4TLEA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
218
Chain Sequence
EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPDLSALIERINYAIQKYRARRVSIDSACSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
total genus 78
structure length 218
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tleA00
4IFEA 4RCZA 2OUKA 4PC2A 1ZM4A 1QHNA 2IF0A 3NC0C 4B34A 5EP4A 2O0JA 3OZXA 1U0HC 2ZJ5A 5EE3A 5FOSA 1XJQA 3CWQA 2QEQA 5FBRB 3K0CA 2RHMA 2XOKA 3IKJA 4UQOA 4Z1MD 3TUIC 1SVLA 2CEAA 1TADA 3QPUA 3HWSA 3B1YA 4US0R 4CDGA 3P4YA 3RLFA 3UXMA 5DNYB 5SZHB 2WPDA 1OE0A 1M8PA 4MKFA 2ZRDA 1M34E 2OESA 3CONA 4D4KA 2FEMA 1GAJA 4ZCLA 2PLRA 3IILA 2ZR0A 2VF7A 4B47A 1HYQA 4GOXA 1ZM7A 1YRAA 3NVAA 1Q1EA 5JI2E 1W5SA 1FTSA 3NC1C 3PQCA 3QVVA 1KMHB 2GAOA 3BBPA 2ASEA 4DDWA 1ZNZA 2WKQA 5E3HA 1N5JA 3F5FA 3SQXA 3P4XA 4QM6A 4JJZA 4EDHA 1KI6B 3WP1B 3QF4B 3WRXC 4DUGD 3GPLA 1OH5A 2ZSFA 2RKOA 3MMPA 1G8YA 4B48A 4EPRA 1R5NA 3MWJA 1IQPA 4XTCS 3IO3A 4LYAA 4YC7A 3KXLA 2A5GA 2O8EA 2JCSA 2CCGA 1WDTA 1DAKA 4PSKA 1JR6A 3AVXA 3PUYA 1TEXA 5G3ZA 3GJ0A 4XVUA 2AHOA 2ZI6A 4V0LA 3NEJA 2QAJA 2W6JA 4LJAA 3AGQA 4KYIB 4PHFA 2P5SA 5DGXA 2IK8A 2P6RA 1N6HA 2FH5B 2QM7A 2C98A 1AS0A 3AEZA 3T35A 2ATXA 4TSFD 4PC1A 1Q1ZA 2A5JA 2VHUA 3IQWA 2PLFA 2F3RA 4LZZA 2XTMA 1AIPA 4N0EA 1UAAA 3BK7A 4S2EA 5FOTA 5BYKA 1Z63A 1YZGA 4G5GA 2PBRA 4EFNA 4CT4B 1SVIA 4MRPA 5FBVB 1XTRA 4JZKA 2ZE5A 2ONKA 1KO7A 2OT3B 1R10A 1XMVA 1RJ9A 4AY2A 3NDPA 1YR8A 2Z83A 3EPJA 2OCYC 4EUNA 4D6PA 1A2BA 4Q7MB 1GM5A 3GCGA 4M1KA 4D81A 4LCBA 4PXAA 4AC9A 1E2LA 3BJIC 1U0JA 4OI2A 1P73A 1CR1A 3MLEA 1JQLB 1SVKA 3PVSA 4BRUA 2G9NA 2QAGA 3VTKA 2CDNA 4MUAA 4B3BA 5KSPA 3FHTA 4FMCF 1EWRA 3PEWA 2B7CA 1A2KC 3K0EA 3RSOA 3S1AB 2FOLA 4M1WA 4CEIB 4TTRA 1GKYA 1JI0A 3THYA 5BW8A 1NVXQ 5L3QA 4X8LA 1O3YA 3VU9A 4YQFA 3TGPA 1RC8A 2OLJA 3NBXX 2NPIA 4LPKA 4TL7A 4RZ3A 5DIFA 4Q1BA 3FYHA 4GL2A 4M1OA 1DVRA 4NMMA 2AFIE 3L2OB 2R6FA 1E99A 5E7JA 2WWFA 1G3IA 1H8EA 4Q18A 5EP1A 1RPZA 4NYIR 4L4UA 3VR1A 5AUPB 1LF0A 1K6MA 4Q9KA 4F4CA 5H1YA 3AVPA 3QG5A 2NO7A 4LHXA 2OCPA 1NY6A 4LY6A 4POAA 4UXJA 1GFIA 1ZJ6A 5L3RA 3NH6A 3TQFA 2F1RA 3R9IA 4TT3D 2IS4A 1GILA 3I92A 3TJZA 1JEEA 1KKMA 1XBTA 3CPEA 4RZ2A 3Q72A 2BJWA 2WAXA 4BQSA 3UPUA 1XCGB 4E22A 3CB4A 1KDRA 1NJFA 2HJGA 2QPTA 2ZE8A 1Y63A 2FZ4A 1VYUA 3FMFA 5J4KA 3RABA 4P0TA 1NLYA 3CF6R 4O3MA 4RCYA 1NVVQ 3U3MA 1W5TA 1Q1BA 1SULA 1ETUA 1LS6A 1T8UA 2FU5C 5BXQC 3R20A 1HT2E 4Q21A 1NN1A 4DIEA 3CWZA 4D4LA 1WXQA 2ZROA 3I32A 1QF9A 2J0UB 3CX7A 4JKIA 2D7CA 3KKMA 3NG1A 1NY5A 2WSSA 4LSGA 3W8RA 2HLDD 4UNPA 4QBIA 3RRZA 2WHXA 5H8WA 2JLVA 1Z6AA 1EWQA 1DEKA 4RD6A 2RGBA 4ZIRB 4WVFA 4GBMA 4DDTA 4KJZA 4F38A 2KJQA 1IJEA 2DHRA 5FOXA 4RD0A 1HA3A 1OB5A 5AJWA 1E94E 1KMHA 1RW4A 3AM1A 2J46A 3GJ8A 2H7VA 1RZ3A 3UK6A 5J4VA 1KI6A 4YDSA 4ESVA 3QF4A 4MITA 1OF1A 1L4YA 4FWTA 1RKBA 1KGDA 2XITA 2QROA 3T34A 5BYJA 2BOVA 3WMEA 4DHEA 2VF8A 3EWAA 4PTLA 2HLDA 1XTJA 2OBNA 3EAQA 1KAGA 4GOKA 4M9SA 2BBSA 2F9LA 2PCLA 2IT1A 2A78A 4MYHA 1G41A 4ASUD 2GESA 2JJ8A 1NVWQ 2GVZC 3L0OA 1BO6A 2B8WA 2GXSA 5GJVC 3SHFA 5K8UA 5FOVA 4DLXA 1II0A 3PXGA 2NO9A 4M1YA 2GWHA 1NRJB 2GVDC 4HATA 4B75A 3K9NA 1XF9A 3H4MA 2BDTA 4LWZA 3GFTA 4Q02A 4BECA 3U4QB 1P5ZB 3GQBA 4C0BA 4NKRA 1GDDA 3LAWA 5HE9A 5TMPA 1AGPA 2ZAOA 1YZLA 1FQKA 1NIPA 3KQNA 5CK4A 1XCMA 3A1UA 5EXXA 4A36A 2QRZA 2WMOB 4C4PA 3CW2A 1SGWA 2C04A 2BMDA 3BRWD 4PQFA 2FFAA 4OK5A 2J41A 1OLOA 1F48A 3PCRB 1LS1A 3GLIB 2CHQA 3BIFA 3FMOB 2ZU6A 3FMIA 5B57C 2F6RA 2PT5A 5FPTA 3KQKA 2J5XA 4Q9JA 2PX0A 3W3AA 1J8YF 2WTUA 3BH7A 2A7QA 3VNVA 2CXXA 1Z22A 3S1AA 2IS2A 4JLPA 4CEIA 1XPUA 1U99A 2ECKA 1P9RA 3UMRA 2W58A 4M9QA 4AIIA 2YVUA 3QPWA 4S35A 1TUIA 2E1RA 1KNQA 2GJAA 1NG1A 2C99A 4JBWA 4V0KA 1ZNWA 2YOFA 1YR7A 5KSOA 4EAQA 2Y8EA 4KO8A 5FBLB 4BEBA 5JSZB 2REBA 2X2EA 3IQXA 5CM9C 4L8GA 4Q9LA 4PAMA 3REFA 1FX0A 4A6PA 4DEYA 5EUQB 2V9PA 5TDHA 3QBTA 2J59A 4QL3A 1Z28A 2CBZA 4A15A 1S1MA 1E2NA 2F43B 1I2DA 2EYUA 4HAYA 4LUCA 4PPNA 1D9XA 1W36B 3PJRA 3MWKA 1W4AA 5C1BA 3N2IA 5J40A 2NO1A 2OO7A 4G5RA 2AKYA 4RD4A 1IAQA 4O2LA 1OXSC 1VCIA 4Q9IA 1RRCA 2ZYUX 2JIZA 4NL4H 4DSUA 1EK0A 3REGA 2G88A 3AF3A 5JWOA 3TVTA 1U94A 4LJ8A 3K0SA 5F98A 1X8LA 2J0UA 4US1R 2WAYA 4FW9A 5D3MA 3BFKA 1E2GA 2EWWA 3KQHA 4QHYA 1XEWY 3KJHA 1A7JA 1G16A 1G19A 1TQDA 4DCSA 2VSOA 3ONWA 2JAQA 2P67A 4MGZR 2ZXUA 4A4DA 1JJ7A 4YMUA 4L9SA 4ZIRA 2E9SA 4LJYA 4NYMR 1BKDR 3JZAA 1WBBA 3ZH9B 1HQCA 5EZ6B 4DVGA 1X86B 5FL7D 2ODNA 2O0HA 5C2JB 1T5LA 2G1JA 1KO5A 1U8YA 4O2RA 2FV8A 2GAAA 3CX6A 3K9LA 3KB2A 1YE8A 2J1LA 3M1IA 4I99A 5FTMA 3LBNA 2WWYA 1OFTA 1KY2A 1W4BA 3SBDA 1QDEA 2WWGA 3KKOA 2IA5A 4JVSB 2PZGA 5AWFC 2JJ2A 3H86A 3A4LA 1BYIA 2YNMA 1W2HA 3LY5A 1COWD 2B92A 3K70D 2WWXA 5C18A 2WKRA 1CJKC 1W1WA 2ZR9A 3P20A 4R2IA 2OFWA 3C8UA 3Q5EA 1E96A 4QOSA 4URZR 1RRPA 2IXFA 2PZFA 2QMEA 3PV0A 3B13B 4WOPA 4C2UA 4X8MA 2ZJ8A 4DLTA 4Q9HA 5LD2B 3K70B 4HDCA 3OF5A 4ZO4A 3AVUA 4KBFA 3U4QA 2JLYA 1LTQA 2J0SA 3EC1A 1KAOA 1AQUA 3W6OA 2DFKB 3FWYA 2HCBA 3RRMA 2EVWX 2AK2A 3CRVA 1J7KA 2ZRHA 2VQSA 2DB3A 1EFCA 1KYIA 1B0UA 3VHLB 4M53A 4JT4A 2A30A 1FNMA 1UBEA 1XTSA 1G9XA 1FFHA 4Q1EA 1QHGA 4WZBE 1BMFA 1R4AA 2GJKA 3PIRA 3EX7C 4DLVA 2HT6A 2BC9A 2ZRJA 1G5PA 3DM5A 4HAVA 5FTKA 4NP6A 3GLIA 3FTQA 1IONA 4M8NE 2D74A 4NE2A 2BMJA 4KBGA 3U44A 2WIAA 4TLBA 5FTLA 3KKPA 3H2YA 1TQ6A 4DCTA 5EE0A 3AF2A 4RD1A 2R8RA 5TY0A 3RS7A 4W5WA 4DIDA 1W0KD 4A8JC 2IUTA 4FXPA 1A5TA 1G291 4Q7JB 1C4OA 2NZJA 3V4RA 2UKDA 3D7MA 3KX2A 4CF7A 2ZYTX 1PLLA 4IFBA 1W44A 1VG0B 1UF9A 2ODEA 2IBMA 2PT7A 2P5TB 4LRWA 4N0DA 1FOEB 2DWOA 4RJLA 5C4GB 4B3XA 1WB9A 4Q4LA 1HE1C 1U2RA 5GVRA 4OQMA 1T5IA 2FNAA 3X2SA 1OFHA 4K8OA 4F4JA 4Q7LA 5JSZA 1KO1A 3FHOA 1JR3A 4BRWA 5A4JA 2AWNA 2GK7A 3GJ3A 1Z0AA 4E07A 3BFXA 4GI7A 4AG6A 5DISB 2ANCA 3TQCA 3GLFB 3GMTA 1SZPA 3H84A 4URUR 1GNRA 3MRSA 4ACBA 2NOAA 3IIKA 2ZSBA 1DAGA 5EXSA 5EXTA 1DAEA 3Q7QA 5GJCA 4NBSA 1LV7A 2F7SA 4B3CA 4PSAA 3M4YA 2FPKA 1N6IA 1KI8A 2WSMA 4D2IA 1GITA 1NVUQ 2Q3MA 1RYHA 1TF7A 2FSHA 1E98A 2QE7D 2DWPA 1K5DA 1NF3A 2AXPA 4YMSA 1N25A 1Q1QA 1J8MF 1YZUA 4R71A 1QHXA 5CJ2A 5KU1A 2FN4A 3RS5A 5CJPA 4D4MA 3R9WA 2VP0A 1D9ZA 3QXJA 1E4VA 2Z4SA 3G5UA 3X1YA 1SVSA 1E9DA 5JS8A 2CHVA 3UATA 2J3EA 3QIAA 2JLQA 4PC6A 1FUUA 2PMDA 2VLIA 1ZM2A 2HF9A 2IXGA 4HB2A 4OHVA 4Q1DA 4AURA 4BLRA 3TH5A 2PZEA 1CIPA 2VSXA 1ZUHA 1KI1A 2CHGA 3I3SR 3SYLA 2ZS7A 1II9A 4P4UA 3NBFA 3EWSA 2FGJA 1G1MA 4V02A 1ESMA 2XNSA 4U00A 3QSYA 1G8HA 1GSIA 2V7QD 2YWGA 4X8HA 1UKZA 3DEFA 4Y0VA 4IXNA 2GCNA 1RYFA 1P2SA 2G77B 3K9HA 4TL9A 1KSHA 1SQ5A 2GCPA 4FIDA 1ELOA 4KFTA 2NQ2C 4QJ5A 4NCHA 1I4LD 3QKUA 1VECA 2RB4A 2C2HA 3ETLA 1F60A 4M0LA 3GFOA 5SZKB 121PA 3CRRA 1OIVA 5JCZA 1VG1A 1WCV1 4MKIA 3X1WA 3LXXA 4D0LB 3THWB 3UIEA 1IM2A 3W90A 1JPNA 3NDBB 3I4LA 3K09A 4HAZA 1E2QA 4IDQA 4P32A 4QGFA 4B32A 1Q3HA 4CVNA 2Q0HA 3W6NA 1CJUC 5CDFE 2BVNA 3MJRA 4TQUS 4EFLA 3LNCA 1KDOA 2ZRFA 3W9YA 2YOGA 3BC1A 2Q9BA 2V7QA 2ZRLA 4TLAA 2W0SA 1S2MA 4EJSB 2CK3D 1E9SA 4LC1A 3FVQA 4LOAA 2YC2C 4XH9B 3VQTA 1KJYA 2H57A 4FMDB 4PZZA 2V1XA 1W7AA 3FKSA 4AI6A 2VO1A 4JT2A 1YZTA 1E9FA 1W48A 4GMDA 4M21A 2LKCA 4F92B 4Q00A 2O8BB 1R2QA 1XNJA 4NZYA 2LWIA 3H0KA 5JMTA 2EWVA 4XSHA 3T06B 3ECCA 3CPJB 4V0ME 4PQRA 2XOKD 3KXIA 1FMJA 4HUTA 3GJ4A 4DLSA 4HUQB 3LRPA 3SFZA 2JLUA 4XTRA 2O8DB 1S4QA 5C4MA 4HLUA 4JL6A 4UXIA 3LW8A 2GBLA 3K0AB 2CLSA 621PA 4NHOA 4P3YA 1JAIA 1FNNA 1G3UA 3CF0A 4LBZA 1IY2A 4BASA 1NG9A 3KJIA 3W5JA 3AVYA 1TQ4A 1II8A 4IHQA 2H1LA 2ANBA 1HQYE 4I1SA 1P61B 2CL7X 2RCNA 4LJ9A 3ZVNA 5JWHA 1H8HD 4PR0A 4YLGA 1UKEA 3MD0A 3U6KA 3CH4B 1E6CA 1TNDA 4MYCA 5B30A 1OHHA 2ZRCA 2FWRA 1BH2A 5E7IA 1AK2A 2G3YA 1GKIA 4D25A 2WVJA 2Q6TA 2F3TA 2QGNA 2ZM5A 1T0JB 2HCJB 2WJJA 3F0TA 1W2GA 5DYIA 3ICQB 1FUKA 2Z43A 1DOAA 1E1QA 2XTNA 5TV2A 1XTQA 2R2AA 4BEJA 3KZ1E 2AL7A 1OB2A 1YJ5A 3GLFA 1U98A 4Z8XA 2H16A 1X3SA 3J81k 3IGFA 2FPLA 3VFDA 2W6JD 2XX3A 1H8HA 1E3MA 2IUSA 2RGAA 1CS4C 1M6NA 1N0VC 2FFBA 2C03A 4JLMA 3RWOA 4Q47A 4B74A 1L4UA 3JVUA 4E03A 3MGCA 2XEXA 1XXHB 4B43A 1EX7A 3BERA 1XD8A 2IF2A 4JSYA 3KFXA 3C14C 3HP1A 1AQYA 2GDJA 1EX6A 2GILA 3OFNA 5CLLA 5BWMA 2CNWA 3W3ZB 4JBYA 4XOIA 1N6OA 3TLXA 1G8GA 2H92A 4CW7A 4NCKA 2W2VA 4ZI2A 3D3QA 4KLZA 1Q0UA 4A0GA 2VHQA 4ZI3A 1SVOA 2ZE7A 4C9BA 1DELA 2FMXA 2GXAA 3QNUA 2Q21A 3QXSA 1QVAA 2HF8A 4ZCIA 2QU8A 3DMNA 3P32A 2FJUA 3WYFA 2CMKA 4BWYA 2PX3A 5G40A 2F1IA 1CJVC 3LX8A 2JLSA 3BB1A 3Q3JB 1GNQA 2R6GA 4XWKA 2V8OA 3THOA 2P6NA 2BKEA 4NCJA 1Z06A 2OV2A 5KPDA 1GTVA 1NN0A 4B3GA 1QG2A 5EXPA 3PITA 3FE2A 3QKTA 3CIOA 2IYSA 5F2EA 3F3YA 3O8RA 4KYUA 2OAQ1 2EFGA 2GKSA 1W0JD 1XTIA 4TTQA 2QPAA 3I5YA 2X77A 1GIAA 2GNOA 4RSGA 5KDLA 4LBVA 1H8ED 4TMTA 2KBFA 3RRNA 3WY9A 2A5YB 1G18A 1GL9B 1X1SA 1G4AE 3KQLA 2BV3A 3THWA 3T5GA 2OM2A 4CEJB 3VKWA 5LDDC 3LQQA 4QKQA 2J45A 3CRMA 3FB4A 2GZAA 4AG5A 2AK3A 1NP6A 4P31A 2O8CB 1H65A 1ZD9A 4A0RA 1U90A 4GPTA 3C4JA 2YOHA 4QJ4A 2P3SA 3FHCB 1AKYA 2C78A 1CRQA 1SVMA 2ZRMA 1S1CA 4EJSA 1QBKC 1W0JA 2VSFA 2EFCB 4ESHA 1VCMA 1Z0JA 3EPLA 3O8CA 1T3SA 1E2JA 2JLZA 3SNHA 5B64A 1SXJB 4KFRA 4C3ZA 3RS0A 4ERNA 2O8BA 1SHZA 2GJ8A 4FWIB 3LBHA 3GJ5A 3I5XA 3ZYCA 2B8TA 3HR8A 4LBYA 3AUYA 3CZPA 1YRBA 3NHAA 3ZIAA 4IVQA 4HUQA 1KK1A 1JECA 2VEDA 3CM0A 2R44A 2O8DA 3A4MA 2WSSD 2QT0A 3A4NA 3OIWA 3QKSB 3K0AA 3LQRA 5FFMA 4DSNA 4B73A 1RE0A 4MRNA 4QG7A 4A6XA 1Z08A 2J87A 1UBGA 1VYVA 3AKYA 1D5CA 1KK0A 3IHLA 2VIIA 4HAUA 2BBOA 3K8YA 5A5GA 4F7WA 1PZNA 4HYYA 4LYJA 3WMFA 4C0LA 4PZYA 4DSOA 2H18A 4RZXA 1XZQA 2QP4A 4TLCA 4TL6A 2ZU0C 4MRRA 5EJEA 4EKDA 1R0ZA 1GKUB 3GEEA 3HR7A 2AN9A 2IYTA 3C7KA 3SJAA 1HURA 4RFSB 4DSTA 4Z54A 2V54A 3AVOA 2XGJA 1G4UR 1ODFA 2OCAA 3AKDA 3BOSA 2XZLA 3AGPA 4BE7B 2ZRPA 1T8TA 4ZKEA 4UNRA 4GOJA 4KAXA 1Q3TA 3SYNA 4NYJR 4IDNA 3LXRA 2Q9CA 3MSXA 1P2TA 1ZIPA 1JEDA 3P1JA 3ZQJA 3ADCA 3OEED 2WJIA 1NJGA 2Q3FA 4G5QA 1GNPA 2QMUA 4JL8A 4OJQA 1X6VA 1M7HA 4JLAA 3QUSA 2OBLA 1XXHA 3EARA 2IYVA 2VTKA 3QVUA 2IYWA 4LV8B 4URYR 3RANA 1OH7A 5JJLA 4XWAA 2EQBA 1NL3A 3WBJA 4KSBA 3TVDA 2GZHA 3RSLA 4L15A 1N6LA 2BJVA 3L82B 3CH5A 3TW8B 5CYPA 1F2TB 2EYQA 4YONB 3EG5A 1XD2B 4IKEA 3SHWA 3K0CC 4B33A 4IOMA 4JVNA 3WXMA 821PA 3PENA 2IWRA 1G3RA 1KK3A 5FPSA 4YMVA 3U7EB 3ZD7A 3OEEA 3OEHA 4LC0A 2BIFA 2D7DA 2RHDA 2VHCA 1E9RA 3BD9A 3QOFA 1CJMA 4K46A 1D2NA 2BWJA 2I1QA 3IPXA 4XIGS 3ZZTA 2XB2A 1VG9B 4ON9A 2ZI9A 4DLWA 4KSCA 2W00A 2GTPA 4F4IA 4JVMA 3SJZA 3UANA 4HAXA 5JFGA 3AVWA 3MJHA 5EQTA 3LA6A 1VPLA 4ZKDA 1HH4A 2IC5A 3CR8A 4YXWD 3I1FA 3MG9A 1HTWA 2D62A 4Z8YA 2CLCX 3I61A 1U9IA 1W4RA 1DAMA 5FOUA 1VHTA 5EE9A 2B7BA 4IVPA 1D2EA 4BZPA 2IS1A 1WMSA 1TAGA 3VX3A 721PA 2AWOA 4MKHA 3CUEF 1P72A 2QTFA 3V00A 3AP1A 2ZUDA 5L3VA 1P7CA 2PL3A 2WJHA 3QENA 1YKSA 2BM1A 3HDTA 4JLNA 2ZITA 3PG5A 8OHMA 1CR4A 2YZ2A 1YU9A 2HV8A 1MABB 1RIFA 4NDZA 2ZVQX 1ZIOA 1OT3A 1E2KA 1LF5A 5BN3A 1XPRA 2GJ9A 4Q19A 4YXWA 4CEJA 3CR7A 4LX0A 1ZCBA 2DYKA 1KSGA 1BIFA 1XDBA 3OAAA 2C9CA 1JB1A 1JXOA 2O8CA 1NKSA 3QJYA 2ZI3A 2J7KA 4BLQA 3R8FA 4GP7A 5L8VA 2KE5A 2BMEA 1HUQA 1VHLA 4DLUA 1Y3AA 2AXNA 5KDDA 3LVQE 1TF2A 2O5VA 3NHBA 1T91A 2KSQA 5B2ZA 2XJ9A 4TTPA 1Z83A 3SBEA 2OG2A 3BH6A 4PHHA 1FQJA 1G8PA 4TYPA 4PSVA 2Q9AA 4MGYR 5FPYA 1SXJA 3KDSE 5HKKA 4CGZA 1OFUX 2CVFA 4UKDA 4II7A 3WHKA 2JIZD 4M9XA 5CK5A 3G82C 2ZJZA 2QSZA 1S0UA 4LJ4A 1X8KA 1CP2A 3RNLA 2JJ1D 2RGNA 2YJTD 4YDHB 1W49A 3DM9B 1PLKA 1Z0KA 1GL6A 5IDVA 4EQ6B 3D8BA 3A1TA 3GLHB 3TSZA 1KI9A 1NMZA 2PCJA 2YV5A 4NCNA 4PANA 4TN1A 3DOEA 4MDFA 3QKSA 1IHUA 3LH5A 2WIBA 1YZKA 2QAGC 4PFSA 1HT1E 3QEJA 4HZUB 3KJGA 3VMFA 1OXXK 2DBYA 5EE5B 3TUZC 4DCUA 4UNNA 2QNRA 2GCOB 1Z6GA 2D4HA 3DKVA 3DOFA 3L8YA 4EFMA 3ZVMA 2HUPA 4Q48A 4HB3A 2JJ1A 3KUDA 4JLKA 4CEHB 2RGCA 1P60A 4H9GA 3ND9A 4U02A 4G01B 2F9MA 3HPQA 3R7WB 4FINA 1XZPA 1OYYA 2BHRA 2EFHB 3I72A 3UG7A 4ZCMA 3U7GA 2JJ2D 4KFUA 2RGXA 1OIXA 2J0VA 2ZRAA 5AUOB 2HEIA 5H68A 2WM9B 2FPMA 4RD3A 5AJXA 4HEJA 3TBKA 4YMWA 3WP0A 3K9GA 4BPBA 1T4GA 1Z47A 3OIUA 2DCUA 4TYQA 4B2IA 4TMXA 5LBIA 4JL5A 1CF4A 3AF0A 4B71A 3A58B 4MRSA 2OFOA 2VRWA 3SR0A 5IK2A 4LJ5A 4C7OB 1YR6A 2VPPA 1DPFA 1QHIA 1Q22A 4TZ6A 4WAUA 1PLJA 1S96A 1GRNA 4GZLA 1CLUA 2ZQ5A 5DN6A 1F3OA 1Q20A 1Z2AA 4CRWB 3VNUA 1Z07A 2V1UA 4JS0A 1F2TA 1PJRA 4HDOB 1XD2A 2X1VA 3N2EA 2GA8A 4FCVA 4MKGA 4D26A 4TQ9A 3B1VA 4RY2A 1BMFD 2Z5FA 5K8IA 1KO8A 4Y0AA 4LDJA 4L9WA 3HJNA 4URVR 3NEYA 5JBQA 4DXAA 5LB2A 4DWJA 4PHGA 1G7CA 1E0KA 3B1WA 4Q1AA 3TAHA 2WV9A 2ZREA 2WWHA 4D0GA 3C16C 4V0NA 3VR6A 2PJZA 4BUJA 5JCPA 2C8VA 1ZINA 1CXZA 3W6PA 1E2MA 1K5GA 2ZAMA 3L0PA 4HLCA 2NPFA 3EPHA 5JRJA 1AGRA 2R6DA 3KL4A 1XCPA 2ODBA 4LBWA 4G1UC 4DLZA 1TU4A 4Q1CA 1MV5A 2VP5A 1NVVR 5KTYA 1E1RA 2D3WA 1R5BA 2OBMA 1J90A 3EZ2A 2RGGA 1N3BA 3ND8A 2PMKA 1E2DA 3ZQ6A 4CZ2A 3QBVA 2ZETA 2CE2X 4LJ7A 1JR3D 2WJGA 3FFBA 4DCNA 3LO5A 3E5HA 2OLKA 3DL0A 5HR5A 2WWWA 5EE1A 1KO4A 4Q1FA 2X8AA 4JMPA 3RC3A 4YMTA 3VKGA 2OXRA 2BM0A 3K0FB 4BZQA 5JZVA 3RVBA 5H70A 4PAOA 5CYOA 4PO8A 4US2R 1N6KA 2IL1A 3QPVA 5DI3B 4DKXA 4NONA 2NG1A 1W36D 1EFTA 4OHZA 2KB0A 5FPKA 1HE8B 4G5SA 4L5BA 1DARA 4RFVA 2Q3HA 1CU1A 2IYZA 2JATA 3P27A 4KVGA 4GZMA 1KI4A 4FMCB 1NKTA 4GFDA 4P33A 2LCFA 1SKYE 1OFIA 3CZQA 3ZD6A 1E9EA 3TNFA 1B23P 1IN5A 2KBEA 5TXGA 3CRW1 2CLDX 3LDAA 1TPZA 1J99A 1MO6A 4LV5B 1RVDA 1Z0FA 1S9HA 2ZIAA 4LHWA 4EQ6A 2VA8A 2F43A 3AP3A 3QXXA 3EIEA 3LV8A 1GVNB 1XMSA 3GLHA 3KUCA 2R9VA 3TSWA 3X1DA 5GJBA 4JVLA 3N70A 4JJKA 4NCIA 4R2HA 1G17A 4OHXA 2GJSA 1ZBDA 4KFSA 4UJ5A 3MCAA 1MKYA 2DY1A 2VP2A 5HTKA 1P62B 4HZUA 1VG8A 1N5IA 1P4SA 4ARZB 4JLJA 2B21A 2WICA 2OZEA 2GCOA 2VHTA 5HPYB 1TQ2A 1JQJC 2GZDA 1VYTA 2MSCB 1MR3F 5B58C 2A5FA 2IW3A 2N1BA 3IDQA 3L0SA 4CEHA 3BWDD 4I1VA 3FMPB 4JKYA 3T1OA 2ZEJA 3HU3A 2WJYA 4C0KA 4IOJA 4NYIQ 3R7WA 3GJ7A 3AF1A 4M22A 3RS4A 2HXYA 3FGNA 3IO5A 2ZJBA 1GRQA 2HJVA 3NKVA 4JYBA 4B76A 3KJEA 4QGAA 3ZZ0A 4OI4A 1TU3A 2EU8A 1E2HA 1WE2A 4JSTA 1QG4A 2RGNC 1AS3A 2W6IA 1T3LA 3QQ5A 4OHWA 4XD7A 2AX4A 2XTZA 4UXHA 1RRGA 1G7SA 1F2UB 2HYDA 4G5OA 2XZOA 1DE0A 3FPAA 1LY1A 1MT0A 2FG5A 3RS2A 3OESA 4HB4A 3TMKA 3W34A 4DCVA 4A0FA 2A9KA 2ZI7A 1KHTA 3MFYA 4Z51A 6Q21A 3QG1A 1KI3A 4AKIA 4HI0E 2G6BA 2ZJOA 3MAAC 4Q66C 3VAAA 3EXAA 1ZP6A 3SJCA 4EIWA 2FDCA 4B35A 1CR0A 1I2MA 2QUZA 3FKSD 2AR7A 2W83A 3HU2A 3Q7PA 1GL7A 4L16A 4ZDJA 3HYRA 1G6OA 1KNXA 2UZIR 2Z0MA 3GEIA 1I4DD 4A0HA 4LGMA 4OI0A 5EP3A 1F6BA 1ZU4A 1VMAA 1UDXA 1NLZA 1UEIA 4WW0A 1FL9A 4MA4A 3Q5DA 3C5CA 4BGDA 2C95A 4V0OA 3A8TA 3QKRB 4NYJQ 5KNCA 4BFVA 5FBWB 4PZLA 221PA 2ZVPX 3B7GA 1OXTA 1UM8A 2VYFA 1OPXA 2XNDA 3OE7A 4EPVA 3VR3A 1E0SA 3GD7A 1C1YA 3QF7A 4DT1B 1ZNXA 2J9RA 4EPWA 2J0QA 1E9BA 3EC2A 3OIVA 3KTAB 3PUVA 1E79A 2E87A 2GXUA 3ZS8A 5J47A 4A9AA 1WQ1R 2JASA 1V43A 3GJXC 1NBMA 3PEUA 5TARA 3ZGXA 2I4IA 1M1YE 4KODA 4UNSA 4AK9A 1BOFA 5E7MA 5K8LA 1Z6XA 3BS4A 5L3SB 3GLGE 2ZRKA 4PPQA 3X1XA 3P26A 1IN8A 2D2FA 521PA 1KY3A 2BBTA 5EP2A 1M7GA 4JLVA 1CR2A 1OHHD 3O8DA 5FUXA 2VP6A 1XB2A 4A1FA 1AS2A 2W0MA 3QXHA 1FTNA 2D06A 1XFAA 3QXCA 4QHSA 3I62A 3EPKA 2QTHA 2FSGA 5P21A 1PVOA 4MGIR 2BMFA 2Z6VA 3WYGA 1E1QD 1ESNA 1BYUA 4AD8A 3ZVRA 2GRJA 2IEZA 1KIMA 2QMHA 3K0FA 1VIAA 4IW3B 2JLXA 3B1ZA 3MUFA 1R8QA 5K8TA 2QY9A 4PPGA 5EUMA 3R8CA 2CE7A 4H1UA 3IIJA 4OQLA 1KDPA 3B85A 5DI3A 1XEWX 2ZR7A 1NIJA 1RFLA 2WOJA 1IXRC 1XU4A 5JI3E 1E2PA 2P6UA 3LX5A 2J7PA 4IEEA 1ZW6A 3GLFE 2XJ4A 3M6AA 2RH5A 2YYZA 1E2IA 4JLDA 4V0MA 4GNKA 4QRHA 3GP8A 2NMVA 1VCOA 2ZI4A 3OFND 3TAUA 3AKCA 4C30A 1YZQA 4BFXA 3KKQA 2CNWD 2OXCA 3RHFA 1A1VA 3EA5A 3AQ4A 5HZHA 2QZ4A 1KZGB 1IBRA 3BE4A 1ONBA 1UADA 2ZPTX 1CULC 1LW7A 1G3QA 1JNYA 1Z3IX 4ILEA 2WOOA 1S8FA 2FSFA 5FUVA 3LD9A 3FDIA 1Z6YA 1P9NA 2REXB 1RRFA 4TYNA 5FTNA 3U6BA 4D80A 4TLDA 4LV6A 4A92A 4DBLC 3KQUA 2FSIA 4WZ6A 5FR1A 3PUWA 3AVTA 2RGEA 1ANKA 3BH0A 4R9UC 2YHSA 4ARZA 1TEVA 5SZJA 1JPJA 2FEOA 5F9FA 1G7RA 2XXAB 4G0NA 3JVVA 1MRNA 2ZSAA 1E2EA 4NU0A 2ZJYA 4Q03A 4GP6A 3B78A 1OXVA 1ZCAA 4Z1MA 1E4YA 3PUZA 1MRSA 5DE3A 2WWIA 5BQ5A 3SI7A 3AUXA 2BCJQ 1FP6A 4AYTA 2WMNB 2R6AA 3GFPA 3U2QA 4BFWA 4GT1A 3EZ9A 1O87A 3SQWA 3QY0A 3WYAA 4QJ3A 1AJEA 1D6JA 3UG6A 1Z0IA 1YZNA 4LHVA 4F93B 2V3CC 5F3WB 3IEVA 1DO0A 1W47A 2QM8A 3PEYA 1G5TA 1HEIA 5A0FA 2R6CA 3SFVA 5D3QA 4A8JB 4BLOA 1F2UA 4JYCA 4LYHA 3UWOA 1W36C 3UKDA 4Q01A 4C7OA 2FFQA 1TF5A 3VR5A 2YWFA 2VH5R 3LW7A 1S3SA 3C15C 3ZS9A 3CBQA 4ZDIA 1E9AA 4FCWA 4XWOA 2IXEA 4DUGA 2IEYA 2QORA 4TL8A 5E95A 2ORVA 1N6NA 2DR3A 4MGKR 1NLFA 3DVLA 5FR2A 5DHAA 5IF9A 4RKEA 1ZUIA 4QFMA 2WJVA 2X19A 1Q21A 3EA0A 3I8SA 4CYMA 3OIYA 4C0AC 2DFLA 5HCIA 3U7HB 2C77A 2C9OA 4FCTA 2QP3A 3T15A 5KDOA 4LPSA 4B3DA 4ACAA 1OH8A 3HPRA 2ZUCA 5E4FA 4W5HA 3NWJA 1XWIA 3SDZA 3ZIAD 3NIBA 1GG2A 4NYMQ 1A82A 3QKRA 3SYKA 2ZE6A 3VKHA 2BKUA 1G21E 1KOFA 1GWNA 4J0QA 3DPUA 4BFZA 3B9PA 4QHTA 2G0TA 4I81A 5GADl 4TSFA 3CRQA 1L7VC 1JBKA 4TWZA 1YVDA 1QHYA 1ZM9A 3UWKA 4DT1A 1Z6TA 2NZ8A 3KTAA 2OFXA 4Q5IA 3THXB 5DI9A 1EXMA 2AKAB 1QHSA 2ORIA 3ZDQA 1KJWA 1QZXA 1JALA 1AN0A 2QT1A 4PPFA 1XPOA 1W4CA 1UEJA 4QM7A 5L3SA 3CX8A 4B3FX 4TZ0A 1IXSB 1UPTA 1N6PA 3CNNA 5ELXA 3AH8A 1OW3B 1J70A 3O8BA 3TKLA 5AJYA 4URXR 1WRBA 1IN4A 5IRCD 1P2VA 4CIDA 3K09C 4LI0A 4PC3A 4CT5A 3NXSA 3A1VA 5J4YA 2L0XA 4BLSA 1DBSA 2NTYC 5FBQB 2QL6A 3ASZA 5CM8B 1R0YA 5EZ5A 4RZUA 1FX0B 3SN6A 2P65A 1XEFA 1ZUNB 3WRYC 3ZJYA 5JEDA 3K70C 5LD2C 4D0NA 1MOZA 4C0SA 4XJXA 2IX3A 5CLQA 4BFSA 3KB1A 2IYUA 4WZAE 5DHFA 2UZ3A 4BLTA 2YWEA 1SKQA 5J4LA 3BFVA 2QPOA 3U3JA 2VBCA 1R5OA 4NPHA 3NTUA 4ABYA 5JWRA 1UKVY 4QBFA 1YR9A 5IHPA 4N1AA 3GEHA 1GZSA 1XXHE 3DZDA 2JEOA 1IOZA 4KITB 2HXSA 5DLQC 1DO2A 2PJRA 1MO3A 1P75A 1S3GA 4B2LA 4KU4A 1N5LA 1FW6A 4HLUC 4KXFB 3OEHD 2B6HA 3L0IB 2GBLC 4R7ZA 4TT3A 5JRZA 5D3MB 1PUIA 4TMVA 2V6JA 4KVAA 3A6PC 5FL3A 2G83A 1KI7A 2DWQA 4H1VA 2ZUBA 5AUNB 4OK6A 2GETA 2JDID 4DZZA 2RGDA 1WP9A 4HDQB 3DMDA 4AKGA 1P3JA 2IYQA 1AM4D 1ZAKA 2JLRA 2YINC 421PA 2ORWA 4UJ3A 2C5LA 3TUJC 3U3OA 1WA5A 2C96A 2XXAA 4Q4HB 3W8NA 3DHWC 1G8FA 1JAHA 1U8AA 1U8ZA 4DLYA 4HLDA 2XSZD 1G6HA 3RYTC 2QG6A 4LHYA 3O47A 3X1ZA 1XD9A 3RWMB 5J4HA 3AVVA 3VX4A 4AKHA 1P9WA 4NTZA 3EW9A 4MH0R 2OAP1 2ZI5A 4P4SB 2R65A 3T12A 3SE0A 3C41J 2PEZA 1IJFA 3GJ6A 5FUYA 3AV0B 4TYWA 2JDIA 4F91B 3FOZA 4M1TA 1DAHA 4A2WA 1D2MA 4FMDF 2A3RA 1VKJA 3B6EA 3R9XA 3SEAA 1IXZA 2EFDB 2VP4A 4C0HA 2QENA 1PV4A 1XX6A 4PHTA 1LB1B 3IBGA 4A8JA 3W5IA 3OAAD 2OSBA 1NSTA 1IY0A 1LFDB 3SZRA 5FPHA 2XSZA 4NH0A 5TB5A 1XMIA 4DC9A 1FMLA 1T0HB 1A4RA 1ZC3A 4JLOA 2R62A 2MSDB 2JA1A 2QGZA 2DPXA 4E5UA 3WHLA 2NO6A 1HV8A 3AVQA 2ONJA 4LYFA 4QGGA 5LPNA 1CBUA 3H1TA 3CLVA 2O52A 1ZU5A 1DS6A 1KJZA 4DRZA 4R98A 2CL0X 1XEXB 1SXJD 5HKKD 1JJVA 1S9DA 3UMSA 1MH1A 1R7RA 4ASUA 5FI0B 3U5ZB 2QTVB 2BCGY 4PO9A 2C9YA 3L43A 5HCNA 2P2LA 1L8QA 2QP9X 4JIMA 3CKLA 1EFRD 3LFUA 4A82A 4DEXA 3ASYA 4OQNA 5TVKA 1XP8A 4EPTA 1SXJE 5KPJA 4TQAA 3U44B 1DG3A 5JHGB 3B5JA 2FZLA 4I1UA 4QNMA 5CB8A 4IVRA 4XVQA 4LK2A 2YWHA 3E70C 5AR1A 5BN5A 3AP2A 1MO5A 3EZFA 4BFYA 1WBDA 4BZXA 3IEUA 3I73A 3KKNA 5KSZA 1E32A 3TK1A 4ZV4A 3BORA 3THXA 3ADDA 2BEKA 4I4LA 4W9MC 3JZMA 4IEIA 4B44A 4FMBB 4KCGA 1TMKA 3AF4A 3C5HA 4M2LA 4PO1A 2GEVA 1OYWA 2QRNA 1NN5A 1EFRA 2UVQA 2W2TA 3A36A 3BAFA 1VTKA 3WBKA 1Z2CA 4GMXA 3B2EA 3EIHA 2SHKA 2H8KA 5KHOC 3E2IA 3V9PA 2O8FB 5KOYA 4U5XA 4KV9A 5AJVB 1ZD8A 2ZRIA 4HAWA 2CCJA 4HZIA 4WIAA 4WBSA 1ZC4A 3RS3A 3BB3A 3WMGA 1TUEA 2ZSEA 2CJWB 1QRAA 1X1RA 1US8B 1ZYUA 2IYLD 2LKDA 4FD2A 1KMQA 3LLMA 1Z0DA 2A2ZA 3VR4A 4C2TA 5KNDA 2XZPA 3K53A 3RAPR 4EJSC 5KUTA 1NSFA 1G3MA 5IK2D 5UKDA 2IS6A 1T3HA 1SKYB 4HSEA 4OQXA 2FFHA 4TMKA 5FH9A 1QHHB 4Q4AB 5KO2A 1P2UA 4OKSA 4RFSA 2IYXA 4RD2A 2ZS9A 2ATVA 1HY3A 5DN6D 3HU1A 3T5DA 5BN4A 2QBYB 4KI0A 1FP7A 1NI3A 3F8TA 4OJKA 3OHMA 4Q4JB 1BS1A 3RDPA 2F55A 2V6IA 3CNLA 3D31A 4C0JA 1ZMXA 2ZRNA 3IIMA 3KXKA 3Q8XB 5AK0A 2OE2A 1FZQA 4ZPXA 5SZIA 3BXZA 1AKEA 1T6NA 4QXAA 1K8RA 4V03A 3SOPA 4AWXA 1ZD1A 2ERXA 1DTSA 2W2XA 2N42A 4TLEA 4M4SA 3PEVA 4BLPA 3U7FB 1G64A 1UKYA 3TIFA 5HZKA 1MO4A 4URWR 1M74A 4DB2A 3A1SA 1SHKA 3SJBA 2VP9A 1KKLA 3ADBA 5G53C 5G41A 3SU8A 2ODWA 2ZJ2A 3T1TA 1QVRA 1N0UA 3QI2A 4KLNA 3QE0A 2DFNA 4MYTA 4Q4HA 5M04A 1EG7A 1FPMA 5DSZA 2FA9A 2FGKA 1OH6A 3CF2A 2NGRA 2WBLC 5FUWA 4DJTA 2ZS8A 3T61A 1VCNA 5KYKA 1E0AA 3U60B 5CIWA 2ZRGA 3WNCA 1N2CE 2QN6A 4JLBA 5JLJA 2GEDA 4P4SA 1T9HA 1E1RD 1WF3A 4TMWA 3Q85A 3LVRE 1M7BA 2QQ0A 2ZTSA 2VL7A 3IHWA 2IHBA 1XMJA 1N6RA 5CIQA 3GLIE 3B82A 5FL7A 2F1JA 1TTTA 5G3YA 2NIPA 4QC2A 1AZTA 1DADA 2AD1A 2FE4A 4PX9A 1X8JA 3WNDA 1Z29A 2YC4C 5J5CA 5DH9A 4FI3C 4IJMA 4AYWA 1TL7C 4C0QC 1F5NA 4OYHA 2OCBA 4GRAA 3UMFA 4E09A 1EFUA 4IXMA 1COWA 1MABA 1XEXA 3L8ZA 4M1MA 1OJLA 2GF0A 3IUYA 3ZZUA 1XRJA 2IUUA 1OSNA 1C9KA 4BFUA 3ADKA 1XJCA 1G20E 3I8XA 3B9QA 1R0WA 3RC8A 3T1VA 4MRVA 3EZ7A 5ANRB 4QBHA 1JR3E 4DDVA 3HYTA 4MUBA 1J2JA 4MDEA 1VDZA 3BGWA 3WNBA 4EPXA 1OKKD 1P6XA 1KK2A 2REOA 4OQFA 2QQEA 4OI1A 3GLGB 2XB4A 1U9IC 1JXMA 2O0KA 1GUAA 1ZNYA 3DKPA 4PC7A 1CEEA 1II8B 2H17A 2WZQA 4W7SA 3PR1A 4IRUB 2QMOA 3GLHE 4RVCA 1LVGA 1SVWA 5KSYA 2QI9C 4G3XA 1UJ2A 2WKPA 1VIYA 3TR5A 1U81A 3V4FA 5IT5A 5HE8A 1CRPA 4D82A 1EESA 2EFEB 5CB6A 4I1OA 4O0MA 1UDWA 3MWYW 1M2OB 1W46A 2MMCA 2O8FA 2A5DA 2G1KA 1OKKA 1KSFX 4OBEA 1N0WA 1NNEA 4PQYA 1UBCA 4ITRC 5KNBA 4DB4A 4QGHA 1W0KA 3CNOA 1AZSC 2CJWA 1US8A 1XTKA 5F9HA 3EASA 1G7TA 2I3BA 2W6ID 1NMYA 4XD7D 3TE6A 2EW1A 2VHJA 3KFVA 2GHIA 5LB4A 3TSOA 1IN6A 1OIWA 5FTJA 3EIQA 1KSJA 2OHFA 1NN3A 1Q12A 2OILA 5FOWA 1QHHA 4Q4AA 2ZANA 2K5UA 2TMKA 3TRFA 2F1HA 2ZJAA 1SXJC 4B6EA 1CJTC 2X2FA 4IDPA 1ZM3A 2OEPA 1UFQA 1KI2A 1LNZA 3DO6A 3QEOA 2QSYA 2O8EB 2QBYA 4RKFA 5JJIA 1GRRA 3BB4A 4Q4JA 4XVRA 3U3KA 2I1VB 1E69A 1E2FA 4DDUA 3IPYA 3FFAA 2ZRBA 3TW4A 3U61B 4KHZA 4DLRA 2GK6A 2XAUA 1R6BX 2HDNB 4GDFA 4LJ6A 2AD5A 1Z8FA 3A37A 1D8TA 1U0LA 3FKQA 4TMZA 2V4ZA 1Z5ZA 3B1XA 4IDHA 1YHNA 1PUJA 3NBYC 3CO5A 4FN5A 1OV4A 4IOLA 1GP2A 1IY1A 4WXRA 4N3NA 4HB0A 1CKEA 1E0JA 4UNQA 2P0EA 2XNDD 3OE7D 3LBIA 1R8SA 2N46A 5AJZA 1ZRHA 4B6FA 5JEEA 4QNRA 2CCKA 3ZVLA 2Z4RA 2QE7A 2NO0A 4D4JA 5JS7A 3B8HA 1OXUA 1KZ7B 5FI1B 1E79D 5JECA 2H5EA 2PH1A 1G5RA 1ZVQA 4MQBA 2BBWA 3SC3A 1NBMD 3VR2A 1DG1G 3A1WA 4GSYA 1AA9A 1KTVA 2V55B 5DYGA 2IWHA 1GOTA 3SS8A 5GVSA 1R0XA 3LWNA 2HYIC 3VHXA 5AUQA 2IYYA 3DZ8A 1RJ9B 2KWIA 4X8OA 1Q44A 2CVHA 3CPHA 4AKEA 4M9ZA 2KI5A 4JBXA 3AB3A 1NBME 2ZSDA 4U7DA 4HLQB 1CTQA 3B60A 3IBYA 3NH9A 4IOKA 3T1QA 3PFIA 3ICEA 4MYUA 2IYRA 3PUXA 5C46F 2DFTA 2QAGB 2RAPA 2PEYA 1IN7A 5DO9A 4Q7KA 4B2PA 4K81B 3G0HA 1YQTA 2MMGA 3THYB 2HT1A 5L3QB 2FX3A 3M0EA 4TYYA 4EPYA 3VU9B 2AFHE 4M1SA 3N5CA 1KDTA 1E9CA 1EFHA 2FF7A 2J7PD 4OL0A 4AYXA 4LHZA 4O25A 4QBGB 4BFTA 3Q9LA 4OK3A 1N5KA 1NMXA 5CDFA 2GXQA 3ZLJA 2JGNA 1DAIA 2D2EA 1EGAA 1UBFA 3K1JA 1DAFA 2QA5A 1TX4B 3TR0A 2CL6X 3MWLA 3LLUA 4ZDKA 1V5WA 2RMKA 5JHHB 2BEJA 3EZ6A 4PAQA 4XSGA 4A2PA 4OHYA 2GF9A 1L2TA 2ZYVX 4WXPA 4WA7A 4ZDWA 3RRYA 5GJWC 3D6TB 4P4TA 2ERYA 3NBZC 2WPDD 2CK3A 3AKEA 1I4TD 2G0NA 2JLWA 3DDCA 2MSEB 2ZYWX 2IHYA 4IDOA 5CITA 2GEUA 1XJ0A 3U3RA 3E1SA 3GLGA 1Q57A 4W5JA 2YKGA 4A2QA 5JJKA
chains in the Genus database with same CATH superfamily
4IFEA 3STUA 2AC2A 1NMEA 1PGNA 1ZM4A 3H7IA 3PSAA 2IF0A 1H0RA 1I3LA 1SPBS 1U2DA 3B1FA 4J0KA 3VPDA 4AJ9A 1ISGA 2O0JA 5B55A 3IJRA 3AR4A 3N8NA 4IQ8A 3ETJA 2O06A 2RHMA 4DADA 1P9LA 1K2VN 2CEAA 1SBNE 4OP3A 3D1JA 1M2OA 1WJGA 2WDPA 2RHGB 1WHSB 3B1YA 3HWSA 3EUEA 3O03A 1RACA 3UXMA 5ALEA 3E9CA 4FOPA 1OA0A 3QXGA 5JNVA 3J80A 4GU5A 2G6TA 4IIVA 4MK4A 1M34E 4D4KA 2MYNA 3JQFC 4KO2S 5JATA 1F6WA 3IILA 3HBNA 1S8NA 4QPZA 1HYQA 1PGPA 1ZM7A 1SBZA 1YRAA 2Y67A 3AW8A 3HBFA 3NVAA 1W5SA 3JAWB 4OU5A 1ZAYA 4ENRA 3QJGA 3O4GA 1B00A 3GWGA 4J4HA 3BBPA 1DDIA 2GK4A 3DD5A 3KFLA 1XE3A 4OQZA 3HEBA 1T10A 4F3YA 2WKQA 4AULA 5E3HA 3F5FA 5JXHA 2AZXA 4J49A 1MVNA 3DUFA 3VR5D 3WP1B 1BX3A 3QF4B 3NDRA 3TTVA 4BMSA 4XQCA 1P39A 2C1XA 1XTTA 4MVJF 2QVCA 4S1VA 3VJMA 3WRXC 4DUGD 5HKOA 2RKOA 4AZ0A 2Q1XA 5AI9A 3MWJA 1K5HA 3NVMB 1LI5A 2VXOA 2Z30A 2ZVJA 2BGKA 5TPWB 4TTVA 4XB6B 2A5GA 2M6KA 2JCSA 2CCGA 4DR2B 2O8EA 4O6VA 3H3FA 3NT2A 3TLCA 1WDTA 4UOZA 1KIAA 1C8VB 3P9KA 3DCJA 3WYDA 4YBZA 4CGYA 2P4EA 1TEXA 3KTDA 4GM1A 4J90A 5C5EA 3IDZA 5MN6A 5LMUB 1WUIS 4W9NC 4E0BA 4YV7A 3O4RA 1Q16A 2H3HA 4V0LA 3NEJA 2SCUB 3IUQA 4G0QA 2QAJA 4OREX 4R9RA 1HNXB 3SOZA 2J09A 4BWVA 2P5SA 4QVIA 2IK8A 1OPRA 2QM7A 1JEAA 2PT6A 3G5AA 1AS0A 3ZZ1A 3EXIB 2HMSA 2COEA 2AMJA 3U4CA 2VHUA 1T1SA 2BJHA 2VHYA 2X2OA 1YT5A 3BTUA 4S2EA 1Z63A 1YZGA 4CT4B 4WD3A 1H4QA 1W0CA 4EF4A 1I7SB 1SVIA 1P1HA 1GPJA 1M2EA 1C1XB 5K51A 5G0WA 1PNTA 1XTRA 1B6RA 1C80A 4JUAA 4KNYA 1XMVA 2E5WA 2MSLA 1K2WA 5CB4B 4EECA 1T9ZA 2JEYA 2HC9A 1ORTA 2Z83A 3ZI7A 5IZ4A 5HP4A 1JU9A 1LSJA 3UHJA 1A2BA 1U5BB 4O5OA 3RAEC 5JCJA 4BJ3A 4MUKA 1CUEA 3HLYA 4OI2A 4RVHA 3A4IA 3PLAE 3C3KA 3KQTA 3B3FA 5AHKA 3QI7A 2CDNA 3FHTA 2WEKA 1CFZA 5DXFA 3V1TC 1EBBA 2O19A 1B1AA 3P94A 4YJ3B 1AGXA 4NFYA 5F21A 2KMLA 2X6RA 4R05A 4R1NA 1GKYA 3G5MA 3THYA 1QRUA 1ZVJA 1NVXQ 5L3QA 1T5OA 1O3YA 1XDSA 5CLGA 3ZI0A 1PJTA 4D45A 1VBKA 1U5CA 2DHCA 4OQEA 4Q1BA 3N6RA 3FYHA 4QLAA 1DJMA 2WAMA 2NXCA 4J3FA 4M1OA 3GV0A 4NMMA 3ZWOA 3L2OB 2ZTLA 3KR0A 4G8CA 2R6FA 1E99A 3HUDA 1V8ZA 3FUWA 4QEKA 1H8EA 3A26A 1UBHS 2PUEA 2R7AA 1GD1O 4KGVA 4NYIR 3VR1A 1RPZA 5AUPB 3FROA 2H65A 2M6LA 3LTEA 1DQRA 1K6MA 5TIIA 4JI2B 1LGYA 5H1YA 3WKBA 3OZVA 2NO7A 2QLLA 3UM9A 4LHXA 4LY6A 3UB4A 4JP5A 3CR3C 1ZJ6A 5TQJA 2C4TA 3ZDXB 1AMUA 1GILA 3BVPA 3I92A 4QT0A 4UFPA 1LNSA 1PK7A 1Y3DE 4U7GA 2GX6A 4QXMA 1NJFA 3LJKA 5COAA 3A4TA 3UAVA 2K7ZA 2X2PA 2ZE8A 1Y63A 1VYUA 1AA6A 2LDXA 5ILQA 4F3KA 3BN3A 1EFLA 4GXNA 4RY0A 1QRTA 2WFMA 4UAJA 1PU2A 5IH3A 2A9JA 1QAMA 2CN1A 1MTZA 4RCYA 2VH1A 1NXSA 4RMGA 4DTCA 3BCHA 1LS6A 3N2NA 4EUFA 3PGVA 4J1TC 3X43A 2BT4A 2FETA 1CIJA 5ALYA 1J9ZA 3IAEA 1I5EA 1WDKA 1Z4KA 1AXRA 2EQAA 4KTVE 1XZCA 4HNQA 2J9FA 2JK1A 4LTMA 1WXQA 4JKIA 3ZE1B 5I01A 2J0UB 4R2XA 5KYYB 4CXMA 4JBHA 2D7CA 3KKMA 1NY5A 1UBTS 2WSSA 2Q3CA 2AOUA 1ZIXA 5BR1A 4LSGA 3GPIA 4S05A 1X14A 3HU5A 4UNPA 2P4SA 4V1CA 3OLVA 1E1DA 1PR4A 2RAUA 5FPPA 2WSBA 3CUKA 1DEKA 3GA0A 1D2CA 1NW8A 4KIJA 5BQPA 4ZIRB 3G23A 3N2ZB 3NXKA 2R8YA 4WVFA 5G4KA 4E32A 2IH5A 4DVJA 1TCVA 4WBXC 3DWGA 2MINA 3PFGA 4PX5A 7REQB 1JE0A 2JLXA 1GY8A 4X1YA 4BMXA 1WU8A 3G1WA 5BWBA 2H7VA 4HWTA 3N3BC 5J4VA 3ETDA 1QJ4A 1KI6A 1V3TA 2QJWA 4C05A 4B40A 1SHJA 2DERA 4MITA 2XRMA 4CL2A 4E46A 3QMVA 2C5GA 3H2BA 4NDAA 1X1QA 3OURA 3DVQX 3IP9A 2QROA 4AF7A 5ADWA 2WD7A 4LY3A 2BOVA 3FPBA 3NP9A 1V41E 4K05A 4M9SA 2XIJA 1KAGA 1NQ5A 1QC5B 4GOKA 1NP3A 1YI8A 3S2ZA 1QFXA 1CY7A 1P1BA 4H35A 3X2FA 2Y93A 5CA1A 4JUDX 2YUTA 1A8SA 3D7LA 3OA0A 2CZCA 1PF7E 3STHA 2EL7A 1NVWQ 2GVZC 4PS1A 1BO6A 1Z13A 2Q4RA 1UK7A 5FOVA 4DLXA 1ORDA 4TM7A 4DCPA 4S1TA 1MZPA 3RC9A 2GVDC 4LXQA 4BBZA 4R51A 2BDTA 5T4HA 1M72A 1V4BA 1T6BY 1QGYA 3H5AA 3EXEA 3L02A 1JJIA 4LWZA 5EESA 2WG0A 4YJ2B 5GP1A 3WJ1A 2TSYB 5FEMA 1CCWA 1THGA 3UJ6A 5HE9A 4FSXA 1JP7A 5JFTA 2C97A 4I9FA 4J7CA 2QL9A 5IHXA 4K88A 4Q24A 5ELMA 1X80A 2EFJA 3MN1A 1OX5A 3ITEA 3R8XA 3A1UA 3FCCA 2DBZA 1K8QA 2NUTB 1NWHA 3MCTA 3C3YA 3BE5A 1PQWA 3I6QA 3PDIA 3UJ8A 3LPAA 3L6UA 4C4PA 2X8WA 1SGWA 5DBHX 5BY2A 3I0MA 2C04A 3DMFA 4QUEA 3HCFA 5I51A 3HWX1 3VSEA 3O83A 3QITA 2EP7A 4U6QA 2IZ0A 3ZHXA 2J41A 4UVDA 4E3WA 3Q9SA 2GPAA 1SB8A 2D59A 3PCRB 1WD7A 2X1MA 4IINA 3B6KA 3O8OA 3ONVA 1X7YA 3FMOB 3FMIA 1Z4QA 1C5KA 3N59A 2CWWA 2WFLB 4GKAA 1ORRA 3BCUA 4NLLA 1QB8A 4M54A 2QUHA 2QTGA 3KQKA 4U4AA 2J5XA 4E5KA 5GINE 5JJ5A 3PRKE 5AW5A 4C4SA 1SVNA 6AT1A 2R47A 1L9KA 3GO4A 3W3AA 4BP8A 1TKRA 4WLEA 3UAZA 4CIWA 2WTUA 3BH7A 2H51A 4GX1A 5BVHB 2A7QA 5FFNA 1QTNA 1QG0A 4P54A 1IEVA 2IS2A 2EGGA 3BGOS 4RADA 4NBTA 5DB4A 2OQVA 1P9RA 2H48A 1PZFA 4L9AA 1JIKA 4Y2TA 4ENPA 4FNGA 4ND8A 4CIYA 4M9QA 2AMYA 3G02A 1JHPA 4Q3DA 3QPWA 5DV9A 1QGED 4S35A 1NG1A 3CNEA 2C99A 1D4AA 5CX1B 4YCMA 3EMVA 1MG5A 1YR7A 5KSOA 5K5EA 4X62B 4AB1A 3MOSA 1SXPA 4C5CA 4CR8A 2PFKA 3KYDA 4EZIA 2REBA 4IQGA 3Q3IA 3IOYA 2X2EA 3KOWA 1JSLA 5AW9A 1E7QA 1JHOA 4D57A 3WQBA 3O95A 3PR2B 2QJFA 1CS0B 4A6PA 4DEYA 4UE3S 1PKEA 1JLLA 4KSYA 2WJ6A 2ETVA 4QL3A 3JYNA 1YJBA 2CBZA 2Q2OA 5H16A 1E2NA 2HDHA 4JP8A 4IIJF 4EOGA 1I2DA 2EYUA 2WW8A 4HV4A 4KGXA 2A0FA 4C4YA 4C89A 4G0YA 2PBLA 2JVJA 1TKCA 1NQVA 2A9PA 1RLTA 2PJUA 2R3SA 1W4AA 3MC1A 3Q9NA 3BGIA 5ALTA 1NJSA 3BWVA 1KZ4A 5SYNA 1HG0A 4WEQA 4BNNA 5LP6F 4GZ3A 2AKYA 4H3HB 3IBSA 5AW4A 1ID8A 4C29A 1JFFA 1OXSC 1BDHA 5IWAB 1DIAA 5BSRA 4TWBA 4REQA 4IZOA 4WCFA 1DWOA 1P4GA 1S2DA 1F38A 3LC1O 4QEDA 5U4QA 3QUCA 1AGNA 1EK0A 1JS1X 2AN4A 3QM1A 1WEKA 2PAAA 1T9GR 1SC4A 1T1JA 1ZY2A 4JEMA 1QH8B 4MW9A 6PFKA 1CVIA 3K05A 3B9RA 2E21A 5LQMA 2O6LA 2CKDA 5A0VA 3IPLA 3N3AC 3K0SA 2VATA 3U9TA 1OXKB 4QO7A 4DV4B 5AOAA 3W5VA 2WAYA 4FW9A 1VLLA 3O92A 2EWWA 3KQHA 2R8ZA 1G19A 1TQDA 5EKDA 4MS3A 1E1CB 2JAQA 1Z0UA 2JD0A 3RM3A 5JAZA 2ZXUA 3FNRA 1SC3A 3KHTA 3OZBA 4YMUA 3TQTA 3WA6A 4LGVA 3DEIA 1J20A 2Z5GA 1TO6A 3CS3A 3LQKA 3I76A 4NYMR 2WU4A 4RYLA 5DFAA 4CF4A 1UKCA 1ZGGA 1KQGA 3ZH9B 4WOKA 1ZOIA 2PSJA 3EZGA 3USES 4L08A 1X86B 5EJ5A 4G0OA 4MPJA 2IUEA 5FL7D 1GNTA 4HOYA 3UJHA 5C2JB 1KO5A 1U8YA 1YCGA 1I5OA 4O2RA 3C87A 1LWOA 1SQGA 2Q41A 3KBBA 3V1YA 1GTG1 3KB2A 2J1LA 2BP7B 3INTA 3NHPA 4HDNB 3LXUX 2LPMA 4JJ8A 1R8JA 1PL7A 1FA9A 3K16A 3CNQS 1W4BA 1J42A 1RWNA 2BHTA 2PS3A 2WWGA 3AT1A 3KKOA 4X91A 4JVSB 2PZGA 4J9UE 1H6BA 5I5GA 1H5QA 3F1LA 3H86A 3NS7A 5BWLA 2PBZA 1HDOA 5JAUA 1BJKA 1P7VA 4GP9A 2B92A 2ZT5A 4NY1A 1A76A 3T99A 2YMPA 3E7PA 1EDDA 1TKAA 4MB0A 5FA6A 3SGLA 1N1GA 2IEGA 3Q5EA 4QOSA 4EW2A 1RRPA 5D2CA 4CMHA 5AVKA 2IXFA 4DTIA 3DW3X 1YRLA 3EVBA 1R4ZA 2NVUA 3Q3EA 4MW2A 3TJMA 4AJ2A 1OZAA 1XUOA 1FS6A 1UAGA 2Q49A 3QKIA 3P2OA 4WOPA 2CEKA 3A0UA 4X8MA 3B12A 1J6UA 4GH5A 3JAMA 3UC9A 3S99A 2FWIA 2GERA 4KBFA 3RV4A 5JNWA 3U4QA 3OE4A 5KTRA 2VJQA 4B3RB 1YH3A 2DFKB 3DZJA 1YS1X 4YRMA 4OYLA 2EVWX 2GNAA 5KQRA 3CRVA 1XAIA 5KOJB 5LU8A 2ZB3A 3LPNA 2PD6A 1EFCA 3PRYA 1T6XA 3C7DB 2IELA 1AUXA 1DBRA 1NQTA 1Z2EA 2D3TA 3CCCA 3R23A 4LKRA 2R4UA 3WJAA 1OX4A 1D0SA 2PT9A 2ON6A 2VZLA 5A5VA 3H2SA 1USUA 1XTSA 1G9XA 3KEOA 2BFBB 1TZMA 1VZ2A 2GJKA 5FV4A 5F5XA 3EX7C 4DLVA 2HT6A 4UM9B 5GZ1A 1FFEA 4MS1B 5ALNA 5ECDA 4EA9A 2ZTUA 4DMRA 3PVCA 5DMHA 3G1UA 1D2RA 3C3AA 5DX1A 1SUDA 1TYCA 3DM5A 3SSOA 3UB2A 4NP6A 1Z26A 1SQFA 1PZXA 2ASVA 2BMJA 1ZW1A 1NUSA 2G7ZA 3NNSA 4KZPA 5CPBA 3KKPA 3N07A 1EM8B 3N39C 4DCTA 2O20A 3AF2A 4RD1A 5DRYA 3W2GA 1PI3A 5TY0A 1M1YB 3DE7X 4W5WA 5KNBD 3ZE0B 3HI6A 4F21A 1PS9A 4A8JC 5FQNA 3OLYA 3U1TA 4FQ8A 4YQYA 1U2GA 2WD9A 1G291 3HACA 4J7AA 5HSGA 2UKDA 2CXRA 3HTXA 3ZU5A 1B74A 1EBFA 4UUOA 3MWDA 3ZDEA 4W5RA 1XQXA 1ISFA 3OWOA 4QX6A 3WLEA 2OGSA 1XVAA 4IFBA 4CF7A 3CMCO 2ZJ6A 2IBMA 3D02A 3PGKA 4N0DA 2BFCB 1ORHA 2YFQA 3H2JA 2HWXA 2JFVA 3CUSA 1PR6A 3LUJA 5AFSA 1ZK3A 1W9HA 4FFSA 4WWHA 1G8MA 3AHDA 3MXTA 3K73O 4JFRA 4E2YA 3GVIA 1OFHA 4F4JA 4EY4A 1DC5A 1Z5GA 1ID1A 2HQBA 3E3OA 4HWRA 3V46A 3W4KA 2NP7A 3DG9A 2AWNA 4ZVRA 5DHPA 1AK9A 1HYBA 1J24A 1FB5A 1FRZA 1Z0AA 5E3JA 3IBTA 1F5SA 2PPLA 4JITA 4NPCA 3WLFA 3WK9A 4TRRA 3VU8A 2ANCA 5DM2A 1XZJA 5JVDF 4BVFA 3GLFB 2OBFA 3GMTA 1QOZA 3AJAA 1FJ2A 4NCXA 3KAPA 3RU7A 3T5CA 1SZPA 3U0BA 5K05A 1FJHA 3H84A 4GXQA 4MRAA 3TL2A 2ISCA 3UUFA 4ACBA 1T34A 4DGQA 4LTNA 1GN8A 1AOXA 1DAGA 4M99A 5EYPB 4FX5A 3R3JA 4G4SP 5EXSA 2E82A 4HQLA 3Q7QA 5GJCA 1LV7A 3KU1A 1HYGA 2QZSA 4KQFA 1L7RA 3L46A 5AI6A 1NJ1A 1N6IA 3C6BA 1XNQB 3AV3A 2D5LA 3EG9A 3OZUA 2EBFX 2PX4A 2Q3MA 3BKWA 4HDKA 1Y8CA 2QT9A 1EA5A 2C5BA 1NF3A 2X5NA 1ABEA 3O6VA 3GFBA 4RLFA 2UYCA 3R9WA 3TW0A 3MTBA 2NSDA 3QXJA 1QKJA 3HVIA 2Z5LA 2HBZA 2C4NA 2Z4SA 1GNLA 3X1YA 3JWHA 5IASA 2D5CA 4K2HA 3QV1A 4OXRA 3ROQA 1Q84A 3NM6B 1C3OB 4U2FA 3U80A 1NXXA 2ZUTA 2FSPA 4OJMX 2JLQA 3EJWA 1TT5A 4FMPA 4HB2A 4QXRA 4OHVA 4D4HA 5ELLA 2X14A 2B3DA 3RK1A 4DMUB 3A9CA 1HNWB 5ECWA 2HN9A 1CIPA 1WVGA 2VN8A 4L3VA 1ZUHA 4NE9A 1T0BA 4BEWA 4ARIA 3U4HA 2CHGA 4OHBA 2FZEA 4HQ0A 2C58A 3B1KA 3IRVA 3SYLA 4YCDA 4YLEA 3NBMA 5C8ZA 1N4DA 3F6BX 4QAQA 4NMLA 1U3WA 1CQIB 4V02A 3ZWNA 2QLBA 3Q2OA 2E1PA 1HK7A 5GJBA 1J8DA 5K6TA 4OGLA 1G8HA 2Y0EA 5LFAA 2LNDA 3CSDA 3DEFA 4Z5XA 1R00A 1LBTA 3D3KA 1W87A 1OMOA 2WIJA 1MX3A 1DJNA 2G77B 3O1IC 4TL9A 3EZYA 3O84A 4KTTE 4R8RA 4CFSA 4XQEA 3S7TA 3LT0A 1I4LD 5FNVA 2APJA 5GM2A 4FB5A 3P97A 1F60A 2FHSA 4M0LA 4QQKA 2E48A 3LX6A 3M82A 4BXOB 4OHMA 1ZWKA 4U2GA 1VG1A 1WCV1 2CWDA 4FEEA 5K3FA 4D0LB 2IKQA 3THWB 3TEJA 4S1WA 3ERCA 3UIEA 4J0JA 2ZYDA 4IDQA 3PD7A 3R2JA 4CLEA 3FNFA 2C4HA 1C3LA 3ZWPA 1U80A 3PCXA 1URPA 1MN6A 3FNBA 2Q5LA 2QN3A 3O74A 3MJRA 3P96A 4HQFA 3Q40A 4QZVA 2R7NA 3TRJA 2KQUA 3LNCA 3GG9A 3WRYA 1I30A 4MCIA 1V8PA 3W9YA 3BC1A 3K96A 3B5IA 4GIBA 3I2JA 4V39A 1JEQB 1GARA 4JBGA 2W0SA 4TLAA 4N47A 5ITWA 5JR3A 3BDAA 4EJSB 1E9SA 4FSHA 4LOAA 2YC2C 1Z2OX 3OE5A 1KJQA 1JZTA 2WK1A 5K0BA 2ZUSA 3FM9A 4HEQA 4JC8A 4DCGA 2NU9A 4F7DA 4Z3KA 5I7EA 2IGTA 3FKSA 3NTVA 4D5EA 2XBUA 2A88A 1W48A 3IMFA 2DEUA 1ZK2A 2O6HA 2LKCA 3K9QO 1SCUB 3LHSA 3WZLA 4Y67A 1G21B 1XWWA 2P9GA 3KYCA 1YB5A 2LWIA 4F5EA 3T06B 1QZ3A 4GPBA 2EP5A 4V0ME 2VZ8A 2DC1A 1B73A 1FMJA 1XKLA 3DULA 2QG4A 4MWCA 3O38A 3GJ4A 4TV8A 3AHGA 2ZSKA 4GOOD 4WX2B 1GPKA 3TGLA 3SFZA 1JH9A 5B5SA 4XTRA 2J6IA 3S2FA 3MJ4A 4RA6A 4X7MA 5JZOA 4PIMA 5C4MA 4FYHA 2GBLA 4NQZA 2RDMA 3ZWXA 3K0AB 5GM1A 1FNNA 3PNYA 4ZZ3A 3CF0A 4MDHA 5H4GA 1D2GA 2FUCA 3LHKA 1XDGA 3L01A 4LOIA 3RYHB 3W5JA 1YS6A 1NG9A 3HKDB 3AVYA 3N2GB 4P83A 4QYXA 3AIMA 4PNPA 4P0PB 2PX5A 3WYEA 1I6KA 2VXBA 1QQTA 1P61B 3TVYA 3V97A 4YMLA 2Z6AA 1L5SA 4DZRA 1YDMA 4PR0A 1UBNA 2ES4A 1JJBA 4QATA 2JAOA 4OGFA 4TXNA 1USKA 3NFYA 2AZDA 4FS8A 4E6EA 3CH4B 5IM4F 3PKZA 4MYCA 4X20A 4KDEA 2C9ZA 4KR2A 4CI9A 1GQ2A 4MLCA 2GCGA 1QU2A 2Q6TA 2F3TA 3GWZA 2QRLA 2QGNA 1V1MA 3TKYA 3V3KA 2HFKA 3QMPA 3S5UA 1YFZA 2XVZA 3K72B 2FN8A 3ICQB 3AYXB 4NC9A 1L4GA 1U7PA 1TUBA 2CHUA 1ULTA 2I2FA 4RZIA 1UZLA 2ZJFA 3G2JA 1Z16A 1Q3KA 2AL7A 3KZ1E 4YN3A 3M6MD 1JPVA 1U98A 4YWJA 1X3SA 2BH9A 2XAAA 4QREA 2C2YA 2Q1TA 3M6VA 4V38A 3SQOA 2IUSA 1VLVA 1M6NA 3ZCPA 3GZJA 3FTEA 2M1XA 5CFZA 1C9EA 3MGCA 5IDQA 4X24A 2NZVG 3EVGA 3JQGB 2IP1A 1JEYB 2P6MA 3BERA 2IF2A 2RCYA 3DVRX 3KWJA 4RV4A 5DGIA 4D3FA 3HFGA 5K3OA 2PL1A 1AQYA 1DB3A 1GZ5A 2GILA 1K6XA 1OGYA 2R60A 5CLLA 2JHCA 4M0MA 3R7FA 2P1RA 3ESAA 4XOIA 1L5VA 1U9YA 2XUKA 3P4UA 3AYZB 1ZN9A 4A0GA 5LZ5A 4I1IA 4YDRA 2F48A 1YCDA 3DNMA 2ZE7A 4C9BA 1NT4A 4FJ2A 2ZUEA 2Q21A 5LP6B 4R81A 1ODKA 2BMVA 2I2DA 2FJUA 3TCNA 2CMKA 1BQ3A 3WYFA 2XH8A 1TEHA 3CBGA 1R6AA 1NVGA 3FWPA 2WM3A 3KQSA 3L8MA 3ZCUA 2V3VA 5ALVA 3ZNOA 4XWKA 5TMBA 3NNDA 1N7HA 4H7DA 3UAOA 3FSEA 3THOA 3NDJA 1CHDA 5BWCA 1EZ4A 4H27A 3GFFA 1ZMBA 4F84A 2OV2A 1AGYA 1QH1B 2CC2A 4HO1X 2WFZA 2H6EA 1NDUA 5EEGA 1KS2A 3EN0A 3N28A 4MUEA 4B3GA 3PGJA 1ZLXA 2YJ4A 1KVRA 4AJOA 3F6EX 1JB9A 3ZV4A 2DH5A 2OAQ1 1G59A 2L18A 4AQ7A 4UHKA 1YBMA 2Z08A 3DKRA 2L17A 1W0JD 2ZR8A 3BFJA 1Z5UA 3DFMA 4TTQA 3SQNA 3I5YA 3U39A 3BD6A 3VXKA 1APBA 1SCAA 3LUCA 2PWZA 5F7XA 2G8NA 5DNUA 2YN0A 4QFCA 4RSGA 2VDQB 1Q1NA 4HAIA 5KDLA 8ABPA 1EX1A 4TMTA 3RYFB 3WY9A 2A5YB 4EG7A 2XQKA 1G4AE 3BJRA 1PG5A 1VA5A 5JYDA 5LDDC 4G4GA 4I55B 3PL5A 4O3FA 4UMDA 5J9FA 3AEXA 1JIVA 2J45A 4QKQA 3V2GA 4EK9A 1X7ZA 2G70A 2IIQA 4HMPA 1DAOA 2GZAA 1XROA 4MJ7A 4W99A 4LDRA 4A0RA 2ZGVA 3C4JA 4Y2RA 4ZJPA 3AZOA 1M8GA 3KSRA 2C78A 2ZRMA 3N1UA 5ADVA 3LZDA 1QBKC 1W0JA 4KXYA 2EFCB 4ESHA 3PNQA 3NUQA 1BCSB 3L7MA 3QLJA 1IZ8A 4XX0B 3UZUA 2ZBEA 3F6YA 3PFCA 3QLVC 4IHJA 3VSCA 4RAQA 4FHZA 1TW3A 5EIBC 4EG1A 1T3SA 3DA8A 1W88A 1JGTA 1T5DX 3I0NA 4UE2A 1UBMS 2O3RA 1SXJB 4KFRA 5FJIA 3WWPA 4UAUA 4ERNA 4O2AB 4FP9A 1SHZA 2GEBA 1J06A 1AKWA 2QD4A 4FWIB 3LBHA 3GJ5A 4WPGA 3OM0A 2Z1MA 2AF3C 4BQRA 1QSGA 4E1BA 4JU9A 4II2A 1JLRA 1CJBA 3ON5A 3DJFA 3QEBZ 3HR8A 5DZSA 3AUYA 5K20A 4FBMA 4BP3A 3L6EA 4KN8A 5TJ9A 4B5KA 4MPDA 2I03A 4HUQA 4RS4A 3GLSA 2YZNA 3VZQA 2R44A 3GLUA 5B1YA 2ISQA 5HK9A 4DV7B 4GKKB 1XRQA 4FSDA 4O08A 4YAEA 3M6UA 4YJFB 5F5LA 4TZKA 3A4NA 4DSNA 1ADGA 3LQRA 3EOAI 4CLXA 2WLTA 2OM6A 5LXTA 1RE0A 2TMDA 4YUVA 4CQLA 5KYUA 1MGPA 1ZRSA 4OBXA 1W5AA 3FW1A 2NV6A 4UW9A 2QK4A 3AKYA 4HAUA 5CXUA 4PG6A 4E7PA 1WMFA 2CHFA 2V7PA 3ROTA 1F0NA 1KARA 4NDNE 3A9RA 4CUKA 4OY3A 2HW8A 1I7PA 1WUYA 4E7OA 2JIDA 3PQDA 3FF4A 3WL6A 3NAQA 2ZU0C 4AQDA 1PQPA 3U7RA 1WHSA 4NWIA 2D5IA 1IG3A 3KOXA 3GEEA 2OD2A 4WACA 2BF4A 4MKZA 4QGSA 3C7KA 3SJAA 1MOSA 1PZGA 2DTDA 4E15A 3LCCA 4L02A 3C0KA 4PGMA 3E61A 4H7HA 2ZIEA 2RG1A 5CH3A 3KQMA 3E9YA 4WZAA 1T8TA 1IOWA 2DUJA 1K3UB 2A4KA 2GSWA 2O5RA 2PO7A 4GOJA 4BV9A 4UQPA 5ADHA 4EX7A 5CTJA 2FWNA 2PHZA 3IVRA 3ORYA 3U9SA 3ZY5A 4HTFA 1GPYA 2Z3VA 3GLIB 2HLHA 1DC6A 3ZQJA 1Q0HA 4KN9S 2EOAA 3OKCA 4YP7A 4AKSA 4JL8A 4G5QA 1SA0B 3EARA 3TAXA 2FZWA 3E03A 4AZTA 2IYWA 4LV8B 4KN6A 2EEPA 2W8BB 5EIAA 2FZ5A 1GXSB 2C4WA 4XWAA 2IPXA 2EQBA 1NL3A 5JJLA 1KPIA 3OWHA 2GZHA 2D5BA 3H0CA 4KSBA 3TVDA 2AG1A 4L15A 3MAGA 2C7OA 3RHSA 2BJVA 1C7EA 1LI4A 1V1JA 2X4GA 1B6GA 4I5FA 3A4VA 5HF8A 4ZV7A 2CB9A 2OD7A 2OVFA 5FAKA 3EG5A 1JHRA 1M8FA 4IKEA 2XZDA 4JLSA 1TYEB 2OCXA 5CD1A 2I4LA 1OC2A 2FEKA 2OBYA 3PENA 2CUTA 3H17A 4RY9A 4YMVA 1NV9A 4YUXA 2ZULA 3RQSA 5A5FA 2L42A 2ECOA 3S2GA 1D2NA 2I1QA 2DUMA 4FYVA 4G24A 5K09A 3E7DA 2XB2A 1VG9B 3EXIA 2RI6A 2OMKA 3UMCA 4JVMA 4MYDA 1H42A 1VL0A 2C82A 1WW8A 3E1GA 3IP1A 1X9HA 3N2YA 3PHJA 3Q6IA 3QPDA 1HH4A 2B4YA 2LDBA 4GECA 5KU7A 3HXPA 2IC5A 4YDQA 4PF1A 4R1MA 4UDYX 3MG9A 1HTWA 1B26A 3DLTA 4Q05A 1I1NA 3D59A 3TCXB 4CFYA 3VPGA 1DQNA 1VHTA 2FWBA 5JAPA 4F0JA 2AUNA 3BWEA 1ETHA 4FZJA 3F73A 1YULA 3VDXA 2AWOA 2ETXA 3V00A 3QOXA 4BCBA 2ZUDA 3UJBA 4E5MA 5L3VA 5I9BA 2REQA 3UGJA 1E9VA 1NVFA 4O63O 3HDTA 3ZHOA 1ULSA 2ZITA 3OZFA 3D43A 5ICSA 4F71A 1U5BA 1GPUA 2BM9A 2HV8A 1MABB 1RIFA 1R12A 1TJ4A 1W30A 3AUAA 3HCBA 4GPD1 4YXFA 2CFIA 4RU1A 5BN3A 4J07A 1XPRA 5AK5A 4UTNA 5D6OA 3WLIA 3MT7A 2UYHA 2NT4A 2YFYA 5CH8A 4Q19A 2O7VA 2H7YA 1WCIA 4LX0A 1XR3A 1YQUA 5KYWA 1LCIA 3MJVA 3T1NA 3DEKA 4QD3A 1QO0A 2FPGA 3P19A 1OU4A 2C9CA 1YV9A 5H83A 4BMDA 2O8CA 3C8HA 4FK8A 1XZKA 3C5WP 3UAGA 3STVA 5L8VA 3VJRA 3K5WA 1VHLA 4RABA 4AO6A 4H77A 3BMOB 4BO0A 3LVQE 3JTEA 4V0RA 5JCOA 4QEZA 4ZYXA 1O0SA 4MQ6A 2KSQA 2FJPA 4TVSA 1VE5A 3A3KA 2XJ9A 3ZQ4A 2J9XB 4QWMA 2EFYA 3PPYA 5ENZA 3SBEA 3OQVA 4RF3A 5AI5A 4AZ3A 1G8PA 1OH8A 3WB9A 3HDHA 5F12A 4MGYR 3Q8MA 1L0BA 1OFUX 5LA6A 2CVFA 3WHKA 1IB0A 5CK5A 3IKTA 3PPVA 2ZYAA 2HBRA 2ZJZA 3MT0A 3OZRA 2W4MA 1ST3A 3CLSD 2ZAGA 1DEOA 4N01A 4CF6A 1TKBA 1AVTA 1TLLA 3KIPA 5K6AC 1X8KA 1M8JA 3TN7A 4JELA 3HUFA 2JNWA 2JJ1D 1T3GA 2P78A 3RNLA 4BO4A 5IEJA 1W49A 3B7WA 2J08A 1ZITA 1GL6A 1WXGA 2AG8A 3MMNA 1RI4A 3HA2A 2GN9A 2BELA 3D8BA 4FOLA 2Q6LA 2HPVA 2CFRA 2HRQA 1P5JA 4MP8A 4NCNA 2FRDA 3UJPA 4UM7A 5B12A 2PE5A 1JT9A 1ZOSA 3QKSA 4G1CA 1K68A 3IQZA 3KR9A 4K87A 3NDIA 2ZM6B 2D8MA 4LK3A 1Z33A 4OKNA 4EJMA 2G9RA 2J4FA 2MJLA 3WLQA 4NJMB 4HZUB 3KT6A 4LXYA 3KHSA 3R4VA 2CVQA 5BQ3A 1H05A 1RQ2A 3NOQA 3VO1A 2EKPA 4FGKA 4KHPB 1FNSA 3D8NA 3DKVA 4YIHA 5FLEX 3L8YA 1C30B 1Y8AA 2WIDA 5IDYA 3ZVMA 2HUPA 4DNPA 2JJ1A 4JLKA 2MR5A 5DM0A 2RGCA 4R0VA 4H9GA 4NZOA 4PGHA 5IJAA 5JQGB 4G01B 3HPQA 4G1VA 4NIMA 1CNFA 3FI0A 3R7WB 5CIYA 1EVEA 1XZPA 2EFHB 1KETA 2I8LA 2KS6A 2EV9A 4ZCMA 4YCLA 1RT9A 4KFUA 4JAVC 1ZRMA 2ZRAA 1XK7A 5T4BA 4B09A 5AUOB 2HEIA 5H68A 2WM9B 2GI4A 3STXA 2FPMA 2FQXA 4RD3A 2VI5A 5E1DA 1RTTA 3MJSA 1T8WA 3QFTA 1NW7A 3S2EA 2JIQA 4NBWA 3QEMA 1VJ5A 3KHKA 4HEJA 4BPBA 1A1SA 1UMBA 1GFZA 3I2HA 3JY6A 1Y3HA 4ZI7A 1SZDA 1T4GA 3UT5A 1DTEA 1Z47A 2BZ1A 3P2EA 3OIUA 4BVLA 2DCUA 3GFGA 1KWKA 1YTLA 5K0JA 3I4CA 2NP6A 2J5BA 5LBIA 3RTCA 3AF0A 5KWVA 2V6BA 3A58B 5FFFA 1LX6A 4YFVA 2OFOA 5BWOA 4LXHA 2CXHA 1IHPA 4QOGA 4YCNA 5CBPB 1BHJA 1K4YA 2PMEA 4TZ6A 2AT1A 5EZYA 1S96A 4LVOA 2G36A 1E60A 1DTWB 1PR3A 3IBCA 3JRWA 2VXYA 5EGSA 2BY4A 4M88A 1NXQA 5L7YA 2M32A 1J00A 2AOWA 1Q20A 3ND6A 1E6WA 5CVJA 3VR6D 3AM5A 1IU9A 1Z07A 4OHPA 2IV7A 2EEZA 1F2TA 1A5BB 4ZQIA 3RBAA 2BZ0A 3W5CA 3FD8A 1L7BA 4D26A 1F06A 2WJ4A 3FNGA 2O3JA 3F6CA 3SAJA 3WWOA 1UKAA 1SOMA 1BMFD 2FMKA 1QBGA 2Z5FA 2X0IA 4MWBA 4LDJA 4YEDA 3N5KA 3T0FA 4J91A 5JBQA 1PV2A 1QAOA 2XI4A 3ZU3A 4B6SA 4PHGA 3ZLBA 1DWUA 3BWMA 3K0HA 1F9AA 4ZOBA 3TAHA 2WV9A 2XA2A 2QQ5A 3ZDCA 1H94A 3W78A 5LOVA 1HLPA 2A57A 1QIKA 5C1OA 4RKWA 5FI5A 4OAOA 3VR6A 1MNAA 2PJZA 2ZYIA 3LQFA 4FB4A 2I4OA 1AQJA 1LX7A 3G6WA 2C8VA 2H1RA 1N2CA 1ZINA 2VUHB 3BHIA 3ETNA 4YALA 3W6PA 2YYYA 3PXUA 3L9XA 4JC4A 2J3DA 3EPHA 1Z56C 5K0EA 2C9BA 2YV4A 2RGUA 2V98A 3OPYA 3QYPA 1XCPA 4LBWA 1UFVA 3M4NA 3PSHA 4G1UC 4LE2A 3JYOA 3AZPA 5C52B 1PE0A 1TU4A 1H2XA 2PZMA 1AKRA 1V2GA 4Q3LA 1NVVR 2BI8A 1B3RA 4MV4A 5EQFA 3H5RA 3GC6A 1CUVA 1NMSA 1J90A 1PL0A 1E8DA 1MMFB 1N3BA 3EZ2A 2PMKA 4HC4A 1E2DA 3SXJA 1QH9A 2AJ8A 2UUPA 4J4BA 4TT8A 5HUQA 1JTFA 4J8PA 5AT1A 2ZETA 4JI0B 1JR3D 2WJGA 4XQ0A 5CXSA 4DCNA 3LO5A 3E5HA 4L0DA 4RX1A 1U9ZA 1ZMRA 2OLKA 4DQDA 4JUIA 2WWWA 1VJ1A 3MILA 5EE1A 1XPJA 4DIBA 3GH3A 5EQDA 3PQ5A 1L1FA 3K0FB 2PRJA 4BVBA 5L7TA 3OZWA 4BZQA 2JEZA 1JIXA 2V7GA 4D0RA 1EFPA 1HYEA 3MEQA 4PAOA 5CYOA 1V71A 4F5YA 5IF3A 1IEWA 4Y6QA 4C1NA 4WOCA 2IL1A 4DKXA 1V35A 4NONA 4UBMA 3U7JA 2FK7A 3KUKA 4ER7A 3NHFA 3G88A 2KB0A 5M34A 1V4VA 3Q10A 1G6Q1 5CX1A 2ZUVA 1HE8B 1QANA 2YXLA 5FPKA 3UOAB