4TLEA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
218
Chain Sequence
EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPDLSALIERINYAIQKYRARRVSIDSACSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
total genus 78
structure length 218
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tleA00
2GESA 5JCZA 1ZUHA 4BWYA 1DEKA 1SXJC 2WKPA 1G8HA 1WA5A 1YR6A 3H86A 1FZQA 3ZQ6A 4N0EA 4F93B 4AIIA 5G3YA 4DLXA 2JLVA 3QG1A 3W3ZB 4AC9A 1ZD8A 2J7KA 1GL9B 5H8WA 4PSKA 4GDFA 1KGDA 3FPAA 4HLUA 3TBKA 3ZVLA 1KSJA 2VSFA 4QGGA 3NH9A 221PA 2NZ8A 5CM8B 4RD3A 3ZVMA 4IFEA 1K6MA 1KYIA 3AF2A 2NO6A 1ETUA 2QMHA 1AKYA 2V54A 2O0HA 3NDBB 4B2PA 1CR4A 3MRSA 3NDPA 3OEHA 4MH0R 2D74A 3U61B 1J90A 2HLDA 3WMFA 2ZJZA 3HYTA 2R6DA 1LFDB 2I1VB 4DLUA 4TL9A 4NCNA 4PC1A 2BVNA 4JZKA 4KU4A 4LJYA 2XX3A 4AYXA 2WWWA 3GLIB 1T5LA 4M1WA 1XEWX 2JATA 1DOAA 2OZEA 1KIMA 2IYXA 3KX2A 4Q21A 3U6BA 3LVRE 3THXA 1LTQA 4OQLA 4B48A 3J81k 4CF7A 1II0A 3EZFA 4RZ2A 5LBIA 1JXMA 2B7CA 1U2RA 1K5DA 5SZKB 3UG7A 2Z5FA 1AS2A 2EW1A 4LBYA 2R6CA 4LJ4A 5D3MB 2X2EA 2FA9A 4V0ME 2L0XA 3KUCA 1W5SA 3OF5A 4JKYA 3PJRA 4RSGA 1R6BX 1LNZA 1TNDA 1TQ6A 2FFAA 2VIIA 3PUVA 5TARA 5DE3A 3VKWA 4TT3D 1ZNXA 1S96A 4Q1BA 2ECKA 3GFPA 4BECA 5EXTA 1NKSA 2ZRJA 3KL4A 1M6NA 2ZRDA 1Z0FA 521PA 4A4DA 4JLPA 5J4HA 3SYNA 5CLQA 4DCTA 2WOJA 4ZDIA 3V00A 2R6GA 2DB3A 5DLQC 1DAGA 5KSPA 1XCMA 3F3YA 1KO1A 1E3MA 4DVGA 3E1SA 2WIAA 4N1AA 4JMPA 1KO8A 4PFSA 1J8MF 4D4KA 1JPNA 4JL5A 1TTTA 1UKEA 2HF9A 2OESA 1S0UA 1JALA 5FBQB 2BKUA 1IN4A 3WHKA 4JT4A 2CK3D 4GOXA 5G3ZA 2XZPA 1NSTA 1II8A 2AFHE 1FP7A 3AP3A 3HPRA 3K9LA 3AKEA 2JJ2D 1P4SA 2G0NA 3TH5A 4B3FX 5IHPA 1EX7A 2WWHA 4HDQB 3OIWA 2BOVA 2WSSD 2GZAA 4DEYA 1E2LA 2UKDA 2V55B 2ZYTX 2ZYVX 1OKKA 1G19A 1XWIA 4O2RA 1UPTA 3LLMA 1MRSA 1W0KA 3SBDA 1RJ9B 1Q1QA 3IPYA 1U0HC 2YHSA 3A6PC 3RRNA 2NZJA 2RGBA 3QENA 1Z6AA 4LJ8A 1PLKA 3AVQA 2G83A 4PX9A 3LD9A 4BLOA 2PJRA 2QTVB 1TF2A 2RCNA 4OBEA 1EWRA 4IRUB 1QF9A 2J41A 4G5RA 1A5TA 3U7HB 3S1AB 3SR0A 4B47A 4BLQA 4XWOA 2FG5A 1GILA 1NN3A 3O8RA 4TZ6A 4NL4H 2DFLA 2MMCA 3PUWA 4S35A 3FGNA 3SYLA 5AUOB 1NG1A 5FOXA 5BWMA 2BMEA 1FUKA 4L8GA 1G64A 3AKDA 2RKOA 4QBGB 2H57A 2R65A 4Q7MB 2QY9A 2OFOA 3IHWA 4HDCA 5DHFA 5FBVB 4PSVA 1FX0A 2NGRA 1T3HA 2O8FB 4A92A 4LBVA 3AGPA 1J99A 4AYWA 4R71A 4DDVA 2GJ9A 1U99A 2YINC 5F2EA 5AWFC 3K70C 2KE5A 2R8RA 2BC9A 2AXNA 2X77A 1IY0A 4MYTA 2BCGY 3SC3A 4QJ3A 3U44A 1N5JA 1P61B 2Q3FA 4PAQA 5GJWC 3EX7C 3KKOA 3NC0C 4YXWD 4PTLA 2XSZD 3KUDA 4KYUA 5DO9A 4BEJA 4K81B 4KSCA 4LV5B 1NJFA 3RWMB 1DG1G 1W5TA 3WNCA 4A8JA 5KNCA 3RLFA 2QP3A 5JWHA 3L43A 2GCNA 4Q9JA 1GVNB 4LJ9A 3WNDA 2JCSA 2OFWA 2CMKA 4E07A 2AK3A 1G7RA 3KXKA 4GL2A 1M7HA 1ZC3A 1VYTA 5CLLA 4CEJB 2NMVA 1OXUA 3EIQA 2LKCA 1YZKA 4ARZB 1VCIA 2XJ4A 4WBSA 1HTWA 1ESMA 1QDEA 1QRAA 5EE9A 1G8GA 4QL3A 5GJVC 2EVWX 4DDWA 3R8FA 3MWJA 4M9XA 3GLHE 3A36A 5J4VA 1HE1C 2ZRBA 4P32A 4EJSA 4JVNA 2IHBA 3BD9A 5CB6A 1PLJA 4TZ0A 1RRCA 2YYZA 1L7VC 3EPKA 4D0GA 1CJUC 4E09A 4DJTA 4DDTA 1HA3A 1R5OA 1XPRA 3PXGA 4EUNA 1G3UA 3NXSA 1YZGA 1R5NA 4WXPA 2WPDA 4DZZA 4YMTA 1WP9A 1G6HA 2QSZA 3LVQE 4NZYA 2QAGB 3RSOA 1AKEA 3U2QA 5G53C 3CWZA 1Z2AA 4LHXA 1JPJA 1SGWA 2RGCA 4O2LA 1HEIA 3GLGB 1L4UA 2X2FA 3C5CA 3ZS9A 2HJGA 1OXTA 3IKJA 3MCAA 1NVUQ 2O0JA 1XTQA 3FKQA 5EUQB 2YC2C 3FMIA 3I62A 4HB0A 2ZSDA 4XTRA 1KI6B 1EFRD 1XMVA 3EA0A 3SJAA 3WMEA 2REOA 2WWIA 1SHZA 1WBBA 1W0JA 4K46A 4GP6A 3WP1B 3R7WB 4U5XA 4NCHA 1UKVY 2V9PA 2IYRA 2JASA 2NO1A 2R6FA 2ZITA 1TU4A 2PZEA 3BH6A 3NH6A 3NHAA 3TW8B 4JLMA 1OW3B 3BH0A 1RKBA 2GVZC 2AHOA 1VCOA 2ZRPA 1E1RD 1OXXK 3RABA 2IUSA 5KPDA 5B58C 4NKRA 1D8TA 4K8OA 3THYB 4MITA 2RHDA 1CXZA 3KQLA 4Q47A 3W6OA 1RRGA 4YLGA 1DAKA 1OHHA 2DCUA 3FWYA 3TJZA 3MGCA 4ERNA 4Z54A 3K09A 3T06B 2ZUBA 3B5JA 1Z5ZA 3GJ8A 3NBXX 1E9FA 2RAPA 1O3YA 3B7GA 4D2IA 4X8OA 2ZI5A 5AUPB 1S8FA 3SHFA 1U94A 2GBLA 3N5CA 5HE9A 3T5DA 3D31A 4AKHA 1TUEA 3MAAC 5FPTA 3O8DA 1OB5A 2BDTA 1DAMA 3EXAA 1IXRC 4BZXA 1OH7A 3U4QA 3JZAA 2GEVA 1T4GA 5LDDC 4NCJA 5FUVA 2CCKA 5E7IA 1U9IC 4IOJA 4ESHA 2WAXA 4O3MA 3AUYA 4RD6A 5F3WB 3H1TA 5L3QB 4RJLA 4QRHA 2ZE5A 4U7DA 1XB2A 2XXAB 3KKPA 1G7SA 5UKDA 5DNYB 2BHRA 2QROA 3B1VA 3AGQA 4C3ZA 2F43B 2CJWA 3A4MA 3RS7A 2PEYA 4YQFA 1E4YA 5SZJA 4JYBA 2DWQA 3RNLA 1J7KA 3QXSA 5E7MA 4CEIB 4Z8XA 1FTSA 4ARZA 1NVXQ 4ZKEA 4PO9A 1NVVR 2GAAA 3M1IA 5CDFA 4Q02A 1GL6A 2ZRKA 4BEBA 1LV7A 2ORIA 1E32A 4TTPA 5JS7A 3R9XA 1E9AA 2AWNA 2EYQA 2VSOA 1N25A 1GTVA 1NI3A 1T9HA 1WRBA 2J3EA 3EWSA 4G5QA 4UQOA 4XOIA 1Z28A 4LK2A 4WOPA 3H2YA 4JJZA 3TW4A 4L9WA 3T1TA 2PCLA 1NNEA 2QRZA 4LGMA 5IK2A 3D8BA 1VTKA 1Q57A 2ZI7A 3P4YA 5HZKA 4V03A 2F1RA 5CJ2A 4NPHA 4KLZA 3F0TA 4OHXA 4LYJA 1OH5A 3P26A 1TQ4A 3C16C 3C7KA 4FXPA 1HT1E 1RW4A 1VG1A 2HCBA 4MGYR 4D82A 2G6BA 4XSHA 2PT7A 4Z1MD 2QP9X 5HR5A 1R4AA 1JXOA 3CNLA 4WAUA 3RS0A 3QSYA 1E2DA 5F9FA 1MR3F 1QVAA 2CXXA 3DHWC 1P73A 2IYSA 3QVVA 4GP7A 3WY9A 2G1JA 1WCV1 2OBLA 1SXJE 1JEEA 2E9SA 4BZPA 721PA 3D3QA 1ZUNB 3A58B 3HWSA 4F7WA 3QEOA 1EFTA 4TTQA 3RRYA 3ZD6A 3R7WA 1QG2A 2ZR9A 1UBGA 2CL7X 3BB3A 4M8NE 4PC2A 2QL6A 1MV5A 2H92A 3AQ4A 1DPFA 5TXGA 3SFVA 1YRAA 3LXXA 3TVDA 2ANCA 2O8BB 4DC9A 4OHWA 1F60A 1YZNA 4KI0A 1R0ZA 1L2TA 2IUTA 4FMCB 3THWB 1W36B 1XTSA 3OFND 1VHTA 1R5BA 4AKIA 1S1CA 4IXMA 5JSZB 4GZMA 5BXQC 3ZIAA 2ZETA 4NMMA 3UG6A 1PJRA 3T61A 2AKYA 1RYHA 5EE3A 4CRWB 2HT6A 3HP1A 1XRJA 2IW3A 3OE7A 3K0FB 3EZ6A 3Q5DA 4ZIRB 2EYUA 3MWKA 4MDFA 2GTPA 3A1UA 1F48A 5JECA 1YRBA 2Q3MA 1HURA 4LJAA 1Z3IX 1OIVA 2JLUA 1D5CA 5FBRB 5JI3E 3PEYA 1KI9A 2H5EA 1US8A 3RWOA 2CLSA 4US0R 3UKDA 4D4MA 2VP2A 4V0MA 3PR1A 4LRWA 2BV3A 1G17A 1NN0A 4V0LA 1WE2A 4TQAA 2GJSA 5B2ZA 5M04A 1XMSA 2RGDA 3PUXA 1FTNA 4OJQA 1TPZA 1LY1A 4UNPA 5GVRA 3SJBA 3GLFE 3ADDA 1PVOA 1ODFA 4LYHA 2ZVPX 2OXRA 1ZINA 2ZI3A 3O8CA 4LHWA 3I73A 3Q7PA 4HYYA 4RVCA 4TSFA 1IXSB 4M1SA 1FMLA 4DXAA 5BN4A 1G21E 4B6FA 5GJCA 2J5XA 3PCRB 4TMTA 4HAWA 4O25A 3K9HA 2ASEA 4PXAA 5FOUA 3K9NA 4F91B 1P5ZB 3QF4A 2ZJ8A 2JLSA 3MMPA 4LY6A 4MKGA 5KSYA 4P3YA 1OH8A 3GJ4A 4DLZA 1CJTC 1KMHA 5D3QA 3HU1A 4B3XA 3DZDA 3CW2A 4LC0A 2WJGA 4G5GA 4UJ5A 2GILA 4KAXA 2V7QA 4DLVA 3TQCA 2BJWA 5KPJA 4W9MC 3SBEA 4LDJA 3VU9B 2DR3A 2WV9A 3A8TA 4I1VA 1KDRA 1J8YF 4JSTA 3QOFA 2PL3A 1G1MA 2CVHA 3QF7A 4XTCS 2AD1A 1R8QA 3CPJB 3PV0A 4BLSA 2QE7D 2X8AA 4EQ6B 3B8HA 2J45A 3IILA 1CU1A 2IK8A 2CDNA 1Z06A 4PQYA 1BYIA 4FWIB 4IVPA 3CF6R 3SE0A 1GNQA 3G82C 1XBTA 2ZROA 3FHOA 1E2EA 1DS6A 4LZZA 4RZ3A 4D26A 3ZYCA 2GJ8A 4TYWA 4QJ4A 2NO7A 4DUGD 4UXHA 2J7PA 1OE0A 3DEFA 1E4VA 3U3MA 4OHZA 4IEEA 2QU8A 1FNMA 4MRPA 1ZC4A 4X8HA 1CLUA 2WJHA 2QM7A 1P2SA 2GNOA 2BBOA 1UEJA 2PX3A 5FFMA 4A15A 4B74A 5J5CA 1W7AA 3BE4A 1CULC 2P5SA 3TSZA 2JLXA 2ODBA 2W2VA 2JLQA 1KNXA 2Q9CA 2ZAMA 3IBGA 2ZJYA 1JR3D 1OYYA 2WAYA 4PHHA 2NQ2C 4Q1AA 1UF9A 1Q21A 3SHWA 2VH5R 4CT4B 2BJVA 1CJVC 3DO6A 3SQWA 4XD7D 3GD7A 2C2HA 4PPFA 5LD2C 4RD4A 1ZM3A 1PUIA 3LO5A 3ZLJA 2TMKA 2GJAA 4IVQA 5P21A 2G77B 2HUPA 4ZIRA 4LWZA 1S9HA 1B23P 4M9QA 2IS2A 2MSCB 4KBGA 5CM9C 3PG5A 3THXB 1FMJA 2WJJA 4IVRA 3SEAA 3GEIA 3X1XA 2VLIA 4TYYA 1D6JA 4AWXA 2J0SA 3T12A 4TYQA 5AK0A 4TMVA 3B6EA 2FWRA 1TEVA 2O8DB 2NO9A 2WBLC 2GK7A 3B13B 3CPEA 5JBQA 1BKDR 1Z6YA 1NG9A 2OEPA 4ZV4A 1UKZA 2C95A 4ZO4A 3B2EA 4UXIA 2KBEA 2V1XA 3BIFA 4DT1A 4GNKA 4QNRA 4B3CA 1CJKC 1I4DD 3CRW1 1XDBA 2XITA 4PO8A 2QTHA 4QOSA 5KDLA 1TF5A 3EPLA 2GXQA 4W5JA 5FOSA 2EFHB 1ZJ6A 4Q4JA 1GKYA 3GLHA 1DARA 5AJZA 4R98A 3ZZ0A 1M7BA 1KSGA 3FYHA 1KSFX 2SHKA 3U6KA 5JMTA 4UNRA 2IHYA 2JDIA 1XPOA 1MO5A 2YOFA 4LV8B 4HB3A 1ZD1A 4NTZA 4B75A 1TF7A 2N46A 4LC1A 3GQBA 4ZCIA 2Z4RA 2W00A 1Z47A 2YOHA 1Q20A 1CR1A 3ZZUA 2ZU0C 4BFUA 1D2NA 5K8LA 4HAVA 2R62A 3CBQA 3MUFA 4LJ5A 1H8ED 2F3TA 4FINA 4ZDJA 4GFDA 1W36D 3T1VA 4US2R 1ZNWA 1MRNA 2W0MA 4HAYA 5FR1A 4DLWA 3WP0A 1RC8A 1JQJC 1YVDA 2H16A 4KO8A 4BLPA 2J0VA 1NVWQ 1E0KA 1YJ5A 3K0SA 4V02A 1VCMA 2WZQA 2GCPA 1G5TA 2V6JA 3DMNA 2XGJA 1GRNA 1T0HB 1CTQA 2F6RA 1YZQA 3LLUA 4EQ6A 2B21A 1IQPA 4Q7LA 2IXFA 4I81A 2J0UB 4OI2A 1Q3TA 3RRZA 3PEWA 1G7TA 1P2UA 2W2TA 4PPGA 4PANA 2NG1A 1FQJA 2QT1A 3L0OA 3MD0A 4DSTA 1U81A 2WSMA 3D6TB 3QPVA 1CRPA 3OEEA 2CE2X 2YOGA 5DI3A 3FOZA 1ZM7A 2JJ1D 3WXMA 5F98A 4C0HA 5C2JB 4MGIR 1NKTA 5J4KA 2ZRAA 1N6IA 2D4HA 5C4GB 1Z08A 1AIPA 4Q4LA 3Q5EA 1NBME 4C0SA 2F1JA 3PUYA 5CYOA 1UDXA 3KFXA 3GJXC 4QHSA 2VP5A 4RFVA 1X1RA 5JCPA 1FX0B 2WJIA 2XOKD 2VYFA 1XD2A 3K0CA 5DH9A 1GRRA 4Q7KA 2JDID 5L3RA 2VP9A 3ZQJA 5EE0A 5EP1A 3V9PA 1ZYUA 1II9A 4B6EA 3L8ZA 1DELA 3THOA 3U44B 5FBLB 2CL6X 1Z83A 2ODNA 4IDQA 4MRNA 2Q9AA 2QTFA 1G5RA 1U90A 3MG9A 2HXSA 1GRQA 1GIAA 1G8FA 5DI9A 5FPHA 1OXSC 1EGAA 4L5BA 4MKIA 5JZVA 2ANBA 2YNMA 1Z0IA 4PQRA 5DISB 4A8JB 3U7GA 2A5GA 3IUYA 1QG4A 3CX7A 5KYKA 5H1YA 2O8DA 1GNPA 1DAIA 4QG7A 2QG6A 4MUBA 3EZ2A 3W90A 2Z43A 1NN5A 1E9BA 4BRWA 1R10A 2VP4A 1D9ZA 2CNWA 1BMFA 3VKGA 3SU8A 1YHNA 3EAQA 2ATXA 2JGNA 4PZYA 5FPSA 4OI1A 3BFVA 3HR7A 1T0JB 4LI0A 5KU1A 3KQUA 3D7MA 1SQ5A 3KDSE 2J9RA 3KTAB 1LS6A 4DLRA 3V4RA 2IWRA 3DKVA 5B57C 3AVPA 4C0KA 1ZU5A 2FSFA 4MKFA 4EJSB 1R0YA 2V6IA 1NMYA 2IYQA 3FE2A 4R2HA 1S3GA 4OJKA 4PR0A 3GJ7A 4L4UA 1JBKA 1TX4B 2FSIA 5KHOC 1G6OA 2ZEJA 3WRXC 5J4LA 3JVVA 1EESA 4J0QA 2B6HA 2Q6TA 2AR7A 2IEZA 4A6PA 1QHSA 1CEEA 4CW7A 4U00A 3HYRA 3OEHD 2ZPTX 2HLDD 3PEVA 4ACBA 1ZM9A 3MJHA 5FBWB 1Y63A 1S4QA 1W4RA 2ZS9A 3KQHA 1M2OB 1SKYE 1SXJA 4NBSA 3Q7QA 3CNOA 3X1WA 4EFLA 4P4UA 4HUTA 4KV9A 3CR7A 1GKIA 2QMUA 2J0UA 3CH4B 3FMFA 4OQNA 4CDGA 2IEYA 3AKCA 4GOJA 3I5XA 3VQTA 3DL0A 4DHEA 1DADA 1D9XA 1XU4A 2OE2A 3M6AA 1CKEA 2OT3B 2P2LA 2VA8A 1E9RA 4YMSA 4L16A 1P60A 4OQFA 1XEFA 2OBMA 1T5IA 4YDHB 1IY1A 2OSBA 5AJYA 4KXFB 5HCIA 4NU0A 3WYAA 3NKVA 4DLTA 3BRWD 1KO4A 1VYVA 3SS8A 3Q85A 3REGA 2FPKA 2A5YB 2C77A 4QHTA 5EXXA 3I3SR 3CF0A 2O8EA 1YKSA 4OK6A 4AY2A 4LX0A 4DBLC 5K8UA 4M1MA 2MMGA 1W2GA 3U60B 3U4QB 2B7BA 2QAJA 3VAAA 2ZS8A 1XTRA 5KSOA 4C0AC 3QXCA 4CVNA 3OAAA 2WWXA 4JJKA 5FL7A 1T8TA 2JIZA 1K5GA 2Q3HA 5FL3A 1OPXA 4EPWA 3U7FB 1E0SA 2ONJA 1W46A 2KWIA 2QN6A 2OG2A 1Z07A 3AM1A 1W1WA 2CJWB 1XZQA 4M53A 1B0UA 2YJTD 3F8TA 4FIDA 4R9UC 3TVTA 3AB3A 3I5YA 2E1RA 4P4SA 3BAFA 1OKKD 2JA1A 3M4YA 3KTAA 4DB4A 3U7EB 1W0KD 3L8YA 4A0FA 2J0QA 3W3AA 2EWVA 4FN5A 2R9VA 4KLNA 1J2JA 3ICEA 4URYR 3UMSA 1QHYA 4Q66C 1M8PA 3RS4A 3LFUA 3TR5A 2FZ4A 2I4IA 4Q1DA 2IYZA 1IHUA 4LUCA 1S1MA 8OHMA 1N5IA 4LBZA 5DYIA 4Q4AB 1E96A 1J70A 1L4YA 4FCVA 2UZ3A 5CB8A 2W83A 1AJEA 2HDNB 3PVSA 2G88A 4POAA 5JWOA 4C9BA 3EPHA 1YR8A 3BB4A 1KZ7B 1E1QA 5H68A 2A5JA 3FFBA 4TYPA 1UKYA 3UXMA 3X2SA 4FWTA 2BEJA 2HYDA 4XH9B 4GI7A 3QJYA 2PZFA 1E6CA 1TMKA 2VHCA 2QBYA 3B82A 4Q1CA 1R0XA 2ODWA 3EZ9A 3MFYA 1PZNA 2QEQA 4L9SA 2RGEA 5TDHA 4CT5A 1AM4D 4JVMA 3FMPB 1NY5A 4MUAA 2UVQA 2C9CA 4Q9LA 2N42A 2BKEA 4NYJQ 2C9OA 4I4LA 1XCGB 3FTQA 1NVVQ 5AUQA 2VEDA 1AGPA 4RD2A 1M74A 1IJEA 1PLLA 1FL9A 2FMXA 2D3WA 3GEHA 4NP6A 4MKHA 2VQSA 4OQXA 3KXLA 5KDDA 3X1YA 1QHGA 3VX4A 4BFWA 4B44A 3I92A 2GDJA 1KDTA 3AEZA 2QAGC 4HLCA 3PIRA 1GNRA 1N3BA 2CLCX 1OH6A 4D4JA 2DYKA 3C5HA 3N2EA 4PHFA 5AJXA 2CHQA 3GFTA 2O8CA 3W9YA 1EFHA 4DLSA 4GZLA 5FTNA 5JJKA 1P9WA 3DOEA 3B60A 2WTUA 2NIPA 1E94E 4TLCA 5C4MA 4E03A 1BS1A 1TAGA 2EFEB 3SNHA 5JS8A 1JEDA 2NTYC 1G291 1TUIA 3TNFA 1US8B 2XNDA 1KO7A 1X86B 2BEKA 4M1OA 1N6HA 3H84A 2YWGA 5HE8A 2JLWA 3RAPR 2WPDD 1N6KA 2IS1A 3VHXA 4F4IA 4EFNA 1XNJA 5JRZA 1W4AA 1Z8FA 3LQRA 4FCWA 1KY3A 4QXAA 1R8SA 4ZKDA 1RE0A 4TYNA 1GKUB 2C8VA 3KXIA 4PC7A 1BIFA 3T1OA 2BBSA 4DIDA 1T3SA 2IC5A 4IOKA 1OSNA 3BJIC 2IS6A 1E2NA 2C98A 4Q03A 5CYPA 1I2DA 2H18A 4A9AA 3E70C 3FVQA 5HZHA 4EKDA 3HDTA 3FMOB 4M1YA 3GJ3A 4RFSB 3QF4B 4FCTA 4A0RA 4HZUB 2LWIA 4NCKA 2VRWA 1W0JD 2FF7A 1P7CA 2BM0A 3KJGA 4H9GA 4AKGA 1KMHB 1SVKA 3TRFA 1AK2A 1FFHA 1KI8A 1RYFA 5EZ6B 3CX6A 1XXHE 1OB2A 2P6NA 5E95A 1FW6A 2NOAA 1KMQA 2VBCA 3MSXA 4YDSA 4YMUA 4NYMQ 1A82A 4Q1EA 1T8UA 2Q0HA 2C96A 2HT1A 5BQ5A 4Q4AA 1N0VC 1RVDA 1Z29A 1SKYB 2ZSBA 2ZAOA 4ZI3A 3KKQA 1OHHD 1QHXA 2I1QA 2A2ZA 4MRVA 2HCJB 2ZIAA 4I1UA 4PAOA 2Q9BA 3K53A 4FMDF 3U3KA 1JI0A 3VFDA 2DFNA 6Q21A 4FMDB 3RHFA 2V8OA 4UNNA 4BFVA 1AZTA 2OBNA 1IOZA 2FEMA 1VYUA 2QGNA 1CRQA 1PV4A 2C5LA 2ZRFA 3U3RA 3E2IA 1ZIPA 3Q9LA 4IDHA 3Q72A 3W5IA 3EARA 2W0SA 2WWYA 2OILA 4ZPXA 1X8LA 1YQTA 2GCOA 2F7SA 2ZJAA 1SVMA 2VHJA 1Q44A 5FR2A 1SVOA 5IRCD 3PEUA 2Y8EA 3VNUA 2A5FA 2IYVA 2D62A 3LNCA 4TMKA 2GAOA 4Q01A 2VHUA 4KVGA 1NBMA 3C4JA 3PITA 5C46F 1LW7A 2BBWA 4FMCF 4EAQA 2J1LA 2R2AA 1Z2CA 5FUYA 3A1VA 4JSYA 5JWRA 2ZS7A 5LB4A 1HE8B 3I8SA 2ERXA 4OHYA 3V4FA 3QG5A 2FNAA 4LJ6A 4QBFA 2C78A 3SI7A 4HEJA 1FP6A 1S3SA 3VR5A 3TGPA 1OXVA 5FTLA 1F2TA 4QM7A 1BOFA 2WJYA 1H8HA 5EQTA 2OAP1 2K5UA 4IOLA 4TLDA 3GFOA 2FE4A 3P20A 4X8LA 1WMSA 2FEOA 4GBMA 5HKKA 2W6IA 5FTKA 4ASUA 4UXJA 2F3RA 2AX4A 2MSEB 1BYUA 5IK2D 2GETA 3AVWA 1LVGA 4EFMA 1NRJB 2D7CA 2HF8A 3AV0B 3ASYA 5JJLA 2FFQA 3A37A 1NSFA 5J47A 3KB1A 3B9PA 1COWA 1P2TA 4G0NA 1W36C 2ODEA 1W44A 4Q4HB 4DT1B 1AZSC 3VX3A 4QFMA 2ZREA 3HU3A 3ZD7A 2X19A 3IBYA 4Q4JB 1NIJA 2WVJA 2PCJA 1UBCA 2RH5A 3GLHB 1OJLA 1KO5A 1TQ2A 4TLAA 1XEXA 4BE7B 4ILEA 4M1TA 4P33A 2ZRLA 1N0WA 4PHTA 3GLIE 4RFSA 3PQCA 3ZS8A 1UDWA 1XP8A 3ZJYA 1DAEA 4C2TA 4HZUA 2VF7A 1OF1A 4PPNA 1VIYA 3FDIA 4BFZA 4DIEA 3MLEA 2IS4A 1O87A 3VNVA 3SFZA 2Q21A 1Z0JA 2RGNA 4XVRA 4H1VA 5DN6A 1UFQA 4D25A 4JLOA 3QVUA 4A2WA 4RD0A 2VTKA 5AJWA 4YMWA 1LF0A 1U8ZA 1NIPA 4OQMA 3JVUA 1G5PA 4XVUA 1GAJA 4M9ZA 3LY5A 3VR3A 4I1SA 3RC8A 1YZTA 1N6LA 2ZUCA 3NIBA 4PAMA 5CK4A 5L3SB 4NYIQ 3BORA 3ZIAD 2A5DA 4YC7A 1HUQA 3L0PA 4V0NA 1KI1A 2ZANA 4P0TA 4H1UA 3FKSA 1GL7A 3OE7D 2W6JA 2GF9A 2GXAA 2QMEA 1E2QA 2ZUDA 3VR4A 4WZBE 4IOMA 1YZLA 4LOAA 1P3JA 2DFTA 3TIFA 5AJVB 3DPUA 3K0AA 4ZDWA 5BW8A 1ZRHA 5J40A 2F9LA 3T1QA 4OI0A 3L2OB 4JLBA 1IONA 1HT2E 1E79A 2GRJA 2FJUA 4DRZA 4UNQA 3FHTA 5ANRB 1X8JA 5DI3B 1F5NA 4EPVA 1KHTA 1SVLA 3GJ6A 3LX5A 4B3DA 3BERA 2P6RA 1XEWY 2QPOA 4TSFD 3TUJC 3A1WA 3AVUA 5G41A 2FDCA 4GMDA 4PZLA 3WBJA 2AXPA 1I4TD 5EP3A 2IWHA 2FGKA 3BBPA 4DCSA 2IXGA 3W6PA 2XAUA 1W48A 3CZQA 4RD1A 2BMDA 1N5KA 1KK1A 1XD2B 3GJ5A 3KJHA 3ZDQA 2QGZA 2PBRA 4MGKR 4M21A 4IFBA 4JBWA 5GVSA 1ZM2A 1AQUA 4B2LA 3OIVA 2BIFA 3QI2A 3DKPA 1TQDA 3B1YA 4IDNA 2FOLA 5EP2A 2V7QD 4URVR 2A7QA 2QZ4A 5E4FA 1M7GA 1JQLB 4RZXA 1GSIA 5CIQA 5K8TA 4HLUC 1VG8A 5TB5A 2IYTA 2RB4A 2OAQ1 4Q18A 2WKRA 5JI2E 1A4RA 1WB9A 4F4CA 4PC3A 4WA7A 1AQYA 1UEIA 3SN6A 3G0HA 3KFVA 1E0JA 1C9KA 1ZIOA 5EXSA 3KZ1E 5EXPA 1DO2A 2XTMA 4B3GA 5FTJA 2ZQ5A 4Q4HA 4C0QC 4DWJA 2CHVA 2QSYA 2QI9C 1IM2A 3CWQA 2Z4SA 3QXHA 2P6UA 1ANKA 1NJGA 3K0CC 1EWQA 1KNQA 1Q0UA 1W47A 2IUUA 1ZCAA 4P4TA 2DPXA 3ZGXA 2IYLD 2DFKB 2H8KA 4Q48A 3VHLB 3QKRB 1XPUA 2BMFA 4XJXA 1G8PA 4TLBA 1U8AA 1JAHA 2PLFA 4ABYA 5DHAA 2J7PD 1WDTA 2WWGA 4G1UC 4JLJA 3RDPA 1LS1A 2FX3A 5JEDA 1G3MA 2JLYA 3HU2A 4PPQA 1N6RA 2ORVA 4DCVA 4BZQA 5KDOA 1IN7A 2AWOA 4Z8YA 4BFSA 2QPTA 1KDPA 1R7RA 5HPYB 5IF9A 1OLOA 1RRPA 4KFTA 1WF3A 2GXSA 1XMJA 2ZI4A 1Z22A 4EPXA 1QVRA 3UK6A 1G18A 3UANA 4B3BA 3GP8A 4QC2A 1XD9A 3W6NA 2GZHA 1Z0AA 2GWHA 1UBEA 1A2KC 3B1XA 1ZMXA 4PZZA 3TUZC 4AG5A 2FSGA 5L3SA 4C30A 4ZI2A 5A0FA 4CGZA 3KB2A 1SXJB 1UADA 2PJZA 2XB4A 3N2IA 3TK1A 1ZD9A 3C41J 2JEOA 3NVAA 4NE2A 1EX6A 4JYCA 3B9QA 1WQ1R 1D2EA 2A9KA 2OUKA 4FW9A 1U0JA 4A0HA 2OCPA 4F4JA 4X8MA 3W34A 3U3OA 3A1TA 3LA6A 4A2QA 4MYCA 5B64A 2QNRA 4GRAA 5TMPA 1G3IA 1JB1A 2FGJA 1RIFA 4C0BA 2ZE7A 2YKGA 4DCNA 3K0EA 3L0IB 3SQXA 3UMFA 4A36A 4HUQA 4TT3A 4A0GA 1GFIA 3LH5A 2CLDX 3QXJA 3LWNA 2GEDA 2HEIA 3RVBA 2WIBA 3GLGE 5JRJA 3R8CA 4G5OA 2GJKA 3T15A 1Z6TA 3AUXA 2QT0A 3VR2A 2QM8A 3NC1C 4UNSA 1KK3A 3EIHA 3SDZA 4QHYA 2WKQA 2OFXA 3QY0A 2AN9A 2O8EB 3OHMA 1E9CA 3NBYC 5G40A 2I3BA 3QBVA 2XJ9A 1VKJA 1IN8A 1NF3A 2A3RA 2PZGA 1AS0A 3AVOA 3EC2A 3QXXA 2V1UA 2QRNA 3GLFB 1QBKC 1F2UA 1A2BA 5KNDA 1KKLA 2HXYA 4B2IA 2ZSEA 1XJQA 5SZHB 1A7JA 5KNBA 3IO5A 3RANA 3KQNA 4MDEA 4CZ2A 1ZP6A 1KJWA 4TN1A 1AN0A 4LHYA 2ZM5A 2ZJ5A 3R9WA 2CK3A 5EE5B 4N0DA 3TAHA 2FZLA 1EFCA 2JJ2A 4JVLA 4KBFA 4WZ6A 1YE8A 1N6NA 5JHGB 3PENA 3NWJA 1ZU4A 3ONWA 2VHTA 2WSSA 3R20A 4JL6A 2WICA 3EC1A 5KSZA 1YR9A 5SZIA 2CHGA 4LV6A 4P4SB 1E9DA 2EWWA 4PSAA 4C7OA 4OYHA 2W2XA 3QKSA 1P6XA 3VKHA 2BMJA 2DWPA 1KDOA 3BGWA 1CR0A 4AURA 4I99A 3B1WA 5FPYA 1KOFA 1XXHA 4LHVA 3QKRA 3X1DA 2PMDA 4GPTA 4WZAE 3UWKA 3ZVRA 1UAAA 1FNNA 4B33A 1GWNA 4ON9A 1ELOA 4B71A 4M22A 3OEED 5E7JA 2IX3A 4NH0A 3CR8A 1N2CE 3T35A 3E5HA 1GDDA 1QHHB 4TMWA 4A8JC 1KZGB 4LPSA 4KODA 4QGAA 3WRYC 3IQXA 5LB2A 4HDOB 2ZRCA 2OO7A 1MO6A 1QZXA 2ZRHA 2GHIA 3VR6A 3ZH9B 2OCYC 2ZU6A 3KKNA 5AUNB 1P62B 1JR3E 2ZR0A 2QBYB 1VMAA 5CJPA 3IIMA 3P1JA 2DWOA 1MABA 4D4LA 3CNNA 5KOYA 1U0LA 3NEYA 1IN6A 1N0UA 2QPAA 1IY2A 4YXWA 4EJSC 2XSZA 1OT3A 4B73A 5JEEA 2PX0A 3CRVA 4AI6A 4M1KA 1GZSA 1DG3A 1ZNYA 3QKUA 2X1VA 2QQ0A 3QBTA 5EUMA 1ZNZA 3EZ7A 2ZI9A 3Q8XB 4OKSA 1OYWA 3FFAA 3CUEF 1NMXA 3CH5A 3QNUA 3QUSA 4GT1A 4JBYA 2GVDC 2OV2A 2OLKA 2FFBA 2OCAA 2CNWD 1BMFD 5JFGA 3OIYA 1RFLA 3AF3A 1E2JA 2O8CB 2D7DA 1RPZA 4JLVA 2EQBA 2YZ2A 2YWEA 3DM9B 1V43A 4KFUA 5A4JA 4II7A 3ZVNA 4DEXA 3K70B 2PH1A 3IIJA 1XTIA 2C9YA 2RGXA 3CRQA 4L15A 1KJZA 1X3SA 3B1ZA 3I4LA 2A30A 2P5TB 4G3XA 3H0KA 1V5WA 3IEUA 4BRUA 4B76A 2J87A 3PUZA 1FUUA 2CBZA 1VG9B 4D0LB 5FTMA 3QE0A 4URUR 5H70A 2BBTA 1OFTA 4OK3A 3UPUA 1DVRA 2YV5A 121PA 4TWZA 4KVAA 3RSLA 4QKQA 3GLFA 5FUWA 3CX8A 2ATVA 2YVUA 5EJEA 4I1OA 1MKYA 1W2HA 3TQFA 2QQEA 2CCGA 1MO3A 2J59A 4BFYA 4JLNA 2PEZA 3CRRA 1Y3AA 2VL7A 2C04A 4KITB 5C18A 5JHHB 1SKQA 2CEAA 2ZRMA 5IT5A 1CJMA 2PT5A 4G5SA 4KCGA 3RYTC 1UBFA 1ZVQA 2VHQA 3K09C 3RS5A 1SXJD 3Q3JB 3GLIA 1MOZA 4JLKA 3EA5A 4MA4A 1EFRA 2WMNB 3RS2A 4IXNA 3AVYA 2Z6VA 2GBLC 4LBWA 5LPNA 3AH8A 4IDPA 1EK0A 3TSOA 1ZM4A 2ZE6A 4LJ7A 1DO0A 5D3MA 4OK5A 4YONB 3IIKA 4HB2A 2AL7A 2G1KA 1KAOA 4C0JA 1X8KA 4AG6A 1E1RA 2DY1A 3BK7A 2FH5B 2Z83A 3KJEA 5DGXA 421PA 3P4XA 3TMKA 1WBDA 1XZPA 3AP1A 2AK2A 2CE7A 1QHHA 1FOEB 4E22A 1ZUIA 4Q1FA 4Q5IA 4JS0A 1G8YA 3C14C 2F1IA 4JT2A 1MH1A 1S2MA 1I4LD 1K8RA 2BM1A 3A4LA 3IHLA 2C99A 1NL3A 4HLQB 3EWAA 2GK6A 3WNBA 4CEHB 2F1HA 3T34A 4BPBA 1D2MA 3DDCA 4NDZA 2WWFA 5EE1A 4LHZA 2CVFA 3GJ0A 3LXRA 3QEJA 5HTKA 4US1R 4M4SA 2G0TA 3ND9A 2GEUA 4BQSA 2ZRNA 3I72A 1SULA 4TQUS 3QQ5A 3KKMA 1G9XA 3DVLA 1E2PA 2GCOB 2LCFA 4Q9IA 5FPKA 1UM8A 3OAAD 1KI2A 1FPMA 4XWAA 3R9IA 5FL7D 3W5JA 1AA9A 2JIZD 4A2PA 4EPTA 4Z51A 1HH4A 2GA8A 5AR1A 2Z0MA 4HI0E 1Z0KA 1DTSA 2KJQA 2YWHA 2YWFA 4Q19A 1T91A 4Y0VA 3RS3A 1JJ7A 3TUIC 3TE6A 2HV8A 2JLZA 4QGHA 1IBRA 2IA5A 1XMIA 4XSGA 3TKLA 5K8IA 3N70A 4HAZA 4AYTA 2DBYA 1XTKA 2R44A 1OFHA 3G5UA 4JVSB 4CIDA 5B30A 3U5ZB 1GOTA 4O0MA 3HR8A 2JLRA 4MYUA 1JECA 3ECCA 2ZJOA 1E99A 3ADCA 2R6AA 4W5WA 4LYFA 2CL0X 2OM2A 1F2TB 2ZVQX 5L3VA 4TQ9A 3EW9A 4QM6A 1OV4A 1RJ9A 4Q9KA 5DIFA 5E3HA 2KI5A 3CO5A 4JLAA 4DSOA 1X1SA 4C2UA 2EFGA 1F3OA 3I8XA 2XB2A 1E2HA 3WBKA 3ASZA 5GADl 4JL8A 1P2VA 3S1AA 1JNYA 3CKLA 4F92B 4URXR 3DMDA 2XZLA 3LBHA 1OIWA 3BS4A 2ZJBA 1DBSA 1C1YA 4RCYA 2OCBA 5KO2A 2J46A 3CPHA 2RGGA 4EPRA 3IEVA 1E0AA 4F38A 1HV8A 2B92A 1KK2A 1JJVA 4Z1MA 3I61A 3NTUA 4ZCLA 1E2IA 2XZOA 1E1QD 4MGZR 4G01B 2ZSAA 1NN1A 2IF0A 2O8FA 2ZYUX 4RZUA 2OLJA 1G20E 3VMFA 4DDUA 2EFCB 2RGAA 1AGRA 2WHXA 1YU9A 1KY2A 1XEXB 4M9SA 1P72A 3JZMA 5JLJA 2FN4A 1DAHA 1Z6GA 3MJRA 4W7SA 5EZ5A 3P27A 1F6BA 2VP6A 1SVWA 3REFA 1E2FA 5CIWA 3W8RA 1GITA 4Q00A 3EPJA 1Z0DA 4WVFA 3QKTA 4MQBA 2FSHA 2IL1A 4AK9A 3LBNA 5KTYA 3TSWA 3LAWA 2P0EA 1QHIA 1ZAKA 3OFNA 2O0KA 3H4MA 3SOPA 3VR1A 4CEJA 3MWYW 4LPKA 3SJCA 4NYJR 1M1YE 2IYYA 1CR2A 4TLEA 3M0EA 3AF0A 4R2IA 4EPYA 3K70D 1Z63A 3ZZTA 4CEHA 4MRSA 1BO6A 1HQCA 3OZXA 2ZRIA 1NMZA 4ITRC 3K9GA 4JLDA 1XTJA 1R2QA 3AF1A 3LQQA 4QBHA 5DSZA 1SZPA 4DKXA 1KI4A 2V3CC 3K0AB 4A6XA 1N5LA 2XNDD 2REXB 2FV8A 2RGNC 1G3QA 4D80A 4B43A 4BFTA 4D81A 1BH2A 2XNSA 4HLDA 4IJMA 4WXRA 4DLYA 1JR6A 2IXEA 2QAGA 3CF2A 4OL0A 1G41A 4OHVA 3HJNA 1PUJA 5TV2A 3GLGA 1S9DA 1WXQA 1ZW6A 1MO4A 2VP0A 2ONKA 3NG1A 5CK5A 2CCJA 5KUTA 3L82B 1VIAA 3ND8A 3WYGA 4Q7JB 1I2MA 5HCNA 3CRMA 5EP4A 1KI7A 1KTVA 2GZDA 1KI6A 2FU5C 5FI1B 5FUXA 1ZCBA 3DZ8A 4UJ3A 3IGFA 5J4YA 1P9RA 5GJBA 1E69A 4HZIA 4JIMA 4EDHA 2H17A 5L8VA 3DM5A 1ONBA 2F55A 4ESVA 1ESNA 3BFKA 1G7CA 4S2EA 3FB4A 2NPFA 2WJVA 3A1SA 4QBIA 4BLTA 1IXZA 1U9IA 3T5GA 1N6PA 1CIPA 3GCGA 4DB2A 1OFIA 1U98A 2G3YA 3THYA 3TR0A 2P65A 1GG2A 1G4AE 4B34A 4MRRA 1N6OA 2H7VA 4XVQA 4V0OA 4C0LA 1EG7A 1X6VA 3UATA 1SHKA 3BC1A 3LRPA 2QE7A 3L0SA 4LCBA 1YZUA 1T6NA 2B8WA 4PQFA 4QJ5A 1Z6XA 1TADA 2VF8A 3RRMA 2E87A 4PC6A 2XEXA 4NYMR 4DSUA 4C4PA 1Q1EA 3K1JA 4JBXA 2IT1A 2FFHA 3UWOA 4HATA 4HSEA 3UIEA 2QORA 1VHLA 1IAQA 3CM0A 4DUGA 4XWKA 2ZSFA 2XTZA 4RY2A 3TAUA 1HQYE 2VPPA 5L3QA 3CZPA 1NBMD 1Q3HA 2XXAA 1W49A 2WMOB 4AD8A 3GPLA 4D0NA 2VO1A 2F43A 4M2LA 2IYWA 5F9HA 4TL7A 3SJZA 1RZ3A 1KK0A 3BB1A 3AKYA 4FI3C 1JR3A 4CEIA 4FMBB 2OXCA 2AFIE 1E98A 3CLVA 3I32A 2KB0A 1YR7A 4JKIA 3LW7A 3CB4A 4KYIB 4XD7A 4OI4A 5FI0B 5CITA 3OIUA 1VECA 2BCJQ 4PHGA 1TU3A 2ZE8A 3EIEA 4HAXA 1H8HD 1HY3A 4Y0AA 1P9NA 2GF0A 4BFXA 4NHOA 4R7ZA 1XJ0A 3U3JA 5BYJA 4YMVA 1NLYA 1VG0B 3CIOA 4TMZA 1Q22A 2ZTSA 4LSGA 5HKKD 2W6ID 2QUZA 4ASUD 1UJ2A 2B8TA 3FHCB 4P31A 2MSDB 3QPWA 3BOSA 3I1FA 3LX8A 4TMXA 4BASA 4GMXA 3OESA 1E2KA 2C03A 1T3LA 2RMKA 2KSQA 4ZCMA 1XJCA 1XFAA 5FOWA 1TL7C 4TL8A 4B35A 2QA5A 3ADBA 3SYKA 4KJZA 2GXUA 1COWD 1E9EA 4HUQB 4BLRA 5C1BA 2PLRA 3NBZC 2YC4C 1CS4C 821PA 1E2MA 1CP2A 3K8YA 3LV8A 2RHMA 3AVTA 4ACAA 3IDQA 4FD2A 2IF2A 5LD2B 1Q1BA 3O8BA 1NY6A 4BGDA 2ERYA 3VTKA 3ADKA 3UMRA 3NEJA 4IW3B 4MYHA 2AKAB 2DHRA 4TTRA 3BWDD 3BXZA 3IQWA 4EIWA 4A1FA 4BUJA 1Q12A 1TEXA 2IYUA 4WW0A 2WM9B 4RKFA 2D2FA 5JJIA 4A82A 4TL6A 1QHNA 3AVXA 4NONA 1MT0A 3LDAA 621PA 1A1VA 3LW8A 5DN6D 3KQKA 1OFUX 1W4BA 1SVSA 1F2UB 2PMKA 1R0WA 4URWR 2O8BA 1KI3A 3SZRA 3WYFA 2QENA 1H8EA 2N1BA 3THWA 5IDVA 3RC3A 1NLFA 2GKSA 1XF9A 3O47A 1G4UR 1KAGA 3B78A 1FQKA 1G3RA 4XIGS 1GUAA 3PFIA 1EFUA 1HYQA 5JSZA 3AF4A 3BH7A 1OIXA 3C8UA 2JAQA 3KJIA 3EASA 3CONA 3MWLA 2D2EA 3IPXA 4IDOA 1GM5A 3FKSD 3K0FA 2KBFA 1E9SA 2ZYWX 2XTNA 4QNMA 2W6JD 1M34E 4PO1A 4HAUA 1RRFA 2ZI6A 4C7OB 3BFXA 3QKSB 3AP2A 2W58A 2EFDB 3LBIA 4W5HA 4UKDA 4N3NA 1Q1ZA 3EG5A 2REBA 1XXHB 1NP6A 1E2GA 1LB1B 4QGFA 2OHFA 4RKEA 3QIAA 2QMOA 4NYIR 3WMGA 1L8QA 1KJYA 1E79D 2LKDA 2FPLA 5DYGA 1W4CA 1VPLA 4AKEA 2FPMA 4LYAA 2JJ8A 2JJ1A 4DSNA 5BN5A 4IHQA 3DOFA 1DAFA 1XCPA 4V0KA 4URZR 2ZR7A 5TY0A 1ZBDA 3NBFA 3NHBA 3X1ZA 3A4NA 1P75A 1CBUA 2P67A 2HYIC 1JAIA 2F9MA 2VSXA 5FOTA 1KKMA 1LF5A 2ZRGA 2XOKA 3B85A 2UZIR 4ZDKA 1SVIA 1KSHA 4M0LA 2O52A 5ELXA 2AD5A 1AS3A 1H65A 1MABB 4GOKA 2A78A 2ORWA 1NLZA 2BWJA 3ETLA 4Q9HA 2WOOA 4KSBA 5BN3A 5CDFE 3P32A 1C4OA 4KHZA 3AVVA 3F5FA 4B32A 3GEEA 1EXMA 4IEIA 1IJFA 1XX6A 5TVKA 3W8NA 4IKEA 1G16A 4RCZA 5A5GA 3ICQB 5FH9A 1VDZA 2H1LA 1CF4A 4U02A 5FOVA 2P3SA 3VU9A 4CYMA 4GSYA 2EU8A 3IO3A 1DE0A 2NO0A 2QP4A 1II8B 3GMTA 1U8YA 5BYKA 4D6PA 2ZXUA 2O5VA 4HB4A 2D06A 2HJVA 4WIAA 3QPUA 3HPQA 1XD8A 3C15C 2V4ZA 4DCUA 4E5UA 1VCNA 2IBMA 2ZJ2A 4KFRA 4KFSA 1IN5A 1GP2A 2NPIA 2G9NA 3WHLA 4NCIA 3TLXA
chains in the Genus database with same CATH superfamily
4EHJA 2HTEA 5JCZA 1ZUHA 2ASVA 5ESWA 1T3ZA 4PLCA 3STHA 4RK0A 2Q1TA 3E03A 2WKPA 1G8HA 3NTVA 3LUAA 3L77A 1LQUA 4I3FA 1WA5A 2IUFA 2YFKA 2QV7A 3E9ZA 3H86A 5B1YA 1QOQB 3ZLBA 5CEFA 1TKBA 3NBUA 4N0EA 4J76A 5G3YA 1N77A 3QG1A 2ZPUA 4AJNA 4OXXA 4I2NA 1QK3A 1MNAA 1GL9B 2NU7B 4JCOA 3ZY5A 5HUQA 2FXVA 2BH2A 3FPAA 1PG2A 3ZVLA 1KC1A 2CVOA 2FX5A 4Q9LA 2OZLA 3BMCB 1XVAA 2V7VA 4I5IA 3NH9A 4X24A 4NE7A 1TO2E 4IFEA 1QC5A 4C7BA 3AF2A 1WNTA 4XIJA 4DHWA 1QLJA 1AKYA 1B0ZA 3F7MA 2XIQA 8ADHA 1V6CA 4ZVTA 1FRFS 2Q4RA 2NXNA 4PZAA 4D9HA 4S1TA 4TSRA 4B2PA 5ICEA 3I53A 4ZQHA 3V33A 1PR2A 2YL2A 3O3MB 1QGAA 4MH0R 3SC2A 2D74A 1U3TA 3C97A 2HLDA 4W5QA 1G20A 2ZJZA 1A5ZA 3F47A 3MN1A 4BHTA 3AHIA 4EH1A 3FGZA 3IKLA 4LOLA 2DTXA 3BE6A 2BVNA 1KYYA 4JZKA 4KU4A 1JG1A 2VNIA 4AYXA 3T5CA 1RI4A 3BMXA 5HX7A 2ZFUA 2H2HA 3V1UA 3MMZA 2JATA 2WFAA 2PS9A 4EG0A 1OBHA 3SZ3A 4J1NA 4QVKA 4PWYA 3RUPA 2JIOA 4YCAA 5IEBA 4EG7A 5EIOA 4RTJA 3EZFA 1T9BA 3PGA1 4RZ2A 4BWFB 5DM70 5ADWA 1AS2A 4PF1A 1YDHA 4LJ4A 1VFNA 3H17A 4M83A 5L7YA 2ZCJA 2Q1WA 1YVRA 3OFSA 4QO7A 1ZIYA 2AUNA 1CERA 3EZLA 3B3FA 3PJRA 4QQFA 4EJMA 2GX6A 4CCAA 3NKLA 3ZWAA 2GM4A 3E82A 4C4XA 3PUVA 5TARA 2C3YA 5DE3A 4JBHA 3PXUA 1M1YA 2XY4A 3IQFA 4NE9A 2INGX 4PONA 3W7BA 4DIUA 5EXTA 1NKSA 3TTUA 3KAQA 3SZUA 4F46A 2H0QA 2G25A 3I9V6 2P2SA 1K6XA 2DBVO 5GM2A 3N3AC 3LIIA 2AI2A 4ZT5A 4A4DA 4OXRA 3COSA 4RPIA 4XGRA 5I8WA 3OZEA 3VR2D 3V1MA 3N39C 4ZDIA 3LPCA 5KTMA 5ED4A 1IMJA 2QU7A 2R6GA 1E7YA 1HFEL 2X8LA 2NZYA 2CVZA 1DAGA 3ETDA 3W8DA 1XCMA 3WTCA 1Q0LA 2GBFA 5E38A 2C7GA 3P9YA 2XZTA 2H07A 4XJTA 5TRTA 3ABOB 4DVGA 1E3MA 5C34B 1J09A 3CEPB 4D02A 4YV0A 4JMPA 1KO8A 2GZMA 4C7MA 4D8WA 3IKTA 2C5BA 5PNTA 4D4KA 1O9HA 5SYAA 3DBLA 5D8DA 1TTTA 1V3UA 2OESA 5HVNA 5GONF 1IIBA 4EGSA 2JIMA 3CLTD 3ETCA 3D1VA 1ML4A 3HCRA 3MUEA 1IN4A 2QUIA 5F2KA 3WHKA 1L6IA 2VNKA 4PG4A 1BH6A 3IVRA 5G3ZA 1FFGA 1D09A 1RPAA 3KT3A 1XRPA 1NSTA 3RUDA 3HPRA 4YCLA 3ZKWB 4XASA 2JJ2D 2QTMA 2A92A 2E4YA 5GIPE 2WWHA 1QOPB 2YJ3A 2BOVA 4MVJF 5LZ4A 1C4XA 1JILA 1OTYA 3R5JA 4BTLA 1ODIA 2HRQA 2JAOA 1W94A 5ENZA 3ZHXA 5DGTA 3WA7A 2UKDA 4LEIA 4BV3A 2WKWA 3UTDA 4DLLA 2W2QA 3N2YA 1HLPA 4XQ0A 2FZGA 5E9AA 3K1YA 4JI3B 4AECA 5BSWA 3LLMA 2AZDA 3PU6A 1VZ3A 4LZJA 4C2BA 2E2WA 4NATA 4UHCA 1Q1QA 3T7RA 2YHSA 3NT2A 2NZJA 2IVFA 4BUCA 3CQ9A 1FNCA 1W75A 5CUQA 2WUEA 1Q0RA 2QTVB 1OU4A 4E3ZA 1C0LA 1CZKA 3KRTA 7AT1A 1TF2A 2RCNA 2WTXA 3K6SA 1VJGA 3WADA 1QF9A 1WWKA 3D7LA 3FNQA 4CKWB 4B47A 1QMGA 2BCEA 4BLQA 1MT3A 1RQXA 4FFBA 3WIVA 1GILA 4AP5A 4YYZA 1NN3A 1UBKS 4TZ6A 4JSRA 3S1LA 5JNLA 3N2ZB 1SD1A 3C6KA 1M10A 3PUWA 1EX9A 2GYUA 5DTQA 3SYLA 4ZI7F 3M6UA 1JAYA 1P18A 4PR3A 1P7ZA 4RV9A 5ALOA 3HB1A 2SCUA 4ZI7B 2FG7C 4GI3A 4U0JA 1G64A 5BWMA 3RUEA 2H57A 5A0TA 1PTJC 3U0VA 2OFOA 4IJVA 4HDCA 5DHFA 5FBVB 4PSVA 3D2AA 2X7JA 2O2SA 2ZG6A 3PDIB 3A9WA 1ZKDA 1NU6A 2AQHA 3BXGA 3KZNA 1B42A 1BHQ1 1W87A 1GL3A 1Y9EA 1C7ZA 2GLUA 2UZ1B 1EUCA 1SBCA 2Y1LA 5TPWB 2VWGA 5F2EA 5AWFC 4ALMA 2BFFB 2BZ0A 2KW5A 5IKMA 5IT4A 3K70C 1NW8A 4MYTA 1IY0A 2BCGY 4H3HB 3MTBA 4WGGA 1N5JA 3NC0C 5C8YA 1V5EA 4PTLA 1A2OA 3J81A 4RTQA 4KR7A 3IFSA 3KUDA 3O1IC 6AT1A 1LC3A 4YT8A 2V03A 1NJFA 1K88A 3RWMB 3IP8A 4BYGA 2UDPA 3U80A 2XA1A 4A8JA 3GMDA 4FP9A 4U2KA 5KNCA 2PLNA 2X7HA 3ORSA 1RWVA 4KQKA 4Q9JA 5M7EA 4KR2A 2X42A 2JCSA 3WO0A 2CMKA 2G4VA 2Q7DA 1E1KA 1SA0B 2AK3A 2C2XA 4CKZA 2O06A 1YQXA 2RCYA 3DVQX 3QTBA 4XQCA 5CLLA 1ZC3A 3I0ZA 4IV8A 1QOZA 3H9CA 2OZPA 3HXTA 4C7JA 2NMVA 3U3ZA 1LVHA 4IHJF 2P8JA 3P9RA 4BCDA 1M0EA 4WBSA 4GVLA 3MXOA 4IHJB 4RLSA 1QDEA 1DCTA 1N78A 5D5HA 3KOOA 1XTZA 4QUGA 4KN6A 1QK5A 4M76B 1QRDA 2M9MA 3K5PA 1TJPB 4FDTA 4F5YA 4DDWA 4BN4A 4EKYA 4G63A 4M9XA 1D6MA 3VA7A 3SVZA 4UMFA 3A36A 4YYEA 2ZRBA 2I3AA 2BLLA 3KDPA 3EW7A 2FWNA 4JVNA 3F97A 5CB6A 1ZK4A 2BT4A 4Y9TA 3ZHBA 3PHLA 4YCBA 4ECAA 4E09A 4DJTA 4DDTA 1PNOA 5MN5A 1DQPA 4IILA 4BWVA 4QXQA 4QOJA 2R8XA 2WYUA 3PXGA 3OU6A 4FOPA 4Y6SA 2VDWB 2WPDA 4DZZA 1DP4A 8LDHA 1G6HA 4FCCA 2IDKA 3RODA 4PN7A 1H05A 3ROMA 2OB2A 2ZVDA 1JVBA 1F7UA 1WV1A 1TFUA 5FDFA 1K08A 4KNWA 1SGWA 5DFAA 5LA6A 3WLHA 4O2LA 1LTHR 1CF9A 1L4UA 5HFNA 1OWPA 2X2FA 3C5CA 1N34B 2RAVA 1NT2A 3VPBA 3W9UA 1U8XX 4OMUA 1ORTA 1ONSA 1PWHA 1SU6A 2V0NA 1SG9A 2PUVA 4WY8A 2FN9A 4DYVA 3MGKA 5BMVF 5IULC 1LVUA 3FMIA 5LQCA 4XTRA 1ZXLA 1KI6B 2A4MA 5BMVB 1EFRD 1XMVA 3DTVA 4KLAA 3WMEA 3MQ4A 2REOA 1FRQA 1REQA 2WWIA 4N47A 3ETNA 1WXDA 1NWHA 5CW1A 3C3MA 4HY3A 1ZHOA 1A5AB 1C29B 4GMFA 1J20A 3KL2A 4NCHA 1RWWA 4I5DA 1LJ8A 1UKVY 3NJ4A 4QQNA 4BO9A 5KYWB 2NO1A 2ZITA 3TW8B 3L7OA 4ZMBA 4YUWA 4OXKA 1OW3B 1O9GA 2XMDA 2PSHA 4HL6A 2C2BA 2FVXA 4QLOA 4B6JA 1AGXA 2HUNA 1MTZA 2LW7A 2PZLA 1EDEA 3H5NA 3RABA 3WJAA 2X4DA 3NHMA 1JV2B 2A7XA 3CR3C 3QMVA 5IDQA 4PAGA 2JFFA 4TM8A 5ED0A 1RBZA 2QLJA 3R2JA 4GEGA 5GAJA 3IEMA 5TQ0A 1UQUA 3GT3A 4HNAA 4XAQA 5ALNA 3OJWA 4PQGA 4Q47A 4NAHA 3GYGA 1CWUA 1DAKA 1I2AA 3FWYA 1IYZA 1ZGBA 4ZGBA 3LG2A 1MF7A 1UXJA 5K9ZA 2ZIUB 1WZCA 2ZUBA 2OGTA 1OX6A 2XDAA 5JXWA 2EGUA 1QVVA 2A86A 4JYPA 4WESB 1XZMA 2RAPA 1O3YA 3B7GA 1FXUA 1AC5A 4D2IA 5AUPB 2II6A 1HSOA 3N5CA 3D31A 3UGJA 3TFQA 2PTGA 2VT7A 5AKLA 3PHJA 3O8DA 2BDTA 1BHJA 1DAMA 1IXRC 4S2UA 3SXUB 2PX5A 5DB4A 1FSSA 3WDKA 4RHXA 1OH7A 3SHVA 2GEVA 3U37A 3CSDA 4E4TA 1RIIA 3ND5A 5LDDC 2KLHA 3HG7A 4C3UA 4X60A 3AEKB 4JDPA 4XRGA 3JR3A 1JT2A 1NRXA 1M1UA 1H5QA 2H7CA 3H2GA 4IOJA 3VPFA 2CNOA 7REQB 1T2FA 5LZ2A 3UAXA 1E7QA 2AJCA 1YTUA 4U63A 5L3QB 1WSBA 1T24A 1FJ2A 2Z2KA 3NM5A 2WHYA 2VDKB 1G5FA 3KKPA 4IIBA 5BN4B 2B69A 2MR6A 1USUA 2QROA 3E5RA 4FYPA 5UKDA 3VGJA 3AF5A 4MDYA 5JV5A 1ZKMA 2CJWA 3AO0B 1K7EB 4JYBA 1G8JA 5CAEA 3LY8A 3QXSA 3WK8A 3V7WA 1BJTA 2I7TA 4RLQA 1FTSA 3PWSA 1NVXQ 3N75A 1F12A 3GW8A 3INGA 2DCMA 2YXPX 4GXQA 1NVVR 3FVVA 4JOSA 3LC0A 3OE1A 5CDFA 2OY0A 4Q02A 2ZRKA 1UFVA 2AUTA 2JC3A 3IP7A 4TTPA 4LZLA 4ENUA 2C5HA 3FAKA 1UT5A 1X7GA 2EYQA 1GTVA 2J3EA 4XOIA 1DIGA 3BJEA 4D0SA 5C1PA 4F21A 4ENRA 5A3RA 4NDAA 3DV0B 2QRMA 1BU5A 3R1IA 1AUOA 1Z28A 1GPMA 2XNCA 4RO0A 3TW4A 1GY8A 3AL0C 1XTUA 4U7WA 2PCLA 2QRZA 4ZJUA 9ATCA 2XDQB 1J07A 3WKEA 1PDVA 2P90A 3B9BA 3KEQA 3SQLA 5HZKA 4V03A 2F1RA 4KNVA 4CM4A 2WIDA 3LUHA 4DS3A 3P9IA 5KHLB 1AO0A 4OHXA 3CJRA 4JP2A 4B6GA 1SXIA 1TQ4A 2GZRA 2QRGA 2N3ZA 3C16C 3C7KA 1TYZA 4DM4A 3ONDA 2ZWAA 4NPCA 4DWOA 2G6BA 2HM7A 2PT7A 3WHIA 4ZP1A 2BONA 1U8CB 3LP8A 3CNLA 4ENTA 4WAUA 1SIWA 4BNDB 5F9FA 2JBAB 4WMLA 3OPQA 3EDCA 4A8TA 4MB6A 5F5LA 2GSDA 2Q27A 2RC6A 2WUGA 3AR7A 3O94A 1P73A 3DEZA 2IPMA 5KVVA 2OBLA 4D45A 5LIPA 1JEEA 721PA 3HJHA 4BZPA 2G36A 5FUMA 3QVTA 1ZUNB 3SZMA 4PIMA 4WK6A 2AG6A 2VS1A 4F7WA 1EFTA 3T52A 1B41A 2XCUA 1U7HA 2OB1A 3R7WA 1QG2A 3BB3A 4M8NE 4PC2A 1CUGA 1MV5A 2GTIA 5JY6A 3QWHA 1PRYA 3AINA 5K6AC 4P7FA 2NYAA 3LXXA 3VM6A 3SF8A 5FKJA 5EA2A 2ZJ3A 1F60A 1ZJYA 2RDMA 2ZDHA 3C6BA 3W9SA 2IUTA 3FVRA 2G6TA 1W36B 2ZZMA 1XTSA 1K75A 1U3WA 3JAKB 4P3OA 2AT1A 2WTNA 4B7CA 1S1CA 1WHTB 4AKIA 5JSZB 3JW8A 4TKZA 4GZMA 4YJ2A 4QD3A 5BXQC 3AUFA 2RHOA 3P94A 3PQ3A 4K2HA 1N2ZA 1CUAA 2O7NA 1RYHA 3QITA 2D1FA 3T61A 4WL0A 3TO5A 3CEAA 3OE7A 2QJRA 2CV0A 1T9CA 1ZVMA 2IEIA 1IMOA 4ECEA 4ZIRB 3A3YA 3A1UA 3KDAA 1UCFA 2BGIA 3VHRA 5AVWA 4XVHA 3JWJA 1HURA 3LFHA 4LJAA 1V8ZA 2JJYA 2UVPB 1Z3IX 4HN4B 4QYIA 4TTSA 5F78A 2WP8J 2KLBA 4EUFA 1NW5A 2CVQA 1GA4A 1E1CB 2FHSA 2QNIA 2DLCX 1LFAA 1US8A 2CLSA 2Q2NA 3O2QB 4D4MA 1GCAA 2VP2A 3SSMA 3PR1A 1Q7GA 2EHJA 3KQMA 1GCOA 2IXDA 2WVGA 2AMVA 2H2WA 4LRWA 4UBJA 5ALFA 3UPDA 3ZY2A 1J5EB 3OUTA 4TQAA 3BA6A 3JYQA 5M04A 1XMSA 3PNLA 3SJBA 1FTNA 5GVRA 3ADDA 3BXPA 3FDFA 2K6GA 2I66A 3HGMA 4UNPA 4F85A 2V3WA 1I32A 5EVCA 2BTEA 3WQBA 2ZI3A 5K3DA 1S2LA 4HS4A 3I73A 2I7VA 2C5EA 5E2AA 5SY4A 2XW6A 4HGZA 4BKPA 4CIVA 1IXSB 4M1SA 4QEKA 2AKEA 1G21E 2Q2VA 5GJCA 1QZUA 2J5XA 3GEPA 3WFJA 1GNSA 3VHQA 1UOEA 4TMTA 2Q5FA 1L5SA 2ASEA 4PXAA 5JNSA 3SSAA 4F91B 4Y9RA 4GI2A 1P5ZB 2GF2A 1BXRA 2JLSA 3JQGB 1L7AA 3L7DA 2OV1A 4GVPA 1Z17A 2OC9A 2X22A 2XYGA 3ISTA 3W4IA 4P3YA 3L1HA 5BRNA 4E5VA 1ZH2A 5DBGA 5A9TA 1GN8A 2W2MA 2MYTA 2O05A 4N40A 1M2WA 2VH1A 4UVIA 2D4AA 2HNKA 1D7OA 3GPBA 3SKYA 2YRWA 3W04A 4MB0A 1KQ3A 1QDLB 4G5GA 2IKQA 4KAXA 3WL3A 2QUKA 1VSVA 1FDTA 2OCGA 2V7QA 3PDUA 4DLVA 1E92A 2RB5A 2BJWA 4MUJA 5KPJA 4W9MC 3SBEA 4DABA 1T1EA 3S7TA 1YR3A 4AMUA 5C1OA 4AQYB 1ETHA 1BXZA 1J8YF 3VNAA 3U4CA 1FYVA 4JSTA 5C0OE 1M9NA 4JWTA 3RSCA 1G1MA 4R8KA 2CVHA 3G5MA 2BGRA 3A11A 1OQAA 3T4EA 3PV0A 3ZDRA 4BLSA 4BLVA 1SUAA 4QRIA 3VOTA 4I55F 3IILA 4RVNA 1M2KA 1U0SY 4WFQA 4IVPA 4XUEA 2A9FA 1ORIA 1GNQA 3SE0A 1LW6E 1M8FA 3EGEA 1AHNA 2H4JA 2ZROA 4B3JA 1WABA 3DKRA 3T0IA 2YN0A 4R8MA 1Z62A 4RZ3A 3ZYCA 5ITZA 3OCVA 1G0NA 1NI4A 2GJ8A 3DOHA 4TYWA 4WVLA 4DIMA 2NO7A 5ALHA 3SM3A 5LQSA 4O5OA 3OQJA 3ILXA 3G1WA 4FZRA 3A3OA 3HHEA 1R88A 4IEEA 2QU8A 1MORA 2P79A 1C3LA 5HA5A 4HH0A 4CMEA 4DV3B 1YDMA 2CXPA 1P2SA 1WL8A 4MPJA 2PX3A 1XUOA 3H11B 4CQMB 1SHJA 3BE4A 3P2IA 3VZPA 2EBHX 2BFOA 2WJ4A 3R7AA 3TSZA 3HDGA 4J0JA 1L1QA 2ODBA 2JLXA 1JG2A 1TVKB 1P19A 1KNXA 2M32A 3IBGA 4KL8S 3I12A 4PZPA 5HJEA 1E61A 4PHHA 3U39A 4Q1AA 3E9DA 2J9XB 4CT4B 2BJVA 1CJVC 2FPSA 3DO6A 3KQPA 7MDHA 2BKXA 2C2HA 2JGRA 3U16A 1BX1A 1PUIA 4X93A 4LZAA 3T8YA 1TMGE 4EYEA 3COJA 2G72A 4ZQBA 2CJFA 4CETA 1A04A 4LWZA 3V32A 5LNK1 1B23P 4KBGA 4YMGA 1WD7A 3THXB 4MJLA 4XUCA 1JZSA 3OJ0A 3X1XA 5L4NA 1FU8A 1OI3A 3TLYA 3EG9A 2G1UA 3TOZA 2J0SA 4TYQA 4TMVA 3KEMA 2CLMB 2XCIA 1TZJA 4G1EB 2Q1XA 1MHPA 3EMVA 2WBLC 1NQXA 2GK7A 1EVKA 5MFZA 5JBQA 1V1MB 1YZ3A 5KIAA 2OEPA 5BVGA 3CX3A 4BE9A 3MBIA 2BMWA 1G9SA 1XAGA 5SYMA 5COBA 2KBEA 3JD1A 2V1XA 3ON5A 4B3CA 4QNRA 2E82A 3T0GA 2XITA 1RM0A 1YZFA 5KINB 2QTHA 2GNPA 1KZ6A 2R4TA 4Y6OA 3DGFC 3V4PB 3WIBA 2GXQA 5FOSA 1ZJ6A 3DZIA 1PJ8A 2FQ1A 5AJZA 2B5VA 3OQ6A 1M7BA 2FQWA 3O9MA 4YRPA 5C5EA 4EG5A 1DTWB 2JI9A 1PFYA 3FYHA 3KLNA 4L5YA 2HDOA 2C1EA 2MSNA 3IURA 2FK7A 3LOPA 1YBHA 1M6EX 5EZYA 3WZ2A 3WYCA 4XM1A 1KMMA 3RQSA 3BULA 3DEHA 1TK9A 1JAZA 2JKZA 3BGSA 1MO5A 2BFCB 2PGDA 1SB8A 1K4KA 2PZ8A 4KGVA 1WOYA 4FE7A 3W1WA 4R71A 3C7DB 3QQPA 4II3A 2DPYA 1DXHA 1BGXT 3GQBA 3IAM1 4LC1A 3RTDA 2AJLI 3FJYA 4JYZA 1A72A 4MWSA 2ATCA 4ZCIA 1QRTA 1CR1A 3KBBA 3ZZUA 1D2NA 3IUPA 2R62A 3D6HA 1K6JA 5JT1A 1F0NA 3ASVA 4MGHA 1MENA 3QYPA 4US2R 4LXYA 1NYTA 2RGUA 3FCXA 4FDUA 4HAYA 4NULA 3V6LA 3E81A 5FR1A 4R9VA 4HDMB 3WP0A 2XLBA 1RC8A 1CZOA 2J6BA 3BEOA 1Y9AA 2H16A 3L79A 4JLUA 4QDZA 5HRUA 1OI2A 5B4VA 1VCMA 3K9BA 4UFPA 1XVUA 4D3ZA 2YTZA 2C29D 2WHRA 1BC5A 3P2JA 1SHLA 1ABEA 1T0HB 4FLMA 4LRXA 1CJCA 2F64A 5FB3A 3B9RA 1ZBQA 3ESRA 1YZQA 4FX5A 5F12A 4Q7LA 1IQPA 4EQ6A 3ENVA 4I81A 4D9IA 2PGJA 3DAPA 5DTRA 1L4EA 1Q3TA 2PWYA 5E6UA 5HJ2A 3N9IA 5IP5A 3ROKA 2EX1A 3A10A 2VSYA 1DC7A 2O50A 3ANSA 1GRCA 3ASUA 3IDAA 3P0JA 3QIVA 1EFVA 2MINA 3ZV3A 1FVFA 4C5AA 2DR2A 1YO6A 3L0OA 4TXJA 1EKXA 1MJ5A 4IWXA 1LK7A 1UBOS 4DSTA 4BO3A 4E6EA 1VRWA 3CVUA 1CD5A 4F6RA 2J32A 5AVTA 2JGEA 1A9PA 1IBKB 2VT6A 2CE2X 2QF7A 1M75A 2Q1SA 3WXMA 1I94B 4FEGA 4Y67A 3UM9A 4C0HA 1RYZA 1N6IA 3VPAA 2JFWA 4FYVA 3DQQA 4AUMA 3LCCA 5G4KB 1DEAA 1POWA 2F1JA 2FDRA 3V8NA 1GXSB 2X9GA 4PG8A 1UDXA 3KFXA 2R11A 3GJXC 4RFVA 1ISJA 4WEQA 3E9NA 4LYDA 5EQJB 2O2GA 2XF8A 2OLEA 2VG8A 4HXYA 1T29A 4ZYWA 3GGPA 4ZTZB 4NAVA 2P1RA 2JLAA 3E2MA 4DPKA 1JA0A 5B7NA 3V9PA 2AUMA 2PAFA 1ZYUA 5JFTA 1II9A 3WR5A 4A15A 3L8ZA 5JNUA 5DCYA 3THOA 3U44B 1ZPDA 5FBLB 3FOWA 3LFTA 4AB1A 1X1TA 1Q7BA 3EDMA 2Q9AA 3FZYA 1TRHA 2R5WA 1U90A 3FLMA 4LSWA 5FPHA 1LLCA 4KB5A 4L5BA 1ZXBA 3L6BA 4LSZA 2YWXA 3FVTA 4PQRA 3P9QA 3DAFA 1BVUA 5DISB 3I1YA 3PDHA 3U7GA 4GDMA 1QG4A 1HRKA 1JEQB 1LSOA 3GRKA 4YMHA 2XMSA 5E1OA 2IXAA 1JPUA 1NDQA 1EGVB 3ZOKA 3KYDA 1DV2A 1VB5A 1RAEA 2M1XA 1E9BA 2Z43A 3GA5A 3RU7A 4BRWA 5TMEA 2PRYA 1CY7A 2VP4A 1XTBA 4UU7A 1D9ZA 4G36A 1BMFA 4ZHSA 4CLOA 1DBVO 1VGVA 1YHNA 2AFIB 5AW6A 3VKGA 2JGNA 5JTUA 3JY6A 4PZYA 4A6EA 2W8BA 2BFDA 2IPAB 1Z5UA 2YCLA 4Z4HA 4J0GA 5F2NA 3ZWBA 4LMRA 3D7MA 1SQ5A 1QE0A 3VUFA 3KDSE 2Y1KA 4IUYA 2FLVA 1XF1A 1QK4A 3FZQA 4CM9A 4DLRA 2P5YA 1HC7A 3HI4A 4P2BA 2VDLB 1ESDA 3AVPA 3S2SA 2O59A 4C0KA 3ICWA 1RBQA 1ZU5A 3IAS1 3TLGB 2NU6B 3STUA 4DLPA 5DHRA 3UC5A 4E3WA 4EJSB 4JJFA 3MTAA 2G5CA 2VPWA 1NMYA 4TV8F 1S3GA 4OJKA 3GJ7A 1K7YA 1M0TA 1NULA 4L4UA 4TV8B 1PNQA 5EFZA 3RKRA 2MR5A 1IVSA 2JAPA 5KHOC 4OLAA 2WA2A 3PNYA 4HNQA 4J07A 4ZVVA 5ALJA 1NF9A 4D9MA 1WXGA 3RR2A 3WLAA 1HL3A 2Q99A 3ZE0B 3OKFA 1UMDB 4OU5A 2FRVA 2CNBA 4G8DA 2AR7A 4LTNA 2IEZA 7MHTA 4HGQA 4M0CA 2WDZA 1QHSA 4NNPA 2I8AA 1GUYA 3HYRA 5HWSA 2XLCA 3VMMA 2W11A 2QRVA 2NTJA 4HQ0A 2ZYIA 4HZGA 3MJHA 1EBFA 4FOTA 1BE8A 4F6LA 3I58A 3OC0A 3RJMA 3MGAA 2CDBA 4RMGA 1SKYE 1SXJA 4NBSA 3Q7QA 3TSYA 2NUAA 3O8NA 1DX6A 1GG5A 2PT9A 3CR7A 3CU5A 4UZSA 4AQDA 2OXIA 2QMUA 2AOUA 4RS3A 4ER0A 3O38A 5KYYB 4RVDA 3CUYA 3M4XA 5IMSA 1L7PA 5I7FA 3NANA 1IK4A 1BOOA 1SWVA 1L5WA 3R3SA 3I5XA 3T3HA 1L5YA 3NQ41 4E08A 4BJHB 4DHEA 2NVOA 4DRXA 4MW4A 4MQ6A 1HE3A 5FORA 9ABPA 2AEMA 4ZAWA 1E89A 2CF5A 4E4YA 3D3WA 2OT3B 2P2LA 2VA8A 3N8NA 1LSJA 5AVQA 1TO1E 2W6QA 4YMSA 1EINA 3IQGX 4HTFB 2QX4A 1P60A 4OQFA 2VZ8A 2W42A 4RW0A 4YI5A 1JDBC 2ZBGA 4YDHB 1SK8A 2OSBA 1IBSA 3OCYA 3EGDA 5JDCA 2NU9A 4KXFB 1T1GA 2ECQA 4NFHA 1Z8HA 1QQ7A 4JEMA 3USZA 3M4ZA 4PZEA 1OA0A 3O73A 5GINE 3BRWD 2DUNA 1DU4A 1ZN2A 2ESRA 3VTZA 5DNEA 1KYVA 4KWTA 4ZODA 1TCAA 3S2FA 1BE6A 1O8BA 4OHUA 3WIOA 5LZ5A 3CF0A 2VUHB 1YKSA 4OK6A 5K8UA 3AHDA 3NWEA 4OIMA 1V7QA 3M6MD 4M1MA 4IMRA 4C05A 3U60B 5EQFA 4F3KA 4QARA 4DQXA 2RK3A 1UZMA 4OKNA 4J0CA 5BSHA 3IUBA 3FBWA 2M1ZA 2ZS8A 4H7IA 2OXTA 1M8JA 4C0AC 3V5NA 3PC3A 4CVNA 3OAAA 1SOVA 2WWXA 3OF3A 4JJKA 2RGRA 1T8TA 5HQTA 1PWEA 4FE4A 3RVKA 1I6MA 3OLXA 3HCOA 1RM3A 2XCLA 2ONZA 1RPJA 1XRSB 2V7UA 2VDNB 3CLKA 4JU9A 1XWFA 4EYGA 3U7FB 2QN6A 2M6KA 3RREA 4ZO7A 2YH2A 4HBGA 1NVDA 1U4NA 3ZWMA 2WZCA 1I1QB 1XZQA 5CT5A 1I0ZA 4FFSA 3H6GA 4HH1A 3FZNA 5IAOA 3WLRA 1TGVA 1DBWA 3IVGA 3MIIA 3D7RA 3JD3A 3RW9A 1WULS 1HXHA 3ZGYA 4D4HA 3BAFA 1T35A 3DOUA 4F5WA 4R05A 2E4AA 3ESXA 1ZUD1 2PXCA 3KTAA 4PLFA 3U7EB 1M54A 4LBVA 6ADHA 3R3UA 1B93A 3W3AA 1A8UA 4K26A 1BEEA 1NE2A 3HCNA 4FN5A 3TN7A 1IN1A 3V34A 1J2JA 1ZL2A 3DCNA 4URYR 4YVFA 1B15A 1VBFA 2GI4A 3EXHB 1QHYA 2F3PA 2J3QA 1M8PA 1AF7A 3GFGA 4PXSA 1MZVA 4P3NA 5B6JA 1TTPB 3TR5A 3ZQ4A 1SKBA 1F4LA 1TAQA 2FZ4A 2C9BA 3D59A 2RONA 1O0SA 1IOVA 2P6PA 2ZIFA 3L92A 4LUCA 2NX2A 2XB6A 1C8VB 1N5IA 2NZUG 1UDBA 1U4SA 1B3BA 1E96A 3K96A 2JGDA 3QLJA 4FGSA 5INTA 4WLUA 3NYIA 1E5QA 3PVSA 5CX4A 3CZ4A 5D2CA 5FWXA 3FNGA 1RKXA 4YECA 4C9BA 1QIDA 1KZ7B 2O3QA 1L7RA 1QYDA 4KTTE 1E1QA 3T7KA 1I10A 5HM8A 2VZ9A 3FFBA 3WGJA 1UKYA 5COQA 4ZCQA 1JHZA 1M67A 1VKOA 4QOIA 4BJ5A 4XH9B 3QJYA 1R4ZA 2PZFA 3A14A 2HR1A 4GX2A 2O1XA 3EZ9A 3TOCA 4YCJA 4L9SA 2RGEA 4XQGA 2YIVX 1U8FO 3D6VA 4M1QA 4Y9SA 1QP0A 1RBYA 1IL0A 1VGRA 3FMPB 4QYTA 4QXOA 1NE7A 4B3TB 4BL5A 2B61A 1IHYA 1LX7A 2ZTHA 3CYFA 5AUQA 5G1OA 3JQDA 2B4KA 1O5IA 4XLZA 1R27A 1D5WA 1SBYA 3GEHA 2A58A 4J90A 4TRMA 4U7GA 4OQXA 1WPGA 3STTA 1FYWA 1YQDA 3LQKA 4DJDC 2LBPA 3X1YA 5KDDA 1BDIA 3RT7A 3OSUA 3C8MA 3L7YA 4O33A 3MGGA 4GZ6A 4CKBB 1NW4A 5HEKA 4GF5A 4AXXA 1ECBA 4ZCPA 3GFRA 1KDTA 1I30A 4HLCA 4YRSA 3PIRA 5FLXA 1Q7TA 2OBBA 3HGQA 1D1PA 1ABFA 3RC2A 5BPFA 5ESRA 3C39A 3C5HA 4P5DA 1EM6A 1H2WA 2CHQA 4G1VA 2JCBA 1XKTA 2QRUA 5FTNA 5JVDF 4MUHA 1G63A 2YV2A 5AW9A 4EO4A 4QLAA 2CT8A 2H00A 3AOGA 5JVDB 1VJCA 4CV1A 4TS9A 2FUG1 1BS1A 4YUVA 4FFMA 2EFEB 4LGCA 2ZBVA 4KW7A 2ZIXA 4E94A 5TX7A 4HDKA 2OWDA 4ZTBA 4CMIB 2OK8A 5JS8A 2NTYC 4HN9A 1TM4E 2Z5GA 3N53A 2Y66A 5E7QA 2BEKA 2QQ5A 4M1OA 3SBOA 1XZAA 3GQVA 2ZIEA 4J29A 1AKNA 1N57A 3RAPR 2VPQA 3IJ5A 3QSGA 3O9VA 4F4IA 2NUTB 4O4JB 4KXVA 3V2UA 1XNJA 4ETMA 2GCIA 4DOMA 3LQRA 4RXMA 1I3MA 1MIHA 1R8SA 3INNA 4ZKDA 4Y1EA 4TYNA 1L4BA 3TM5A 1MGPA 1BIFA 2BDEA 2HJRA 1O97C 4YWHA 2NWQA 2EX4A 2IS6A 3GUYA 1E2NA 2C98A 3AFOA 2GYYA 1EA7A 1OAAA 1SCIA 1Y7IA 1QWSA 2XUPA 3E70C 3FVQA 3HDTA 4RFSB 5KI6A 1VLMA 3V2GA 5I7AA 1PBTA 3ZLVA 5JPCA 2JGIA 2PQ2A 1ODTC 3CH7A 1ZI9A 3GZNB 3L04A 4HZUB 4NCKA 1FNBA 3DH0A 5LC1A 2FF7A 3A9TA 3PDCA 3JALA 4QA9A 3T9CA 2OR3A 4E2ZA 4GR5A 1KMHB 2P9HA 1TECE 1VL0A 1FFHA 1H3NA 1KI8A 1RYFA 2EKZA 3GNQA 3LXMA 4G9GA 4RADA 1XXHE 4MLZA 5G02A 2Z9BA 4CTNA 4EABA 4QU9A 5E95A 5KREA 2JJMA 5BNIA 3MINB 3NIGB 1EQ2A 4GLFA 1FFCA 1HTTA 1T8UA 5DM2A 2C96A 4CQJA 3DB2A 2UUAB 2AFHB 2BELA 4Q4AA 4RELA 2OBFA 5JRDS 1XYGA 1RVDA 1ZRNA 4AJOA 4I7EA 1IAVA 3AKZA 3KKQA 2I1QA 4UU8A 5HK8A 3SXPA 5EEHA 4Z5XA 2ZIAA 4I1UA 4JIGA 1L5MA 3OICA 2HJ9A 2R8YA 2PYIA 2XOEA 5F76A 4L78A 4MCHA 3LY7A 1JI0A 4XZ3A 3U3KA 3VFDA 5B55A 1THGA 2ZR8A 3PTZA 3LLCA 1FA9A 3GP3A 2XT0A 1VXRA 1VRVA 4UPEA 2WB4A 2P91A 3UAWA 5ILQA 4XM0A 1CRQA 5C81A 2C5LA 4D46A 5F77A 3IE2A 3OT1A 5ALYA 4C6TB 4MW6A 3Q9LA 4ZOLB 3W5IA 3EARA 4HN2A 2B94A 3OLWA 2HBZA 1IEQA 1X8LA 3G5TA 3ZR4B 3EIXA 2DFVA 2F7SA 2GCOA 5H3HA 1SVMA 5B1SA 1EB8A 2VHJA 2P2NA 3A9CA 2DKFA 1Z6ZA 2Y8EA 3FPBA 3JQBC 3L40A 3ANTA 4FGLA 2A5FA 2D8MA 2CFOA 5DWQA 4BO1A 1EFLA 1YB5A 4H3KB 5TGTA 4FBLA 3L06A 1Z45A 2VHUA 4KVGA 4KWHA 1NBMA 4AN0A 4F8JA 5C46F 4QRDA 1OR8A 1LW7A 1XNGA 3I09A 4PG5A 4FMCF 1B8VA 3EOBI 1D7AA 2FMIA 1Z2CA 2R2AA 3BMNB 5AVZA 1KF0A 5DNUA 1WW8A 1H4TA 3KNZA 5LL6P 4AKSA 5LB4A 2SKEA 3ABQB 3T41A 1P4GA 1UXIA 1CJSA 3A2LA 4OHYA 2EF0A 4HYTA 4BQRA 2OGSA 3A0RB 1XNQB 4QBFA 1NBIA 1YFLA 1GT91 1BG6A 4HEJA 2QYHA 1S3SA 1P8JA 1WKCA 3MERA 2Q6LA 3GIDA 1H8HA 1JVNA 1AK1A 2K5UA 2HADA 2Q1YA 4IOLA 4KIWA 5FX2A 1BVHA 3P20A 3PQEA 2QTRA 3WOVA 3IOYA 4B31A 4CIYA 2IZZA 4ISCA 4M55A 5HKKA 3TQHA 1L8XA 1NPYA 2BR4A 2IVZA 2VDPB 3HA2A 4YJ3B 3F49S 3H0EA 5HQJA 1BYUA 1OX5A 4PYLA 3AVWA 4JJ7A 2DUJA 2YDYA 4LWPA 4RXUA 4RH3A 3NCTA 1L3BA 5CURA 2NV0A 3BMOA 5A3SA 1OWMA 3VR5H 4CV2A 2ADMA 1NV9A 2IPXA 4J1TA 4I9FA 5ADHA 3ZVKA 1RXIA 2BISA 3AUJB 5BY2A 3OTQA 4G0NA 1N5RA 2WG2A 4HMPA 4Q4HB 4W5NA 1Q83A 4HPXB 4XQ9A 3HU3A 3WWCA 1DMRA 4JJEA 2O7QA 2ADOA 2FMHA 1TZ2A 3IBYA 3HHPA 2FXIA 3KPJA 3MMSA 3PJFA 4Q4JB 5JNWA 1ID8A 1TQ2A 2Z9CA 1J5PA 4ILEA 2NQTA 2OHGA 4P33A 1N0WA 4X7RA 3HCDA 3PQCA 1UDWA 1D4ZA 4ZYTA 5BSMA 1EH5A 2VF7A 1OF1A 1VIYA 2HA7A 5HFAA 2IS4A 1JBQA 4D8XA 5EI5A 2PMBA