4R2IA 3BB4A 5SZKB 4KFTA 4XWKA 1AGRA 3MG9A 3OIVA 4ESVA 3QXJA 1TEVA 4IRUB 4DSOA 2ZRMA 2GJAA 3QG1A 4D81A 3U44A 3PQCA 4XTRA 5GJVC 2O8CB 3P4YA 1NVXQ 2DYKA 3EPKA 1G1MA 2OFXA 4BEBA 1KDRA 1NNEA 3CX6A 2H1LA 3ZIAD 2JJ8A 3T1OA 1ZBDA 1MRNA 1Z47A 2YKGA 4AYTA 4BFUA 2WJIA 2Q9AA 2MMCA 2PBRA 4GFDA 3TR5A 5JRZA 3GJ3A 3LBNA 4TQAA 4TQUS 2P6NA 3X1XA 2XJ4A 4FCVA 4QKQA 3CF6R 5JSZA 1TL7C 1MKYA 2I1VB 3VHLB 1SQ5A 4XD7A 1M34E 2A78A 4KSCA 3TR0A 3TSWA 2IF2A 3RAPR 3VFDA 3WRYC 1Q20A 1NKTA 4KODA 4PR0A 2CLCX 3HWSA 4W5WA 2VH5R 2XTNA 4M9QA 4YQFA 2FDCA 1CBUA 2WPDA 5JRJA 1WBBA 5KSOA 2VSXA 4Q48A 4TTPA 3TVTA 4L9SA 3I32A 3U3RA 5FL7D 1T0HB 3U44B 2O8CA 3O8BA 4LJ5A 1L2TA 3FTQA 4Q47A 2VP4A 4LYFA 4DLTA 3MFYA 4HSEA 3VKWA 1Z29A 4URXR 2KSQA 3AKCA 2B21A 5CLQA 5FPYA 2O8DA 1LNZA 1YZKA 3HPQA 4MH0R 1D2EA 4UNRA 4Y0VA 5FPHA 3LVQE 2F1IA 3UPUA 1UPTA 1CXZA 1ZAKA 2AL7A 3PUWA 3BFKA 5FR1A 1XTKA 4WIAA 3UMRA 5JSZB 2PMKA 2JLVA 4UJ3A 3B1VA 5F9HA 2XX3A 2R8RA 2QY9A 4ZPXA 2R62A 1G64A 2IS6A 1T6NA 4A6XA 3FHCB 3DEFA 2ZI7A 3KQNA 1U9IC 2WJHA 1GKIA 2WJGA 3IKJA 5AJVB 2V1UA 1VYUA 3CF2A 1KI7A 3RRZA 1S3GA 1EXMA 4AWXA 2OLKA 4PC3A
chains in the Genus database with same CATH superfamily
1VIYA 5I9SA 1PFKA 1J0BA 1OTYA 2VEDA 1SIWA 3IP9A 1YA8A 3PP8A 1M2EA 1GUAA 4AN1A 4NR0A 1NC3A 3ZDRA 2JGKA 1Z6YA 2VJMB 2M32A 3DP9A 1EEXB 3A9CA 3JQCA 3V8QA 3HDHA 3FVTA 4J3FA 3CISA 5E6SA 4S1VA 2EF1A 1MX1A 2ZRNA 4KQHA 3SGLA 4F9TA 1PNTA 1WDMA 1WIWA 3Q5DA 3VKGA 3FPHA 3U2QA 4J0IA 5JU6A 2RGGA 3BREA 1XAHA 3HCRA 1SRQA 2EFJA 4DMKA 4CV0A 1W49A 1PWEA 1UK6A 1VLQA 3LOQA 1E0AA 4Q0MA 4D9HA 4OYYA 3GFQA 3N8GA 4R2HA 4BFXA 3QJ5A 3AFGA 2AFIA 4KVAA 4HLUA 4ECAA 1FFHA 4CEJB 4HEJA 4OBWA 4Y1EA 3B7GA 7ABPA 2UZAA 3AKYA 1EWVA 1EFCA 3MTGA 3IP1A 4G5FA 1PT5A 2AZTA 2C5SA 3NKFA 2HF2A 4GYJA 3E1KA 3MBIA 3SZGA 5DJ5A 5JBNA 1DOAA 1V11B 1UBHS 1H65A 3C3CA 2GAIA 4UREA 4J0JA 1CUCA 4M1ZA 2O8EB 5EIBD 2O8VA 4PVCA 2IXGA 3R0ZA 5E6SB 4LCEA 3T5TA 1LFDB 5TV2A 4TVSA 4OH1A 5IN5A 5KPDA 1QGYA 1NJ6A 4YAFA 2QQ0A 1K5GA 1Y81A 4DA8A 4UFPA 1PRYA 2BZ0A 3QKSA 4LDPA 4N5HX 1TJNA 1WQ3A 4DCSA 1LDGA 1TC1A 2J9ZB 4YH1A 4CW7A 2OEPA 5KSZA 2VT2A 1GILA 2Q0HA 4JBHA 5B1EA 3HXMA 3RM3A 2YHUA 1MAVA 1NVFA 2JEZA 3TNYA 4EEZA 5KHOC 4V39A 1UJ2A 3ZD7A 2OA0A 4OIMA 5EMHA 3GGJA 1I4DD 4NMHA 3C4QA 5EL0A 1GNQA 4QC2A 1QHFA 1JSZA 2R25B 2NVOA 4ETMA 3C6XA 3HDYA 3QK7A 5CDGA 1DEAA 1OQAA 1X7XB 4J7UA 1XXHA 4QEZA 2I6GA 1HQKA 5ITZA 1ULUA 3S8MA 4AUKA 5J5CA 3CC8A 3IFSA 4WOPA 2J08A 5AVXA 2FPGA 3L7YA 4Y6QA 1CY7A 2Q50A 1PE0A 3CW9A 2HCFA 3SJAA 1EFRD 1WDKA 3JWJA 4HRVA 4FN4A 5FAXA 3SPXA 4ZT7A 4B4WA 5IU6A 2EJUA 1B1CA 3ZWMA 4W7IA 3S27A 4YCSA 3PLNA 4LY3A 4HNHA 4V3BA 1XZLA 1KC3A 1U90A 1XZNA 3CNHA 3LJKA 4PYMA 4WBSA 5EIOA 5CPFA 3U9LA 4BECA 4AY2A 4XEUA 3U3XA 5HRAA 1RAHA 1P2FA 2RHRA 3A0UA 3BWCA 3RNLA 4ZTZB 2ATXA 4ZVMA 2LKDA 4PWZA 1NF2A 3X2EA 4LTMA 4MEBA 1P7CA 3RSHA 4YCCA 1W34A 1VIVA 1P75A 2FUNB 4P3XA 1J49A 3ZLTA 4E4YA 3BIOA 4UTOA 4F2GA 1W4CA 4GPZA 3ZQUA 5FOWA 3GZJA 4KFUA 3T99A 3M1IA 3KYDA 4IFEA 4Q7EA 2BDTA 3VV2A 5EQDA 3IB3A 1KARA 1Y34E 1K8RA 4QQRA 1L5KA 3A32A 3DBHB 1FS6A 3V42A 3GQVA 3V7YA 4CCAA 1FP7A 1LVHA 3U3ZA 3NWPA 2W43A 2ZJ7A 4FMDB 3VDXA 4WY2A 1S89A 1P0MA 2K7FA 1RD4A 2ZIVB 2CFCA 1RE0A 3ESZA 3CA8A 4PZAA 2QTBA 4X3PA 5CBKA 1C0EA 1RJ9B 4M99A 3LDHA 4DYVA 2ZJBA 2OBBA 2XTAA 3EGDA 3PA6A 3UQZA 3LM8A 5BR4A 1JPNA 4MI6A 3O8QB 2O14A 3DW3X 3H1TA 1QO0D 2LPMA 2QE7A 4W63A 2HIAA 3ADCA 2VF4X 1E79D 1R88A 3EMDA 2WP0A 1SQFA 4X63A 2NUAB 4YJDA 3PFGA 3EB9A 5K3FB 3VVCA 3VPDA 1ZD4A 5DYIA 3W9SA 5E38A 4P5DA 2UU9B 4P5EA 1EVJA 4LXHA 4B46A 2V97A 5A4JA 2JLCA 1G4UR 3GFSA 1AKMA 4UAGA 1AUOA 1T6BY 3FYSA 3GA0A 4OMDA 4J6EA 2I03A 4YQZA 4F45A 1MT0A 1QFJA 1SC3A 3DCYA 4ZOLA 4AU1A 4B4OA 3O2JA 4FMCB 3DZJA 5CYFA 3RQSA 2M6RA 3A1VA 4KX3A 4IFTA 1AK9A 1KDZA 3P9YA 1UDXA 2C8JA 1DQNA 4NE9A 2OAGA 5A0TA 1SWVA 4DLBA 4XSVA 2F67A 4MVJD 4QD3A 4EJFA 1NONA 4Q7QA 3IVMA 5DV9A 3FMFA 3C15C 1DC7A 1F5NA 1KK1A 2FQWA 3ETNA 1GL6A 2R4QA 2QW1A 4MA4A 4AJ9A 5KHLB 2QNBA 4I9GA 3WWPA 2Q0XA 1E98A 4RKEA 5E0KB 1IHDA 3CEHA 4GBJA 4PSAA 3W90A 2B5WA 3CRNA 4YJHA 5BMVF 3GFOA 4HWKA 1E7YA 4R2WA 1CETA 4LV5B 4XR4A 4D57A 4X6LA 4D9KA 5LXTF 3P0HA 1U0BB 2JGFA 4INAA 3GEPA 1M7HA 2B25A 4MQEA 2C4VA 2WHYA 3GBVA 2ZUWA 3EOBI 4JEHA 4OHMA 3TO5A 4D46A 1ULTA 2VJYA 4G0OA 1TIPA 1RXVA 4OIFA 3S2IA 2C3MA 4MR8A 5DNVA 4ND8A 4ZVSA 1EWTA 1M1XB 3QWFA 1S1CA 1LQ2A 4NU0A 1Y9EA 4XDYA 2NWQA 4N0PA 1UQTA 3RS9A 1WEHA 7GPBA 3W3AA 4X1IA 5A0VA 1QTIA 4MUHA 1H22A 4C6TB 1EESA 3JATB 5BNWA 1R8SA 4TPKA 2PX8A 2CL7X 3RRFA 1BA3A 5AMXA 5KUTA 1DI0A 1X80A 1BH2A 1YS2X 5F7ZA 1SQ6A 2OD7A 2VYVA 1ECPA 4U9HS 3QYFA 3R23A 3ZLUA 4JDPA 5B57C 3ESAA 3QU2A 3LAWA 2CBXA 5L3QA 2REQB 1IHUA 3KLMX 3KYBA 4MVJF 2FXIA 4XYBA 5C4MA 2PK3A 1OT5A 1D09A 2G3YA 3CPSA 4UUBA 3DKIA 1KZ4A 1SM4A 2QMEA 2OHIA 2ZCUA 4PZZA 4UM7A 2WSLA 1YR7A 2OCXA 1XMPA 3L1JA 3ZJVA 2WJ3A 1WM1A 4KQCA 1Z4PX 2FMHA 4MB6A 3RDPA 1C8BA 5I8ZA 3JD1A 1W75A 5LP6A 2B5OA 4RQBA 1P9LA 4B8WA 2AN1A 4RANA 5DHQA 1CVLA 3A31A 3EZ7A 3WBJA 1XZGA 3B1XA 1JWAB 1YUBA 1GZHB 3MUFA 3TM5A 2PBZA 2BGJA 1I5OA 2YZ2A 3L0DA 3BEDA 1ND6A 2FK7A 1CS4C 1GVHA 3L5KA 2XMBA 4E6EA 1HBJA 3TKLA 1F7UA 1DS6A 4QOHA 5C1DA 2AE1A 2COEA 4KREA 4MYHA 4B31A 2DUUA 1A7KA 3NHWA 5JJLA 3PITA 5FBLB 2OVFA 3ZDDA 4AVYA 3AUSA 2H5EA 3P1JA 2O0MA 5E4FA 3O4RA 3HJUA 3TUZC 4ZMBA 4IV8A 2A1TR 4NV1A 2VXYA 4U7PB 3VPHA 1L7PA 3EK2A 3PQ5A 1T43A 2WZCA 2IH5A 1IQRA 2FPSA 1VXOA 2N46A 2ZJYA 1JLMA 4HDKA 4KQMA 3CG4A 3KFLA 5CK4A 3CKKA 2JB9A 2PZLA 4MKXA 4OHOA 3O03A 3KWLA 3WVNA 5LXTA 1DBIA 2IOYA 2IVFA 2X5OA 4YT2A 2F1JA 3N5KA 4YX9A 2VBFA 1KGDA 1WW8A 4RY0A 3H2ZA 5C1BA 4R1LA 2IPOA 1EQAA 4HP8A 1EM8B 1SG6A 4IG4A 3RVKA 4YCMA 3PD1A 4P4TA 5IASA 3R3UA 1X8LA 3L1UA 4IIJB 2ADMA 3CLUD 4MCIA 4UBNA 2IF0A 1CTQA 3F4LA 4BX2A 4J7XA 2BI8A 1VG0B 4MVJH 2IZ7A 1JDSA 3L0IB 4ZVUA 5IW8A 2H00A 1G17A 3GEHA 4UXIA 3Q6NA 4PAQA 4UE6A 2DSTA 4EHNA 1IU9A 1JU4A 3LMKA 1Q12A 2NUTB 1PJ2A 3EF3A 2W6QA 3TINA 2Z5FA 4L0CA 1P1CA 4YCLA 2RKBA 1V3QE 3GLUA 4NQRA 1VE7A 4OMFG 4ARAA 4D45A 4F04A 4ESOA 2BF7A 4A0GA 4WNIA 1L4YA 4MV1A 3FUCA 4W7SA 1T8YA 4DQUA 2AVDA 5CFZA 4WFIA 5HW0A 3FJYA 1DJNA 3KZOA 1RSZA 4IKPA 1XKTA 2EW2A 3EJ6A 3HL0A 5DZSA 4YONB 4D56A 1GPH1 1ZONA 3RUCA 1U8FO 4OM8A 4NBVA 3SZRA 5CCEA 1Y8QA 3LY7A 1YMUA 4ANFA 1MC8A 1CZRA 2AC2A 4F1JA 3M3PA 4X7PA 5LCXA 4TKVA 3OQNA 3AVVA 3OPVA 3N9IA 1FTQA 3UEOA 4LX0A 1KSGA 4HPXB 3SF8B 2A0FA 2ZYWX 1Z4JA 3FPKA 2GYWA 4AF7A 1E1QA 3H5OA 2V6GA 3NBUA 2XB6A 2ZRQA 1R2QA 3PHJA 3VZDA 4OLAA 1IONA 4PN3A 1I3NA 2GNOA 4JP3A 4KAJA 1K89A 1JLRA 1FU8A 3F3MA 3KOMA 4QWWA 3UWKA 1GNRA 4E2FA 2JCXA 4R01A 2VSQA 4YP7A 4BYGA 3ER6A 2WHPB 3B6JA 3SXJA 2YMPA 2GTPA 5FNVF 3FMOB 3ZJ5A 4EP1A 4NU8X 3EFEA 3LKVA 3RU7A 1DC5A 4KJXA 4HH3C 3FFTA 1VB5A 4LN1A 1YULA 1UJ5A 3FTNA 4WLFA 4WZAB 5EEGA 5ALIA 5GONA 3ZHBA 5EZQA 4ZVVA 4YLYA 5B2ZA 2FNAA 3SOZA 1QRTA 1DFIA 1ZIDA 5TJ9A 2WJWA 2J09A 1G2OA 2VNJA 4WOCA 5AOAA 1C4KA 5B1DA 1OYOA 1E2KA 3GG9A 5NLLA 4E2ZA 2JEYA 1YNOA 3AJRA 3AVQA 3DKPA 1XI2A 4FGUA 4OREX 2WNSA 5U1PA 4QGSA 3LL7A 1ECJA 1FUUA 3I2FA 3PE6A 4MWEA 4CGZA 1U8ZA 2H4HA 2IUYA 4HLCA 2WF8A 3BRWA 1IG0A 1CDZA 5JG7A 3FDIA 2BFCB 4OOFA 3IQEA 3PQ8A 3QVJA 4MYRA 4OXKA 1V41E 1YAJA 4QDOA 4W9NC 2FWPA 3P0JA 4MWBA 2C8KA 2IT1A 2CWWA 1K75A 1E2JA 3PDJA 3IIEA 1G8JA 3DMTA 2JIOA 1O96B 3RVSA 4FI3C 2FHPA 1M7GA 2IDMA 3ASVA 4G63A 4RY8A 2I8LA 2Q45A 5CM8B 1YONA 3BD6A 2GAFA 1KDTA 4AZVA 6AT1A 2WPDD 1DO0A 1LC3A 1BNCA 1WPXA 2ZAYA 3OOSA 3TZQA 2VWGA 2HHAA 1IJFA 2YWXA 3OUTA 1EVZA 1OH6A 3FNRA 1DLIA 2BFDA 2ZUBA 3CF4A 3NC4A 4M7OA 4KRYA 4ZCTA 5KMGA 3Q6MA 1CZUA 3IBTA 4X8OA 1TQHA 4JUDX 4LYYA 3ZWDA 4ILKA 3O1JC 3CRQA 3U4GA 5T4FA 1NVVQ 5IJ9A 3WGGA 1E2UA 3ETEA 3R0VA 5IX8A 1RM5A 1A88A 3RAFC 4AKHA 4BVLA 3KSZO 2Z6UA 2WUFA 3B52X 3K09C 4L51A 2YIVX 4A3SA 1GA6A 2KHZA 2WPNA 3OKFA 4IZOA 4F9FA 5EJ6A 4OKSA 1XALA 4JBWA 2EKDA 3EEQA 2C54A 4QUAA 4D0SA 3U4IA 4FFMA 4TL8A 2ODEA 2F1HA 4TWZA 4QICA 3KR0A 1G3IA 2B8NA 2FX3A 2QHXA 3I4FA 1KH2A 1RQXA 2E4YA 5ALOA 3P4UA 5FF9A 3T7KA 2FMXA 1BH6A 3G0GA 1ANKA 2R5WA 4D96A 2REOA 3WTBA 4D6XA 3EPJA 3SOPA 4R05A 5FWAA 2J48A 4J07A 1Z34A 3LLCA 5F2NA 1ZNZA 3WIEA 4MMZB 1UMKA 4V0OA 3L0OA 1MFPA 5H1YA 5HIMA 2O54A 5B1IA 4G65A 4PSVA 1BXGA 4OVKA 2EL7A 4FDTA 5BSTA 4Q21A 3TBHA 1C9NA 5GJCA 4HQKA 5IJ9B 3IQFA 2NNWB 1KI6A 2H4JA 3NCHA 4FE7A 1NN5A 4YN3A 4KJZA 4GP6A 1C5KA 1UBUS 2YJGA 5U4QA 1BZYA 3KHTA 2VDMB 4B79A 2BJVA 2FSFA 2NTEA 1T1JA 1ZPDA 2G72A 5JCPA 3TSAA 4Z51A 5CH5A 3UWSA 4IEFB 5LU8A 1KIAA 4EHFA 4KN6A 3OOWA 3LXXA 1QF7A 4YC7A 1KE2A 4ENUA 3IKTA 3PFIA 1DKQA 2OWDA 2QZZA 3UV7A 4PHGA 5CB4B 4JCCA 4IVNA 3O8RA 2UYGA 1SBHA 1MC4A 1O95A 1ZN8A 5CT8A 3W1EA 2VPIA 2EOAA 4HAUA 2SKEA 4IEIA 5KHAA 5A9SB 1CUEA 2EZTA 3AHIA 3AYZB 2EAUA 5FFFA 3PRYA 5KJFA 3I0ZA 2OMEA 1T1SA 3TNDA 1ZI6A 4A73A 2JLZA 3UG6A 4UMVA 2QTRA 4YDHB 13PKA 4QPZA 3QPCA 3U4MA 1JDBB 1B0ZA 2IEBA 4BNMA 3B48A 2GF9A 1J0XO 1UPXA 4ND5A 1WB5A 3PGVA 4G1UC 1TM2A 1E0DA 1GKLA 4XWYA 2XVXA 2NVUA 1I7NA 1A50B 1WMFA 1ODLA 2J3LA 2E49A 1X8KA 2F64A 4X6XA 5LD2B 2YWDA 5EHNA 3WK7A 1SULA 4AO7A 4HQRA 1VGQA 2H2AA 4DSUA 5JMOA 4GOLD 4LRXA 5IDVA 1CNEA 1F8XA 1X1AA 1U99A 2HSZA 3PC3A 4P3KA 4U8HA 2Q7DA 2XYHA 1L4FA 2BMVA 1ZYUA 3L6DA 4P3PA 3ROZA 3ZK9A 1KEZA 3QFRA 2KX7A 3S2EA 1QONA 3DLHA 3RS4A 3G23A 4ZC1A 2JARA 3HFJA 3UK2A 4MB2A 1THMA 3UB3A 4D82A 4JP2A 1JDBC 4H9GA 5FQNA 4ZU3A 5AVVA 3ZR4B 4OHFA 2FPIB 2FW0A 2OCIA 2X2EA 4DNQA 2HMYB 3OHSX 3G9TA 3N2EA 2IDJA 1EVEA 3WQSB 3LTNC 4BUJA 4IJMA 3EYWA 4BQQA 5IF3A 2I4OA 3IKMB 1FTYA 1M3SA 3HBFA 3UT5B 4EVSA 3CBGA 5IWAB 4Z3OA 4C2AA 2CLSA 3AR3A 4JMLA 2VJCA 4PLPA 1W5TA 3JQAA 2VF7A 2F6RA 3P9KA 4G5XA 4A0SA 4E5UA 5L40A 2JLUA 4JFAA 4TS3A 2HJSA 1TPZA 2R1ZA 4Q6WA 4BP8A 2IW3A 1YRAA 2A4KA 3C3YA 4RV4A 2ILTA 3CEJA 3PF8A 4BKMA 3NXSA 4PXAA 1ZVJA 4HDRB 4W1RA 2GHTA 3SZOA 4ZJPA 3E9QA 1GAEO 3VU8A 1JV2B 4DREA 3SKYA 3C5HA 4H2DA 2K7ZA 3RI3A 3D0OA 3FG9A 3CUUA 4N7JA 2ZTMA 2II6A 2XQJA 4MA0A 1Z2OX 1BVYF 5ALSA 3ZY2A 4Q4LA 3OCZA 1P72A 2XW6A 4BN4A 4JXZA 3EH2A 5EGSA 1ISHA 1FA9A 5C51B 1Q95A 3GLRA 4URFA 3QOFA 3HKBA 4M83A 5ALTA 2IUFA 2C0CA 4KQ1A 4MB0A 2D1QA 4R2MA 4XGQA 4BO0A 1JG7A 1F8GA 1SU4A 2QTWB 5LQAA 4OXQA 1MJGM 4O4LB 4OSEA 4TROA 4Y2JA 5FOVA 3W9UA 3JVEA 2HHHB 1VFPA 1JAXA 1KNQA 1YB2A 1G6OA 3FOBA 2IHNA 1YQQA 3TLKA 2FP4A 1O97D 2F62A 2ALJA 3U61B 3HGMA 1XT6A 3FGOA 4X1OA 1OZFA 5TIIA 4IDEA 4X8HA 2P7IA 2C5LA 2ZSFA 3D0KA 4XLLA 4JZKA 1Z8HA 3EEYA 4HDRA 4N49A 3MPUA 4RTMA 1JX6A 4CF4A 1NW3A 3FZNA 3BWXA 2BBSA 4C87A 2VTEA 1TYDE 1R9NA 2VHQA 4QBTA 3PC4A 1HI9A 1OGYA 4B0OA 4GBMA 3VYRB 1QM5A 3TR6A 1A4UA 2VDVE 2ZE7A 2FE4A 2QAGC 3QFSA 1IAVA 4Q9DA 2I80A 2H18A 3CT4A 5FWDA 4IHJA 4ENSA 5B6IA 1F5SA 5HKLA 3DNMA 2X4DA 4D74A 5BWNA 2PUVA 5CYGA 5LJIA 1E3MA 3RTBA 4O4IA 1UT8A 4AG6A 3KB2A 3U7QB 1W6UA 4PCAA 4MJLA 1KMNA 2FZLA 5DM2A 4IIJA 4LDNA 3WLTA 4B6OA 1UKEA 2BKAA 4KK3A 4C89A 3BYZA 1NQOA 2QR3A 4ADSG 1BS2A 1VBMA 1C29B 2JIPA 1BSVA 3INRA 4QUJA 4E15A 3WKEA 1YE3A 3S55A 3FAKA 4JVMA 2CUZA 2HLHA 2UXCB 1JFVA 1ABFA 4DSNA 4MWCA 3L40A 5ILOA 1T5BA 4IUDS 3UK0A 3OQ6A 3ZQJA 1VECA 1XRQA 2HDWA 4OY3A 1K0UA 4MTLA 4AJKA 3T3GA 1CU1A 4A7PA 4F5DA 4D4KA 3TMYA 1PS9A 4ROTA 4JX9A 5EKUA 1EX9A 1ZJJA 2ZQ5A 1P5ZB 2VJNA 2LCQA 2CXQA 1DBPA 4LBZA 3LNCA 3ODPA 4BNGA 5IM4F 1OD6A 2X0NA 1EP9A 4MS1A 3T34A 5F76A 3IR7A 4DYDA 3FNHA 4MWZA 1HC7A 3RVJA 1YI1A 1BVUA 2W71A 5I4BA 2QX4A 3PHHA 4D6PA 4M53A 1GKKA 1HSOA 3RH0A 2HLNA 1NYQA 2KLBA 3ZGYA 3V4ZA 4EH1A 2OHGA 1UAGA 4ZI7F 1TW2A 2BHNA 5FQOA 4CM5A 1E2DA 1OFGA 3EXHA 4A4DA 4CT0A 4K3UA 4LHWA 2P9HA 3N28A 4K6HA 4Y2VA 4XD2A 3T1TA 3ZW9A 5BYAA 1UANA 3EGVA 5K6AC 3D9QX 3BH7A 2IEGA 4ZXPA 3ENQA 4MVXA 4M3NA 3WGZA 2O59A 3O8OA 2B4QA 1MXHA 3GDFA 1U28A 2PJDA 1XDZA 2E4AA 2O6LA 1LCIA 1CIVA 2BFFA 2ZQYA 3EOZA 1KEEB 3M9XA 4FE3A 4TN1A 1EJ2A 1LVGA 1THGA 4J3JA 4OATA 4B48A 4I5EA 4MDEA 3EQ6A 4Q4AB 2H07A 4FS8A 3HGTA 3MM4A 3BHNA 1U04A 3F7MA 3KJNA 3A4IA 4ZV4A 3NHJA 5H3HA 3BX1A 3Q3IA 4J0HA 4EPTA 4XSHA 1UWLA 1XVAA 3M2TA 2CHVA 3O8DA 2CB0A 1G5TA 5JHGB 4MS1B 4WXRA 4MS4A 3NHFA 2ZREA 4BEJA 4RXUA 1OFHA 1ZITA 1HT2E 4ZEMA 2H85A 4AI6A 1EX7A 4BBPA 2ZE8A 1GPLA 1O2DA 1KU0A 2POQX 1G5PA 2IYVA 5JFOA 1YZGA 2EJBA 5SZHB 1I4TD 4P6VF 1BMFA 4ETIA 1IM2A 5CLIA 3RE1A 2JGAA 2WHXA 3D5EA 1VSBA 2D5CA 2IPMA 1FTWA 2OZEA 3ETJA 5IG2A 1ISRA 1TDJA 5DTMA 2JBHA 1R0KA 1EVIA 1TKRA 3D7SA 3UMGA 2UXDB 2D4HA 2NU7B 4GZLA 2LWIA 4GKKB 1WCXA 2IYOA 1QUEA 3DAYA 1Q7EA 2PRIA 5DHTA 3WRVA 5JI2E 4W6ZA 2D3WA 1Z0AA 1I4EB 5D7NA 4B3HA 4KN5A 5LQSA 1GWNA 5I47A 5KYXA 1GDTA 4EA9A 4TZ6A 1EHIA 2O2SA 4JI5B 1E6KA 5GVSA 2AMFA 2X1VA 3HRHA 4RVGA 2Z57A 3P2MA 2Q62A 2R1TA 3GFVA 2Y1DA 2O1EA 3BSYA 3NEYA 2D0IA 3A1SA 3KQWA 3SN6A 2YIJA 3FD8A 4Q39A 4YROA 5HEKA 1M2OA 2W2VA 4DG9A 2JAOA 4QPNA 1JHPA 2C5BA 3TPCA 2EP7A 1DWQA 2OHOA 2X58A 2YY5A 3OE7A 2DWCA 4MWGA 4AURA 5TC4A 1NULA 5IUJC 4HEQA 9ATCA 4MRAA 5AI4A 2D62A 3WS7A 4BQPA 3WAGA 4XKJA 1VLJA 2FPWA 1VL8A 1HE5A 1YVUA 1FMTA 4X61A 3T12A 4Q4CA 1UBGA 2QN8A 3EDYA 1U0RA 4B45A 5AVSA 1CUYA 1T3SA 3L0SA 4Y9SA 2GN2A 3BIXA 4YAIA 5B4TA 2LCIA 2W22A 4JI4B 3A6PC 1RYBA 3EVAA 1MO5A 4X54A 1FL9A 2QJTA 2OFOA 4G1VA 4MYUA 4Q6BA 2C2GA 4MKGA 1MF7A 2QTGA 4PZDA 5JISA 1CR1A 1T26A 3A2MA 2GZAA 4K2AA 5M5BA 2ZYVX 1L5MA 3KZXA 5I9TA 3A6FA 2X7JA 2H59A 1PWZA 2PUAA 2EZUA 1GZ6A 2L2QA 4M87A 3MOGA 1JE0A 2PSHA 4MVJE 3AU9A 2WOJA 3UJ3X 3Q8LA 3AJ8A 4N8EA 2G25A 4KQXA 1T2FA 4YR7A 1QDLB 1U9IA 3B7WA 1QHEA 3G6KA 4R9RA 5F33A 2Q3DA 2ZG6A 4IQFA 1EIZA 2Q21A 3QVTA 1C4OA 1LTKA 1LI4A 1BXGB 1QIJA 1Z3IX 3TH5A 3U7EB 4IOLA 2H06A 2VDRB 1KERA 2ZVJA 3LX4A 4BGEA 1W9MA 5GV8A 4DDUA 4LV6A 4D9BA 2UYOA 3TSOA 1N6PA 3UYLA 3MWJA 4NC9A 3EVEA 1L3BA 1OAOC 1WO8A 3WKCA 5GIPE 1F17A 2P9FA 3C3BA 5LMNB 3DOOA 4UTVA 2NZYA 5D01A 1MAAA 4IXDA 4LX8A 3IT0A 1A72A 2HXSA 3ETLA 1AS3A 1R16A 3RYFB 2X40A 5JFTA 3G0IA 4WN3A 5JC1A 4JU8A 4DCOA 2SBTA 4X90A 1JQAA 1R15A 2JBAA 4QHTA 5LYJF 1A8SA 3GOQA 1HNNA 4Q15A 2XKJE 1T35A 2YWEA 3NG1A 3P9ZA 4QNNA 4RQUA 2RG1A 3SQDA 4UE2A 3VX3A 4PF1A 4BO9A 4PG7A 2VTKA 4OI2A 3SX4A 1OWPA 1RXCA 1EI9A 1UZUA 3PYMA 4FHDA 1CY0A 1DG3A 2VG8A 3DM9B 5G4KA 3RVNA 2FAXA 4ARVA 5JD6A 5K3DA 4NZPA 3RV3A 1U2GA 1RAFA 3U17A 5I3CA 1SFRA 1MV5A 4IHKA 3TZHA 5LWHA 3NYQA 5KKNB 1TUGA 1USIA 1DCFA 2BI4A 5IWCA 2CHGA 4J1QA 4WFJA 3AX6A 1JLHA 4AMZA 5JECA 4PZUA 5J5VA 4JITA 4ZU6X 2B34A 1MAWA 1R0WA 4DTCA 3FUWA 5FYDA 1OE0A 5FWNA 4IDCA 3IQHX 4IIBA 4CM4A 4LMPA 1PSWA 1A77A 3ORFA 4RELA 3NHZA 3IQXA 2W90A 3ESYA 3UCXA 3BSWA 3Q2OA 2X8AA 1H3FA 1TF7A 3PD7A 2GFQA 3ZXUB 4AX8A 3TZBA 4ZOEA 2Q46A 2Y27A 2ZPAA 4XCVA 5CIYA 1V8FA 2ZIAA 5A3QA 3KXIA 2JBAB 4CF5A 4AICA 1V39A 3UAWA 1ISSA 4ACAA 3KHSA 2WFLB 3B3FA 3PGA1 3LY9A 5DKFA 3T9CA 5AW2A 4RVDA 4TYMA 2YWFA 4ZZ2A 3IELA 1TZMA 4D8VA 1WQ4A 4HK4A 3VPXA 3SVTA 4BVAA 3MWKA 2HX1A 4PRLA 3LLUA 1CQIB 3VDNB 3WIVA 5KREA 5GADl 1PV4A 3D6NB 1P17A 2GYUA 3F78A 1TIBA 2PO7A 5BY2A 2B1GA 3V33A 1EXVA 1U9YA 1Q7BA 1JI3A 2FPXA 3H11B 3IHKA 5BP7A 3PDCA 1CNMA 5G4LA 2H0AA 2NPIA 5EQFA 2IIQA 4Z0TA 3CU5A 3BBPA 2FW6A 3K16A 1RCUA 2CXRA 4B09A 1V6SA 3OM8A 4QQFA 2WSIA 4E14A 5DT9A 3KKNA 3U4CA 2J7PD 3MD9A 4NHOA 4E5VA 3THOA 3JQAB 5ERYA 2R7NA 1M33A 3BILA 2OORC 2GRAA 3RKSA 4BP9A 5B4UA 7ADHA 2BBTA 2XHEA 3DQPA 4WV3A 3RRMA 5HM6A 1XVLA 4HRAA 1MEJA 1JQKA 1UDWA 3QEOA 5C8YA 3VC1A 1X6VA 3KBBA 2FPRA 2VQSA 3WMRA 4O6VA 2GWRA 3EXHC 5JYDA 1HYBA 3JASB 1TFUA 1KFEB 2IYAA 4YRRA 1M0EA 1P1RA 2ZSEA 4J2TA 2D54A 1E62A 3I37X 4XIFA 5TQ0B 1NXQA 2PVSA 3U56A 3OJWA 3VNVA 4WKCA 2PLNA 4IFIA 3FBTA 3WWOA 5BW6B 1Z75A 4KACA 5JSFA 2V54A 3GQBB 4CE6A 4HZGA 3DQQA 1B8UA 4NYJR 4P22A 4D4GA 4E07A 2W8BA 2ZI6A 3AC0A 4CIVA 3PKIA 4IV0A 1QXSA 2KPOA 1NIJA 4PGAA 5BSEA 1EFRA 2Z2IA 2AT1A 5B53A 2V6BA 3AKDA 5KJCA 4ID3A 1MQ9A 1UK7A 4YDQA 3HKBB 4JXJA 4IF4A 1M34B 3QXHA 3L8MA 4MZXA 5A4FS 3OFVA 5EUQB 4K26A 5M04A 3WAJA 3GO4A 3JV7A 2ZM6B 3LHIA 3U4QB 1YJ5A 3T7RA 4YMVA 4IGKA 1Y5MA 1DEKA 2ONKA 2W98A 3BGIA 4KXWA 4F4CA 4ZO6A 1TK2A 1WKCA 1XJWA 2BRUA 5DK6A 5IK2A 3W5AA 3PDIA 1E6WA 1R0ZA 5FPSA 3V9AA 3CX8A 4PLCA 1N6IA 1Y9JA 3ETCA 5C34B 5AW7A 4BRZA 1QWOA 1JI0A 4GL2A 1AXEA 4ZCLA 1RRCA 4CFYA 3VDMA 1FOEB 4OK6A 3ZZMA 1T9BA 4DZTA 5LSAA 3C43A 3KHUA 3MMSA 2D2VA 1UFQA 4OM7A 4JI7B 4BGUA 1FRQA 1QV9A 5E9WA 3WB9A 1E5DA 4AFNA 1FNBA 1QRSA 2DB3A 1Q7RA 2REXB 3K2EA 2RJ3A 4YAOA 4F21A 1H1LA 3MCZA 4JJ4A 4K8OA 4O5AA 4OJMX 3GAMA 3DG9A 3UPTA 1HUQA 2XMPA 4O4LF 4BRWA 2R00C 4EPYA 2CGEA 2CMGA 2PUEA 2X4LA 4EEXA 2O19A 3E3AA 4UUNA 3NIDB 4YO7A 3L4SO 3A1EA 4MW2A 3PE3A 1EFKA 4QDUA 7MDHA 4C29A 4PRZA 3BPSA 1NT4A 2NYRA 4Z9FA 4JGGA 2WT4A 1L5LA 4BAZA 2JJ2D 1GRNA 5K3SA 3PKJA 4IUYA 2R6JA 2QGNA 3JAWA 4BNIA 4Y1RB 2ZWPA 4ERNA 2IRWA 4ER7A 2R4UA 3OX4A 3RSSA 2HXGA 3FIUA 5TQJA 1QF9A 4TVKA 2JZNA 4Q1AA 1UM9A 3O9ZA 1H2XA 2FZKA 2VDPB 2RIPA 1S9DA 1LNSA 3DQZA 1T0BA 3EVGA 4Q9HA 5FLYA 1ND5A 4BFCA 3P5SA 3WWCA 5EKSA 4PAGA 1U0NA 1XA0A 4M37A 3PRHA 4X20B 5F4ZA 4W5OA 2NU8A 4OBXA 2W83A 3WXMA 1ZY2A 5LKAA 2QRZA 2WKRA 4GW3A 4NG5A 3ZUGA 4EHLA 2JATA 3BM5A 3Q0EA 4GXNA 5AK5A 4PSDA 2BGRA 1J21A 1ZW6A 3GUHA 5J3JA 5MN6A 1EHYA 4R1QA 4LKOA 5E7QA 4N5MA 3WMWA 3E8MA 1X7WA 4Y98A 3TFQA 1DO2A 5AVWA 2GMWA 5AH0A 1UM8A 1FLAA 4PO9A 4PS1A 1GGHA 2GSDA 1JNYA 2V7VA 4BMNA 4E1AA 4E70A 2E6UX 3W3AH 4UUAA 1I4OA 3HABA 1RLTA 5ALUA 4NBRA 3SR0A 5F52A 2XTZA 3SZMA 3SM9A 2W0MA 1EVYA 3I53A 3Q8XB 3PZRA 3ZEAA 5FL7A 5K0CA 4LZAA 2YHAA 4MQUA 3DMHA 1XMQB 4PFSA 3ESRA 3VSEA 5FCDA 3NBXX 1JZQA 5DI9A 1A9YA 3OFJA 1WD5A 3L9WA 4PZEA 2FEKA 5CRIA 3TSCA 4IIDA 4CMJA 3QFHA 4RFSA 4EELA 2J9GA 3E9MA 3TL2A 4EFDA 4RIFA 4DSZA 4NBTA 2PMBA 1LTQA 3AO0B 4D9NA 1SJ9A 3FZYA 3BHMA 1XD8A 3WZLA 1SAYA 2JRLA 1Q0UA 1YHNA 1Y33E 1Z7YA 3QX9A 3MMZA 4RFLA 4CR8A 1V8ZA 3EXG1 4Z49A 1XJCA 3N0TA 1UBLS 3JALA 3THXB 2GGSA 1SNYA 3IXMA 2OYRA 5AW8A 3G2QA 1ADBA 1X7HA 3GJ5A 2XCQA 4HN2A 3QNMA 5ARCA 2YFHA 5AJTA 4EJ6A 3G2KA 2RK3A 1OZ0A 4NMXB 4J4BA 1QVVA 3OQ1A 5BPHA 1M73E 2QXUA 2WABA 3MT9A 1I13A 4IX1A 3SM3A 2WFMA 2V7EA 2V8BA 4NV0A 5AI6A 2DOKA 5AW5A 3IPRA 5SYAA 1YI0A 1XIVA 2AE2A 1I0LA 2J4CA 4XARA 5KU1A 5CHYA 1U1DA 2BEVB 4F93B 4MPDA 2AHOA 2ZIGA 3WO0A 1FDTA 1A9TA 2IHBA 3O4GA 1T36B 2WKSA 3CY6A 3HM9A 3B20A 3UAGA 2CVZA 3BMCA 3NRCA 4FFPA 3T7TA 2OENG 4GC5A 5AJYA 1KP2A 5HILA 4L22A 1BKDR 5JCXA 4DPKA 1NBIA 5CX1A 2X41A 3AI3A 4P5PA 1PW5A 3BMNB 4HX9A 4HWSA 1NP3A 3BXFA 3PT9A 2E85A 4B2PA 2ADFA 4J0EA 1N1GA 4S2UA 1P7PA 4G1MB 4WCVA 4BO7A 4E5DA 3COJA 1LVUA 4X00A 4RJTA 1SHUX 2IUSA 3UJ6A 1QOQB 4KXQA 2FV8A 1D4FA 3OETA 1U9JA 1XLUA 2NZWA 2CVPA 1XXHB 3GLGE 1WDLA 3RUDA 5JSQA 3P5BA 1DELA 1ZAYA 3AETA 4GGPA 4Y2PA 2PS1A 3LA6A 2FPGB 3FR8A 3AESB 1YZVA 4TXHA 4B80A 4X85A 3EPPA 3FFAA 3C14C 4HJXA 3CONA 2A58A 2G9RA 1HNZB 3L6BA 3PKZA 3R3HA 2I2DA 3CF4G 1G0NA 3LUCA 1UJCA 2MYPA 1KZYC 4H4CA 2FEXA 2AEJA 3KKEA 1OAAA 4EENA 2Y1CA 5FDFA 1EVLA 3I42A 3DZIA 2OXFA 1X74A 4B4DA 3G89A 3L0ZA 1MX3A 2D13A 1E2FA 3LC0A 5ESWA 4CIWA 1W76A 3BD7A 3FHLA 5BSMA 5F7JA 4I3HA 1Q0HA 1VDZA 2OORA 5FD8A 1NBMA 1NJ2A 2OZLA 1UPFA 2WUGA 3CYFA 4DWOA 5FUQA 5LMUB 4CLRB 4C03A 4CTOA 1HDEA 3CJQA 3KQYA 2QN2A 1PEAA 3GOHA 3L8DA 2A5GA 3RTDA 1NMQA 1ZD2P 2YWBA 2QN1A 3N8KA 4B2YA 1R50A 2L42A 4IAOA 4EITA 2I87A 2XQGA 2R44A 3EAFA 3U3KA 1Q3TA 1SHZA 1XZIA 1Y7TA 1ZLYA 2X3UA 3IGFA 2AC4A 2OGSA 3GNTA 1IHXA 3IAUA 1DX4A 1E1DA 5CIQA 2CZCA 2I34A