4TLGA

Crystal structure of sec14-like protein 4 (sec14l4)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
396
Chain Sequence
b'SRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEC14-like protein 4
publication title Crystal structure of SEC14-like protein 4 (SEC14L4)
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 138
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 4tlgA02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 4tlgA01
3Q8GA 3P7ZA 3HY5A 1OLMA 4UYBA 3B74A 1OLME 2D4QA 1OIPA 5LZ6A 3HX3A 3PEGA 4M8ZA 3W67A 1O6UA 1AUAA 1OIZA 3B7ZA 3PG7A 4J7PA 4OMJA 1R5LA 4FMMA 4CIZA 4OMKA 2E2XA 3W68A 3B7QA 3B7NA 4CJ6A 4TLGA 4J7QA
chains in the Genus database with same CATH superfamily
2JECA 4B7EA 5JVVA 2P4EA 2QQNA 3D0SA 5FYSA 1MS8A 5JI9A 1RUH2 1AYN1 3B9IA 3OEBA 5FMOL 3W5MA 4DRVA 2KR2A 2VZ3A 1OT5A 1TME1 5FZAA 3NV4A 4OUMA 3OYWB 4K6BA 2FD8A 2ORZA 5I8TA 2B39A 1VAKA 4FPEA 2V5YA 2J1SA 5C3SA 5I0DA 4CUAA 4P5YA 4QX2A 5I91A 3MFCA 3NNLA 2P2KA 3T2PA 3I2OA 1X50A 1CZSA 4YZ4A 2JEMA 3IIIA 3SQOA 1NG0A 1V6OA 1VPHA 4OQ9A 2EXIA 1R083 3PDQA 1XU1A 4EWAA 1GP5A 1GOFA 3O1PA 5C3RA 1K5JA 4QPGA 2I74A 4IV3B 4EWEA 3OBAA 4XABA 2XUEA 4CCJA 1QH7A 1YXWA 2YC4A 1OLME 1S2BA 3ACHA 5EYXA 1LNSA 2RMU3 1XJAA 2FCTA 3L2HA 2PA7A 4LITA 1IOAA 4CP2A 3D8CA 2WFF2 3ME2A 4DUWA 2WNUB 3BB6A 1ACCA 5F3EA 2VTXA 4I09A 1W6OB 4MX3A 2UY8A 2ZGKA 1XC6A 3BODA 2XJSA 3ZMNA 5LW9A 1FOD1 4LA2A 4OHWA 4OQ8A 2BPA2 1G9FA 5FZCA 2R062 5JCTA 2QQPA 5FK7A 1NY71 2JDAA 5F2WA 5C5TA 1F4AA 1NCQA 3BTZA 4E2GA 2G9FA 4PQ9A 5FP4A 4LHKA 4Y22A 1PO21 2ZKLA 4EWDA 1Q8VA 1ND3B 3FLPA 3BU7A 5ANNA 1TVGA 1HXS3 4K1ZA 3TN92 4AEDC 1D2SA 1TQ5A 5F5CA 2ZAAA 3AMHA 3NWKA 5E6HA 3VZLA 4CP9B 4XC9A 2VVFA 4FXKB 1GBGA 1AR62 4J6GA 1DZRA 2RDRA 4BWOA 4M8ZA 3W67A 3JU9A 4LTAA 2D5FA 3ZFGC 2X5IA 3KHCA 1D4VB 1W0OA 1DCSA 2VL4A 1OA4A 2N7GA 3VD3A 2D98A 2Q5TA 4M3CB 3GHNA 5HCAA 1NYWA 2QTWB 3I2FA 1RUNA 1AX1A 1REFA 3AZVA 4DXSA 3H3ZA 1VB2A 2D43A 3MIGA 1QY4A 2VW2A 4TLFA 2ZX1A 5LBCA 1NXD1 1LOAA 3ZXJA 1LHOA 4R4ZA 2K9ZA 5CFCC 3QH7A 1DGLA 2Y6FA 4HONA 5L73A 1SLBA 3C7OA 1H0BA 3POGA 4P9XA 4Q4Y1 5LA0A 1TEIA 4QD2A 1CJDA 2VM9A 5CFDB 1JHJA 2P1BA 3O14A 4Q0SA 1VBC3 2YU1A 3OYWA 5F1RA 1ZBA2 3I2DA 3OBZA 2VZVA 1M06G 2WJSA 4GXLA 3N7JA 5A3LA 1BXHA 1IQAA 3AFGA 3S5QA 2QQUA 2YZ4A 1GP6A 3HIFA 1YFWA 5DZFA 3PUSA 2E26A 4AGVA 4CCKA 4E8CA 5A33B 3PTRB 5C70A 3WHTA 1ULCA 2ERFA 4Z07A 1ZBE3 1NLRA 4LBJA 4TLGA 4UFIA 5FYTA 4FBFA 5JSPA 1BBT3 4YGDA 1UKRA 3WINE 3VDCA 2EAKA 1MS0A 4NMIA 4Q5OA 3I2GA 3RZKA 1XSQA 3UL2A 3POBA 3RZJA 1A6CA 3FLRA 4ISRA 4Q0PA 4EQVA 3V0AB 1UX7A 1F8VA 2QJVA 5B2GB 3ON7A 2R041 4XCBA 1OHFA 1BK0A 3VD7A 2WNUA 1OBNA 5LASA 4DUVA 4NRMA 1W6OA 4ARXA 4YW7A 3O1RA 1H2LA 1V70A 2AZ5A 4A42A 5D1IA 5FYIA 1OSGA 4Y1XA 2CTVA 1M4WA 4XACA 5JAXA 4H7LA 2OX0A 2HWF3 1KGYA 1LOBA 3PLQA 4RN5A 5DQ0A 5EYYA 3WP6A 3NNGA 2ZBJA 3D82A 1C8NA 1WMFA 1I3HA 2H0VA 1IG0A 2D3PA 3S0MA 3RZMA 1RUJ2 1REDA 2NQYA 3WCRA 1WBFA 3LEGA 2VECA 5JWPA 1LECA 1H4HA 1ND3A 2XHKA 3JBG2 3SH3A 3WNMA 4A6SA 1UW8A 4YVWC 1ASJ2 3ZYIB 4A45A 1S2EA 3ZSMA 1W8FA 2AENA 4CP9A 3PURA 1W39A 3H50A 4LEJA 2RS52 2GC2A 3ZMOA 1VBA3 3RYRA 4CCLA 4YZ5A 1GNHA 1HRI1 4JKKA 2FMDA 5LBBA 2WWSA 4AEDB 1E5RA 3EMRA 1MACA 5CEHA 4MH0E 3CIHA 1V6LA 2VCBA 4M3CA 4YNIA 2A7AA 4BYYA 3ZFGB 3ZPYA 1U12A 4COYA 2DVFA 2PLV1 2VY0A 3WW4A 4Y1UA 3HT2A 1I9RA 3ZFFC 2DCTA 1EY2A 2GC0A 2WO3A 1NKGA 3PMEA 4OLLA 4LOTA 3ZN5A 5KXCA 4MADA 2GMEA 1X9PA 1LODA 2P3KA 1CAUB 3M4FA 3A21A 3AZYA 5FLHA 5FKBA 3D0JA 1JYXA 2ZABA 5JMCA 3JD73 4NUBA 1DZTA 1G86A 4LUKA 3ZYGA 4DUXA 1G9AA 5CFDA 5CFCB 2XPJA 2YBPA 3K51A 4ET7A 4BE3A 1N1TA 3B7MA 5FXXA 5AC91 1SLAA 3LB9A 1D4M1 4N53C 4AGGA 1JW6A 2A1XA 5A3PA 3CJIC 4R9BA 5DN2A 3C7FA 2W08A 3LWCA 4QGNA 5FZDA 2EF6A 1OQ1A 3MPPG 3KWVA 1PHMA 2WDBA 3BIWE 3DECA 3PU3A 1NE6A 1SPPA 2ZHMA 3VBFC 4ZHNA 1HKDA 3KCCA 4YG3A 5J7MA 2XL9A 4XXPA 3KT7A 3MUZ1 3AZWA 1AR71 1S0EA 2Q4SA 2VOTA 4E8DA 3PUAA 1UXXX 3T09A 1JZ6A 3RWKX 1AX0A 1IS5A 3HNBM 4U2AA 4IGQA 3UV9A 1V9U2 2VE1A 4CXWA 4NIGA 1K42A 1KDKA 1OLMA 1AYM2 2GN7A 3GZUC 1G7YA 1YJLA 5JR7B 3WNXA 3V0AA 3KCYA 3T1LA 1X8EA 1COV1 4A7ZA 2MEV1 4WZCA 1GOHA 2VMHA 5CVRA 1IG3A 2VQ0A 4QX3A 3WVJA 3BCWA 1DYPA 1PVXA 5A7NA 4JRLA 5LY2A 2AR6A 1EUUA 1H1MA 3VBOC 5FAXA 2ZEYA 4Q4W2 3IT8A 2JKXA 5ACA2 4IGOA 4Y1VA 3B7NA 5HV0A 5E8AA 4CCDA 1RB8G 1MZ6A 2A3XA 1UL9A 3NJZA 5DUWA 3HN3A 1DGRN 1LKNA 3MFAA 5FZOB 3VZJA 3S5AA 2GH2A 2R072 3HQUA 5DAWA 1DQ4A 5FYBA 1UMHA 2D6MA 2X53S 2GSYA 4AHWA 1WCQA 1J1TA 2W0XA 1UPSA 4FQ4A 3NV2A 5FZ7A 4AI9A 5KC5A 1IHMA 1EAH3 1YO8A 2IC1A 2R7EB 4PCRA 4YVWB 1BEV1 4AEDA 1RUG3 1RVF2 4CUCA 4OCTA 5FP9A 5I93A 1JOJA 4CDWC 1O3SA 1V6IA 2FCVA 2ET7A 1UCXA 2YFUA 1LAJA 1GV9A 3AYEA 1O5LA 1UY2A 4LK7A 4LR4A 5DAQA 3P5BA 4IEOA 4IW3A 4AF9A 3DL3A 4YPJA 4K8RB 3CNAA 1QJEA 4Y1YA 5APAA 2CWSA 3MIEA 5EWSA 3LE0A 1GZCA 1N1SA 4Q4V3 1E57A 4GD4A 2E7TA 1PM4A 3OOXA 3J8F2 4FVVA 4JGYC 3EQEA 1OH4A 2QKDA 4D8MA 1GOGA 1QJU2 3FC0A 4HK9A 5HXMA 2WS91 4NO4A 1J1LA 2GAUA 5IFTA 1DQ2A 4N53B 5BPXA 4NIIA 3UETA 2EXJA 1JZ3A 1YFUA 3CJIB 3MLLA 3OF1A 5J96B 4CJ6A 5FZMA 4XF0A 2WZR1 2Q0AA 3MIBA 3VBFB 5HI0A 2AH2A 1W8OA 2FZ1A 2VJXA 3HY5A 5DG1A 2DVAA 1MS1A 1NE4A 1Q8SA 1VRBA 4MYEA 3LD8A 1JYNA 1OMIA 3M3EA 4E4SA 2LW8A 3N7KA 1HN1A 4NHLA 2O8OA 4Y1ZA 5DUVA 4CDQB 4XQ4A 4DXTA 4ZZ5A 2PAMA 1UN1A 2YGLA 5CBLA 2WBKA 3RWNA 3GDBA 3DKQA 5I8YA 4BXFA 5L9VA 2MHFA 3K4DA 4RQPC 5A32B 1UZYA 4RS5C 2JENA 4PBPA 4K7JA 5A3WA 4B4PA 1PZ9A 4IEXA 1S1AA 4PIYA 4PDWC 1RUE3 3VBOB 4UFKA 5IVVA 3Q8GA 3E5XA 3U4SA 3WNPA 1SLCA 3LCPA 5FZOA 2B7YA 4QX1A 3I7DA 1VBB1 2W1UA 2WNVB 4HKLA 4A6OA 5C9AC 4A41A 2AEZA 2C24A 3K2OA 5A7PA 1PNGA 2YMZA 3RYPA 4BLIA 3KS7A 1UKGA 5I8SA 2XXZA 3SC7X 4NRQA 4E9KA 1X7NA 4N43B 2ZGPA 4YVWA 4CXYA 2XKOA 2LS6A 1J3RA 5BNOC 5IVCA 5FTTC 4IERA 5LEJA 3MIDA 2E9QA 3USUB 1DHKB 2WZEA 1D2QA 4WVVA 4XIOA 4GAZA 2W47A 4AVCA 3EHKA 3N7MA 3APBA 1R1A3 2OQ7A 2VVDA 1FX5A 3LEKA 4A44A 4ATEA 4L97A 4YRDA 4BIOA 1DFQA 2Q1ZB 5K8SA 4DXZA 3KHBA 3OGJA 4HKOA 1MEC2 2WO1A 4XPVA 3WDTA 4DEQA 3NVCA 2Y6HA 4HL0A 4JCKA 4MXWA 4C1XA 3H8RA 2BU9A 3ETPA 2DCYA 4YVSC 5HBAA 5CG9A 4HVQA 4QKFA 3ORJA 5BY5A 2IXIA 2XVLA 5DAVA 2P5BA 4BMEA 5F3IA 1L7QA 1QOTA 4O7XA 1CVNA 4DS0A 2HLEA 4XTMA 2DUOA 2R49A 4YZ2A 3HPNA 2GNDA 2GMMA 2W2IA 1VMJA 1BMV1 2PHWA 4RL7A 4K8FA 2BWCA 4XJ8A 1W2OA 1JYVA 3L2YA 1PMHX 2JJ6A 1UF2C 5FYMA 1W99A 1YCIA 2XGXA 2YV8A 3LGRA 4JGYB 4N53A 2HWB1 2HWC1 3CJIA 2HKXA 2LM3A 4IV1C 4HANA 4PIXA 4YG6A 3AYAA 5EP9A 3V65A 5I0SA 2Y6KA 4XF3A 1HRI3 1UNBA 4A3XA 2CDPA 3VBFA 3ACIA 4EJRA 4GB31 1SEFA 3W5NA 2YBSA 3H1YA 3HX3A 3HOBA 3ZLIA 1NLQA 5FJKA 4B1LA 1DYKA 3TYJA 2DCZA 2ZCWA 4HETA 2ZMKA 3AK0A 3AVRA 3C3VA 3J7NA 1Z7S3 2Y60A 3B5LB 5FLJA 4CDQA 3AP9A 5JSRA 2VH9A 2XQRA 5LBFA 3POWA 3VHRA 4B4QA 3S7IA 3T3YA 4RFT0 1N3QA 5A32A 2GDFA 1QXPA 4S2FA 5T5OA 1DIWA 4Y5Z0 3M3IA 1RUI3 3TNPB 3HD8B 5A3NA 3VBOA 4AHZA 1YFYA 3WW1A 2W46A 2WR9A 3TRSB 3BKZA 2WNVA 4RQPB 4RS5B 4P02B 4OZXA 4XQDA 3WG1A 1W05A 2MNGA 3M2MA 4XUNA 3LIGA 1GANA 1W8NA 4PDWB 1POQA 3PEGA 1AR73 1UY3A 1WW5A 5JI7A 3WDXA 3LEIA 4NHYA 4HBNA 4R9CA 3I3MA 4BQ3A 1R081 4N43A 3USSA 4HMZA 4MGSA 5C9AB 3QLQA 3MZHA 4AEKA 1RUC3 2VMCA 3USUA 4QHZA 2LALA 3DKWA 1IS4A 1JYTA 1QKQA 4L92A 2RMU1 3R0RA 1COV3 3WZ1A 5BNOB 1ENXA 1S0IA 1CPMA 1KDMA 2GMPA 3B94A 5HCFA 3IAPA 1PIV2 1S2KA 2GN3A 5F37A 1WLTA 4AI2A 1GKBA 4NHXA 4P00B 5IK5A 3ZN4A 3NJYA 1DG6A 4XJWA 1O6UA 2OT7A 4LE3A 3TEZA 2WYFA 3BI3A 2VCAA 4CDXC 2W3JA 3RNSA 3T0AA 1VMFA 4FAHA 3FLTA 3ZVXA 1GZTA 4MGTA 4GWJA 4OULA 4YVSB 3SHRA 1RHI3 4JKMA 1RUF3 2W1SA 5B4XA 1UX6A 3UGHA 3A7QA 3WT3A 4YARA 1S0DA 2PHTA 4KNCA 4QPGC 4W8JA 3UKNA 3WF2A 5A3UA 1PGSA 1BQPA 4JGYA 4M01A 3D3AA 3POEA 2DCKA 5DDJ2 3WNLA 3O1MA 1PGL1 2YFZA 4GALA 2OQ6A 4XJUA 5FPXA 4MGKE 1XOYA 5IT6A 5FZGA 3IDBB 3WD5A 1HV0A 1C8M3 4QU2A 5GLWA 1QEXA 5J09A 2XWBB 1LOGA 3A0NA 3B01A 3J7MA 4GULA 4IV1B 1WA4A 1IPKA 1MZFA 1Y9QA 1RC6A 4PQQA 4OMDA 1A78A 2Y8KA 2D5HA 2OZ6A 2FDFA 1U5ZA 3TOJA 2ZGRA 4HLTA 3ZXFA 2V4AA 1XNAA 1XYPA 3JQWA 4XQWA 5IK8A 1EV12 1VR3A 3RVHA 5JUVA 5IK7A 5HCHA 2UWCA 1WGPA 2GC3A 1VJ2A 2Z4FA 4FPYA 2VZRA 2CSGA 2RV9A 1HQNA 3H1WA 4Q4X3 3JCIA 2Z42A 4O9EA 1VBC1 2ZX2A 4TYSA 1AX2A 1F2NA 1H30A 1S0GA 3E5UA 2V72A 4FFFA 4FPCA 3AVSA 5JZGA 1XNCA 4RQPA 4AR2A 4RS5A 3LKJA 2JXAA 4M4PA 3MBWA 5H9QA 2ADDA 1PVC3 2DUPA 2RM23 2WYSA 2XLFA 4PDWA 4UW5A 2HBUA 4WVMB 2VZUA 3IDCB 3J4UH 1IS6A 3IZOA 1ZBE1 2DURA 2PN5A 2VUJA 4PI0A 4QGMA 1AYN2 5IVBA 1BBT1 2DTYA 5FMDA 4AXOA 5C9AA 4SBVA 1TME2 4Y3OA 4Q8KA 1EP0A 2OUHA 1ENSA 1Q8OA 3VZOA 3M8LA 3IKWA 1HRV3 2VBPA 1FPN3 3ZYJB 2JE7A 5BNOA 5L9BA 2JB8A 5A70A 1YI9A 5FJHA 5TSWA 1UXZA 1OUSA 3K77A 3NSTA 4XBLA 1XNKA 2HWF1 5F7UA 1NQJA 1OIZA 3OGGA 1J3PA 3BPSA 1W8UA 3VGIA 2JIJA 2UURA 5FZLA 2VPVA 2J1UA 2ZX3A 5FPLA 2FDKA 2HEYF 4YVSA 5EJ3A 5KHHA 4J7PA 2AREA 1NOVA 5EPAA 4CDXB 3IN9A 4H55A 3ZDVA 1N3PA 2XWJB 5FBZA 4AI0A 4IE7A 1FOD2 2Q1MA 2XBO3 1ZZCA 1TNFA 4IEQA 5K0UB 1VBA1 2WRAA 3L9JT 2YC0A 3I59B 4QPGB 4RGKA 4FTBA 2IVJA 4YW2A 5FXWA 2CGNA 3VHNA 4IV1A 5LZ6A 1H2KA 3MYXA 5FY4A 3VV1A 1PO22 4LUMA 1C28A 1QJZA 2YHJA 4BMBA 4PIZA 3AYCA 1R64A 2D3RA 5FO7B 3VD9A 1VBE3 1CN1A 4LE4A 2OVUA 4W6YA 4XZPA 4YM0A 1K5MC 3WQ1A 5IAXA 3JD71 5KR7A 3DPRB 5DXDA 3LFIA 3H3LA 4AVSA 4UFJA 5KHKA 2KM2A 2FDHA 2C5DA 4KGQA 5E89A 4ITCA 4P9WA 1Q8QA 3T2OA 3H7JA 4LO4B 4YGEA 3VBHC 3VBSB 1AL0G 2PFWA 2OPWA 5JR2A 5JPNB 4QB2A 2CDOA 3UKTA 3ZKYA 3OY8B 5KWRA 4K21A 4WVMA 1RUD3 1AUAA 5ANQA 3DN7A 4LHLA 2FMYA 3LSEA 5KC6A 1AR93 3AMMA 2C4XA 2J1AA 4MGZE 4Q4Y2 4LMFA 2HWE3 5FMOS 4AHXA 1PNFA 2HH9A 4LBLA 4C90A 3LDRA 5T3NA 2FDIA 2WQ8A 2VMDA 2WZPP 5BNQA 3B7QA 3NV1A 4MG2A 4I0BA 3ETQA 1JYCA 3OJBA 3RZZA 3KD4A 5A80A 1XBFA 1HB3A 4P08A 4YM3A 3M3CA 4R4XA 1R093 4W50A 1FXZA 2PHDA 1U0AA 3KV5A 3V64A 4MV2A 1H2MA 1OQDA 5FY1A 3CLPA 2DCJA 1NXMA 2Q8CA 4HKWA 4BPZA 5EFUA 4P9YA 1MZ5A 2XJVA 1DGWA 2A75A 2R042 5D8AC 2GNMA 1S4CA 3WQ0A 5E88A 1JUIA 4AEJA 3O5SA 1Q56A 4CDXA 5A6XA 2ZXQA 2YXSA 2D6NA 4FFGA 2D6KA 4GJZA 3RQ0A 3B3QE 1OPMA 2D44A 2ENRA 1IZ3A 2BFUL 3DEMA 1XNBA 1J3QA 2CNAA 2WAAA 1EAH1 1DF0A 2V5DA 4URTA 5K0UA 5J1XA 3I59A 4KWJA 1RUG1 1L7LA 5LB6A 1YC61 2D97A 3AB0A 3AKPA 3P6BA 2EIEA 2RJLA 1GUIA 4AOCA 1A8MA 3S57A 3B93A 1CPNA 4B8EA 2RJ2A 1K3IA 3HWJA 4FI9A 5T55A 3H42B 2V09A 4XURA 4EYUA 4MXVA 5JXIA 1QQP3 1XE0A 1UZWA 2QCSB 2ZHKA 3K46A 4CXXA 2GALA 3EXUA 2VW1A 3FBYA 4MHRA 2VAUA 4YFWA 5FP3A 4COVA 3QCWA 3MGUA 3D4KA 4Q4V1 1HRI2 3DPRA 3VKOA 5FYYA 1UY1A 1PZ7A 1PZ8A 3SH4A 4CCNA 3AMNA 4RYDA 1X33A 1PO13 2G1MA 2W94A 4O9GA 2NZ9A 1K5MB 3ZXKA 4BQXA 2D40A 1AVBA 3VBSA 2Q8OA 2PLV2 4META 4ZU7A 3NAPC 2EVXA 3OY8A 4E2SA 2VU9A 1D7PM 3UYJA 3H8OA 3OGVA 4MZUA 3VBHB 2WSUA 1QJY3 1OD5A 1TG7A 3PVOA 4P9GA 4DNYA 1DGRA 3C7HA 4JAAA 4Q26A 2B46X 3ALQA 4GH4C 5AC92 3IM0A 2C6SA 1D4M2 2ZGNA 1O7FA 1LOFC 3X29B 5JDBA 3ZN6B 1O3QA 4DO0A 1AHSA 1PGW1 5F8PA 5FPBA 1JODA 3CBNA 4TTGA 4JZRA 2VNOA 5IVFA 4FOVA 2QFEA 4WVZA 3WOGA 1NX9A 4N9HA 3ZO0B 3ZXDA 4FP2A 4RA0A 5LA2A 3PUQA 3PJQA 1MVEA 5AFBA 1C5HA 1XNDA 2JDZA 3MW2A 2Z5WA 3WP4A 5FMCA 3FHQA 3ZYPA 1WZXA 1YLLA 4IEYA 4KBBA 5KXBA 2WLPA 2ES3A 2VZSA 3KLSA 4NRPA 5FREA 4X8NA 4F7ZA 1RUE1 5E1RA 2TEPA 5J37A 4QB6A 3T2QA 2G9ZA 1SPPB 4ZU4A 2MEV2 3EJKA 4P14A 4LBNA 3HMYA 1JXNA 4AQSA 1RJ8A 5F3GA 4UF0B 3KF5A 5D8AB 3T08A 2AUYA 5FLIA 3P7ZA 2DU1A 2XKPA 4GZ9A 2VXRA 4BQWA 2VZTA 4DXRA 2X29A 3OCPA 4E27A 5FFOC 4LIVA 3GYDA 4UFMA 4HZFA 3AZZA 5IVYA 4IE5A 1R1A1 4JRAA 2Q8EA 3VD5A 2TUNA 2A3WA 3B7ZA 1YEWA 4OUSA 4FPFA 1MPXA 4HXCA 5IAVA 3THTA 2VUDA 1JOPA 4CUGA 2L9LA 1V6MA 2RS13 3K3OA 4EZHA 5GLUA 5I0UA 3PU8A 4NAMA 1QJFA 3ILFA 1BEV2 2R0HA 1V6KA 2RDSA 4JQTA 3IPVB 4NR1A 4UFHA 1TMF3 3EO6A 2FCUA 2P17A 1BJQA 4PLOA 4CU8A 5CZKA 4A4AA 1ULFA 1GSLA 1K5MA 2QQOA 2ATFA 4RHV2 1A34A 2ZGUA 4CUBA 2PHFA 1W04A 3N3HA 2JDUA 2J7MA 4YGBA 4A7YA 1PX3A 4A7KA 1Z78A 2VZOA 1VRH3 3R4DB 1LJ7A 3DF0A 4P5HA 3ZXGA 4MUVA 3FMGA 2UYAA 3ZM8A 1LHUA 3VBHA 4GWIA 1CX4A 4LORA 1ULDA 4FOQA 2BJSA 4CP0A 1LULA 2E7QA 3ZYBA 4B7KA 4QQLA 3WEZA 3NAPB 1AR83 4FPLA 1L7RA 1O8SA 3A0KA 2W68A 2WN3A 3GZEA 2O14A 2YROA 5JSOA 2VG9A 2X10A 2RJKA 1W6QB 4LA3A 2JG9C 2E6VA 4BA6A 1H9WA 2SLIA 4QGLA 3ZN6A 1UZZA 1QJX3 4LHNA 4X8PA 5F2SA 5JOXA 4LOSA 3PVNA 5FWEA 2WS92 2P37A 1Z7S1 5JXGA 4GH4B 1SG3A 4TZDA 3W21A 3RFRA 1CIWA 3WW3A 4OI4A 2BV4A 1MS5A 4CYDA 3A4UA 2R061 2WZR2 1HQLA 4BQ2A 1UZ0A 2HWD3 1JZ5A 2F4LA 1XQNA 2PHRA 2PHUA 4LKDA 1RUI1 2NLRA 5GALA 3GXUA 1HJGA 1QDOA 1UWWA 2ZHNA 4QKDA 2VMIA 2W87A 1UPIA 3JUUA 3WV6A 4AYUA 2QQMA 3RRDA 2OPKA 1IGOA 1H6YA 4HOOA 3W20A 4XIKA 1OOPC 3E6BA 4HVOA 1H6XA 3FX3A 5FZFA 1VBD3 1K12A 2NYYA 4UF0A 4XCAA 5D8AA 2BNNA 1QXRA 1FMD3 3LDBA 2PTMA 2RHPA 4XUOA 1AL23 5IJRA 4Q0QA 3G7DA 2OXBA 5T5JA 5C7GA 2MPFA 3P3NA 3WNNA 1HDKA 1RUC1 2PHLA 4NROA 4RGGA 4CDQC 1H1IA 2QQIA 4WM8C 5L19A 3FUQA 5CNAA 4H2AA 2PHXA 1O4TA 4K3UA 5FZ3A 2QE3A 4EV0A 4NAOA 1VBB2 1QF3A 1HIXA 2JE9A 5FP7A 3HEIA 5EIYB 4OUEA 2XLGA 1UY0A 3AL6A 5H9PA 1T6BX 3MUY1 5LRRA 4X6RB 1NLSA 1E5IA 5AFEA 2VZ1A 4HK8A 4ES8A 2WNVC 3VDAA 4FPGA 3SNMA 3IPVA 5C6CA 3ZIWA 3KGLA 4D69A 1US3A 3LF7A 4H14A 2VZQA 3SXWA 3NRUA 4BCUA 3THCA 3T0BA 4LJHA 2R1BA 3MEPA 3ZXEA 1ULGA 2A6XA 1RHI1 3MV01 1NA1C 1RUF1 4N43C 3THDA 3RZHA 1KRIA 2RR13 4LBOA 1QNYA 2PMWB 1J83A 3H9AA 1IQDC 4IUGA 2BGPA 3WG3A 4DY5A 1GR3A 4AQ6A 1I5PA 1GU3A 3ZX7A 1UOBA 2C0ZA 2WT1A 5H9SA 2WL1A 4OFGA 3VD4A 2XJTA 4XUQA 4KU7A 1H1AA 2UY9A 2CWMA 2YUEA 2BRTA 3GHMA 3M3OA 4LXLA 3NAPA 1C8M1 2PYTA 4GKYA 2WFPA 3MW3A 5L9RA 1W3VA 4LLOA 2CAUA 2HBTA 5FPAA 1W6QA 3IWZA 4S2GA 1HN0A 5JIAA 2FHRA 3VLBB 3WUDA 3ZKUA 3OGRA 2W91A 3BTYA 4FP3A 1BMV2 2P34A 3HT1A 4MHUA 5EHDA 4CA9A 1GP4A 1G6NA 2DWRA 2IVIB 4GH4A 5A1FA 1Q3EA 2GU9A 2F6BA 2JG9B 4AQ2A 2XONA 3FJSA 1LOFA 2HWB2 2HWC2 4MXWB 5JOYA 5FR3A 4LNVA 3W9AA 4RFRB 4ATFA 2ZGTA 4KG0A 1LR5A 5JOWA 1WW6A 1NT0A 1UO9A 4Q4X1 2W1WA 1EUTA 5C33A 2HYXA 2ET1A 5FPZA 5HPOA 5GZGA 3WR0A 4GB32 4FO9A 3WDWA 4IDZA 3U14A 2ZZQA 1WMEA 1KFXL 2ZGOA 4AWDA 2E2XA 1GWMA 1YI7A 3NQHA 2WZ8A 1PVC1 1W2NA 2RM21 2A6VA 3N9MA 2QQVA 4WZFA 3TEYA 2VNRA 4FQZA 2PAEA 1OFSA 3IBMA 4XDOA 2DFBA 2JDYA 3AC0A 4UW3A 3LPGA 4YW1A 5AVAA 5A1LA 3J26N 4WV8A 1VAVA 1OOPB 2WAOA 4XFAA 3RS6A 5C3QA 3U11A 2P3JA 2BP6A 4D6SA 4AL9A 3ILNA 4YW5A 1HRV1 1FPN1 1MQTC 4QXKA 1X82A 4IEWA 4A2UA 1CX1A 4D7YA 2HYKA 2JDPA 4WM8B 1HV1A 4B4RA 3SKJE 2ZJCA 2ZPXA 3KB5A 3H3UA 3QH6A 2YU2A 5FKCA 4HFSA 2ORXA 1R082 1LRHA 4AVBA 5JZGC 1XB9A 4EN9B 4QDRA 1UYPA 3GJBA 4QDSA 3AMQA 3AKTA 3T2TA 4CZSA 3VBRC 1O4ZA 2DF7A 1WWYA 1RMU3 2RMU2 1LHNA 4IGPA 1ZRIA 4NWVA 1LHWA 3C2UA 4Y5TA 3E1F1 2Y26A 3RI8A 3OD4A 2QUOA 5FMBA 3WP5A 4D0QA 4E4ZA 3NKTA 2XBO1 3VHOA 3I54A 4Y20B 1NA1B 5GLZA 4AI3A 4AFMA 1ZZ9A 1OKOA 4CTEA 1LCLA 1TZOA 2GP5A 3WQBA 1OPOA 5JIUA 4NHKA 4XZUG 2VCCA 3H0OA 1W28A 2FDGA 3DYMA 2RS33 1F5FA 1W90A 4C8DA 4F8AA 3SKVA 3A22A 1HXS2 4AK3A 4U36A 2VUCA 1WCKA 1N47A 2V73A 4PHZA 4DRRA 3ZFFB 1URXA 4FFHA 2JG9A 5LK5A 2OA2A 1PGL2 4W4ZA 1RUH3 4OHZA 2ARCA 2EIGA 3IDEA 1VBE1 4PT6A 5JMOA 1RXFA 5I0TA 3I3QA 3U78A 3FUOA 5CKNA 2EIBA 1DZQA 1S0BA 4JDOA 3B9CA 5A6QA 1EPWA 1JN2P 5A3OA 3LA2A 3ACFA 1W0PA 3MICA 1HW5A 3CDZB 1SBFA 1CR7A 1GICA 1RL3A 5M0TA 1G8WA 5CISA 3T1MA 3BU0A 1QNWA 1ENQA 1W8ZA 4UWDA 4XMAA 1UD1A 1RUD1 3TEWA 1JBCA 1N3OA 2VMFA 3NNFA 3Q8BA 4C0BA 1H8TC 1SBDA 1KEXA 4G3YC 1AR91 2WO2A 3UGGA 4JDNA 2NP0A 3I2IA 3GZAA 2HWE1 1XU2A 2Q1FA 4QWNA 4ZS2A 1MVQA 2JDMA 1DQ0A 1OOPA 3E5QA 5ISLA 4EROA 1FI2A 1WLDA 1VBC2 3OPWA 2ID4A 1ZYBA 1QOOA 2WFF3 4I01A 4TWTA 1UU4A 4QPYA 4JKLA 2BBAA 2WSVA 3IAQA 4WM8A 5F5AA 4D6RA 4NPMA 1R091 1MQTB 2R063 1ZBE2 5BNNA 3DUIA 2GNTA 4AVTA 5JPMB 1BBT2 1I5ZA 5FY9A 4Q0VA 4NPLA 4QU1A 4NWWA 2QQWA 3O0VA 1W6MB 1O59A 2VVEA 5JZGB 4ZKTB 3KV4A 1GNYA 5A7OA 5DAXA 3TN93 4GMP3 5GZCA 4F83A 3MI8A 1RINA 4EN6B 3KQRA 3VBRB 2WWUA 4XF9A 4FOYA 2XJUA 1AR63 1LOEA 2QQJA 3QOPA 3URFA 4YW6A 3I3EA 4Y20A 5A1AA 1AJOA 1NA1A 2F4PA 2PXJA 1GNZA 3VB9A 5J3UA 2ARBA 4N7UA 4Z2AA 1U5XA 5KXDA 4L99A 2HWF2 3WY6A 5FPVA 3KV9A 2A6WA 3AJYA 2WINB 1Z0HA 4MSVA 4XHXA 5K9YA 2DFCA 1S0FA 2BWAA 2WN2A 3POFA 1DLLA 3OBRA 3RJ2X 4X6QB 2EXKA 5CYYA 1QQP1 1SHWB 1XYOA 3J9SA 3I3BA 1HX6A 3BPZA 3ZFFA 5DG2A 3WF4A 1QHDA 4C1WA 3KQ4B 3A23A 3D6EA 3BYWA 1WW4A 1VBA2 1XE8A 3LAGA 5FO9B 4SLIA 5CAZA 3SH5A 1O3RA 2BW8A 4QM8A 1ZBA3 4AHYA 3O1SA 1PO11 3VN4A 3PMSA 4ASLA 5A3TA 2VBDA 1ULPA 1ND2B 1VALA 1GZWB 1QOSA 4Q8LA 4WBBA 3OSDA 4XFCA 5KHGA 1FNYA 3Q8CA 2NN8A 5GM0A 1SMVA 3H8UA 1S55A 2ZEWA 5F39A 4QDQA 4V2VA 5H9RA 3ASIA 1ZNPA 4L8QA 4DMIA 2JDHA 3VKNA 2NMOA 3T4HB 5I0RA 2BZDA 1QJY1 1XXNA 1AF9A 4YFZA 1OFNA 3DYPA 1XRUA 3JD72 4UYBA 3I97A 4BXSV 5KHJA 2W52A 2JWPA 3ACGA 4V2WA 1H8TB 2WIIB 3N9QA 3UJQA 2CYFA 1WBLA 5D21A 3ZR5A 4O65A 3DYOA 1VMHA 1YHFA 2JD4A 3D5OA 1W0NA 3KMHA 1U5YA 3OGSA 3DPRC 4HPKB 4QXCA 4XUTA 5EV7A 5T5PA 4ASKA 1VB4A 1V00A 2DUQA 1GYKA 3POIA 3OPZA 1SQ4A 2EXHA 4HSLA 5BUVA 1MQTA 1SACA 1B35C 2BTVC 2R16A 1V0AA 2RDNA 2BYVE 1DYOA 4I3PA 4QHBA 4OHXA 1SCSA 5DUUA 3RG0A 3TNQA 3VBSC 4C91A 1UU5A 5FZ4A 3N36A 4ISQA 1CESA 2YPJA 4BQ5A 1RUJ3 3WQ7A 2B8MA 4D94A 4JHTA 4XETA 2WQZC 4XBQA 1W6MA 3JBG3 3W59A 2WT2A 4JX0A 4KG8A 3LPFA 1ASJ3 2OYZA 2HEWF 4KL1A 3NL1A 4BLJA 1RJ7A 3VBRA 1OVPA 4IQPA 3UK9A 3J7HA 1CJPA 1DP0A 3POJA 3ZSKA 1J59A 2BNMA 2RS53 5F6KA 3F2ZA 2WWJA 1OQEA 3OEAA 4YG0A 2BERA 2JKBA 3NNMA 1YYNA 3H1MA 4PBOA 4AFCA 1OKQA 4L11A 5FQ0B 1YNAA 2JG8C 3POSA 3BIEA 3ILRA 4UFLA 2BOIA 3INAA 4BZ4A 4M0HA 1PM7A 1HB1A 3M7AA 2IWGB 3T4VA 1C3HA 5FOBB 3GCWA 4LO5B 4N7IA 2CGPA 5K7PA 2VQUA 2RS11 4JTNA 5CA6A 1KFUL 3KVAA 1OA3A 1EAH2 2X09A 4N9IA 1UOFA 1W03A 1VP6A 5IYYA 1SFNA 1F31A 1RUG2 1A3KA 1HB4A 4S2HA 1C4RA 4CP1A 4QX8A 1OXCA 1TMF1 4UOJA 2D6LX 1I1EA 1TE1B 4AEMA 4OMJA 5FZBA 1ND2A 4UBGA 3HAGA 1GZWA 1A8DA 3OB8A 2DYCA 3EYPA 3NKGA 4J25A 2OUJA 4WM7C 3OTFA 2DVBA 2OIIA 3B02A 1RITA 1VRH1 2Z79A 1DQ1A 4QXBA 1FAYA 2QQLA 4RGAA 4QB1A 4BQYA 1GMMA 4DFSA 1UMZA 2HEVF 1CWPA 1FYUA 1KXGA 4PF5A 1CIYA 1V9U3 1NY72 2CV6A 4Q4V2 4AAXA 4BHPA 1AR81 4Q27A 4FTSA 1AYM3 4QHOA 2XVKA 2I2SA 1H8TA 2A73B 4ZY9A 5L7OC 2WNOA 1YRZA 4OVEA 2YPDA 1QJX1 4BOWA 5IWFA 4HPKA 4QQOA 3FL7A 3ELNA 1FV3A 1LENA 4OYUA 5EZWA 4GWMA 4LIUA 2XL7A 4Q4W3 4FSJA 1MR5A 3AMPA 1D0GA 1AZDA 4OI2A 5ACA3 2HWD1 1SFYA 2EICA 3FHAA 3PTYA 3PIJA 4BQ1A 2B5HA 3AXDA 3OG2A 2H0BA 5FPUA 2J42A 1B35B 4YZ3A 4B29A 4BJ0A 1LTEA 5C71A 2R073 4IL7A 4CDUC 3HJRA 3KT1A 4IESA 2Y6LA 1PGW2 4BH9A 4XJ9A 4NJ4A 3PNAA 4QPIC 4TSVA 1BZWA 1OH3A 2XLAA 1VBD1 2ZOEB 3TEXA 2ZGMA 3AKRA 4LBQB 4ARYA 4BQ4A 1FMD1 2R1DA 4CEWC 1RVF3 4K20A 2VTFA 1AL21 1ZA7A 5EXOA 4DB5A 1J58A 5KXEA 5JOZA 2W39A 4R8HA 3SISA 3I8TA 5FQ0A 5BNPB 2EA7A 2XQXA 3UESA 1RUE2 1VE0A 2ZS6B 5IVJA 2VR4A 1YIPA 2J1EA 1BK1A 2B42B 3U10A 1LU2A 4Y33A 1P8JA 3OUHA 1W2UA 5FO8B 2JG8B 3JZVA 2BQPA 2TNFA 1PX4A 1JU4A 4KI5M 5FY5A 4DOUA 2F17A 2I45A 2BBVA 2CGOA 4F3JA 3SEPA 2BFUS 4DINB 1PMJX 5C3PA 4XAEA 3ZDSA 4BK5A 2BGCA 2Y0IA 3J8F3 3HR9A 1GFF2 4FCAA 4GMP0 4AAPA 2WNEA 1W2AX 1ZRDA 1QJU3 3N9PA 4QKNA 4CEYA 4Y4YA 4W6WA 4H3WA 4E2QA 4EN8B 5BYNA 4CPBA 2ZX4A 1R1A2 1KS5A 2RR11 3NV3A 1WMDA 1QMJA 4PLMA 2FQPA 5FYUA 2CHHA 1JHNA 1H2NA 1OF3A 3U0ZA 4WM7B 3TAYA 2ZTNA 4COUA 3PVEA 1UOGA 2B45X 5FUNA 1SFPA 2VQAA 4GA9A 4BIFA 5IHRA 4QQHA 5L36A 4LKSA 1UIKA 4FFIA 4K1YA 4WVWA 5GKAC 3WDUA 1H9PA 3QACA 3S6PA 3ZFEC 3AP4A 1CZVA 4YSFA 5B4NA 1PMIA 3E6CC 3VDDA 4CU7A 3WUCA 3MPBA 3O1TA 4ZZ8A 4XW3A 5FXZA 2Q30A 3V0BB 2ZAHA 5BXXA 3WG4A 4UW4A 5L7OB 4CCEA 1AXYA 2R32A 4XAAA 5DMYA 2XVGA 3SCFA 1W06A 3MV11 5GLTA 1RIRA 5F32A 3N4MA 4TN7A 5FUIA 4CE8A 4OI1A 4NN0A 4W6XA 3IB3A 2DBNA 4XXAA 1B35A 5DZGA 3BOPA 4J1XA 1FATA 3ES4A 3FZ3A 4QPWA 5FZ6A 2Q8DA 3VZKA 4AFDA 3PVBB 3VKFC 1IPJA 2G19A 2LUWA 4UI9L 1Z7S2 4Z8BA 1DU3D 4MO3M 5FZ8A 3U4XA 4S2DA 3K4AA 2VOVA 1Q5OA 2DTWA 1RTVA 2SBAA 1N1VA 4CDUB 3UGFA 4LBQA 3CEWA 4XFFA 4XE9A 4QPIB 1JU3A 3F95A 2I07B 4AGRA 5GJ6A 3W68A 1NAEA 2QQKA 3MLJA 2UYBA 1IKQA 1RUI2 5BNPA 1ZRRA 5DABA 2EAAA 4CEWB 2O1QA 1JZ7A 2B9VA 1EPZA 3IMMA 1ZA4A 3HBZA 1D0HA 1MEC3 3KGZA 4XBNA 2KD7A 5HV4A 2JG8A 2LROA 2XJPA 2XMLA 4LBMA 1C5IA 2YDEA 1AR72 3CMGA 1LB2A 5FYVA 2YC2A 4IEUA 1DLCA 3RPQA 1X9TA 1STMA 3MHZA 4GQ7A 4JVAA 3GM8A 3NW4A 3SEEA 3R05A 1RUC2 4QKBA 1MS4A 3GGLA 2XOMA 1XYNA 5GZFA 4BDVB 1AUYA 5IVEA 1QU0A 1RMU1 3AKQA 4FPKA 2BUKA 5A6ZA 1COV2 2ZGQA 3AP5A 3ECQA 2PQQA 3LIHA 1GQPA 1E5HA 1YWKA 4IXLA 5F6LB 3ZPOA 3FHIB 2D6OX 2OW4A 5GZEA 5T50A 1S0JA 2IXLA 2VMGA 4WM7A 4CCOA 4XF4A 2VZPA 1C1LA 1ZM1A 3ZXLA 2A5ZA 4RD7A 4Q1PA 3PJYA 3LSDA 2YYOA 1Y43B 3O12A 4FAGA 3HQXA 1UYYA 4EZ4A 1O3TA 1APNA 3S7EA 3O7OA 1JMUB 1RHI2 2RS31 3RZLA 1RUF2 1XSRA 2XJQA 5LA9A 4MOAA 1G9CA 2KXLA 3V0BA 2A71A 2IUWA 3TWIA 5J98B 1RUH1 4LLFA 3ZFEB 2TBVA 3AP6A 1HQWA 2QZ2A 3RYKA 5L7OA 1U5IA 3ITQA 4GWNA 4NE9A 4AFAA 1FV2A 3AM2A 3DGTA 4B1MA 4IV3A 4QM9A 3ZYHA 3P1IA 1C8M2 1YIFA 2VULA 3ABZA 1POV3 1C1FA 3B74A 5A7SA 1OA2A 2D4QA 2DU0A 4H7MA 4AW7A 3CF6E 5LK7B 3FN9A 4YYOA 5FZ1A 4NPRA 1QWRA 4XEZA 5ERLA 4ES9A 4Z2WA 4LQRA 5FCCA 5LY1A 4IEPA 4CDUA 1Y7BA 2LRPA 4JGZC 5A7WB 3O0WA 5EJ1B 3VZMA 3OD0A 1OF4A 4QPIA 2WT0A 1YQ6A 2QBXA 1ODNA 3G6JB 4HG6B 4Q4X2 4V1PA 2W5FA 1UYZA 3C8XA 1FT9A 4MGIE 4XDQA 1W2TA 3VHPA 4CEWA 2WFF1 1UY4A 1PIV3 4Q2FA 3HBKA 2NPIA 3NO8A 4L9BA 4TXWA 1JTZX 4Q29A 4Q1RA 3VZNA 1PVC2 2RM22 4D7SA 4PF1A 2ZEXA 1QGLA 5FUPA 1ZZ8A 1GWKA 4LKEA 1RXGA 1UYXA 1SBEA 2WC2A 3U37A 5E16A 1SCRA 4BM8A 2PQSA 3NJVA 4FT8A 3JB8A 1TNRA 4QX0A 3UKVA 4BK4A 5FWJA 1HRV2 3SMHA 1FPN2 3LEMA 3TN91 1Q43A 4GMP1 1CONA 5SV5A 3SCHA 4AVVA 5JXHA 2XR4A 5DDJ3 5K0UC 1O5UA 4NHMA 1AR61 2IXHA 1RUOA 1W6NB 4KWUA 3WLUA 3SCGA 4YGCA 1ODMA 1NQDA 4KGGA 2YY1A 2IFWA 2C1FA 3DXUA 5KHIA 1F15A 5FOJB 3R4SA 2HJIA 3FFZA 2DV9A 1JS9A 3B69A 4MGQA 1AXZA 2A6ZA 2H6BA 2UWBA 3ENRA 2CU5A 2P6HA 4QXHA 4UT5A 3RDIA 5BNNC 3BUCA 2CL2A 3E6DA 4ZXKA 3MLKA 1O91A 1H8VA 2A3YA 1ULEA 3R4UA 5A33A 1EV13 3WNOA 2RE9A 3BALA 5GZDA 2J1RA 4L2NA 5CG8A 3ZFEA 2P6CA 3AJZA 4Z82A 1T2XA 2XBO2 1JI6A 1PK6C 1NCRC 2GP3A 3T30A 4DQAA 3O1OA 5ABJC 1WLWA 3LA7A 1C57A 4R9DA 3VKMA 1ZBA1 1SLLA 2X8KA 5LATA 3LOBA 5FYCA 3FE5A 3WHUA 1JYIA 5DUXA 3AKSA 5JLVA 4QQPA 1ST8A 2NM1A 2VTXJ 1AJKA 1ZX5A 2FDJA 4M00A 3WG2A 3BTAA 1FNZA 1BHGA 3N7LA 4FTEA 4I30A 1AYN3 3IDAA 1LGCA 3E97A 4IE0A 4Q0UA 1VBE2 4XDPA 5FY0A 4D7TA 5A7WA 1DGWX 2JIGA 1TME3 3R6SA 4AVAA 1JZ4A 5FZEA 5C4WC 4IE4A 5GLVA 1WCSA 4M0NA 2GC1A 1CAVB 3ZIXA 2E32A 4JGZB 1W9FA 5C3OA 2GNBA 5C8CC 4GKXA 1WMXA 3PUHA 4JQRA 1W9WA 3MIFA 2JE8A 4ZPIA 5G04L 4DZGA 4E4HA 5LWBA 1VLNA 3WX5A 3GBWA 3JXSA 1LOCA 3ZSLA 4YZ1A 3Q8FA 4MGYE 1RUD2 4NIDA 4COWA 4LPLA 2GZWA 1AR92 3JQXA 5FZHA 1OD3A 2HWE2 3PUIA 3DXTA 2Y38A 4YM1A 1RUJ1 3S30A 4Y26A 2NMNA 2ZZJA 4XFIA 1MS9A 3JBG1 1SLTA 3OPTA 4RHV1 3ZFGA 1OC1A 1QXJA 2D93A 1JH5A 3N35A 5IW0A 1W6PB 3BGAA 3MIHA 1ASJ1 3PL0A 4ASMB 1LHVA 4YLZA 4YM2A 2PELA 1FOD3 1W6NA 2RS51 1OI6A 1R092 2ZACA 4XJZA 1N1YA 4I0AA 1CAUA 2E31A 3M1HA 2CY6A 4N8MA 4RR3C 3ZSJA 2AGSA 1LGBA 3WF1A 4IEVA 1DDLA 1QIQA 2QDRA 2BVVA 1DBNA 5FV3A 1OVSA 2G4IA 1O4YA 5CFCA 3CZUA 1HB2A 1PO23 3BOWA 4C0HA 2WA4A 4W65A 4INDA 1GQHA 1SDDB 5CU1A 5FIXA 4HN0A 4AI8A 4XVHA 3N9OA 3W58A 1GQGA 3I2JA 5CKMA 2O8QA 2Z2SB 1REEA 2ILMA 1XNTA 4BISA 1BVVA 5BNNB 1CD3G 1HJFA 4HVRA 2ZMNA 3N9LA 2K46A 4LBKA 2VGDA 1W9TA 4XJAA 2WA3A 3VL8A 2WO7A 3J7LA 5J36A 2W92A 3EB7A 3GBGA 2VQTA 5CB7A 1PK6B 1NCRB 3AZXA 2WABA 2W9XA 2AACA 3GZTB 1NZCA 3BTXA 4BB3A 1WKYA 3AP7A 2QVSB 1QQP2 1BVP1 2JDKA 3SLIA 2W1QA 1DQ6A 3JB4C 1CZTA 1J84A 1S0CA 4MVTA 4Q4Y3 5EJZB 4KQ7A 4CRQA 3OUIA 3Q9OA 4A3ZA 1JZ8A 1V9U1 1F4HA 3LZZA 2ZGLA 1AYM1 5IUQA 3BVCA 1CAVA 1PO12 1Y9GA 2WUHA 3GBFA 3SITA 2Y64A 4JGZA 2VMEA 1F35A 1X36A 3HN1A 2A6YA 4NVPA 5C4WB 1UIJA 1LESA 4JHZA 2DVDA 2XUMA 4OMCA 3UT0A 4KWLA 1NZIA 2XB6C 2XJRA 4AZZA 1BCXA 4XILA 4Q4W1 1ND2C 2B9UA 4P9IA 5C8CB 2FBEA 3B00A 1QJY2 4GJYA 5ACA1 4K9SA 1POV0 3VBUC 3MW4A 4URAA 4XUPA 3C7EA 4NOTA 2QDNA 3THPA 3WCSA 1Y3TA 3KT4A 1YUDA 2R043 1ZRCA 3KF3A 2KA3A 2R071 2YBKA 3LQCA 4R9AA 4LT5A 2BGOA 3WDYA 5A6YA 1W6PA 4HT1T 3K3NA 1WCUA 2JDNA 4CDWB 4CVUA 1OURA 2RDQA 3Q8AA 2VXJA 5FRAA 1WW7A 2VCMA 4HSJA 4FPOB 1RVF1 1QH6A 4I3GA 4ZXEA 1ZVFA 3V56A 4COZA 2UWAA 4DEVA 1OLRA 4Y24A 2C26A 5KBFA 1XPWA 3RZGA 1ULOA 2BNOA 1RGSA 3ACLA 4JC1A 4RR3B 1SDWA 3FBMA 3VUOA 3HNMA 2J1TA 1R1ZA 3WXPA 3WNKA 3ZYFA 1IS3A 3CKHA 2DBIA 1JZ2A 3ATGA 4Z1VA 1W3XA 4AE2A 3AX4A 1BYHA 3CO2A 2OZJA 3RGBA 2Z69A 5FP8A 2BVBA 3GJAA 2IXKA 3RJRA 5K4LA 3VL9A 2P3IA 3J8F1 3O0XA 5HCBA 1ALYA 4LO7A 3Q8EA 1PK6A 1NCRA 1QJU1 4HN1A 1AXKA 3K4ZA 3GNEA 3CL1A 5EQUA 2PLV3 5AVPA 4CCMA 4K40A 4UXAA 1WD3A 1KQRA 4KBZA 1HLCA 2XG3A 1KJRA 3OBTA 1V6JA 3I3DA 3FWEA 5IK4A 5T5LA 4Y5SA 1CAXB 3LFMA 4FOWA 3ZYRA 3H8XA 3C7GA 1GWLA 2RS12 2ZMLA 3ZR6A 3GCXA 4LK6A 3QD6A 3O1UA 3P3PA 4QMAA 5JXJA 3KV6A 4CIZA 1BKZA 3LOIA 4EE2A 4QX7A 5AC93 1D4M3 2WKKA 2DDUA 1TMF2 4OZOA 2YGMA 5F9TA 2AC1A 1ZRFA 1L3JA 4LKFA 2D6PA 1Y9MA 5C4WA 1CAWB 1UQXA 1O8PA 2VUAA 2Y0OA 2Y33A 4IETA 1VRH2 4FPJA 1XE7A 5C8CA 1YJKA 3NMBA 5FYZA 2PAKA 4CEYC 4DPNA 2JICA 4YW4A 2Y6JA 1T6GC 3CJXA 5J48A 4CU6A 3HVDA 1AR82 4KU8A 1X8MA 2VOKA 5C8WA 1ZZ7A 2RVAA 2R0FA 4E4DX 1R5LA 2E33A 1MS3A 3TBDA 3KM5A 3AYDA 1WLCA 1QJX2 2MEV3 2WQ4A 5DPNA 3VBUB 1SZBA 3ES1A 3RMYA 4J1WA 3U07A 2BDRA 4CDWA 3VDBA 2ZA9A 2A70A 3PHMA 3LDKA 1YQ8A 4IEZA 4DIQA 1YQ5A 5ABJB 4ZU5A 3VDDC 4ONUA 2EALA 1ENRA 2IXJA 1G9DA 2HWD2 5G05L 4ZONA 2XDVA 4OHVA 4RR3A 3ZOIA 4I0WB 3AL5A 5FXVA 3AFKA 5D2AA 1HXS1 4P9LA 2OKXA 4FMMA 4LHSA 5F5QA 1MEC1 2C9AA 1LGNA 2EIDA 3I2KA 1JOBA 5DZEA 5C5UA 1E5SA 4G4FA 1VBD2 1NUKA 3I2HA 3U1XA 1BEV3 1FMD2 3KCXA 1GLHA 1OLQA 1JUHA 2X05A 1AL22 2QZ3A 4J7QA 3ROUA 2JD9A 4FPHA 3I49A 4LULA 1W9SA 2VC9A 2AEYA 3OUJA 4D3WA 4RHV3 1QDCA 3KSCA 3RSJA 1LU1A 2R6QA 4XYXA 1MZEA 3AXEA 4NIAA 1NCQC 1ZZBA 2VD7A 2YG0A 3FFQA 5BNPC 2YB7A 1CGPA 1CAXA 5A7QA 2R30A 4PLNA 1G9BA 1IKPA 4YW3A 3T0DA 1SLIA 4AI1A 3WF3A 2CAVA 2Y34A 1VIWB 2ZKNA 5HXVA 4N90A 5CIRA 2LTNA 1BLZA 2ADEA 1LEMA 1UU6A 4XFGA 2WS93 4XMIA 5FZ0A 3BN6A 5SV8A 3WP3A 1CAWA 2X5IC 2RR12 3M70A 5FBJA 1OIPA 2J1VA 3MO4A 2W95A 4KMQA 3MDPA 5T52A 2E51A 1ZZ6A 4XF1A 1W8TA 2WZR3 1B09A 1YQCA 2ZX0A 4AG4A 5A3MA 2ARAA 4ZS3A 4CU9A 5BV6A 2IXCA 1ONAA 3H7YA 5F5IA 4JV4A 3K48A 2C9KA 1F9KA 3PIGA 2ARXA 4D6QA 4QAWA 1POV1 3WSOA 1WCDJ 3WF0A 4CEYB 3CU7A 3UNPA 2ZEZA 4OHYA 3VBUA 2JB4A 5F3CA 4NIHA 3GF6A 1JYWA 5FZKA 5LBEA 3NJXA 4QT6A 4XHBA 4MLOA 3K75B 3N9NA 5ABJA 4RSUA 5T54A 5IFPA 2RG4A 2VO5A 3POYA 1UAIA 1WUVA 4GIQA 3O1VA 5CKQA 2XH6A 5FYHA 4I2OA 1UMIA 2VNGA 3WDVA 3KVBA 5IATA 4YWAA 4CPBD 2ZGSA 4UAPA 3ZSEA 1UZVA 1VBB3 3VDDB 2E7AA 2G9GA 2D3SA 4ORFA 1PIV1 4M3CF 3ZXAC 4PI2A 4IV3C 4LO6B 4Y4RA 3IIAA 3WW2A 1H4GA 2VNVA 4EN0A 4OMKA 5LCWL 3GALA 3RI9A 1CQ9A 1I6XA 1YFXA 1OUXA 3MF6A 1DQ5A 1UOJA 1WD4A 2E53A 1LEDA 2WNUC 3QBQA 4CSWA 4AFBA 1W9YA 2B4KA 2BOJA 3I4IA 2P3YA 3CQOA 4EN7B 2K2SA 1KJLA 1ZREA 2ZHLA 4KWKA 3LA3A 4G9SB 4R52A 5DDJ1 5FY7A 2XHNA 4JDMA 4AQTA 2UU8A 3MF9A 4KH9A 2OS2A 2BEOA 3TB0A 2VBBA 4UBHA 5FZ9A 1KD7A 1YQ2A 4I02A 2K0GA 2Y6GA 5FK8A 1ND3C 4FXGB 4B3NA 5DAPA 1NCQB 1Q8PA 2AYHA 3DV8A 1WA6X 4OI0A 1US2A 1W8WA 2O0OA 4DY3A 4Y22B 2FZ2A 1KS4A 1KITA 5LEKA 1EYBA 2H6CA 3CHXA 1GZ9A 4XTPA 2VOWA 1RMU2 4QX5A 4BU2A 1V6NA 2IZWA 4PJYA 2VOXA 2IFRA 1EV11 4L0PA 4LO8A 4LBQD 4UW6A 5FZIA 2HWB3 2HWC3 3HNYM 4JTOA 3U75A 5LA1A 3KZ4C 3UJOA 5LRSA 3M3QA 3EBRA 2DVGA 1K45A 2GH8A 2J22A 1W8HA 2VW0A 2D7FA 2X5IB 2ETEA 4Z92B 4O61A 2JX9A 3RMXA 5CADA 3PG7A 1F5JA 3CZJA 4XFBA 3IMNA 4IE6A 4GB33 1IPSA 3VKLA 4P9JA 4M3CE 4XOGA 2QNKA 5FY8A 4CCCA 3NNJA 2WLQA 4XFHA 2V4VA 3ST7A 1RYYA 3DCQA 1Y4WA 3HQRA 5FDBA 2RS32 1VAMA 4M4RA 2E63A 4QQ2A 5CFDC
chains in the Genus database with same CATH topology
3Q8GA 3P7ZA 3HY5A 1OLMA 4UYBA 3B74A 1OLME 2D4QA 1OIPA 5LZ6A 3HX3A 3PEGA 4M8ZA 3W67A 1O6UA 1AUAA 1OIZA 3B7ZA 3PG7A 4J7PA 4OMJA 1R5LA 4FMMA 4CIZA 4OMKA 2E2XA 3W68A 3B7QA 3B7NA 4CJ6A 4TLGA 4J7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8G A;  3P7Z A;  3HY5 A;  1OLM A;  4UYB A;  3B74 A;  1OLM E;  2D4Q A;  1OIP A;  5LZ6 A;  3HX3 A;  3PEG A;  4M8Z A;  3W67 A;  1O6U A;  1AUA A;  1OIZ A;  3B7Z A;  3PG7 A;  4J7P A;  4OMJ A;  1R5L A;  4FMM A;  4CIZ A;  4OMK A;  2E2X A;  3W68 A;  3B7Q A;  3B7N A;  4CJ6 A;  4TLG A;  4J7Q A; 
#chains in the Genus database with same CATH topology
 2JEC A;  4B7E A;  5JVV A;  2P4E A;  2QQN A;  3D0S A;  5FYS A;  1MS8 A;  5JI9 A;  1RUH 2;  1AYN 1;  3B9I A;  3OEB A;  5FMO L;  3W5M A;  4DRV A;  2KR2 A;  2VZ3 A;  1OT5 A;  1TME 1;  5FZA A;  3NV4 A;  4OUM A;  3OYW B;  4K6B A;  2FD8 A;  2ORZ A;  5I8T A;  2B39 A;  1VAK A;  4FPE A;  2V5Y A;  2J1S A;  5C3S A;  5I0D A;  4CUA A;  4P5Y A;  4QX2 A;  5I91 A;  3MFC A;  3NNL A;  2P2K A;  3T2P A;  3I2O A;  1X50 A;  1CZS A;  4YZ4 A;  2JEM A;  3III A;  3SQO A;  1NG0 A;  1V6O A;  1VPH A;  4OQ9 A;  2EXI A;  1R08 3;  3PDQ A;  1XU1 A;  4EWA A;  1GP5 A;  1GOF A;  3O1P A;  5C3R A;  1K5J A;  4QPG A;  2I74 A;  4IV3 B;  4EWE A;  3OBA A;  4XAB A;  2XUE A;  4CCJ A;  1QH7 A;  1YXW A;  2YC4 A;  1OLM E;  1S2B A;  3ACH A;  5EYX A;  1LNS A;  2RMU 3;  1XJA A;  2FCT A;  3L2H A;  2PA7 A;  4LIT A;  1IOA A;  4CP2 A;  3D8C A;  2WFF 2;  3ME2 A;  4DUW A;  2WNU B;  3BB6 A;  1ACC A;  5F3E A;  2VTX A;  4I09 A;  1W6O B;  4MX3 A;  2UY8 A;  2ZGK A;  1XC6 A;  3BOD A;  2XJS A;  3ZMN A;  5LW9 A;  1FOD 1;  4LA2 A;  4OHW A;  4OQ8 A;  2BPA 2;  1G9F A;  5FZC A;  2R06 2;  5JCT A;  2QQP A;  5FK7 A;  1NY7 1;  2JDA A;  5F2W A;  5C5T A;  1F4A A;  1NCQ A;  3BTZ A;  4E2G A;  2G9F A;  4PQ9 A;  5FP4 A;  4LHK A;  4Y22 A;  1PO2 1;  2ZKL A;  4EWD A;  1Q8V A;  1ND3 B;  3FLP A;  3BU7 A;  5ANN A;  1TVG A;  1HXS 3;  4K1Z A;  3TN9 2;  4AED C;  1D2S A;  1TQ5 A;  5F5C A;  2ZAA A;  3AMH A;  3NWK A;  5E6H A;  3VZL A;  4CP9 B;  4XC9 A;  2VVF A;  4FXK B;  1GBG A;  1AR6 2;  4J6G A;  1DZR A;  2RDR A;  4BWO A;  4M8Z A;  3W67 A;  3JU9 A;  4LTA A;  2D5F A;  3ZFG C;  2X5I A;  3KHC A;  1D4V B;  1W0O A;  1DCS A;  2VL4 A;  1OA4 A;  2N7G A;  3VD3 A;  2D98 A;  2Q5T A;  4M3C B;  3GHN A;  5HCA A;  1NYW A;  2QTW B;  3I2F A;  1RUN A;  1AX1 A;  1REF A;  3AZV A;  4DXS A;  3H3Z A;  1VB2 A;  2D43 A;  3MIG A;  1QY4 A;  2VW2 A;  4TLF A;  2ZX1 A;  5LBC A;  1NXD 1;  1LOA A;  3ZXJ A;  1LHO A;  4R4Z A;  2K9Z A;  5CFC C;  3QH7 A;  1DGL A;  2Y6F A;  4HON A;  5L73 A;  1SLB A;  3C7O A;  1H0B A;  3POG A;  4P9X A;  4Q4Y 1;  5LA0 A;  1TEI A;  4QD2 A;  1CJD A;  2VM9 A;  5CFD B;  1JHJ A;  2P1B A;  3O14 A;  4Q0S A;  1VBC 3;  2YU1 A;  3OYW A;  5F1R A;  1ZBA 2;  3I2D A;  3OBZ A;  2VZV A;  1M06 G;  2WJS A;  4GXL A;  3N7J A;  5A3L A;  1BXH A;  1IQA A;  3AFG A;  3S5Q A;  2QQU A;  2YZ4 A;  1GP6 A;  3HIF A;  1YFW A;  5DZF A;  3PUS A;  2E26 A;  4AGV A;  4CCK A;  4E8C A;  5A33 B;  3PTR B;  5C70 A;  3WHT A;  1ULC A;  2ERF A;  4Z07 A;  1ZBE 3;  1NLR A;  4LBJ A;  4TLG A;  4UFI A;  5FYT A;  4FBF A;  5JSP A;  1BBT 3;  4YGD A;  1UKR A;  3WIN E;  3VDC A;  2EAK A;  1MS0 A;  4NMI A;  4Q5O A;  3I2G A;  3RZK A;  1XSQ A;  3UL2 A;  3POB A;  3RZJ A;  1A6C A;  3FLR A;  4ISR A;  4Q0P A;  4EQV A;  3V0A B;  1UX7 A;  1F8V A;  2QJV A;  5B2G B;  3ON7 A;  2R04 1;  4XCB A;  1OHF A;  1BK0 A;  3VD7 A;  2WNU A;  1OBN A;  5LAS A;  4DUV A;  4NRM A;  1W6O A;  4ARX A;  4YW7 A;  3O1R A;  1H2L A;  1V70 A;  2AZ5 A;  4A42 A;  5D1I A;  5FYI A;  1OSG A;  4Y1X A;  2CTV A;  1M4W A;  4XAC A;  5JAX A;  4H7L A;  2OX0 A;  2HWF 3;  1KGY A;  1LOB A;  3PLQ A;  4RN5 A;  5DQ0 A;  5EYY A;  3WP6 A;  3NNG A;  2ZBJ A;  3D82 A;  1C8N A;  1WMF A;  1I3H A;  2H0V A;  1IG0 A;  2D3P A;  3S0M A;  3RZM A;  1RUJ 2;  1RED A;  2NQY A;  3WCR A;  1WBF A;  3LEG A;  2VEC A;  5JWP A;  1LEC A;  1H4H A;  1ND3 A;  2XHK A;  3JBG 2;  3SH3 A;  3WNM A;  4A6S A;  1UW8 A;  4YVW C;  1ASJ 2;  3ZYI B;  4A45 A;  1S2E A;  3ZSM A;  1W8F A;  2AEN A;  4CP9 A;  3PUR A;  1W39 A;  3H50 A;  4LEJ A;  2RS5 2;  2GC2 A;  3ZMO A;  1VBA 3;  3RYR A;  4CCL A;  4YZ5 A;  1GNH A;  1HRI 1;  4JKK A;  2FMD A;  5LBB A;  2WWS A;  4AED B;  1E5R A;  3EMR A;  1MAC A;  5CEH A;  4MH0 E;  3CIH A;  1V6L A;  2VCB A;  4M3C A;  4YNI A;  2A7A A;  4BYY A;  3ZFG B;  3ZPY A;  1U12 A;  4COY A;  2DVF A;  2PLV 1;  2VY0 A;  3WW4 A;  4Y1U A;  3HT2 A;  1I9R A;  3ZFF C;  2DCT A;  1EY2 A;  2GC0 A;  2WO3 A;  1NKG A;  3PME A;  4OLL A;  4LOT A;  3ZN5 A;  5KXC A;  4MAD A;  2GME A;  1X9P A;  1LOD A;  2P3K A;  1CAU B;  3M4F A;  3A21 A;  3AZY A;  5FLH A;  5FKB A;  3D0J A;  1JYX A;  2ZAB A;  5JMC A;  3JD7 3;  4NUB A;  1DZT A;  1G86 A;  4LUK A;  3ZYG A;  4DUX A;  1G9A A;  5CFD A;  5CFC B;  2XPJ A;  2YBP A;  3K51 A;  4ET7 A;  4BE3 A;  1N1T A;  3B7M A;  5FXX A;  5AC9 1;  1SLA A;  3LB9 A;  1D4M 1;  4N53 C;  4AGG A;  1JW6 A;  2A1X A;  5A3P A;  3CJI C;  4R9B A;  5DN2 A;  3C7F A;  2W08 A;  3LWC A;  4QGN A;  5FZD A;  2EF6 A;  1OQ1 A;  3MPP G;  3KWV A;  1PHM A;  2WDB A;  3BIW E;  3DEC A;  3PU3 A;  1NE6 A;  1SPP A;  2ZHM A;  3VBF C;  4ZHN A;  1HKD A;  3KCC A;  4YG3 A;  5J7M A;  2XL9 A;  4XXP A;  3KT7 A;  3MUZ 1;  3AZW A;  1AR7 1;  1S0E A;  2Q4S A;  2VOT A;  4E8D A;  3PUA A;  1UXX X;  3T09 A;  1JZ6 A;  3RWK X;  1AX0 A;  1IS5 A;  3HNB M;  4U2A A;  4IGQ A;  3UV9 A;  1V9U 2;  2VE1 A;  4CXW A;  4NIG A;  1K42 A;  1KDK A;  1OLM A;  1AYM 2;  2GN7 A;  3GZU C;  1G7Y A;  1YJL A;  5JR7 B;  3WNX A;  3V0A A;  3KCY A;  3T1L A;  1X8E A;  1COV 1;  4A7Z A;  2MEV 1;  4WZC A;  1GOH A;  2VMH A;  5CVR A;  1IG3 A;  2VQ0 A;  4QX3 A;  3WVJ A;  3BCW A;  1DYP A;  1PVX A;  5A7N A;  4JRL A;  5LY2 A;  2AR6 A;  1EUU A;  1H1M A;  3VBO C;  5FAX A;  2ZEY A;  4Q4W 2;  3IT8 A;  2JKX A;  5ACA 2;  4IGO A;  4Y1V A;  3B7N A;  5HV0 A;  5E8A A;  4CCD A;  1RB8 G;  1MZ6 A;  2A3X A;  1UL9 A;  3NJZ A;  5DUW A;  3HN3 A;  1DGR N;  1LKN A;  3MFA A;  5FZO B;  3VZJ A;  3S5A A;  2GH2 A;  2R07 2;  3HQU A;  5DAW A;  1DQ4 A;  5FYB A;  1UMH A;  2D6M A;  2X53 S;  2GSY A;  4AHW A;  1WCQ A;  1J1T A;  2W0X A;  1UPS A;  4FQ4 A;  3NV2 A;  5FZ7 A;  4AI9 A;  5KC5 A;  1IHM A;  1EAH 3;  1YO8 A;  2IC1 A;  2R7E B;  4PCR A;  4YVW B;  1BEV 1;  4AED A;  1RUG 3;  1RVF 2;  4CUC A;  4OCT A;  5FP9 A;  5I93 A;  1JOJ A;  4CDW C;  1O3S A;  1V6I A;  2FCV A;  2ET7 A;  1UCX A;  2YFU A;  1LAJ A;  1GV9 A;  3AYE A;  1O5L A;  1UY2 A;  4LK7 A;  4LR4 A;  5DAQ A;  3P5B A;  4IEO A;  4IW3 A;  4AF9 A;  3DL3 A;  4YPJ A;  4K8R B;  3CNA A;  1QJE A;  4Y1Y A;  5APA A;  2CWS A;  3MIE A;  5EWS A;  3LE0 A;  1GZC A;  1N1S A;  4Q4V 3;  1E57 A;  4GD4 A;  2E7T A;  1PM4 A;  3OOX A;  3J8F 2;  4FVV A;  4JGY C;  3EQE A;  1OH4 A;  2QKD A;  4D8M A;  1GOG A;  1QJU 2;  3FC0 A;  4HK9 A;  5HXM A;  2WS9 1;  4NO4 A;  1J1L A;  2GAU A;  5IFT A;  1DQ2 A;  4N53 B;  5BPX A;  4NII A;  3UET A;  2EXJ A;  1JZ3 A;  1YFU A;  3CJI B;  3MLL A;  3OF1 A;  5J96 B;  4CJ6 A;  5FZM A;  4XF0 A;  2WZR 1;  2Q0A A;  3MIB A;  3VBF B;  5HI0 A;  2AH2 A;  1W8O A;  2FZ1 A;  2VJX A;  3HY5 A;  5DG1 A;  2DVA A;  1MS1 A;  1NE4 A;  1Q8S A;  1VRB A;  4MYE A;  3LD8 A;  1JYN A;  1OMI A;  3M3E A;  4E4S A;  2LW8 A;  3N7K A;  1HN1 A;  4NHL A;  2O8O A;  4Y1Z A;  5DUV A;  4CDQ B;  4XQ4 A;  4DXT A;  4ZZ5 A;  2PAM A;  1UN1 A;  2YGL A;  5CBL A;  2WBK A;  3RWN A;  3GDB A;  3DKQ A;  5I8Y A;  4BXF A;  5L9V A;  2MHF A;  3K4D A;  4RQP C;  5A32 B;  1UZY A;  4RS5 C;  2JEN A;  4PBP A;  4K7J A;  5A3W A;  4B4P A;  1PZ9 A;  4IEX A;  1S1A A;  4PIY A;  4PDW C;  1RUE 3;  3VBO B;  4UFK A;  5IVV A;  3Q8G A;  3E5X A;  3U4S A;  3WNP A;  1SLC A;  3LCP A;  5FZO A;  2B7Y A;  4QX1 A;  3I7D A;  1VBB 1;  2W1U A;  2WNV B;  4HKL A;  4A6O A;  5C9A C;  4A41 A;  2AEZ A;  2C24 A;  3K2O A;  5A7P A;  1PNG A;  2YMZ A;  3RYP A;  4BLI A;  3KS7 A;  1UKG A;  5I8S A;  2XXZ A;  3SC7 X;  4NRQ A;  4E9K A;  1X7N A;  4N43 B;  2ZGP A;  4YVW A;  4CXY A;  2XKO A;  2LS6 A;  1J3R A;  5BNO C;  5IVC A;  5FTT C;  4IER A;  5LEJ A;  3MID A;  2E9Q A;  3USU B;  1DHK B;  2WZE A;  1D2Q A;  4WVV A;  4XIO A;  4GAZ A;  2W47 A;  4AVC A;  3EHK A;  3N7M A;  3APB A;  1R1A 3;  2OQ7 A;  2VVD A;  1FX5 A;  3LEK A;  4A44 A;  4ATE A;  4L97 A;  4YRD A;  4BIO A;  1DFQ A;  2Q1Z B;  5K8S A;  4DXZ A;  3KHB A;  3OGJ A;  4HKO A;  1MEC 2;  2WO1 A;  4XPV A;  3WDT A;  4DEQ A;  3NVC A;  2Y6H A;  4HL0 A;  4JCK A;  4MXW A;  4C1X A;  3H8R A;  2BU9 A;  3ETP A;  2DCY A;  4YVS C;  5HBA A;  5CG9 A;  4HVQ A;  4QKF A;  3ORJ A;  5BY5 A;  2IXI A;  2XVL A;  5DAV A;  2P5B A;  4BME A;  5F3I A;  1L7Q A;  1QOT A;  4O7X A;  1CVN A;  4DS0 A;  2HLE A;  4XTM A;  2DUO A;  2R49 A;  4YZ2 A;  3HPN A;  2GND A;  2GMM A;  2W2I A;  1VMJ A;  1BMV 1;  2PHW A;  4RL7 A;  4K8F A;  2BWC A;  4XJ8 A;  1W2O A;  1JYV A;  3L2Y A;  1PMH X;  2JJ6 A;  1UF2 C;  5FYM A;  1W99 A;  1YCI A;  2XGX A;  2YV8 A;  3LGR A;  4JGY B;  4N53 A;  2HWB 1;  2HWC 1;  3CJI A;  2HKX A;  2LM3 A;  4IV1 C;  4HAN A;  4PIX A;  4YG6 A;  3AYA A;  5EP9 A;  3V65 A;  5I0S A;  2Y6K A;  4XF3 A;  1HRI 3;  1UNB A;  4A3X A;  2CDP A;  3VBF A;  3ACI A;  4EJR A;  4GB3 1;  1SEF A;  3W5N A;  2YBS A;  3H1Y A;  3HX3 A;  3HOB A;  3ZLI A;  1NLQ A;  5FJK A;  4B1L A;  1DYK A;  3TYJ A;  2DCZ A;  2ZCW A;  4HET A;  2ZMK A;  3AK0 A;  3AVR A;  3C3V A;  3J7N A;  1Z7S 3;  2Y60 A;  3B5L B;  5FLJ A;  4CDQ A;  3AP9 A;  5JSR A;  2VH9 A;  2XQR A;  5LBF A;  3POW A;  3VHR A;  4B4Q A;  3S7I A;  3T3Y A;  4RFT 0;  1N3Q A;  5A32 A;  2GDF A;  1QXP A;  4S2F A;  5T5O A;  1DIW A;  4Y5Z 0;  3M3I A;  1RUI 3;  3TNP B;  3HD8 B;  5A3N A;  3VBO A;  4AHZ A;  1YFY A;  3WW1 A;  2W46 A;  2WR9 A;  3TRS B;  3BKZ A;  2WNV A;  4RQP B;  4RS5 B;  4P02 B;  4OZX A;  4XQD A;  3WG1 A;  1W05 A;  2MNG A;  3M2M A;  4XUN A;  3LIG A;  1GAN A;  1W8N A;  4PDW B;  1POQ A;  3PEG A;  1AR7 3;  1UY3 A;  1WW5 A;  5JI7 A;  3WDX A;  3LEI A;  4NHY A;  4HBN A;  4R9C A;  3I3M A;  4BQ3 A;  1R08 1;  4N43 A;  3USS A;  4HMZ A;  4MGS A;  5C9A B;  3QLQ A;  3MZH A;  4AEK A;  1RUC 3;  2VMC A;  3USU A;  4QHZ A;  2LAL A;  3DKW A;  1IS4 A;  1JYT A;  1QKQ A;  4L92 A;  2RMU 1;  3R0R A;  1COV 3;  3WZ1 A;  5BNO B;  1ENX A;  1S0I A;  1CPM A;  1KDM A;  2GMP A;  3B94 A;  5HCF A;  3IAP A;  1PIV 2;  1S2K A;  2GN3 A;  5F37 A;  1WLT A;  4AI2 A;  1GKB A;  4NHX A;  4P00 B;  5IK5 A;  3ZN4 A;  3NJY A;  1DG6 A;  4XJW A;  1O6U A;  2OT7 A;  4LE3 A;  3TEZ A;  2WYF A;  3BI3 A;  2VCA A;  4CDX C;  2W3J A;  3RNS A;  3T0A A;  1VMF A;  4FAH A;  3FLT A;  3ZVX A;  1GZT A;  4MGT A;  4GWJ A;  4OUL A;  4YVS B;  3SHR A;  1RHI 3;  4JKM A;  1RUF 3;  2W1S A;  5B4X A;  1UX6 A;  3UGH A;  3A7Q A;  3WT3 A;  4YAR A;  1S0D A;  2PHT A;  4KNC A;  4QPG C;  4W8J A;  3UKN A;  3WF2 A;  5A3U A;  1PGS A;  1BQP A;  4JGY A;  4M01 A;  3D3A A;  3POE A;  2DCK A;  5DDJ 2;  3WNL A;  3O1M A;  1PGL 1;  2YFZ A;  4GAL A;  2OQ6 A;  4XJU A;  5FPX A;  4MGK E;  1XOY A;  5IT6 A;  5FZG A;  3IDB B;  3WD5 A;  1HV0 A;  1C8M 3;  4QU2 A;  5GLW A;  1QEX A;  5J09 A;  2XWB B;  1LOG A;  3A0N A;  3B01 A;  3J7M A;  4GUL A;  4IV1 B;  1WA4 A;  1IPK A;  1MZF A;  1Y9Q A;  1RC6 A;  4PQQ A;  4OMD A;  1A78 A;  2Y8K A;  2D5H A;  2OZ6 A;  2FDF A;  1U5Z A;  3TOJ A;  2ZGR A;  4HLT A;  3ZXF A;  2V4A A;  1XNA A;  1XYP A;  3JQW A;  4XQW A;  5IK8 A;  1EV1 2;  1VR3 A;  3RVH A;  5JUV A;  5IK7 A;  5HCH A;  2UWC A;  1WGP A;  2GC3 A;  1VJ2 A;  2Z4F A;  4FPY A;  2VZR A;  2CSG A;  2RV9 A;  1HQN A;  3H1W A;  4Q4X 3;  3JCI A;  2Z42 A;  4O9E A;  1VBC 1;  2ZX2 A;  4TYS A;  1AX2 A;  1F2N A;  1H30 A;  1S0G A;  3E5U A;  2V72 A;  4FFF A;  4FPC A;  3AVS A;  5JZG A;  1XNC A;  4RQP A;  4AR2 A;  4RS5 A;  3LKJ A;  2JXA A;  4M4P A;  3MBW A;  5H9Q A;  2ADD A;  1PVC 3;  2DUP A;  2RM2 3;  2WYS A;  2XLF A;  4PDW A;  4UW5 A;  2HBU A;  4WVM B;  2VZU A;  3IDC B;  3J4U H;  1IS6 A;  3IZO A;  1ZBE 1;  2DUR A;  2PN5 A;  2VUJ A;  4PI0 A;  4QGM A;  1AYN 2;  5IVB A;  1BBT 1;  2DTY A;  5FMD A;  4AXO A;  5C9A A;  4SBV A;  1TME 2;  4Y3O A;  4Q8K A;  1EP0 A;  2OUH A;  1ENS A;  1Q8O A;  3VZO A;  3M8L A;  3IKW A;  1HRV 3;  2VBP A;  1FPN 3;  3ZYJ B;  2JE7 A;  5BNO A;  5L9B A;  2JB8 A;  5A70 A;  1YI9 A;  5FJH A;  5TSW A;  1UXZ A;  1OUS A;  3K77 A;  3NST A;  4XBL A;  1XNK A;  2HWF 1;  5F7U A;  1NQJ A;  1OIZ A;  3OGG A;  1J3P A;  3BPS A;  1W8U A;  3VGI A;  2JIJ A;  2UUR A;  5FZL A;  2VPV A;  2J1U A;  2ZX3 A;  5FPL A;  2FDK A;  2HEY F;  4YVS A;  5EJ3 A;  5KHH A;  4J7P A;  2ARE A;  1NOV A;  5EPA A;  4CDX B;  3IN9 A;  4H55 A;  3ZDV A;  1N3P A;  2XWJ B;  5FBZ A;  4AI0 A;  4IE7 A;  1FOD 2;  2Q1M A;  2XBO 3;  1ZZC A;  1TNF A;  4IEQ A;  5K0U B;  1VBA 1;  2WRA A;  3L9J T;  2YC0 A;  3I59 B;  4QPG B;  4RGK A;  4FTB A;  2IVJ A;  4YW2 A;  5FXW A;  2CGN A;  3VHN A;  4IV1 A;  5LZ6 A;  1H2K A;  3MYX A;  5FY4 A;  3VV1 A;  1PO2 2;  4LUM A;  1C28 A;  1QJZ A;  2YHJ A;  4BMB A;  4PIZ A;  3AYC A;  1R64 A;  2D3R A;  5FO7 B;  3VD9 A;  1VBE 3;  1CN1 A;  4LE4 A;  2OVU A;  4W6Y A;  4XZP A;  4YM0 A;  1K5M C;  3WQ1 A;  5IAX A;  3JD7 1;  5KR7 A;  3DPR B;  5DXD A;  3LFI A;  3H3L A;  4AVS A;  4UFJ A;  5KHK A;  2KM2 A;  2FDH A;  2C5D A;  4KGQ A;  5E89 A;  4ITC A;  4P9W A;  1Q8Q A;  3T2O A;  3H7J A;  4LO4 B;  4YGE A;  3VBH C;  3VBS B;  1AL0 G;  2PFW A;  2OPW A;  5JR2 A;  5JPN B;  4QB2 A;  2CDO A;  3UKT A;  3ZKY A;  3OY8 B;  5KWR A;  4K21 A;  4WVM A;  1RUD 3;  1AUA A;  5ANQ A;  3DN7 A;  4LHL A;  2FMY A;  3LSE A;  5KC6 A;  1AR9 3;  3AMM A;  2C4X A;  2J1A A;  4MGZ E;  4Q4Y 2;  4LMF A;  2HWE 3;  5FMO S;  4AHX A;  1PNF A;  2HH9 A;  4LBL A;  4C90 A;  3LDR A;  5T3N A;  2FDI A;  2WQ8 A;  2VMD A;  2WZP P;  5BNQ A;  3B7Q A;  3NV1 A;  4MG2 A;  4I0B A;  3ETQ A;  1JYC A;  3OJB A;  3RZZ A;  3KD4 A;  5A80 A;  1XBF A;  1HB3 A;  4P08 A;  4YM3 A;  3M3C A;  4R4X A;  1R09 3;  4W50 A;  1FXZ A;  2PHD A;  1U0A A;  3KV5 A;  3V64 A;  4MV2 A;  1H2M A;  1OQD A;  5FY1 A;  3CLP A;  2DCJ A;  1NXM A;  2Q8C A;  4HKW A;  4BPZ A;  5EFU A;  4P9Y A;  1MZ5 A;  2XJV A;  1DGW A;  2A75 A;  2R04 2;  5D8A C;  2GNM A;  1S4C A;  3WQ0 A;  5E88 A;  1JUI A;  4AEJ A;  3O5S A;  1Q56 A;  4CDX A;  5A6X A;  2ZXQ A;  2YXS A;  2D6N A;  4FFG A;  2D6K A;  4GJZ A;  3RQ0 A;  3B3Q E;  1OPM A;  2D44 A;  2ENR A;  1IZ3 A;  2BFU L;  3DEM A;  1XNB A;  1J3Q A;  2CNA A;  2WAA A;  1EAH 1;  1DF0 A;  2V5D A;  4URT A;  5K0U A;  5J1X A;  3I59 A;  4KWJ A;  1RUG 1;  1L7L A;  5LB6 A;  1YC6 1;  2D97 A;  3AB0 A;  3AKP A;  3P6B A;  2EIE A;  2RJL A;  1GUI A;  4AOC A;  1A8M A;  3S57 A;  3B93 A;  1CPN A;  4B8E A;  2RJ2 A;  1K3I A;  3HWJ A;  4FI9 A;  5T55 A;  3H42 B;  2V09 A;  4XUR A;  4EYU A;  4MXV A;  5JXI A;  1QQP 3;  1XE0 A;  1UZW A;  2QCS B;  2ZHK A;  3K46 A;  4CXX A;  2GAL A;  3EXU A;  2VW1 A;  3FBY A;  4MHR A;  2VAU A;  4YFW A;  5FP3 A;  4COV A;  3QCW A;  3MGU A;  3D4K A;  4Q4V 1;  1HRI 2;  3DPR A;  3VKO A;  5FYY A;  1UY1 A;  1PZ7 A;  1PZ8 A;  3SH4 A;  4CCN A;  3AMN A;  4RYD A;  1X33 A;  1PO1 3;  2G1M A;  2W94 A;  4O9G A;  2NZ9 A;  1K5M B;  3ZXK A;  4BQX A;  2D40 A;  1AVB A;  3VBS A;  2Q8O A;  2PLV 2;  4MET A;  4ZU7 A;  3NAP C;  2EVX A;  3OY8 A;  4E2S A;  2VU9 A;  1D7P M;  3UYJ A;  3H8O A;  3OGV A;  4MZU A;  3VBH B;  2WSU A;  1QJY 3;  1OD5 A;  1TG7 A;  3PVO A;  4P9G A;  4DNY A;  1DGR A;  3C7H A;  4JAA A;  4Q26 A;  2B46 X;  3ALQ A;  4GH4 C;  5AC9 2;  3IM0 A;  2C6S A;  1D4M 2;  2ZGN A;  1O7F A;  1LOF C;  3X29 B;  5JDB A;  3ZN6 B;  1O3Q A;  4DO0 A;  1AHS A;  1PGW 1;  5F8P A;  5FPB A;  1JOD A;  3CBN A;  4TTG A;  4JZR A;  2VNO A;  5IVF A;  4FOV A;  2QFE A;  4WVZ A;  3WOG A;  1NX9 A;  4N9H A;  3ZO0 B;  3ZXD A;  4FP2 A;  4RA0 A;  5LA2 A;  3PUQ A;  3PJQ A;  1MVE A;  5AFB A;  1C5H A;  1XND A;  2JDZ A;  3MW2 A;  2Z5W A;  3WP4 A;  5FMC A;  3FHQ A;  3ZYP A;  1WZX A;  1YLL A;  4IEY A;  4KBB A;  5KXB A;  2WLP A;  2ES3 A;  2VZS A;  3KLS A;  4NRP A;  5FRE A;  4X8N A;  4F7Z A;  1RUE 1;  5E1R A;  2TEP A;  5J37 A;  4QB6 A;  3T2Q A;  2G9Z A;  1SPP B;  4ZU4 A;  2MEV 2;  3EJK A;  4P14 A;  4LBN A;  3HMY A;  1JXN A;  4AQS A;  1RJ8 A;  5F3G A;  4UF0 B;  3KF5 A;  5D8A B;  3T08 A;  2AUY A;  5FLI A;  3P7Z A;  2DU1 A;  2XKP A;  4GZ9 A;  2VXR A;  4BQW A;  2VZT A;  4DXR A;  2X29 A;  3OCP A;  4E27 A;  5FFO C;  4LIV A;  3GYD A;  4UFM A;  4HZF A;  3AZZ A;  5IVY A;  4IE5 A;  1R1A 1;  4JRA A;  2Q8E A;  3VD5 A;  2TUN A;  2A3W A;  3B7Z A;  1YEW A;  4OUS A;  4FPF A;  1MPX A;  4HXC A;  5IAV A;  3THT A;  2VUD A;  1JOP A;  4CUG A;  2L9L A;  1V6M A;  2RS1 3;  3K3O A;  4EZH A;  5GLU A;  5I0U A;  3PU8 A;  4NAM A;  1QJF A;  3ILF A;  1BEV 2;  2R0H A;  1V6K A;  2RDS A;  4JQT A;  3IPV B;  4NR1 A;  4UFH A;  1TMF 3;  3EO6 A;  2FCU A;  2P17 A;  1BJQ A;  4PLO A;  4CU8 A;  5CZK A;  4A4A A;  1ULF A;  1GSL A;  1K5M A;  2QQO A;  2ATF A;  4RHV 2;  1A34 A;  2ZGU A;  4CUB A;  2PHF A;  1W04 A;  3N3H A;  2JDU A;  2J7M A;  4YGB A;  4A7Y A;  1PX3 A;  4A7K A;  1Z78 A;  2VZO A;  1VRH 3;  3R4D B;  1LJ7 A;  3DF0 A;  4P5H A;  3ZXG A;  4MUV A;  3FMG A;  2UYA A;  3ZM8 A;  1LHU A;  3VBH A;  4GWI A;  1CX4 A;  4LOR A;  1ULD A;  4FOQ A;  2BJS A;  4CP0 A;  1LUL A;  2E7Q A;  3ZYB A;  4B7K A;  4QQL A;  3WEZ A;  3NAP B;  1AR8 3;  4FPL A;  1L7R A;  1O8S A;  3A0K A;  2W68 A;  2WN3 A;  3GZE A;  2O14 A;  2YRO A;  5JSO A;  2VG9 A;  2X10 A;  2RJK A;  1W6Q B;  4LA3 A;  2JG9 C;  2E6V A;  4BA6 A;  1H9W A;  2SLI A;  4QGL A;  3ZN6 A;  1UZZ A;  1QJX 3;  4LHN A;  4X8P A;  5F2S A;  5JOX A;  4LOS A;  3PVN A;  5FWE A;  2WS9 2;  2P37 A;  1Z7S 1;  5JXG A;  4GH4 B;  1SG3 A;  4TZD A;  3W21 A;  3RFR A;  1CIW A;  3WW3 A;  4OI4 A;  2BV4 A;  1MS5 A;  4CYD A;  3A4U A;  2R06 1;  2WZR 2;  1HQL A;  4BQ2 A;  1UZ0 A;  2HWD 3;  1JZ5 A;  2F4L A;  1XQN A;  2PHR A;  2PHU A;  4LKD A;  1RUI 1;  2NLR A;  5GAL A;  3GXU A;  1HJG A;  1QDO A;  1UWW A;  2ZHN A;  4QKD A;  2VMI A;  2W87 A;  1UPI A;  3JUU A;  3WV6 A;  4AYU A;  2QQM A;  3RRD A;  2OPK A;  1IGO A;  1H6Y A;  4HOO A;  3W20 A;  4XIK A;  1OOP C;  3E6B A;  4HVO A;  1H6X A;  3FX3 A;  5FZF A;  1VBD 3;  1K12 A;  2NYY A;  4UF0 A;  4XCA A;  5D8A A;  2BNN A;  1QXR A;  1FMD 3;  3LDB A;  2PTM A;  2RHP A;  4XUO A;  1AL2 3;  5IJR A;  4Q0Q A;  3G7D A;  2OXB A;  5T5J A;  5C7G A;  2MPF A;  3P3N A;  3WNN A;  1HDK A;  1RUC 1;  2PHL A;  4NRO A;  4RGG A;  4CDQ C;  1H1I A;  2QQI A;  4WM8 C;  5L19 A;  3FUQ A;  5CNA A;  4H2A A;  2PHX A;  1O4T A;  4K3U A;  5FZ3 A;  2QE3 A;  4EV0 A;  4NAO A;  1VBB 2;  1QF3 A;  1HIX A;  2JE9 A;  5FP7 A;  3HEI A;  5EIY B;  4OUE A;  2XLG A;  1UY0 A;  3AL6 A;  5H9P A;  1T6B X;  3MUY 1;  5LRR A;  4X6R B;  1NLS A;  1E5I A;  5AFE A;  2VZ1 A;  4HK8 A;  4ES8 A;  2WNV C;  3VDA A;  4FPG A;  3SNM A;  3IPV A;  5C6C A;  3ZIW A;  3KGL A;  4D69 A;  1US3 A;  3LF7 A;  4H14 A;  2VZQ A;  3SXW A;  3NRU A;  4BCU A;  3THC A;  3T0B A;  4LJH A;  2R1B A;  3MEP A;  3ZXE A;  1ULG A;  2A6X A;  1RHI 1;  3MV0 1;  1NA1 C;  1RUF 1;  4N43 C;  3THD A;  3RZH A;  1KRI A;  2RR1 3;  4LBO A;  1QNY A;  2PMW B;  1J83 A;  3H9A A;  1IQD C;  4IUG A;  2BGP A;  3WG3 A;  4DY5 A;  1GR3 A;  4AQ6 A;  1I5P A;  1GU3 A;  3ZX7 A;  1UOB A;  2C0Z A;  2WT1 A;  5H9S A;  2WL1 A;  4OFG A;  3VD4 A;  2XJT A;  4XUQ A;  4KU7 A;  1H1A A;  2UY9 A;  2CWM A;  2YUE A;  2BRT A;  3GHM A;  3M3O A;  4LXL A;  3NAP A;  1C8M 1;  2PYT A;  4GKY A;  2WFP A;  3MW3 A;  5L9R A;  1W3V A;  4LLO A;  2CAU A;  2HBT A;  5FPA A;  1W6Q A;  3IWZ A;  4S2G A;  1HN0 A;  5JIA A;  2FHR A;  3VLB B;  3WUD A;  3ZKU A;  3OGR A;  2W91 A;  3BTY A;  4FP3 A;  1BMV 2;  2P34 A;  3HT1 A;  4MHU A;  5EHD A;  4CA9 A;  1GP4 A;  1G6N A;  2DWR A;  2IVI B;  4GH4 A;  5A1F A;  1Q3E A;  2GU9 A;  2F6B A;  2JG9 B;  4AQ2 A;  2XON A;  3FJS A;  1LOF A;  2HWB 2;  2HWC 2;  4MXW B;  5JOY A;  5FR3 A;  4LNV A;  3W9A A;  4RFR B;  4ATF A;  2ZGT A;  4KG0 A;  1LR5 A;  5JOW A;  1WW6 A;  1NT0 A;  1UO9 A;  4Q4X 1;  2W1W A;  1EUT A;  5C33 A;  2HYX A;  2ET1 A;  5FPZ A;  5HPO A;  5GZG A;  3WR0 A;  4GB3 2;  4FO9 A;  3WDW A;  4IDZ A;  3U14 A;  2ZZQ A;  1WME A;  1KFX L;  2ZGO A;  4AWD A;  2E2X A;  1GWM A;  1YI7 A;  3NQH A;  2WZ8 A;  1PVC 1;  1W2N A;  2RM2 1;  2A6V A;  3N9M A;  2QQV A;  4WZF A;  3TEY A;  2VNR A;  4FQZ A;  2PAE A;  1OFS A;  3IBM A;  4XDO A;  2DFB A;  2JDY A;  3AC0 A;  4UW3 A;  3LPG A;  4YW1 A;  5AVA A;  5A1L A;  3J26 N;  4WV8 A;  1VAV A;  1OOP B;  2WAO A;  4XFA A;  3RS6 A;  5C3Q A;  3U11 A;  2P3J A;  2BP6 A;  4D6S A;  4AL9 A;  3ILN A;  4YW5 A;  1HRV 1;  1FPN 1;  1MQT C;  4QXK A;  1X82 A;  4IEW A;  4A2U A;  1CX1 A;  4D7Y A;  2HYK A;  2JDP A;  4WM8 B;  1HV1 A;  4B4R A;  3SKJ E;  2ZJC A;  2ZPX A;  3KB5 A;  3H3U A;  3QH6 A;  2YU2 A;  5FKC A;  4HFS A;  2ORX A;  1R08 2;  1LRH A;  4AVB A;  5JZG C;  1XB9 A;  4EN9 B;  4QDR A;  1UYP A;  3GJB A;  4QDS A;  3AMQ A;  3AKT A;  3T2T A;  4CZS A;  3VBR C;  1O4Z A;  2DF7 A;  1WWY A;  1RMU 3;  2RMU 2;  1LHN A;  4IGP A;  1ZRI A;  4NWV A;  1LHW A;  3C2U A;  4Y5T A;  3E1F 1;  2Y26 A;  3RI8 A;  3OD4 A;  2QUO A;  5FMB A;  3WP5 A;  4D0Q A;  4E4Z A;  3NKT A;  2XBO 1;  3VHO A;  3I54 A;  4Y20 B;  1NA1 B;  5GLZ A;  4AI3 A;  4AFM A;  1ZZ9 A;  1OKO A;  4CTE A;  1LCL A;  1TZO A;  2GP5 A;  3WQB A;  1OPO A;  5JIU A;  4NHK A;  4XZU G;  2VCC A;  3H0O A;  1W28 A;  2FDG A;  3DYM A;  2RS3 3;  1F5F A;  1W90 A;  4C8D A;  4F8A A;  3SKV A;  3A22 A;  1HXS 2;  4AK3 A;  4U36 A;  2VUC A;  1WCK A;  1N47 A;  2V73 A;  4PHZ A;  4DRR A;  3ZFF B;  1URX A;  4FFH A;  2JG9 A;  5LK5 A;  2OA2 A;  1PGL 2;  4W4Z A;  1RUH 3;  4OHZ A;  2ARC A;  2EIG A;  3IDE A;  1VBE 1;  4PT6 A;  5JMO A;  1RXF A;  5I0T A;  3I3Q A;  3U78 A;  3FUO A;  5CKN A;  2EIB A;  1DZQ A;  1S0B A;  4JDO A;  3B9C A;  5A6Q A;  1EPW A;  1JN2 P;  5A3O A;  3LA2 A;  3ACF A;  1W0P A;  3MIC A;  1HW5 A;  3CDZ B;  1SBF A;  1CR7 A;  1GIC A;  1RL3 A;  5M0T A;  1G8W A;  5CIS A;  3T1M A;  3BU0 A;  1QNW A;  1ENQ A;  1W8Z A;  4UWD A;  4XMA A;  1UD1 A;  1RUD 1;  3TEW A;  1JBC A;  1N3O A;  2VMF A;  3NNF A;  3Q8B A;  4C0B A;  1H8T C;  1SBD A;  1KEX A;  4G3Y C;  1AR9 1;  2WO2 A;  3UGG A;  4JDN A;  2NP0 A;  3I2I A;  3GZA A;  2HWE 1;  1XU2 A;  2Q1F A;  4QWN A;  4ZS2 A;  1MVQ A;  2JDM A;  1DQ0 A;  1OOP A;  3E5Q A;  5ISL A;  4ERO A;  1FI2 A;  1WLD A;  1VBC 2;  3OPW A;  2ID4 A;  1ZYB A;  1QOO A;  2WFF 3;  4I01 A;  4TWT A;  1UU4 A;  4QPY A;  4JKL A;  2BBA A;  2WSV A;  3IAQ A;  4WM8 A;  5F5A A;  4D6R A;  4NPM A;  1R09 1;  1MQT B;  2R06 3;  1ZBE 2;  5BNN A;  3DUI A;  2GNT A;  4AVT A;  5JPM B;  1BBT 2;  1I5Z A;  5FY9 A;  4Q0V A;  4NPL A;  4QU1 A;  4NWW A;  2QQW A;  3O0V A;  1W6M B;  1O59 A;  2VVE A;  5JZG B;  4ZKT B;  3KV4 A;  1GNY A;  5A7O A;  5DAX A;  3TN9 3;  4GMP 3;  5GZC A;  4F83 A;  3MI8 A;  1RIN A;  4EN6 B;  3KQR A;  3VBR B;  2WWU A;  4XF9 A;  4FOY A;  2XJU A;  1AR6 3;  1LOE A;  2QQJ A;  3QOP A;  3URF A;  4YW6 A;  3I3E A;  4Y20 A;  5A1A A;  1AJO A;  1NA1 A;  2F4P A;  2PXJ A;  1GNZ A;  3VB9 A;  5J3U A;  2ARB A;  4N7U A;  4Z2A A;  1U5X A;  5KXD A;  4L99 A;  2HWF 2;  3WY6 A;  5FPV A;  3KV9 A;  2A6W A;  3AJY A;  2WIN B;  1Z0H A;  4MSV A;  4XHX A;  5K9Y A;  2DFC A;  1S0F A;  2BWA A;  2WN2 A;  3POF A;  1DLL A;  3OBR A;  3RJ2 X;  4X6Q B;  2EXK A;  5CYY A;  1QQP 1;  1SHW B;  1XYO A;  3J9S A;  3I3B A;  1HX6 A;  3BPZ A;  3ZFF A;  5DG2 A;  3WF4 A;  1QHD A;  4C1W A;  3KQ4 B;  3A23 A;  3D6E A;  3BYW A;  1WW4 A;  1VBA 2;  1XE8 A;  3LAG A;  5FO9 B;  4SLI A;  5CAZ A;  3SH5 A;  1O3R A;  2BW8 A;  4QM8 A;  1ZBA 3;  4AHY A;  3O1S A;  1PO1 1;  3VN4 A;  3PMS A;  4ASL A;  5A3T A;  2VBD A;  1ULP A;  1ND2 B;  1VAL A;  1GZW B;  1QOS A;  4Q8L A;  4WBB A;  3OSD A;  4XFC A;  5KHG A;  1FNY A;  3Q8C A;  2NN8 A;  5GM0 A;  1SMV A;  3H8U A;  1S55 A;  2ZEW A;  5F39 A;  4QDQ A;  4V2V A;  5H9R A;  3ASI A;  1ZNP A;  4L8Q A;  4DMI A;  2JDH A;  3VKN A;  2NMO A;  3T4H B;  5I0R A;  2BZD A;  1QJY 1;  1XXN A;  1AF9 A;  4YFZ A;  1OFN A;  3DYP A;  1XRU A;  3JD7 2;  4UYB A;  3I97 A;  4BXS V;  5KHJ A;  2W52 A;  2JWP A;  3ACG A;  4V2W A;  1H8T B;  2WII B;  3N9Q A;  3UJQ A;  2CYF A;  1WBL A;  5D21 A;  3ZR5 A;  4O65 A;  3DYO A;  1VMH A;  1YHF A;  2JD4 A;  3D5O A;  1W0N A;  3KMH A;  1U5Y A;  3OGS A;  3DPR C;  4HPK B;  4QXC A;  4XUT A;  5EV7 A;  5T5P A;  4ASK A;  1VB4 A;  1V00 A;  2DUQ A;  1GYK A;  3POI A;  3OPZ A;  1SQ4 A;  2EXH A;  4HSL A;  5BUV A;  1MQT A;  1SAC A;  1B35 C;  2BTV C;  2R16 A;  1V0A A;  2RDN A;  2BYV E;  1DYO A;  4I3P A;  4QHB A;  4OHX A;  1SCS A;  5DUU A;  3RG0 A;  3TNQ A;  3VBS C;  4C91 A;  1UU5 A;  5FZ4 A;  3N36 A;  4ISQ A;  1CES A;  2YPJ A;  4BQ5 A;  1RUJ 3;  3WQ7 A;  2B8M A;  4D94 A;  4JHT A;  4XET A;  2WQZ C;  4XBQ A;  1W6M A;  3JBG 3;  3W59 A;  2WT2 A;  4JX0 A;  4KG8 A;  3LPF A;  1ASJ 3;  2OYZ A;  2HEW F;  4KL1 A;  3NL1 A;  4BLJ A;  1RJ7 A;  3VBR A;  1OVP A;  4IQP A;  3UK9 A;  3J7H A;  1CJP A;  1DP0 A;  3POJ A;  3ZSK A;  1J59 A;  2BNM A;  2RS5 3;  5F6K A;  3F2Z A;  2WWJ A;  1OQE A;  3OEA A;  4YG0 A;  2BER A;  2JKB A;  3NNM A;  1YYN A;  3H1M A;  4PBO A;  4AFC A;  1OKQ A;  4L11 A;  5FQ0 B;  1YNA A;  2JG8 C;  3POS A;  3BIE A;  3ILR A;  4UFL A;  2BOI A;  3INA A;  4BZ4 A;  4M0H A;  1PM7 A;  1HB1 A;  3M7A A;  2IWG B;  3T4V A;  1C3H A;  5FOB B;  3GCW A;  4LO5 B;  4N7I A;  2CGP A;  5K7P A;  2VQU A;  2RS1 1;  4JTN A;  5CA6 A;  1KFU L;  3KVA A;  1OA3 A;  1EAH 2;  2X09 A;  4N9I A;  1UOF A;  1W03 A;  1VP6 A;  5IYY A;  1SFN A;  1F31 A;  1RUG 2;  1A3K A;  1HB4 A;  4S2H A;  1C4R A;  4CP1 A;  4QX8 A;  1OXC A;  1TMF 1;  4UOJ A;  2D6L X;  1I1E A;  1TE1 B;  4AEM A;  4OMJ A;  5FZB A;  1ND2 A;  4UBG A;  3HAG A;  1GZW A;  1A8D A;  3OB8 A;  2DYC A;  3EYP A;  3NKG A;  4J25 A;  2OUJ A;  4WM7 C;  3OTF A;  2DVB A;  2OII A;  3B02 A;  1RIT A;  1VRH 1;  2Z79 A;  1DQ1 A;  4QXB A;  1FAY A;  2QQL A;  4RGA A;  4QB1 A;  4BQY A;  1GMM A;  4DFS A;  1UMZ A;  2HEV F;  1CWP A;  1FYU A;  1KXG A;  4PF5 A;  1CIY A;  1V9U 3;  1NY7 2;  2CV6 A;  4Q4V 2;  4AAX A;  4BHP A;  1AR8 1;  4Q27 A;  4FTS A;  1AYM 3;  4QHO A;  2XVK A;  2I2S A;  1H8T A;  2A73 B;  4ZY9 A;  5L7O C;  2WNO A;  1YRZ A;  4OVE A;  2YPD A;  1QJX 1;  4BOW A;  5IWF A;  4HPK A;  4QQO A;  3FL7 A;  3ELN A;  1FV3 A;  1LEN A;  4OYU A;  5EZW A;  4GWM A;  4LIU A;  2XL7 A;  4Q4W 3;  4FSJ A;  1MR5 A;  3AMP A;  1D0G A;  1AZD A;  4OI2 A;  5ACA 3;  2HWD 1;  1SFY A;  2EIC A;  3FHA A;  3PTY A;  3PIJ A;  4BQ1 A;  2B5H A;  3AXD A;  3OG2 A;  2H0B A;  5FPU A;  2J42 A;  1B35 B;  4YZ3 A;  4B29 A;  4BJ0 A;  1LTE A;  5C71 A;  2R07 3;  4IL7 A;  4CDU C;  3HJR A;  3KT1 A;  4IES A;  2Y6L A;  1PGW 2;  4BH9 A;  4XJ9 A;  4NJ4 A;  3PNA A;  4QPI C;  4TSV A;  1BZW A;  1OH3 A;  2XLA A;  1VBD 1;  2ZOE B;  3TEX A;  2ZGM A;  3AKR A;  4LBQ B;  4ARY A;  4BQ4 A;  1FMD 1;  2R1D A;  4CEW C;  1RVF 3;  4K20 A;  2VTF A;  1AL2 1;  1ZA7 A;  5EXO A;  4DB5 A;  1J58 A;  5KXE A;  5JOZ A;  2W39 A;  4R8H A;  3SIS A;  3I8T A;  5FQ0 A;  5BNP B;  2EA7 A;  2XQX A;  3UES A;  1RUE 2;  1VE0 A;  2ZS6 B;  5IVJ A;  2VR4 A;  1YIP A;  2J1E A;  1BK1 A;  2B42 B;  3U10 A;  1LU2 A;  4Y33 A;  1P8J A;  3OUH A;  1W2U A;  5FO8 B;  2JG8 B;  3JZV A;  2BQP A;  2TNF A;  1PX4 A;  1JU4 A;  4KI5 M;  5FY5 A;  4DOU A;  2F17 A;  2I45 A;  2BBV A;  2CGO A;  4F3J A;  3SEP A;  2BFU S;  4DIN B;  1PMJ X;  5C3P A;  4XAE A;  3ZDS A;  4BK5 A;  2BGC A;  2Y0I A;  3J8F 3;  3HR9 A;  1GFF 2;  4FCA A;  4GMP 0;  4AAP A;  2WNE A;  1W2A X;  1ZRD A;  1QJU 3;  3N9P A;  4QKN A;  4CEY A;  4Y4Y A;  4W6W A;  4H3W A;  4E2Q A;  4EN8 B;  5BYN A;  4CPB A;  2ZX4 A;  1R1A 2;  1KS5 A;  2RR1 1;  3NV3 A;  1WMD A;  1QMJ A;  4PLM A;  2FQP A;  5FYU A;  2CHH A;  1JHN A;  1H2N A;  1OF3 A;  3U0Z A;  4WM7 B;  3TAY A;  2ZTN A;  4COU A;  3PVE A;  1UOG A;  2B45 X;  5FUN A;  1SFP A;  2VQA A;  4GA9 A;  4BIF A;  5IHR A;  4QQH A;  5L36 A;  4LKS A;  1UIK A;  4FFI A;  4K1Y A;  4WVW A;  5GKA C;  3WDU A;  1H9P A;  3QAC A;  3S6P A;  3ZFE C;  3AP4 A;  1CZV A;  4YSF A;  5B4N A;  1PMI A;  3E6C C;  3VDD A;  4CU7 A;  3WUC A;  3MPB A;  3O1T A;  4ZZ8 A;  4XW3 A;  5FXZ A;  2Q30 A;  3V0B B;  2ZAH A;  5BXX A;  3WG4 A;  4UW4 A;  5L7O B;  4CCE A;  1AXY A;  2R32 A;  4XAA A;  5DMY A;  2XVG A;  3SCF A;  1W06 A;  3MV1 1;  5GLT A;  1RIR A;  5F32 A;  3N4M A;  4TN7 A;  5FUI A;  4CE8 A;  4OI1 A;  4NN0 A;  4W6X A;  3IB3 A;  2DBN A;  4XXA A;  1B35 A;  5DZG A;  3BOP A;  4J1X A;  1FAT A;  3ES4 A;  3FZ3 A;  4QPW A;  5FZ6 A;  2Q8D A;  3VZK A;  4AFD A;  3PVB B;  3VKF C;  1IPJ A;  2G19 A;  2LUW A;  4UI9 L;  1Z7S 2;  4Z8B A;  1DU3 D;  4MO3 M;  5FZ8 A;  3U4X A;  4S2D A;  3K4A A;  2VOV A;  1Q5O A;  2DTW A;  1RTV A;  2SBA A;  1N1V A;  4CDU B;  3UGF A;  4LBQ A;  3CEW A;  4XFF A;  4XE9 A;  4QPI B;  1JU3 A;  3F95 A;  2I07 B;  4AGR A;  5GJ6 A;  3W68 A;  1NAE A;  2QQK A;  3MLJ A;  2UYB A;  1IKQ A;  1RUI 2;  5BNP A;  1ZRR A;  5DAB A;  2EAA A;  4CEW B;  2O1Q A;  1JZ7 A;  2B9V A;  1EPZ A;  3IMM A;  1ZA4 A;  3HBZ A;  1D0H A;  1MEC 3;  3KGZ A;  4XBN A;  2KD7 A;  5HV4 A;  2JG8 A;  2LRO A;  2XJP A;  2XML A;  4LBM A;  1C5I A;  2YDE A;  1AR7 2;  3CMG A;  1LB2 A;  5FYV A;  2YC2 A;  4IEU A;  1DLC A;  3RPQ A;  1X9T A;  1STM A;  3MHZ A;  4GQ7 A;  4JVA A;  3GM8 A;  3NW4 A;  3SEE A;  3R05 A;  1RUC 2;  4QKB A;  1MS4 A;  3GGL A;  2XOM A;  1XYN A;  5GZF A;  4BDV B;  1AUY A;  5IVE A;  1QU0 A;  1RMU 1;  3AKQ A;  4FPK A;  2BUK A;  5A6Z A;  1COV 2;  2ZGQ A;  3AP5 A;  3ECQ A;  2PQQ A;  3LIH A;  1GQP A;  1E5H A;  1YWK A;  4IXL A;  5F6L B;  3ZPO A;  3FHI B;  2D6O X;  2OW4 A;  5GZE A;  5T50 A;  1S0J A;  2IXL A;  2VMG A;  4WM7 A;  4CCO A;  4XF4 A;  2VZP A;  1C1L A;  1ZM1 A;  3ZXL A;  2A5Z A;  4RD7 A;  4Q1P A;  3PJY A;  3LSD A;  2YYO A;  1Y43 B;  3O12 A;  4FAG A;  3HQX A;  1UYY A;  4EZ4 A;  1O3T A;  1APN A;  3S7E A;  3O7O A;  1JMU B;  1RHI 2;  2RS3 1;  3RZL A;  1RUF 2;  1XSR A;  2XJQ A;  5LA9 A;  4MOA A;  1G9C A;  2KXL A;  3V0B A;  2A71 A;  2IUW A;  3TWI A;  5J98 B;  1RUH 1;  4LLF A;  3ZFE B;  2TBV A;  3AP6 A;  1HQW A;  2QZ2 A;  3RYK A;  5L7O A;  1U5I A;  3ITQ A;  4GWN A;  4NE9 A;  4AFA A;  1FV2 A;  3AM2 A;  3DGT A;  4B1M A;  4IV3 A;  4QM9 A;  3ZYH A;  3P1I A;  1C8M 2;  1YIF A;  2VUL A;  3ABZ A;  1POV 3;  1C1F A;  3B74 A;  5A7S A;  1OA2 A;  2D4Q A;  2DU0 A;  4H7M A;  4AW7 A;  3CF6 E;  5LK7 B;  3FN9 A;  4YYO A;  5FZ1 A;  4NPR A;  1QWR A;  4XEZ A;  5ERL A;  4ES9 A;  4Z2W A;  4LQR A;  5FCC A;  5LY1 A;  4IEP A;  4CDU A;  1Y7B A;  2LRP A;  4JGZ C;  5A7W B;  3O0W A;  5EJ1 B;  3VZM A;  3OD0 A;  1OF4 A;  4QPI A;  2WT0 A;  1YQ6 A;  2QBX A;  1ODN A;  3G6J B;  4HG6 B;  4Q4X 2;  4V1P A;  2W5F A;  1UYZ A;  3C8X A;  1FT9 A;  4MGI E;  4XDQ A;  1W2T A;  3VHP A;  4CEW A;  2WFF 1;  1UY4 A;  1PIV 3;  4Q2F A;  3HBK A;  2NPI A;  3NO8 A;  4L9B A;  4TXW A;  1JTZ X;  4Q29 A;  4Q1R A;  3VZN A;  1PVC 2;  2RM2 2;  4D7S A;  4PF1 A;  2ZEX A;  1QGL A;  5FUP A;  1ZZ8 A;  1GWK A;  4LKE A;  1RXG A;  1UYX A;  1SBE A;  2WC2 A;  3U37 A;  5E16 A;  1SCR A;  4BM8 A;  2PQS A;  3NJV A;  4FT8 A;  3JB8 A;  1TNR A;  4QX0 A;  3UKV A;  4BK4 A;  5FWJ A;  1HRV 2;  3SMH A;  1FPN 2;  3LEM A;  3TN9 1;  1Q43 A;  4GMP 1;  1CON A;  5SV5 A;  3SCH A;  4AVV A;  5JXH A;  2XR4 A;  5DDJ 3;  5K0U C;  1O5U A;  4NHM A;  1AR6 1;  2IXH A;  1RUO A;  1W6N B;  4KWU A;  3WLU A;  3SCG A;  4YGC A;  1ODM A;  1NQD A;  4KGG A;  2YY1 A;  2IFW A;  2C1F A;  3DXU A;  5KHI A;  1F15 A;  5FOJ B;  3R4S A;  2HJI A;  3FFZ A;  2DV9 A;  1JS9 A;  3B69 A;  4MGQ A;  1AXZ A;  2A6Z A;  2H6B A;  2UWB A;  3ENR A;  2CU5 A;  2P6H A;  4QXH A;  4UT5 A;  3RDI A;  5BNN C;  3BUC A;  2CL2 A;  3E6D A;  4ZXK A;  3MLK A;  1O91 A;  1H8V A;  2A3Y A;  1ULE A;  3R4U A;  5A33 A;  1EV1 3;  3WNO A;  2RE9 A;  3BAL A;  5GZD A;  2J1R A;  4L2N A;  5CG8 A;  3ZFE A;  2P6C A;  3AJZ A;  4Z82 A;  1T2X A;  2XBO 2;  1JI6 A;  1PK6 C;  1NCR C;  2GP3 A;  3T30 A;  4DQA A;  3O1O A;  5ABJ C;  1WLW A;  3LA7 A;  1C57 A;  4R9D A;  3VKM A;  1ZBA 1;  1SLL A;  2X8K A;  5LAT A;  3LOB A;  5FYC A;  3FE5 A;  3WHU A;  1JYI A;  5DUX A;  3AKS A;  5JLV A;  4QQP A;  1ST8 A;  2NM1 A;  2VTX J;  1AJK A;  1ZX5 A;  2FDJ A;  4M00 A;  3WG2 A;  3BTA A;  1FNZ A;  1BHG A;  3N7L A;  4FTE A;  4I30 A;  1AYN 3;  3IDA A;  1LGC A;  3E97 A;  4IE0 A;  4Q0U A;  1VBE 2;  4XDP A;  5FY0 A;  4D7T A;  5A7W A;  1DGW X;  2JIG A;  1TME 3;  3R6S A;  4AVA A;  1JZ4 A;  5FZE A;  5C4W C;  4IE4 A;  5GLV A;  1WCS A;  4M0N A;  2GC1 A;  1CAV B;  3ZIX A;  2E32 A;  4JGZ B;  1W9F A;  5C3O A;  2GNB A;  5C8C C;  4GKX A;  1WMX A;  3PUH A;  4JQR A;  1W9W A;  3MIF A;  2JE8 A;  4ZPI A;  5G04 L;  4DZG A;  4E4H A;  5LWB A;  1VLN A;  3WX5 A;  3GBW A;  3JXS A;  1LOC A;  3ZSL A;  4YZ1 A;  3Q8F A;  4MGY E;  1RUD 2;  4NID A;  4COW A;  4LPL A;  2GZW A;  1AR9 2;  3JQX A;  5FZH A;  1OD3 A;  2HWE 2;  3PUI A;  3DXT A;  2Y38 A;  4YM1 A;  1RUJ 1;  3S30 A;  4Y26 A;  2NMN A;  2ZZJ A;  4XFI A;  1MS9 A;  3JBG 1;  1SLT A;  3OPT A;  4RHV 1;  3ZFG A;  1OC1 A;  1QXJ A;  2D93 A;  1JH5 A;  3N35 A;  5IW0 A;  1W6P B;  3BGA A;  3MIH A;  1ASJ 1;  3PL0 A;  4ASM B;  1LHV A;  4YLZ A;  4YM2 A;  2PEL A;  1FOD 3;  1W6N A;  2RS5 1;  1OI6 A;  1R09 2;  2ZAC A;  4XJZ A;  1N1Y A;  4I0A A;  1CAU A;  2E31 A;  3M1H A;  2CY6 A;  4N8M A;  4RR3 C;  3ZSJ A;  2AGS A;  1LGB A;  3WF1 A;  4IEV A;  1DDL A;  1QIQ A;  2QDR A;  2BVV A;  1DBN A;  5FV3 A;  1OVS A;  2G4I A;  1O4Y A;  5CFC A;  3CZU A;  1HB2 A;  1PO2 3;  3BOW A;  4C0H A;  2WA4 A;  4W65 A;  4IND A;  1GQH A;  1SDD B;  5CU1 A;  5FIX A;  4HN0 A;  4AI8 A;  4XVH A;  3N9O A;  3W58 A;  1GQG A;  3I2J A;  5CKM A;  2O8Q A;  2Z2S B;  1REE A;  2ILM A;  1XNT A;  4BIS A;  1BVV A;  5BNN B;  1CD3 G;  1HJF A;  4HVR A;  2ZMN A;  3N9L A;  2K46 A;  4LBK A;  2VGD A;  1W9T A;  4XJA A;  2WA3 A;  3VL8 A;  2WO7 A;  3J7L A;  5J36 A;  2W92 A;  3EB7 A;  3GBG A;  2VQT A;  5CB7 A;  1PK6 B;  1NCR B;  3AZX A;  2WAB A;  2W9X A;  2AAC A;  3GZT B;  1NZC A;  3BTX A;  4BB3 A;  1WKY A;  3AP7 A;  2QVS B;  1QQP 2;  1BVP 1;  2JDK A;  3SLI A;  2W1Q A;  1DQ6 A;  3JB4 C;  1CZT A;  1J84 A;  1S0C A;  4MVT A;  4Q4Y 3;  5EJZ B;  4KQ7 A;  4CRQ A;  3OUI A;  3Q9O A;  4A3Z A;  1JZ8 A;  1V9U 1;  1F4H A;  3LZZ A;  2ZGL A;  1AYM 1;  5IUQ A;  3BVC A;  1CAV A;  1PO1 2;  1Y9G A;  2WUH A;  3GBF A;  3SIT A;  2Y64 A;  4JGZ A;  2VME A;  1F35 A;  1X36 A;  3HN1 A;  2A6Y A;  4NVP A;  5C4W B;  1UIJ A;  1LES A;  4JHZ A;  2DVD A;  2XUM A;  4OMC A;  3UT0 A;  4KWL A;  1NZI A;  2XB6 C;  2XJR A;  4AZZ A;  1BCX A;  4XIL A;  4Q4W 1;  1ND2 C;  2B9U A;  4P9I A;  5C8C B;  2FBE A;  3B00 A;  1QJY 2;  4GJY A;  5ACA 1;  4K9S A;  1POV 0;  3VBU C;  3MW4 A;  4URA A;  4XUP A;  3C7E A;  4NOT A;  2QDN A;  3THP A;  3WCS A;  1Y3T A;  3KT4 A;  1YUD A;  2R04 3;  1ZRC A;  3KF3 A;  2KA3 A;  2R07 1;  2YBK A;  3LQC A;  4R9A A;  4LT5 A;  2BGO A;  3WDY A;  5A6Y A;  1W6P A;  4HT1 T;  3K3N A;  1WCU A;  2JDN A;  4CDW B;  4CVU A;  1OUR A;  2RDQ A;  3Q8A A;  2VXJ A;  5FRA A;  1WW7 A;  2VCM A;  4HSJ A;  4FPO B;  1RVF 1;  1QH6 A;  4I3G A;  4ZXE A;  1ZVF A;  3V56 A;  4COZ A;  2UWA A;  4DEV A;  1OLR A;  4Y24 A;  2C26 A;  5KBF A;  1XPW A;  3RZG A;  1ULO A;  2BNO A;  1RGS A;  3ACL A;  4JC1 A;  4RR3 B;  1SDW A;  3FBM A;  3VUO A;  3HNM A;  2J1T A;  1R1Z A;  3WXP A;  3WNK A;  3ZYF A;  1IS3 A;  3CKH A;  2DBI A;  1JZ2 A;  3ATG A;  4Z1V A;  1W3X A;  4AE2 A;  3AX4 A;  1BYH A;  3CO2 A;  2OZJ A;  3RGB A;  2Z69 A;  5FP8 A;  2BVB A;  3GJA A;  2IXK A;  3RJR A;  5K4L A;  3VL9 A;  2P3I A;  3J8F 1;  3O0X A;  5HCB A;  1ALY A;  4LO7 A;  3Q8E A;  1PK6 A;  1NCR A;  1QJU 1;  4HN1 A;  1AXK A;  3K4Z A;  3GNE A;  3CL1 A;  5EQU A;  2PLV 3;  5AVP A;  4CCM A;  4K40 A;  4UXA A;  1WD3 A;  1KQR A;  4KBZ A;  1HLC A;  2XG3 A;  1KJR A;  3OBT A;  1V6J A;  3I3D A;  3FWE A;  5IK4 A;  5T5L A;  4Y5S A;  1CAX B;  3LFM A;  4FOW A;  3ZYR A;  3H8X A;  3C7G A;  1GWL A;  2RS1 2;  2ZML A;  3ZR6 A;  3GCX A;  4LK6 A;  3QD6 A;  3O1U A;  3P3P A;  4QMA A;  5JXJ A;  3KV6 A;  4CIZ A;  1BKZ A;  3LOI A;  4EE2 A;  4QX7 A;  5AC9 3;  1D4M 3;  2WKK A;  2DDU A;  1TMF 2;  4OZO A;  2YGM A;  5F9T A;  2AC1 A;  1ZRF A;  1L3J A;  4LKF A;  2D6P A;  1Y9M A;  5C4W A;  1CAW B;  1UQX A;  1O8P A;  2VUA A;  2Y0O A;  2Y33 A;  4IET A;  1VRH 2;  4FPJ A;  1XE7 A;  5C8C A;  1YJK A;  3NMB A;  5FYZ A;  2PAK A;  4CEY C;  4DPN A;  2JIC A;  4YW4 A;  2Y6J A;  1T6G C;  3CJX A;  5J48 A;  4CU6 A;  3HVD A;  1AR8 2;  4KU8 A;  1X8M A;  2VOK A;  5C8W A;  1ZZ7 A;  2RVA A;  2R0F A;  4E4D X;  1R5L A;  2E33 A;  1MS3 A;  3TBD A;  3KM5 A;  3AYD A;  1WLC A;  1QJX 2;  2MEV 3;  2WQ4 A;  5DPN A;  3VBU B;  1SZB A;  3ES1 A;  3RMY A;  4J1W A;  3U07 A;  2BDR A;  4CDW A;  3VDB A;  2ZA9 A;  2A70 A;  3PHM A;  3LDK A;  1YQ8 A;  4IEZ A;  4DIQ A;  1YQ5 A;  5ABJ B;  4ZU5 A;  3VDD C;  4ONU A;  2EAL A;  1ENR A;  2IXJ A;  1G9D A;  2HWD 2;  5G05 L;  4ZON A;  2XDV A;  4OHV A;  4RR3 A;  3ZOI A;  4I0W B;  3AL5 A;  5FXV A;  3AFK A;  5D2A A;  1HXS 1;  4P9L A;  2OKX A;  4FMM A;  4LHS A;  5F5Q A;  1MEC 1;  2C9A A;  1LGN A;  2EID A;  3I2K A;  1JOB A;  5DZE A;  5C5U A;  1E5S A;  4G4F A;  1VBD 2;  1NUK A;  3I2H A;  3U1X A;  1BEV 3;  1FMD 2;  3KCX A;  1GLH A;  1OLQ A;  1JUH A;  2X05 A;  1AL2 2;  2QZ3 A;  4J7Q A;  3ROU A;  2JD9 A;  4FPH A;  3I49 A;  4LUL A;  1W9S A;  2VC9 A;  2AEY A;  3OUJ A;  4D3W A;  4RHV 3;  1QDC A;  3KSC A;  3RSJ A;  1LU1 A;  2R6Q A;  4XYX A;  1MZE A;  3AXE A;  4NIA A;  1NCQ C;  1ZZB A;  2VD7 A;  2YG0 A;  3FFQ A;  5BNP C;  2YB7 A;  1CGP A;  1CAX A;  5A7Q A;  2R30 A;  4PLN A;  1G9B A;  1IKP A;  4YW3 A;  3T0D A;  1SLI A;  4AI1 A;  3WF3 A;  2CAV A;  2Y34 A;  1VIW B;  2ZKN A;  5HXV A;  4N90 A;  5CIR A;  2LTN A;  1BLZ A;  2ADE A;  1LEM A;  1UU6 A;  4XFG A;  2WS9 3;  4XMI A;  5FZ0 A;  3BN6 A;  5SV8 A;  3WP3 A;  1CAW A;  2X5I C;  2RR1 2;  3M70 A;  5FBJ A;  1OIP A;  2J1V A;  3MO4 A;  2W95 A;  4KMQ A;  3MDP A;  5T52 A;  2E51 A;  1ZZ6 A;  4XF1 A;  1W8T A;  2WZR 3;  1B09 A;  1YQC A;  2ZX0 A;  4AG4 A;  5A3M A;  2ARA A;  4ZS3 A;  4CU9 A;  5BV6 A;  2IXC A;  1ONA A;  3H7Y A;  5F5I A;  4JV4 A;  3K48 A;  2C9K A;  1F9K A;  3PIG A;  2ARX A;  4D6Q A;  4QAW A;  1POV 1;  3WSO A;  1WCD J;  3WF0 A;  4CEY B;  3CU7 A;  3UNP A;  2ZEZ A;  4OHY A;  3VBU A;  2JB4 A;  5F3C A;  4NIH A;  3GF6 A;  1JYW A;  5FZK A;  5LBE A;  3NJX A;  4QT6 A;  4XHB A;  4MLO A;  3K75 B;  3N9N A;  5ABJ A;  4RSU A;  5T54 A;  5IFP A;  2RG4 A;  2VO5 A;  3POY A;  1UAI A;  1WUV A;  4GIQ A;  3O1V A;  5CKQ A;  2XH6 A;  5FYH A;  4I2O A;  1UMI A;  2VNG A;  3WDV A;  3KVB A;  5IAT A;  4YWA A;  4CPB D;  2ZGS A;  4UAP A;  3ZSE A;  1UZV A;  1VBB 3;  3VDD B;  2E7A A;  2G9G A;  2D3S A;  4ORF A;  1PIV 1;  4M3C F;  3ZXA C;  4PI2 A;  4IV3 C;  4LO6 B;  4Y4R A;  3IIA A;  3WW2 A;  1H4G A;  2VNV A;  4EN0 A;  4OMK A;  5LCW L;  3GAL A;  3RI9 A;  1CQ9 A;  1I6X A;  1YFX A;  1OUX A;  3MF6 A;  1DQ5 A;  1UOJ A;  1WD4 A;  2E53 A;  1LED A;  2WNU C;  3QBQ A;  4CSW A;  4AFB A;  1W9Y A;  2B4K A;  2BOJ A;  3I4I A;  2P3Y A;  3CQO A;  4EN7 B;  2K2S A;  1KJL A;  1ZRE A;  2ZHL A;  4KWK A;  3LA3 A;  4G9S B;  4R52 A;  5DDJ 1;  5FY7 A;  2XHN A;  4JDM A;  4AQT A;  2UU8 A;  3MF9 A;  4KH9 A;  2OS2 A;  2BEO A;  3TB0 A;  2VBB A;  4UBH A;  5FZ9 A;  1KD7 A;  1YQ2 A;  4I02 A;  2K0G A;  2Y6G A;  5FK8 A;  1ND3 C;  4FXG B;  4B3N A;  5DAP A;  1NCQ B;  1Q8P A;  2AYH A;  3DV8 A;  1WA6 X;  4OI0 A;  1US2 A;  1W8W A;  2O0O A;  4DY3 A;  4Y22 B;  2FZ2 A;  1KS4 A;  1KIT A;  5LEK A;  1EYB A;  2H6C A;  3CHX A;  1GZ9 A;  4XTP A;  2VOW A;  1RMU 2;  4QX5 A;  4BU2 A;  1V6N A;  2IZW A;  4PJY A;  2VOX A;  2IFR A;  1EV1 1;  4L0P A;  4LO8 A;  4LBQ D;  4UW6 A;  5FZI A;  2HWB 3;  2HWC 3;  3HNY M;  4JTO A;  3U75 A;  5LA1 A;  3KZ4 C;  3UJO A;  5LRS A;  3M3Q A;  3EBR A;  2DVG A;  1K45 A;  2GH8 A;  2J22 A;  1W8H A;  2VW0 A;  2D7F A;  2X5I B;  2ETE A;  4Z92 B;  4O61 A;  2JX9 A;  3RMX A;  5CAD A;  3PG7 A;  1F5J A;  3CZJ A;  4XFB A;  3IMN A;  4IE6 A;  4GB3 3;  1IPS A;  3VKL A;  4P9J A;  4M3C E;  4XOG A;  2QNK A;  5FY8 A;  4CCC A;  3NNJ A;  2WLQ A;  4XFH A;  2V4V A;  3ST7 A;  1RYY A;  3DCQ A;  1Y4W A;  3HQR A;  5FDB A;  2RS3 2;  1VAM A;  4M4R A;  2E63 A;  4QQ2 A;  5CFD C; 
#chains in the Genus database with same CATH homology
 3Q8G A;  3P7Z A;  3HY5 A;  1OLM A;  4UYB A;  3B74 A;  1OLM E;  2D4Q A;  1OIP A;  5LZ6 A;  3HX3 A;  3PEG A;  4M8Z A;  3W67 A;  1O6U A;  1AUA A;  1OIZ A;  3B7Z A;  3PG7 A;  4J7P A;  4OMJ A;  1R5L A;  4FMM A;  4CIZ A;  4OMK A;  2E2X A;  3W68 A;  3B7Q A;  3B7N A;  4CJ6 A;  4TLG A;  4J7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...