4TMPA

Crystal structure of af9 yeats bound to h3k9ac peptide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
138
Chain Sequence
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AF-9
publication title AF9 YEATS Domain Links Histone Acetylation to DOT1L-Mediated H3K79 Methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 138
sequence length 138
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4tmpA00
2NDGA 5IQLA 3RLSA 2L7EA 5HJBA 5IOKA 4TMPA 5HJDA 5D7EA 3QRLA 3FK3A 2NDFA
chains in the Genus database with same CATH superfamily
3PDDA 1I1FA 1KGWA 4RGNC 3WEXA 2FGWL 1LO0H 5C3TA 4UZGA 1YQ2A 4ZFOB 2FLMA 4N9GA 3GJFH 1CFSA 2CG9X 1D5MA 3O6FD 1AIFB 4G7VH 1ES0A 5D1QE 4CDHA 4HHAB 4F9LA 1T1WA 2Z91B 3VQMA 1NFIA 1YEEL 3O8XD 1C8PA 3HKZA 1U8OB 1YNKH 4OTXL 1HXMA 1HQ4B 2G4GA 2JJTA 4B9FA 3QR2A 3AVEA 3EFOA 4HKJB 4PTTB 3UTQA 3C60A 3VW3H 4BA8A 4GMTL 3OV6A 3D4ZA 5JHLA 3KPQA 5IBLC 4FQ1H 1ZA3A 4OAWA 1MCOH 2P8MA 4P2OC 4W6XB 3ECQA 4JY6B 1BVKA 4P5MA 2FSDA 1EXUB 4JRFA 5I19L 4NP4L 2C5DC 4K7FB 3NSYA 2AQSA 3D2UB 4FQLH 5KBDA 2Q20A 4KITB 4OV6F 3MR9B 4D3CH 2DTSA 1WGVA 1W9XA 3CZKA 5HGDA 3MO1A 3RDJA 1P1ZA 2J88H 3SCMD 5FECA 1FNLA 3QPQD 4NJAH 4CMHC 3GO1L 4U1KA 1E9PB 1IQWL 4GG6B 3BUQA 2A7BA 4QCIB 1JIBA 2EVIA 2UZIL 3MRGB 4TN9A 4YUEL 3HIZA 2TAAA 2KH2B 2ZAIA 1D9KC 2BZDA 2B8OT 2KQMA 1MHCB 2BINA 4R5TA 4EMZA 1LWJA 1A1MA 1RL1A 2BFVL 1MUJB 3H56A 4WAFA 1MRDL 1Q0EA 3F7VB 4JN1H 2VLKE 4NC1C 4BRJA 5EEXA 1CWVA 3UG4A 1EEQA 1KULA 1I1RA 4OZFH 2GSIB 1BLIA 1FZMA 1DBJH 3D09A 3QDME 3K7UA 5HHOB 2J55A 1A2YA 4Z0BL 3QIWA 4I18C 3BEVA 2RQEA 2JTYA 1YEIH 3GC3A 5I15H 1H19A 4LCUA 1CFMA 4AJ0A 1A7RH 1OHZA 1KBBA 3OAUH 4U6HA 1CDHA 3L9RA 4Y16B 1UHVA 2A9ML 2Q0ZX 4X6BA 3GXMA 1TCMA 5LAPA 4GG6F 1ZHBB 5MEOA 1W80A 3NCXA 2AJSL 4XB3A 1DYZA 5TGBB 3V5DB 3PWPD 1C08A 2OJZL 1JHKL 4LPTA 4X5XB 2BO0A 3D4GA 4P2OA 1ETB1 2BNQB 4I0PB 4QRPA 4GIAA 1KFAL 3BQUD 4POZD 5EUKA 2E4TA 2VJ8A 4X4YB 1XMEB 4ZRGA 3QNZA 5HHQA 2XWEA 3C87A 5CWSB 1JV2B 1LVEA 3MCYA 5F1IB 5E1GA 4X8GA 2DLHA 3VYOA 4I1NB 1R46A 4P48A 2ZZUT 1YMMA 1BWMA 5IJDC 4IOSA 3KPSB 4PJXB 3VWKB 5KSAC 4KPHL 1LEIA 2IAMD 4FMKA 3T4AC 3HN3A 5EORL 5DZJA 2YGQA 1I3RA 1IC1A 2WGXA 1Y1DA 1J1PH 1R17A 3BSZA 1D9KA 3IRCA 4FJZA 1UKTA 3AT9A 1MWAL 4C47A 5IMOB 4L3EE 2J2ZA 4PJIA 2CLRA 4OZIA 1E8YA 3F00A 4NO5B 4XR8C 2J8UF 4NQUA 1N5YH 5EF0A 4F7TA 3MRDB 3ULVE 1CCZA 1WG3A 1GZHC 2LFEA 1WD8A 1INEL 1KT2A 4C83B 2XIDA 2A2QT 4K4KA 1X9RA 3BE1H 3CD4A 3T1WA 3G5WA 1QSZA 1BQUA 1Z3GL 2JB5H 3BD4A 4X9GA 4I77L 3UABA 3C08H 4QAMB 3CVDA 4I18A 3WFHB 4DZBA 4BIKA 2VDNL 1EJOL 4ONHA 2AQ1A 4QOKA 3ZSSA 1O75A 4GQRA 1QEWA 3WKML 3AXLB 3D87B 4HZAA 3H9SB 3PCYA 4M8RA 3C6LD 3ARZA 5D4HA 1VFUA 4RGOL 3NZ8B 1ZMYA 3QFDA 5ALCH 1KYDA 2TRYA 1QNIA 2AAAA 2ZUSA 2ENYA 3D69B 1S7TA 4OCXL 5GZOD 4WW1B 4MA3B 2DLTA 5E99L 2WWKO 4JS7A 2ATKA 4BKLA 5KTEL 5H2BA 1DBBH 1CYWA 4QTIL 5EPMA 1A7PL 2IPKB 2Q7AA 1OB1B 4G6AD 4PW3A 1MG3C 1KFGA 5KSAA 1LK3H 4NI6A 3T4AA 2DM2A 3V6OC 5A2JH 3CFEB 3LS4L 2XVKA 1A4KB 3HLAB 4PJBB 1OAYL 5I0DA 4RAUA 5F21B 1XIWD 3SYOA 1FYHB 4ZFGH 4HS3A 1GYUA 1HXYB 4NUJA 2EDNA 5J89A 3HBQA 3ECBB 1RK7A 1AJ7H 5F93C 5JQIB 1JNLH 4WWKD 2JK5A 4DP1X 5BRZB 5AOJA 2FNBA 4KXCA 1GZHA 2H2PD 3K80A 3GSOB 3CFDA 4RISL 4YHOL 1E3ZA 5G4OA 4BQCA 3VFVB 4LK4A 1PDKA 3AC0A 2Z93A 4HSCX 4F7MA 4LBEA 1NCJA 2DQ6A 2RCSH 1DTUA 2HTLC 2X4PB 3K4ZA 5AVRB 1TFPA 5GHWL 4DZ8B 1TJHL 3GJFB 1BAFL 5DR5H 3S37H 3C6EA 1ASQA 3KPMB 3NCYP 3KZ8A 1BD2E 2D3NA 1KTBA 4GIOA 4PJBF 3ZL4L 4DUWA 4LSPL 1YYMH 3REWB 2BDNH 4D9RE 2ESVA 2JV6A 2AEOA 4G7RB 2DD8H 1B3JA 3MLYL 1VFOA 1YUHB 5GS3A 5A2IH 5ICZA 5FGCE 1VKXB 3L3OC 5TQ2L 4HX1B 2PCXA 2QQQA 3PG2A 1SN0A 1F1DA 2XQBL 1A7BA 3H9HB 5HI4C 2G0KA 4UWQB 4QR7A 5BJTA 2WMPB 2MQGA 1FNHA 1OGAD 3BAJA 3O45B 4Y19A 3ZDXE 1F90H 1G9NL 4NZTL 1N59B 4PJ8B 2WQAA 3V6OA 5KWYC 4CSPA 5IQ7H 1JZ7A 4WUUB 3Q0HA 1JP5A 4MCYB 4KTDH 5T1DL 5GRVL 3CFBA 3UPRB 3GHPA 4PLKD 4X7FC 1EDYA 4LP4A 1OCWH 4OGXH 3U7WL 3SDXE 1K9TA 3QQ3B 5AWNH 5GS0H 2YPLA 4I0KA 3S8WA 4XN9A 4XN1A 4PS4H 3KMDA 2BIOA 1FAKT 4NAMA 2YPVH 1SN2A 1BIIB 1BM7A 4XX5A 3POHA 3LDBB 1U2HA 5LCVA 4JO3H 3DK2A 4NO0A 4P23D 4N0CD 2XBZA 1AYRA 4OM1H 2WVUA 5AENA 1S6NA 4HEME 1IBGL 2J73A 4Q52A 4JRYD 5C07B 3FFCA 2O5YH 4OZFB 3Q06A 8PAZA 1NKGA 4CU8A 1GL4B 1WHOA 4NWTL 5F6HJ 4I48A 1F3RB 5EO9B 3QBTB 2AJZA 3FTSA 2VDRL 3DECA 4K5OA 4YSPA 5PAZA 5JXEC 2O5ZL 2LVCA 3PV7A 4KXBA 3WENA 1MCEA 3OKLA 5FDYA 4AVHA 3QJOA 5I1IL 15C8L 4H88H 3L3OA 3SD5A 1NGYA 2KI6A 1QUNA 2X3CA 3AWFA 2YEZA 3NJIA 2VQTA 3WXVH 5J6GB 2J6WA 1E4JA 1KY6A 1ZY9A 3UAEA 3PP4H 1JXJA 4FFTA 1A14L 4JPIA 4OLZH 4U3SA 1OARL 3LKOA 1U8CA 2QJDA 4O02A 4R26H 4JLRA 2QV4A 3W39B 4R7DB 3W9DB 4N8CH 3JV5A 4XAWL 3KLQA 2AKRA 2RHEA 4RIRB 3V4PH 2ITDA 3DSNB 1ORSB 1ETZA 1KBVA 2CDFB 3V6ZA 4ABWA 4CVZB 1KN2L 3TURA 3HNTH 4ODSL 4OZHE 5JPNB 3RKDD 5LG6A 1II4E 3PXHA 3RWJB 1JSYA 4HAFA 4M6OL 1L4IA 1N0XH 3VI4E 1Q1JH 4XBPB 2FD6H 3U7AA 4KTGA 3HN8A 1SJXA 4ZFOA 1TTCA 3DK0A 2PCFB 1A1OB 3KXFD 4DNLA 2DQTH 2GUOB 2IMNA 4V2CB 4XCCH 4AENB 1AIFA 1A7NL 4TUUA 1SUJA 2DBLL 2N1KA 5I76B 4HHAA 2Z91A 4HJ0D 3PGDB 1IAKB 1U8OA 1C16B 1HQ4A 1T83C 2D3LA 2VR5A 3QQDB 1KCSL 2QVTA 5D2LB 1MN4A 4HKJA 2WLYA 4PTTA 5JXEA 2G3ZA 3HE6B 4Y16C 3W2DH 3TZVB 3QI9D 2PCPB 5KZCD 2CUIA 4B9YA 1SM3L 1UOLA 3PAVA 4LU5L 2EKJA 3OAYH 1DBAH 4XCYB 5T1KD 5DRZB 4I0PC 4JY6A 5HI3C 4OI8A 3B5GA 1AG6A 1EXUA 1WTLA 4JUTA 5T5FL 4K7FA 1UM5L 4CA4A 1E6OH 3D2UA 4H0GA 4NJ9H 2TRHA 3O4LD 1MIEH 4Y5VB 2KT6A 3OR6B 4RX4D 1JZ8A 2B1AH 3MR9A 3FO0L 3EYVB 4E9SA 5C0BB 4QGYA 1E9PA 1BVNP 1S7RB 2DQUL 3R1GH 4YVNA 2Y7QB 2Z4QB 1P69B 2Q8AL 3VWKC 1H6TA 4GG6A 4QCIA 4PY8J 1YRKA 3MRGA 4YLCA 1DR9A 5C9KA 1WUZA 1W6LA 3CK0L 1MHCA 3V4UH 5D6CB 3EGXB 3LMJH 5D2LF 1EFXB 4X4XB 5D1XB 1TQSA 2PWFA 2XWBB 3CFNA 3S3BB 2J6EH 3SE8H 4BUGA 4DEUA 2FWOB 1MUJA 4TTDC 5LNEA 3F7VA 2BP3A 3GRWA 1AGEB 4HIXH 2KUTA 4B97A 4YX2H 5T5NG 5ABDE 3N55A 1JERA 1OE1A 4D2NA 2Q1EA 2GSIA 2CNZA 4JY4B 5HHOA 2EQDA 4DUVA 3A6OA 5BZXA 4MJ4A 5E56A 1T83A 3MCLH 4NQCE 1F8TH 4Y16A 4JB9H 3RAJH 5MP6H 2WO2B 1ZHBA 5E4EB 5TGBA 3V5DA 1O7DC 1ECYA 2ZE0A 4X5XA 1OAQH 2BNQA 1E8ZA 3E7JA 3ETBF 3O0RL 1PLCA 5GGRY 4I0PA 4IBQA 2QQLH 4MXQC 2Z8WC 2DICA 4A2DA 4X4YA 2LTQB 4A2GA 3C2SA 3QWRD 2QR0B 3V95A 4FI6A 5CWSA 3R06B 1JV2A 1P6FA 2FQEA 1L5GB 1EANA 4UZUA 5F1IA 4FRWA 4QXWA 4YO0B 2HFTA 2YD8A 3JZYA 1I53A 3KPSA 4PJXA 3VWKA 4C56E 2X70B 5CU9A 4B5ZA 3SKOB 2BWIA 1MRCL 3AQYA 3WNIA 3CLWA 3CVHL 1QFPA 2YMXH 2LU3A 1SYVB 3ZVVA 5BZWB 1AIZA 5IMOA 2VXUL 4NO5A 2WXMA 4FFYA 4JPQA 5DO2C 4JJOA 1A7QH 4OB5L 4CVXB 3DKHA 3MRDA 3H42H 3U4BL 4G80B 5GJSH 1UASA 4WFFE 4C83A 2DQHH 1EHLH 1XH3B 4ZZKA 3NPSB 4OZGE 4OI7A 1IBFA 4XNZB 3BDYH 1S9KC 2IQ9H 5FUZH 3BP4B 3WFHA 1O7VA 1JXKA 1IC7L 3IDJB 5CNHA 3X3GL 3VXRB 1EHKB 2VABB 4JFFB 3ZYJA 3AXLA 3WYRA 1WD9A 2HLFC 1T2QH 3NIDF 3H9SA 4YZFE 2BXZA 4XN7A 3BFOA 4X7SH 2EE6A 5F7EH 1FNFA 2G60H 3A24A 3NZ8A 4NGHL 3BMWA 2IOMA 2Z1KA 1M9SA 3D69A 5LXGH 1I1YB 1XGYL 1JDDA 4J28A 1B9ZA 4WW1A 4MA3A 4RMWA 5J06A 2YMOA 1V05A 4WSGA 3NTCH 5DD0L 3WSQL 1N6QH 4KV5E 5C09B 5I5IA 2F54D 3VRJB 2IPKA 4UIMB 5D72L 4DK6A 3QS3A 4UT6H 1OB1A 1OGSA 3FU7B 1QD0A 3DJRA 4QHUB 2KL6A 4PJ8C 4NC2B 2BS71 3CFEA 4PJBA 1A4KA 3HLAA 4WJ5B 4XNAA 1NOAA 4HK3J 3P3SA 1WFJA 1KGYE 2AK1H 4L0ZA 4HGWB 1HXYA 3O81A 1I85C 2UWEE 3ECBA 3BSGA 5A16B 5I6NA 2XYCA 1YJDH 3HUJB 4N85A 4J27A 5BRZA 5E4AA 5I1HL 4KJYB 3V4PB 2QVFB 1HNYA 1CBVH 4IBSA 2HVBA 3GSOA 3LHPH 3PPEA 1OXYA 3VFVA 1A7OH 1I31A 1CD8A 3WKQA 3FHQA 5K39B 5SWSE 5L6YL 5IK3B 3LDBC 2JIXD 5F8RC 4P59H 3KBHE 4DQOH 5FYLH 4X80H 2X4PA 3X13B 3B2MA 3QYNA 3SHSA 1IV8A 1WWCA 4DZ8A 3GLEA 4ES9A 3GJFA 4KC3B 3UP6A 3PE9A 5K5YA 4MMZB 3QUZB 3LZPA 1RJZB 1EO8H 3KR3H 3KPMA 4DGIL 2C1PB 4N87A 4LSUH 2WYHA 4HIEB 2CHWA 1JAEA 3VGDA 1NINA 2HRLA 3WUWB 3REWA 2WYIA 3QIWD 4ZTPH 4W93A 4MB5A 4N24A 4IRZL 1YUHA 3VFMB 4UU9B 7FABL 1VKXA 3MRKB 3EYUL 4HX1A 2G30A 3AMLA 1RJYB 3H9HA 2FQDA 2XQYK 4LQFL 4JFEB 4OCYH 3KYNB 4YHYB 2WMPA 1A4CA 3O45A 3CFTA 5J12B 1C12B 5DFAA 2QDVA 3T3PB 4JKPL 3LQAH 1RFDH 5DLMH 1N59A 4PJ8A 2J3SA 4IOFC 3BAYA 4P2OD 1OOWA 4NAJA 1FCCA 4QRPD 2JKIS 4WUUA 1E5YA 4MCYA 5DC4B 3RVVD 3ECUA 5F7FA 3N1FC 3UPRA 4DP0X 1I85A 4BE5A 2Y1AA 4L1DA 2B15A 2OZNA 1CB4A 1TJIL 3QQ3A 4S1DC 4WNJA 4GSDL 1E7UA 1SBSH 2NY7L 4N2OA 3N40F 4F93B 5T33H 1WFNA 4AJVA 1BIIA 2JI1A 2XCMC 3KEHA 3MV9E 4P2QE 1DQQB 1V55B 1I3GL 4MZIA 3CZJA 3L4UA 4GSRA 1A4JB 3LKSB 5C07A 3R8QA 4DK3A 4OZFA 2EVHA 3QJFB 3LZFH 3GKZA 5GGSB 3T3PF 1I8KB 4NWUH 4PLJC 3UMNA 1JPGB 2X09A 2QT6A 1IFHL 2WB1A 4I89A 5EO9A 3RHWK 2BP8B 3B9DA 1HKLL 3U46B 1PZ2A 4Y7MA 1D2PA 3GT6A 4M8VA 3HE6C 3TZVC 4JO2H 1RK0B 4WLCA 3BAEH 3ZX1A 4G7YH 4KK5D 5IHLB 4KQ3H 3V7MA 1AQDB 4OLVH 4XMLL 3KYAA 1QBLH 4FQXB 6PAZA 2HT4C 5MI0B 3EH5B 2VUOA 4JRXB 1GAFL 2PETA 3SDYL 5EEWA 2WO4A 5J6GA 5C1MB 2P8LB 4YHML 3EFDL 3NCMA 4Y5VC 2ZKYA 3ZJAA 5IT2H 2ED7A 1A22B 1ZK5A 2JKRM 1UVQB 4M5YH 1C7SA 3VRLF 3W39A 4R7DA 3W9DA 4HH8A 4ZFFB 1LO3H 1BPLB 4RIRA 3DSNA 4NYLB 2BVPB 1ORSA 2JTDA 2CDFA 4EIUA 4K7PX 4LEXL 4CVZA 3ZUCA 4HCIA 4UB0H 5JPNA 5D1XC 2FO8A 2R69L 3GJFK 1HVXA 3RWJA 2Q2EB 3A5VA 1HQRB 4XBPA 5CJBA 4KO7A 3WFEH 4CN4A 4WZ9A 4F92B 2GT9B 1KELH 2Z7WA 2PCFA 4JEGB 1A1OA 3VDCA 1V3JA 5KOMC 2GUOA 3W0WD 4AENA 4ZUUB 5C92A 5HGBB 5I76A 4LL9A 2C8NA 3PGDA 4NQSB 2HJFB 1IAKA 2BSDA 1C16A 5DA4A 3QQDA 5D2LA 4JMNA 3HE6A 2AJYH 4WI9A 5LDSA 3TZVA 5E4EC 3UTZB 5FHAL 5BRQA 2PCPA 1QEXA 4EZKA 5HHMB 2AXGB 2E8ZA 4HJIA 2R4SH 4XCYA 2P45B 4FQJL 1HINH 1QSEE 2D2OA 5DRZA 1IC0A 5F0LB 4TYUA 2YUWA 4OLUL 5AOLA 2FNWA 2LTQC 3S98A 1UXLA 2ATPB 5FYJL 2LLGA 4Y5VA 2TSAA 4QY8B 5FWQA 3OR6A 5KW9H 2PTVA 2HFGL 2ESVD 4M62H 3EYVA 5KVDE 5C0BA 4WVRA 1S7RA 2Y7QA 2Z4QA 2VJ0A 2YD5A 4XTRD 1QWHA 2FECL 3UC0L 2KZWA 5LGHH 1BVOA 1R5VB 5DU7A 3TIEB 2C34A 1IT9L 2WBXA 1R4XA 4Y19D 5D6CA 1NFAA 1EFXA 2ZYIA 3MUY1 2WZ0A 4X4XA 5D1XA 1SEBA 2XWBA 5F44A 2LAGB 5D7LD 2ZUVA 3QUYB 2FWOA 1KGIA 4XP5H 2TSBA 4OSUL 1AGEA 3LRLA 4E41D 2CGYA 2DI8A 2HT2C 5EUOE 3AAZB 5GS0C 3WL9B 5JIMA 3NPSC 3CFCL 4HS8H 4JCMA 1OIOA 4AITA 3V0FA 1OHQA 5F7MC 4XNZC 4JY4A 4I3RH 1TYJA 1D7BA 1KJ2L 2K3HA 3PJLA 1SLUA 4RGMB 1AOZA 4LSVL 3NESA 3WLBB 1A21A 1B6UA 3OC8A 2BY3A 2BFGA 2R1XB 2BWQA 2DI7A 3V4VL 2EE9A 1WS8A 2A9NH 3DO3A 3OMIB 4Y1AB 3T2OA 2GTQA 4GW5B 5DEZA 1N18A 5AVZB 5FUCE 3KHQA 1G5AA 1MF2H 5DD5H 4ALAH 2F19H 2QR0A 2VLMD 1GPOL 3R06A 2OLDA 1L5GA 1U6AL 4OZFG 3V2AR 5J5EA 1S7SB 4YO0A 3SGKA 1SVCP 3M8OH 1EERB 4M7KH 2V7NB 2Q76B 35C8L 3K3QA 2X70A 3AQXA 3SKOA 3J2PA 2VR3A 4AG4H 1SYVA 5DHDA 2OMZB 4M6MH 5BZWA 3EYSH 1QFOA 2XY1A 2YD1A 4HU2A 1K5WA 4OQTH 4FXTA 4Y9CA 5CZKA 4JM2B 3SJVB 4CVXA 1FVEB 4N2NA 4LAQH 5E2WH 1SPDA 1GJIA 4G80A 2VW4A 5A1AA 1OAXL 2X4NB 1XH3A 3VTMA 1I9IH 2V5SA 4TSBH 1JZDC 4BZYA 2YPVA 1YSOA 1Z0MA 3EDJA 3BP4A 5IJCC 1A0QL 1SOQA 2R4RH 3IDJA 3KHOA 4NQXB 4XNXL 3VXRA 1HYSD 2VABA 4JFFA 4P99A 3QUZC 3IGAB 1ET5A 2E59A 1BMWA 4I9WD 1IARB 2IH8A 2AI0H 3IDYC 4M48H 1T1XB 3ZL1A 3R8BB 1EO7A 4XXWA 2FZ3B 2GCYB 4HKZB 1E3XA 5E6SB 2W07B 1JGLH 1I1YA 4GSUA 1CVRA 2BIMA 4HUCA 1YEFL 2J4WH 5FO9B 4JM2F 4Z76B 3FUNA 3HMWL 3SOBH 3LKNB 5DD6B 5F7BA 5C09A 3MNZB 1OAKL 1EVTC 3VRJA 1JWSB 1ZTXH 2MSPA 4JUSA 4UIMA 4XNBA 4A55A 4YHYC 5K9OB 2D73A 1BBDH 5J12C 4DP9X 3VGHA 4CKQA 1GC1H 3FU7A 1CLCA 3WN5B 4HWZB 4PPTA 4DW2H 4QHUA 2OYMA 5EZLB 5EF2A 3JBG7 5CHNB 4WJ5A 3VFGH 3A6CL 4DVBA 4AM0B 5EDSA 3H8NA 2EDMA 3D2UD 1GYCA 3VD7A 3WNMA 2CKBH 4W9CC 1TZIB 4HGWA 4MNQB 5IB1B 3ZHDA 3ESNA 5CILH 5A16A 2D7PA 3HUJA 3QXWA 3SDCD 3WDHA 3ULAB 1J9QA 1KV3A 2YAHA 4KJYA 3V4PA 2JKWA 4BGLA 1BAGA 3F5WB 3ILQD 4I5BB 2WNKA 2EYRB 3ERXA 3GUTB 2B16A 2ZX6A 4Q6KA 4B0MM 1MCPH 5K39A 2Y9RT 4OF5A 5IK3A 1SOSA 3L3KB 5GZND 1UGKA 4FS0A 3IWUA 4LOUD 3LXUX 4WUKH 4N6RB 3PGCB 3X13A 3IMSA 1IC5L 3IPEA 4UMSA 4U2YA 3GS0A 2GJZB 4MMZA 3QUZA 1RJZA 1OPGH 2C1PA 1X5IA 4H4NA 4HIEA 5D5MB 4X42A 2CRZA 1U92B 4HOXA 5HHOD 2M1KA 3WUWA 1EA9C 1KXTB 4Z7UB 4XNYH 1NJ9B 1Y1UA 5D8JL 4ZMZA 2PWEA 3IYLW 3VFMA 1FRGL 2AZUA 1KCUL 4UU9A 4FQXC 3MRKA 2APSA 5MI0C 1RJYA 1HCFX 1S78C 2AK4E 5EU6D 1MW3A 4JFEA 3WIHH 3BCFA 3KYNA 4HIJB 3QR0A 3MZTA 1BPVA 1ECZA 4OLYL 2E9WA 1MKFA 5I74B 2WIIB 3U4EB 2H5UA 1QASA 4NQTA 4A2LA 4BHUI 4LCCB 1WH0A 1TQUA 5HI3D 3C12A 3WXWH 2AQ3A 1RVFH 4WTWA 4OCRH 2XTJE 4WSJA 1AS8A 1B4JL 3ZE2B 4ZX6A 5SWZD 1OCCB 3P73B 5KANG 4M3JA 1RUML 5FR3A 2WQUA 4YSCA 3K6SB 3ALWA 4R5XA 4RGNE 4JY5L 4Z7WB 4HV8B 1E5ZA 4Z7UF 3GEWB 5MEND 1Q0XH 1QFWH 2J6EA 3KPPB 1DQQA 2AJXH 4V1DB 5A40E 4ZUTB 2FHCA 5HVGB 3IN0A 4HQQH 2WTOA 1X5MA 4UQ3B 4H0LC 5E5LA 3LKRB 5I1CL 1A4JA 3A3YB 3LKSA 5DRNB 1X9QA 3QJFA 5GGSA 1E0OB 1I8KA 3X1EA 1JPGA 1MHEB 3B7UX 3JVGC 3QZLA 3CXHK 4LLYB 5JA9A 2BP8A 5FCSH 3U46A 2IFFH 4FXKB 4DAGL 1VAHA 1V10A 3L2NA 4LPCA 4GSQA 1RK0A 4UT9H 3IMBA 4KVCL 5I8EB 2FLBT 3QT2A 1AQDA 4W9FC 4QRPE 4GEIA 5HVWA 4X6CF 1HHKB 4FQXA 2F53D 5I1JH 2XWZA 4JRXA 4Z7WF 5JHMA 4HK3N 2ETWA 1TQTA 2P8LA 3EOYG 1KBGH 4WK2B 1OV8A 1YMME 2OJ1A 5AAWC 4GUQA 2NQCA 4M5TA 3ZKMD 5JW4R 4GAJH 1QPXA 5FHBL 2L7UA 3UTSB 1X44A 1SOXA 2DIBA 1UVQA 4JDTL 1AY1H 4MXQD 5L4MA 3B2VH 2I7SA 2QVIA 4ZFFA 2E6PA 4OZIE 1WCQA 5CEZE 1G1OA 1QA9B 2YHGA 3MUJA 5D71H 4NYLA 2BVPA 2PO6D 3PP3K 4FP8L 1KCWA 4PEEA 2G3MA 6FABL 4JHWH 4X7TB 5DVLA 4NC1E 3ZE1E 1C5BL 3QUYC 1N68A 5F1OB 1T1YB 1YJDC 2W0FB 2Y6TE 1HQRA 1NWOA 1QFWM 3NBNA 3DYMA 1C7TA 4WHCA 4UZSA 3PFUA 4XPAH 2DYPB 2GT9A 2CJSA 2VAJA 1NICA 4B0MB 1TQWA 2DTMH 4JHAL 4AOFA 3DPDA 4L05A 1JTPA 2HLAB 4QOKE 1U2YA 1CDJA 2X2YA 2X89A 4ZUUA 3ZRCC 5HGBA 1K85A 5LNDA 3TXAA 1VDGA 2X1WL 3QH3B 3GNMH 2HJFA 3JVGA 4NQSA 4RGMC 4YDIH 1R0AH 2WZAA 4LE8A 2KERA 3WFDL 3OAYK 2FYYB 4TNGA 2WY3B 3UTZA 5JMRA 4H8QA 5A2LH 3HI6H 1R47A 1LEGB 2AP2A 1ZPUA 1MRFH 2AXGA 1E43A 3I6GB 5IQMA 2HLFD 2LU5A 1N4XH 1MWOA 2A38A 4WI8A 5CCHE 1KLUB 5K1VA 5BQ7B 4YGVB 3KYOB 2ATPA 4X6DB 4DESA 3DX8B 4QY8A 4OF7A 5DTFB 3DBSA 5ANMB 1MSPA 2IO5A 2R0LL 3P30L 4UT6A 2W81C 4FZEL 3VFRB 5JQ6L 2WGNB 4U0QB 2FBJH 2AZAA 1RPKA 2ZG1A 1R5VA 5C3LD 2ADFL 3TIEA 4OI9A 3JT2A 1T6VN 4I4WB 3DJTA 4L9LB 4CN6A 5BZDB 4G11A 1OTUD 5A6MA 1GGTA 4XVSL 3O3EB 3VFWB 4OIIL 2CKBB 4JM2C 2NLJB 4P4KB 1AGDB 3OJVC 3QUYA 4KMTH 5L7XH 1OAUL 4WUUD 1LO4L 1CR9L 3AAZA 4PRBB 2DEXX 3WL9A 4HOZA 4LHQB 3ZSTA 3WY3A 4P5SA 1AG0A 3S36X 4YEEA 4TSAH 3GMRB 1J8SA 1CZ8H 2IEPA 4WI2A 4FI8A 3KS0H 6CGTA 3ARXA 3WLBA 3JV0A 1PLAA 4A68A 1OAZH 2XIBA 4RNRB 5HGHB 2R1XA 1BG1A 4DKAA 4JR9L 4JPWH 4TL4A 2GTWB 2E9IA 4LGPB 4Y1AA 1JCKA 4J3OH 3OKKB 2WZPD 3M88A 5FYJU 3ATBA 4GW5A 1DBMH 3T0DA 1HFUA 2QPUA 4ORGB 1DQTA 1JWUB 1QWNA 4FG0A 5EU4B 3B2PA 2ED6A 2V7HB 4TTGA 4Y19E 5INDB 1TVDA 2R0ZL 4DN4H 1S7SA 3S7GA 1VRSA 5EFIB 3V6OE 5DURB 2V7NA 1ZA6B 4AC4A 2PABA 3WN5C 4MQ7B 2Q76A 2DLEA 3X1FA 1U8JB 2X9WA 1TUPA 2MWCA 3N3EA 1NBYB 4S1QL 1FLRH 2N1TE 1D7DA 2AFNA 2OMZA 2ZCKH 4LKCA 1JTOA 2X0VA 1NL0L 1R3IL 2P5WD 2YPLE 3JVFC 4JM2A 3SJVA 3B1UA 1FVEA 3FL7A 1HIML 1WICA 3HTLX 5FFOA 3ZKQD 1IBZA 4ADGA 2V17H 2X4NA 1U2CA 1J1OL 4HZ1A 2UY7B 1ZDQA 1ZVNA 2H2SC 2DKMA 1HU8A 1QRNB 5CGMA 5C0AD 3FFCE 1P4IL 3NIGB 2FT8A 3APDA 4NQXA 1JYNA 4DFIA 3IU4H 3IGAA 1A6PA 1UUSA 2B4CL 1ED3B 4BJLA 1N3NB 3L4CA 4N8VB 3VQ2C 2BRRH 1T1XA 1BW8A 2FZ3A 2GCYA 2F74B 4HKZA 5TJWK 5HHXH 1E9QB 2HKFL 2W07A 1OVZA 3NJLA 1RZ8B 5FO9A 5TK2A 4WWPA 4Z76A 1SVZA 4BFOA 1NCWH 3LKNA 5DD6A 1CIUA 4J3TA 4K2UH 1UC6A 1J5OH 3MNZA 3MV8D 1T1ZB 5CCGE 1F5WA 2N7BA 3DDGA 1PYWB 1JWSA 3SYQA 5K9OA 1NCAL 3U6XS 4PJ7F 3PUCA 5I74C 4KJWD 3WN5A 4HWZA 4MJID 3CFIC 2EABA 1IAII 2C4FU 5EZLA 4LCCC 1LDPH 1QUPA 2HT4D 5F9OH 4JW3A 3NIGF 4NHCH 5CHNA 3V0JA 3O6ML 4RMBA 4LFHG 1JUFB 3NSXA 4AM0A 4ANWA 2ZOWA 2COQA 1TZIA 4LL4A 4MNQA 5IB1A 1RZFL 1L7IL 4CJ1A 5KVGE 2BP0B 3NN8B 5C0BD 2GY5A 3D9AH 2Z0UA 3F5WA 5AKRA 2IBZY 4I5BA 2EYRA 4JANB 1AXTL 3GUTA 3EXLA 4I9WE 3DDFA 1O6VA 1NMCC 2VXTH 1YQVL 2NYYC 3BVWA 4DPCX 2P48B 3HFML 1P4BL 3L3KA 4D94A 5HI5C 1NCCH 1CGVA 4UDTB 3ZMEA 1R3JB 4N6RA 2G9KA 3PGCA 3TS8A 4X5PA 5IQLA 1PTZA 2E27H 1W91A 3KJ6L 3VMNA 4KKLC 5ESAB 1JZ6A 5FWRA 3CHXA 2GJZA 1G4RA 3QW9A 1AZVA 1R24B 1UEYA 2IH3B 5I8OH 1ERNA 3KGRA 1CLZL 2O6PA 4R7NB 4R3SB 5D5MA 4RSYA 4FXKC 1U92A 2VXVL 5IVNA 1WEJL 1MI5B 1KXTA 4Z7UA 1CL7L 1NJ9A 1H6EA 1J1XL 5CLTA 1ACYH 4ZT1A 1NMBL 2VRAA 1YEEH 5AD0B 3J8F7 1PZ5B 3MJGX 4OTXH 3MJ7B 4RMTA 3TJEL 4AKQA 5D7JB 1N7ML 4HIJA 1EEYB 3V9FA 3I9PA 1GOGA 2EZ0C 3P02A 4WJKB 3UJTL 2E9GA 2R2CA 4GXUN 4M7LL 1I8MB 4HIIB 4ALAC 4GMTH 2WIIA 3DTUB 3U4EA 5IJBC 4TNFA 3L95B 4AEHL 1KXVC 4LCCA 4GG6E 4Y4HD 5DMIL 4N1EA 4CC0A 2ISDA 2HMID 2YR3A 2NOYA 2OSXA 3X17A 3JT0A 2OTPA 2YXFA 2EYTB 3P73A 5I19H 1AKJA 2R2EB 1AANA 1H5BB 5EZJB 5FF6B 4UCFA 4WW2F 3MLRL 1NH6A 3K6SA 2BWDA 4Z7WA 4M6NH 3M1BB 4HV8A 3GO1H 4WEMB 3IE9A 1DUYB 1VFBB 1IQWH 4FFVD 3WLWC 4OCWL 3KPPA 3SDDB 2UZIH 4FHBD 4V1DA 4ZUTA 3GPSA 5HHOE 1TETL 4YUEH 3CXDL 4Y5YB 2WSDA 4UQ3A 3LKRA 3ZGIA 5DRNA 4P2RE 3WE1A 4YC2B 4XPTL 2N4IA 2ZNWA 2BFVH 1MHEA 4LLYA 1U91B 2J8UE 3D51A 1XHHA 4QO1B 3WNPA 4FXGB 4J4PC 1VGKB 4FXKA 1MQKL 3NSDA 5I8EA 2H8PB 5CJXC 2BNQE 2YPKB 4Z0BH 2EC9U 2VB5A 1HHKA 1NCDL 1PD6A 1UXSB 2O26U 3MA9L 4JFFD 1JDAA 1J18A 5E2TL 2PWHA 1XTMA 3UBXB 2P42B 2APWA 2A9MH 4KK9C 4OFPA 1DUZB 5D7IB 3GZPA 4FEIA 3IJ7A 1KXVA 2AJSH 3KPSE 4PJXE 1WZKA 4M5ZL 2OJZH 3BJLA 1JHKH 3FQYA 3NRFA 3M86A 5EO0B 3UTSA 3BUBA 2MNUA 2PPEA 2EH8L 3FU0A 4XMXA 2HCZX 4ZZFA 4X5QA 1KFAH 3DXAE 4GS7B 4G8AC 1QA9A 4L9LC 3VGEA 2DMCA 1K4DB 2WW8A 2ICWJ 1ZGLB 1XWVA 2VSDA 2XN1A 4X7TA 3ABLB 4P4KC 4OQTA 5A3IC 4ZQKB 4KPHH 2KLRA 4WEEA 4XP1L 1T1YA 2W0FA 1AQMA 3QK0A 2LV4A 1CF1A 2JWYA 5EORH 4ODWB 2DYPA 1QRKA 1INDL 5EN3A 4L8SC 5ID0B 1BVLB 4NERA 1MWAH 2GBTA 2HLAA 4C57C 1ZLSL 5D7IF 3ASNB 5I2IB 3CSPA 3IAQA 3QH3A 3SEPA 2MCAA 3H9SE 2X9YA 3ZZLA 2FEDC 1NKRA 1INEH 4J4PA 1RAMA 4DFHA 3C75A 1NLDL 5F72S 1O7DE 1R3HB 3MCG1 4M9PA 2FYYA 2BY0A 1BQHB 5L88L 1PY9A 1Z3GH 2PYED 5CJXA 3RTLA 4I77H 2UUDK 1LEGA 5LBVA 2VDNH 1EJOH 5CO1A 2C9SA 3F7PC 3FN0L 3I6GA 3WMPA 3ECWA 4KQ4L 1SYSB 4R4FL 3WKMH 3QC5X 1KLUA 3FUJA 1UD3A 5BQ7A 4YGVA 1TVBB 3KYOA 3RWFB 4X6DA 3DX8A 5EMYA 4RGOH 5DTFA 4QXVA 4NPJA 4HCGA 4RRPA 5AOMA 5K93A 2PR4L 5ANMA 2MPAL 4NUPA 4PJBE 2VR7A 5ECGA 3EJPA 2YAOA 1AR1D 3VFRA 4OCXH 5FC9A 1QAWA 1QW9A 5E99H 2XWTB 3DLQR 4H8PA 4JFED 5KTEH 2E7LC 4I4WA 5BZDA 4PGZA 4L9LA 4QTIH 1IM3B 5M95B 1A7PH 5BRZE 5IJKC 3HPLB 4OJAA 1T21B 3O3EA 4X9HA 4Y2DD 3VFWA 2CKBA 2NLJA 4P4KA 3BUDA 2H6UA 1AGDA 3KG5A 1SF3A 5CGTA 3HC4L 3PS6A 2B1HL 3D5OF 3LN9A 3MJ6A 4NNPL 3LS4H 4PRBA 1UXWB 4KGLA 2O5XL 3CVCA 1RZIB 2PN5A 4WI0B 2GI7A 2GK0B 2CQVA 1XSJA 3Q2CA 3GMRA 2M26A 4JO5A 3BP7B 3HB3D 5IBUB 5DVMA 1U3HB 1U58B 2ZUYA 4M29A 4YHOH 4ZFZA 4MS8D 4RNRA 4QI3A 5HP5A 1PAMA 5HGHA 1KWKA 1THAA 2OTWB 4ZOCA 1FCGA 4EN3B 2GTWA 1E8WA 3WEOA 1GGCL 2DLFL 2OMWB 3E8UL 1GVIA 2GVYA 1P4LB 3OKKA 4HKBB 5GHWH 1F97A 5LO7A 1TJHH 3GRGA 1BAFH 4ORGA 1JWUA 2BSCA 5HHNB 3SZ6A 1MPAL 5EU4A 2V7HA 4TUJB 1E28B 5INDA 3QRGL 3ZL4H 2HWZH 3LIUA 4LSPH 5EFIA 3WIHA 1SF5A 2R23B 1HSAB 1ZA6A 5KVGL 4MQ7A 1NPNA 5FUOL 4WUUE 5D96B 1U8JA 1HYRC 3MLYH 1ET8A 2IG2L 3H3KA 4JRXD 1NBYA 2AGJL 4XHQA 5TQ2H 2E7LA 4WO0A 4KROB 3OBAA 2Z31B 3ISYA 5IJKA 1FGVL 1RU9L 3IM1A 2EJ1A 3LPGA 4LIQL 4RBPH 4YL4A 2XUWA 5JDJA 2JNZA 1G9NH 4BXVA 3GBML 4NZTH 4GLRI 4BKSC 5D7SL 3BX7C 3B2XA 2C1OB 2H3XC 2X2JA 4YOKA 4PJ7A 5T1DH 2UY7A 4H0IA 1TCRB 4D8OA 2YN3A 3BVTA 1QRNA 1DVXA 4PB9L 2DJSA 5C07E 3ZKXB 4Q56A 4HCFA 4E9YA 1JZHA 5I8CB 3U7WH 5FO7B 4R0LB 1GGIH 2VXSL 1Z9OA 3RGVD 5CBEB 1XO8A 1MHHB 5E2VL 1P5VB 2CDGB 4XP6L 1LEKB 1ED3A 1N3NA 2E9BA 4N8VA 1PFOA 2WLMA 4WENB 4WW2C 4WF7A 3M07A 2F74A 3LNHA 4FQQB 1E9QA 4O00A 4M7JL 2WLIB 2X89D 1RZ8A 1IBGH 3OWRA 4G5ZL 4UT9A 5D1ZD 4OBRA 5F7DB 4W4OC 2RAMA 3NSCA 3ZTJH 2DS4A 1XV8A 3NK4A 1DQML 2X12A 2X0WA 4WFHE 1T1ZA 1QI5A 2P8PB 2VDRH 5D7JC 1PYWA 1N5AB 1WDAA 4DWHA 5AW2B 2O5ZH 1T3FB 3EH1A 5C2BL 3S2CA 1GYWA 3NJNA 2F6AA 5I1IH 4WDIB 4P5TD 15C8H 2F7OA 4X5RA 4YHPB 4AIZB 2GBAA 5BUGA 1JUFA 1E8XA 4CGTA 1DJGA 3B7TA 2IPUG 3RVXD 3S8FB 3Q8EA 2G0LA 3FNKA 5E00B 3K91A 4BCXA 2BP0A 1NA8A 5I17B 1H5BC 5EEZA 4XPBL 3NN8A 5DJAB 3RJDA 1A14H 3BRGC 1OARH 2Y1YA 3GWJA 3QQ4B 4G9FB 4JANA 3ILEA 4XT1C 2WXOA 4XO5A 3SDDC 4U0RC 4RRPG 1FBIL 1L0QA 4XAWH 4OVUA 4JFHE 1J10A 3IFLL 2ZXGA 4UDTA 5AW4B 1R3JA 2E0PA 4NM8H 2FQFA 2IDQA 4Y5YC 2LLNA 3T0XA 3GBLA 1KN2H 5ESAA 3DJSA 5A2AA 3C8KB 4YDJB 4ODSH 1C5CL 4YC2C 4AL8L 2JKXA 1EH9A 1MWAB 2IH3A 1R24A 1OE3A 5D2LE 3LPFA 3A4EA 3V0WH 3Q1SL 4NZUH 2F0CA 4ZOAA 4R3SA 3V6FB 4FXGC 3VXNB 3WUZA 3L4YA 5C2UB 1MI5A 1X5FA 3NDZE 3GINA 1JHTB 4MJ2A 4LARL 3KW8A 3NEXA 2E76C 2QGDA 1A7NH 3DV6B 4JPVL 4XWOD 2DBLH 3I3DA 2APXA 1WWAX 2PUQT 5AD0A 3UGEA 1PZ5A 4AUYA 2VDNB 3MJ7A 4JE4B 3D4YA 5D7JA 2ZJSH 1EEYA 1KCSH 4GIPD 1FNEB 3BPNB 2AVGA 3LRHA 1I8MA 4HIIA 1XBDA 3MLUL 4XMPL 5C0BE 2FJFA 1TOXA 3L95A 1ANUA 4UM9D 1WTGT 4MWFB 1SM3H 3DX2A 4QGTA 4LU5H 4IGBB 1HAUA 3ME0B 3DROB 4J8RB 3FCSB 1NCTA 2APTA 5T5FH 2EDDA 1UM5H 2R2EA 4GS7C 5BVPL 5D1XE 1H5BA 1U8HB 5EZJA 3E38A 5FF6A 2K7QA 1OTSC 3W9EB 1F1GA 1SXZA 5EU5B 4FA7B 4APQD 3US1A 3M1BA 2VDOL 5E6IC 3CXHJ 2DQUH 1DUYA 1T89C 1VFBA 2Q8AH 3HBGA 3SDDA 4YHNB 2BHUA 1CGUA 4Z7QB 2X0UA 5JIDA 3IKCB 1WAEA 2BSED 2BVOB 4F33B 4Y5YA 4JM2D 3SJVD 3CK0H 1EAQA 2F1EA 5C0DB 4MVBC 3VD9A 4UI2A 1OZUA 3ZT5A 5KG9B 1U91A 1PKOA 3B9AA 1DQIA 3SYAA 4KZDL 5JTWA 4QO1A 4WHYH 4FXGA 3B7RL 1VGKA 3FB5B 2J5LC 3AXHA 4L1TA 1SDAB 3MOBH 4KVNL 4AGNA 5A7BA 5BPPA 4WWNA 2H8PA 4ZMPA 2JKSA 2YPKA 4JL2A 4NZ8A 3L4VA 1UXSA 4KJQD 1SXSA 4G8EB 4ILDA 3V5KB 3FFDB 5MHSD 3TP4A 2QL1A 5E9DB 5B1CA 1D3CA 1KN4L 3UBXA 3BZ4B 1DUZA 5D7IA 1GTNA 5GRXG 2MRYA 2HG5B 4D8PB 3NIDE 3EH2A 4Z7QF 1NDTA 2QLVB 2C7UB 5MEPB 3ZK0A 5EO0A 3INUH 5HHPB 3WD5L 4GMSL 2BY1A 4C58B 4KHTL 1AE6L 4N8VG 3O0RH 2XPYA 4J3UA 1HCVA 2K8MA 1EIBA 3QEQB 4YXKL 1WIUA 5H37H 2EXYC 4HLJA 5BO0D 4F8LA 1CG9B 3VSUA 3IKKA 1K4DA 4LMQE 1ZGLA 1KEML 2H0FA 1OD9A 3FCTB 3IJ9A 1T89A 4ZQKA 1IE4A 1WBZB 2B59B 1MRCH 4URKA 5ISZD 2DDQL 4ODWA 4NO2B 3QIUB 2GIXA 3CVHH 2GEQA 4PJEF 3ROLB 3VSTA 5ID0A 1BVLA 5AYQA 1KCLA 3LNFA 1JZ4A 2MTAA 3D85B 3FCBA 2VXUH 3VD2A 1NGXB 4JHBA 3VXRE 2NXZB 3B56A 3HA0A 4JG1L 4PWKA 4JFFE 4OB5H 5I2IA 1FVDB 3PL6D 2WJ7A 1HNGA 3H6JA 3U4BH 3CIAA 4Q97A 1U3HC 1MCHA 1F4WL 2VE6B 3C5XA 1R3HA 1BQHA 5KANI 3CE1A 1XBRA 1ETJA 4P57B 1SHSA 2H3NB 5AKVA 3ETTA 1KF9B 4K07A 4EN3C 1VGEL 4YHIB 2IIJA 1IC7H 1MFVA 2QGBA 2KHAA 3TGXA 3L4XA 3H2WA 5C09E 3N2JA 3X3GH 3TIDB 1GH7A 2YRZA 4C8XA 2R9HC 1SYSA 4XODA 2OCFD 1R3LB 1TVBA 3RWFA 1DVFC 2LQRA 2PNDA 4H8WC 4NGHH 1UD6A 2VDRB 5K59F 1JYXA 1VHPA 1XGYH 4HJ1A 1HCYA 2AXWA 3NCEB 2I25N 5D96C 3BZFB 4B50A 2I60H 1YEDB 3M46A 4NPYB 2XWTA 4HEPA 1H6UA 5DD0H 4DEWA 3WSQH 2WN2A 1IM3A 1YNLL 4KROC 1P2CB 2Z31C 1CMOA 5D72H 3HPLA 3NOIA 1T21A 4LMQI 3DUUB 4P9HC 3ARED 5I0VA 3S3CB 1SNRA 1HNFA 3QORD 4KKBD 1IKFL 1UATA 1UXWA 4JKNA 1ZXKA 1FO0L 2C9RA 3LEVH 3LH9A 1RZIA 4WI0A 1DJYA 3BAKA 4LEOB 2GK0A 4LASL 1S9VB 4LO9A 1H8OA 3ZKXC 3NPZB 4X9FA 3D1MC 4TV3A 3WO4C 3MXVL 2BW4A 4BM7A 4R0LC 5I1HH 4IBUA 4HBQA 3BP7A 5C0ND 2WO3B 1BZEA 1U3HA 1HH6B 1U58A 2NYYD 4GQQA 3U7YL 3AQZA 1DDHB 2PF6A 1E2VA 4X83A 3TA3D 2VW7A 2Y69B 2OTWA 3VJ6B 3TF7C 5I1LB 4MB3A 5HXMA 1XEDA 2WXGA 3B1TA 4EN3A 1OK0A 2OMWA 1P4LA 3QHTC 4HKBA 4R4ND 4X6EB 2IOIA 3H2QA 5E8OB 3MMEB 4JFXB 1JVOA 5HHNA 3K72B 2VISB 4R7VA 4TUJA 1E28A 3BAWA 3T3PE 4OF0A 1CF8L 1V27A 4FYTA 2R23A 1HSAA 1NIEA 3MGAA 4IRZH 4M3HA 1COBA 2F58L 3EYOB 3ULUD 7FABH 3ILDA 3EYUH 2NNAB 4F80A 3W5MA 2RQ8A 4LQFH 2Z31A 4XPFL 4XN5A 3RPBA 2Y24A 2ZP0T 3HG3A 1UOWA 4HGKC 4ZSOB 3BE1L 4NUQA 1AKPA 1I3UA 4JKPH 2Y7OA 4X4MA 5H94B 4PCKA 4J3OG 4PRPD 3C08L 2AHIA 2X2IA 3FSWA 3UBXG 2C1OA 5LVEA 3LXCA 3ZIYA 4IDJH 2XWCA 3BGFB 1TCRA 3BH9B 1BF2A 4PSRA 1VESA 3VRLE 4YDMA 4TNVF 3FOMB 3X11B 5I8CA 4ZXBB 1KB5H 2C9PA 3F01A 5FO7A 1TJIH 4QHKJ 4R0LA 5GGQL 1CU4H 1CXEA 2GC4C 4GSDH 5DA0B 1TF4A 5ELIA 3WLWD 1CO1A 3E2HB 2NY7H 2EDLA 2WPGA 5CBEA 1EZVX 5KBPA 1MHHA 5DGQA 2CDGA 2OR9L 2YAPA 1LEKA 3RTQC 5DD3L 3O11B 3KWUA 1ZVHA 3UTPD 3QDGB 5GGRB 1X7SA 4FQQA 3U25A 3VFNB 1I3GH 2WLIA 5AKSA 2JVUA 4AEEA 2ZP9A 3B3IB 3ZTCC 1GCFA 3HZKB 1KJVB 5F7DA 5HDLA 4KAQL 1B3IA 3A21A 3IGFA 1WQVT 3DURB 4FLQA 4LHUB 2AANA 2Y07L 3CSFA 4ATTA 1IFHH 3H9ZA 3P0YH 2P8PA 3FJTA 2QSQA 1N5AA 1HKLH 2JF1A 4WKXA 5AVVB 1T3FA 3BPNC 3BVNA 1UJTA 3C8HA 1JV5B 2A6DB 5CP7B 3A4DA 4X9IA 5IFHL 1I8UA 4AMKL 1AJ7L 3BT0A 4WDIA 1I3VA 1JNLL 4K5LA 4YHPA 4IGBC 4AIZA 1WV7T 1BQHG 2XT1B 2ZOKB 4KK9D 2WKGA 5CLXA 3RNKB 3SDYH 2IWFA 3BUPA 3ZHKA 4MFHA 5E00A 3ZGHA 1Z2KA 2YIHA 5I17A 4XN4A 5DJAA 1TQCB 4U05A 4YSUA 4KDTC 1Q4NX 2CK0L 3DMMB 1TR7A 3OPZL 3QQ4A 1G7PB 4PWJA 4LCIL 4XHJC 5DR5L 1MY5A 4Y2OB 2IGTA 3OHXB 3EO9H 3E1ZA 2VZSA 3RX8A 1E30A 5FO2A 3CVHB 5H4YA 4LEXH 3MGTB 3OM3B 4ZW3A 5CKAA 3C8KA 4K71C 4YDJA 4HEPG 3UAJD 5IKCB 1MWAA 4G3YL 3MYJB 4M93B 4AYGA 1BJ8A 2Y22A 3L4WA 5IESH 3OKMB 1HHJB 3V6FA 4GRLB 1WFUA 2IQAB 3VXNA 5HHME 5F0JB 2NXYC 4I88A 1CFNB 1JHTA 4YDVB 2DOCA 2YWZA 3KCPB 3DV6A 3V5HB 3NCJL 5CUSL 4N26A 4UINL 5FDWB 3S6CA 4XPHL 1I8IB 3EBAA 3MRPB 1NBCA 2AMUA 1SQ2N 3MRLB 4PJCB 4AE0A 3GMOB 4PUBL 1FNEA 3E3QC 1BOGB 4KTDL 4PM1A 5EHFA 4G59C 5FHAH 3CBJB 5FGCB 2YUVA 2WKOA 3QXVA 2C26A 4MWFA 4J1UB 1EFQA 3DRTB 3LZOA 5C0JB 4IGBA 3ME0A 4U3CA 3TH2T 3DROA 3FAXA 4J8RA 3FCSA 4FE9A 2H6OA 4OLUH 2N7SA 1OTTC 2ZAHA 1S9YB 1DVZA 1U8HA 5FYJH 3CZNA 5C7XL 4RETB 4KDTA 3W9EA 2HFGH 5EU5A 4NRXB 2KDYA 2MEJB 3WKNA 3GSNL 1RIHL 3D08A 1U8IB 1QWUA 5EIVA 4K15A 1F4XL 4HPYH 3UC0H 1J11A 3KVQA 3FQUB 4NFDA 4YHNA 1G9NC 3NA9L 3SDXB 3QIUC 3IKCA 5JHBA 4DGYL 2BVOA 4F33A 1IT9H 4ZO8A 4G6ML 5FYLE 2WV3A 4PJCF 5C0DA 4FKKA 2NXZC 3MUGB 2DF3A 3OKDB 1CGSH 2V0AA 3UP1A 3HCVB 5KG9A 4OSUH 5T1LD 2FK9A 3T0BA 4G2AA 3FB5A 3CFCH 3SE6A 1LQBC 5I24A 1XFPA 4Y1AE 4JZOB 3SGEH 3FHEA 4M61B 3MBED 4KWUA 1KJ2H 3FRPA 1ND0B 4FABL 2X4QB 3DGDA 1IGFL 4G8EA 3V5KA 1HX0A 2EDYA 3CSBA 3FFDA 4LSVH 1QTYT 3VM7A 5E9DA 2P43B 4GO8A 1CXFA 1DEEB 3B34A 1F86A 3MUHL 3BZ4A 4ATWA 3V4VH 2HG5A 4CU7A 4D8PA 4Q9RL 1UYWL 4QHKI 2E7CA 1KB3A 2C7UA 4U6VH 3V4PL 5MEPA 4KRPB 3P2DA 5HHPA 1GW0A 3UOAB 5JOPD 2ZTBA 3QJHB 5LUMA 4HXBL 3QEQA 3UBGA 4KFMA 3FSZA 2NTSP 3SJVE 1N0XL 5FA4B 3X3FH 2HA1A 3ELAT 4AW7A 3M1CA 1CG9A 2WTPA 2EC8A 1U6AH 4P9ML 1PZUB 3ARRA 2R56L 2CM6A 3O6LL 3FCTA 35C8H 4EDXB 4UM8B 2B59A 1WBZA 1S7QB 3NRPA 4H25B 2VLRD 3QQ9C 2FT7A 3QIUA 3MRNB 4MCZB 3L1EA 4NO2A 1IILE 3WG7B 1P1VA 3ROLA 4OZHB 2DJ4A 3CSGA 2EICA 3D85A 4OJCA 2WLJA 2J1KA 5KYNA 1NGXA 3W2DL 3NSFA 2G5RA 1SY6L 4LPWA 1FVDA 4UAOB 3UADA 1IO4C 3S35X 1KB5B 1UB5B 1H3TA 1G0DA 1OAXH 2VE6A 3CGTA 3G3LA 1MCSA 2K7PA 4W9ZA 4A1RA 4P57A 1AXSB 2H3NA 4RQQB 5E6YA 2D3VA 4W9EC 4F57H 1N8ZB 1A0QH 3L3HB 1IZJA 2R29H 2SEBB 4XZUB 4YHIA 3CDCA 3CUPB 4JFYB 4XO9A 3ISWA 4XNXH 3TIDA 4EI5B 5IZ7A 2CLZB 1R3LA 4ZW6A 4KI5F 1J8RA 1QSVA 2CMRL 3FUDA 2X6MA 1FA4A 1QFUL 3GSWB 3OJMB 3V4UL 4NNXB 3D3VB 2H4EA 3MCKB 4AZUA 5D7KE 1YEFH 1UA7A 1KPVB 3BZFA 1URZA 2QPSA 1YEDA 4HWNA 3HMWH 4JKKA 4NPYA 4JL1A 2AAVA 4MNQE 2LABA 1X5KA 1YC8A 3LNIA 4GSXA 1OAKH 2NQ3A 4YSQA 3KPRD 3EJZD 2QGEA 1P2CA 2X6BA 1VA9A 3HZVB 3LB6C 1XSIA 4MKMA 2OXHB 3C5ZB 4R8WL 5EU7C 3SZKC 3DUUA 3FQTB 2WXIA 3FO1B 5FM5M 1X4YA 2N59A 2VRQA 1WFMA 3D50A 2PPAA 2FWUA 5DVNA 3A6CH 4AY0A 2QTVA 3BGFC 4LEOA 3ZTEA 1ILUA 3FHAA 1F8TL 3O3UN 4I0CC 3TBCA 3RAJL 1S9VA 1JZ3A 2X38A 3P40A 5MP6L 1HS6A 2WOYA 3DHMA 2N01B 4JNXA 3QDAA 3DPBB 4ZXBC 2E5EA 2XDHA 4L4TB 3H54A 1HH6A 1ZE3H 3E2HC 1MLBB 1W8NA 3TJHD 2IPTL 1DDHA 3CFJB 1UTDA 4A66A 3FF8A 4Z7UE 3VJ6A 2WK2A 2VLJB 4F2FA 5LGYA 5I1LA 1S5HB 1IC5H 5GGSY 3U4KA 1WAAF 3LNEA 4X6EA 3NJGA 5CZXD 4JZNB 5DD1L 3MMEA 4JFXA 4WU7B 5E8OA 2EDTA 5AOZA 3WHXB 2VISA 4EOWH 3ZUNC 2YK1L 4O51B 4OF6A 2MOVA 4G71B 3QRFM 5DK0B 2YMXL 5AALA 3GFUA 5EOTB 1MCWW 1K3ZA 1HT6A 5D8JH 5C70A 2YOAA 3ZE2E 3BKML 1J8HD 1A7QL 2VSCA 1FRGH 3EYOA 1KCUH 4J3OD 4RBPK 4P49A 4WFEE 5BXFB 4N0YL 2NNAA 5GJSL 4K5PA 1AO7D 1F4HA 3BPCB 2BMKB 3GMPB 4A2EA 1Q72L 4OLYH 4ZSOA 4Z7WE 5T5FA 4L8DB 4MMYB 1FPTL 1TQCC 4FFWC 2IQ9L 5H94A 4MBRA 3CN0A 5AB1A 1NC4D 2I07B 2P80A 1XF4B 3DMMC 4V1DE 4HU8A 5D7EA 3VVVA 1B4JH 2YSSB 3BH9A 4M56A 3OHXC 1T2QL 3FOMA 1RUMH 3GXFA 3X11A 4NFCA 4ZXBA 5KBKA 5IB5B 4L29B 3GLDA 4OZGB 1XCWA 4GOSA 4YIQB 1ACZA 3IDIB 4JY5H 4BH7B 2NX5D 5GRZA 4M93C 1E6JL 2AQRA 3OZKA 3WNLA 2A0LC 4Y0GA 3TASA 3TVMB 3O11A 1ZANL 5TE6L 3RBGA 4GRLC 3QDGA 4IM8A 5GGRA 4MVBD 3VFNA 5D55A 3B3IA 3L16A 4FQCL 5I1CH 3HZKA 3RX9A 3UXFA 1MREH 3DURA 4JZJB 4LHUA 1KJ2B 2KYIA 1T5XB 1E2WA 3O9WB 1INQB 4L1BA 1VF5C 4S1RH 1KCVL 4GRWH 4EIZC 3SOTA 3TFKD 5G5DB 5I6MA 1JV5A 2A6DA 2AK1L 2ORBL 4KVCH 5CP7A 1K8DB 4UYQA 3UTSE 4L8CB 3H6AA 1S7WB 1NAKL 3FKUS 3V4VB 3GIZL 2XYBA 2EADA 1MAJA 2ZOKA 4NN5C 3RNKA 2W0LA 4IJ3B 2IV9A 2XVGA 4KY1L 3U82B 2A4CA 3OPUA 3HZYB 1JMXA 1L3NA 3T65B 3TWYA 1G7IB 4ETYA 3F8UB 5H37A 4HD5A 3DMMA 4JKLA 4Z0XB 5FHBH 2Y2YA 43CAB 4AGQA 1G7PA 1UWXH 3L9EA 3VXSD 4JDTH 1BLNA 1RPUA 3THML 2ARWA 4Y2OA 3OHXA 1IM3D 5I18L 3KR3L 4NLAA 3II1A 3KBFA 2EUVA 4XNMB 4Z3FA 1BJ1J 4FP8H 3CVHA 1X5YA 1NCIA 3MGTA 4JFZL 1L0XA 1EBPA 1WP6A 3RWHB 5IKCA 3MYJA 2EIKB 5E0FA 1C5BH 1RHHB 4ENED 3OKMA 5B39B 1HHJA 3JWOH 1U3JA 4GRLA 1EXHA 2IQAA 4PVNA 4Z23A 3BT2L 1NBVL 3RDTD 3VMOA 4JHAH 3B83A 1CFNA 4OCYL 4XVUD 4YDVA 3KCPA 4A7VA 2OTUB 3V5HA 3PFQA 5FDWA 1I8IA 1U3HD 1J88A 1P84K 5JW4Q 2VTFA 3MRPA 1WPCA 4ZS7L 3NZUA 4XWGL 2Z64C 3MRLA 4PJCA 4U1IB 3WFDH 3GMOA 1EZSA 4MXWH 2CCVA 1BOGA 2EAEA 1YN6B 1ZTXE 2BS8A 3IK2A 2ZCZA 5DJDB 4EN3D 4KZEL 1JOIA 4TRPL 4J1UA 3DRTA 4KRPC 4FA8A 5C0JA 1ID2A 1UA3A 3HC3H 3BUTA 2K3TA 1AFVL 1FFPB 1SBSL 2FTAA 2XA8L 2BK8A 3EYFB 1GZQB 1BXXA 1S9YA 5DZ9A 4PN6A 3GDCA 1Z9NA 3HE7B 4QKTA 4NRXA 2A74C 4JGJA 2R0LH 3P30H 1U8IA 3HBPA 3PIQB 3BMVA 4FZEH 5JQ6H 4KI5C 3I75B 3FQUA 3V0AC 3SDXA 4PP1C 5T3ZD 2ADFH 1J86A 2DQFB 4MRBA 3ROOB 5FGBC 4AYDC 3WFCL 4XVSH 1DZBA 4OIIH 3MUGA 3OKDA 3MV9B 5HTSA 4P2QB 1RD6A 1JZGA 1BMZA 3HCVA 4MDRA 2GUYA 4UAOC 5IV2B 4MAYC 5BS0B 1OAUH 3MFFB 1BYNA 1LO4H 4QHMB 1B2YA 2QBWA 4NO3B 1F0LA 3HS0B 4JZOA 4M61A 1T5WB 5DI8B 3IEAA 5AL8A 1ND0A 5KUMA 3IVKB 2X4QA 1IM9B 5IT2L 3H1ZA 2F1AA 4ZO6A 3JWNH 4EI5C 5I1GL 3RILA 1DEEA 1GKEA 2DIAA 2ZP8A 4OKDA 3JTBA 3TEUA 4EI6B 5C0EB 1JI2A 1JXFA 1I9EA 2RBLA 1W15A 1YMHB 3H3BC 3IB4A 3MGOB 4JR9H 1FYTB 1CGTA 2FE0A 2ZYSA 1Z6JT 5E8PB 3WOVA 2CE6A 4G6FD 3QJHA 3BZDA 2JKJA 3H9YA 1ZWIB 5CP3H 3PPSA 2VC2L 4JQVC 4IRZA 4WHYG 1YO4A 2NNRA 2NY6D 3IDMB 1Q8MA 1DHKA 4X8XA 5FA4A 2R0ZH 2H0PA 3C5ZC 4OJYA 2EDOA 4UT7L 4H13C 1J8KA 5LHDA 4BZ1L 4PJ7E 4EDXA 4FNRA 4UM8A 3QB7C 1R5WB 3UIZA 1S7QA 4S1QH 4H25A 4MCZA 3MRNA 1QRNE 3NQIA 3TV3H 4DTGL 5HVHB 3LQMA 2EH7L 4OZHA 1W0VB 3NIGE 3QHZL 1QSFB 5FGBA 2UZYB 3JV6B 1NL0H 2WBWB 1HIMH 2F15A 2YWYA 4G9FD 1A3RL 1KB5A 1UB5A 3WCYA 3CJJA 1BBJB 2EKSB 4I3GA 4Z3EA 4X0KB 1J1OH 5H37G 1X5JA 1BQKA 4K8RC 1RUPL 1WZ1L 4QTFA 1AXSA 2UZXB 3FT0A 3OXRB 4RQQA 5K9KB 5I1AB 3SY0B 1N8ZA 1P4IH 3L3HA 4WRLA 5E08H 3QUXD 4U6XB 2SEBA 4XZUA 5LNGA 3TO4D 3V0IA 3CUPA 2V5YA 4GH7B 2XFXB 4JFYA 4EI5A 2CLZA 3ARGB 4OGAD 1REIA 5C08B 2FUTA 4J5VA 2PXYB 4PLNC 2B4CH 4WO4B 4JVUA 3N04A 3IJSB 3IJ8A 4YFLF 3GLAA 2HKFH 2NDFA 3GSWA 1BZ7B 4GRWB 4NNXA 3D3VA 3MCKA 5KBMA 2GW5A 1KPVA 3LYRA 4JQVA 4K3DL 4OKVB 4AMWA 2A1WL 2K78A 1ZIBA 3QUML 1JK9B 1WAAA 3ALPA 3HZVA 3IS1X 1PIGA 4YDNA 1NCAH 2OXHA 3C5ZA 4AEFA 3FQTA 3CC1A 3FO1A 3KW7A 3WEAA 4IGBD 2DKUA 4MQXD 3E9TA 1DQVA 2NY0B 1XB3A 3O6MH 4BGDA 5CLYA 5EIIB 2GABA 3QWQB 1RZJL 2Y5EA 1RZFH 3Q13A 2CIIB 3WV0A 3OKYA 2GBUA 4UOJA 3WTXA 3DPBA 3VWJD 4N25A 3T6WA 3GBDA 1G5GA 4L4TA 2A9NL 1MLBA 4FCAA 1AXTH 2PMZA 4GRWF 4RESB 3TVMC 2WXHA 1T5KA 1NANH 3CFJA 1YQVH 2WQ8A 1MI5E 3H55A 3SBQA 4CDGC 3HFMH 1P4BH 1TJMA 3QAQA 3LEYL 3N91A 2VLJA 3QDJD 4GXUM 1S5HA 3WIIL 4GKLA 5B7MA 4JZNA 3ABZA 4WU7A 3ZQWA 1J0HA 4JZJC 2WQRA 4UNIA 3WHXA 4O51A 3O9WC 4BQ6A 1CLZH 4GKNB 2DMGA 3I6SA 2EDEA 4AG4L 2PWGA 4LP8A 5DK0A 3C5JB 2VXVH 5EOTA 5F7WC 1N0LB 1WEJH 4KX9A 4Z3HA 3EYSL 3N0AA 4YXHH 4JFDB 1CL7H 4XOEA 4WTQA 4NLHA 4R97B 1J1XH 4J12A 3EJRA 2P7TB 4RDBA 2J71A 3GYRA 4LAQL 4WTXA 4H44C 5E2WL 5BXFA 4AV5A 4ZMYA 2HYMA 3TJEH 1RK1B 3D05A 4B9IA 4IJ3C 1N7MH 3BPCA 2BMKA 1CT8B 1VJSA 3GMPA 3UJTH 4YPJA 5L9DL 3TCTA 4M7LH 3WIFB 1UJ3B 2C3HA 3GXIA 4L8DA 4MMYA 3B7SA 3TT1L 4HOMA 3FPXA 4D0CB 4AEHH 4LSTH 3ZE0B 3VD1A 4ICWA 5HVFB 1DSWA 2YA2A 5DMIH 1TPXB 2I07A 1XF4A 1LHZA 4N3TA 1TKWB 3S5LB 3QEQD 1WWBX 3ZMNA 4DOHB 5GISL 1ZS8B 2YSSA 3FK3A 4MS6A 5IG7B 4XMTA 4F2MB 2Z7YA 1PCXA 3CDZB 2GJ6B 1RJLB 2YEVB 5IB5A 4JO1H 3M6DA 4B9KC 3GSQB 3BC9A 4L29A 3MLRH 4OZGA 1Z1WA 4YIQA 3IDIA 1YPZF 4AEIH 1F6LL 4BH7A 2ZAGA 1CD0A 3TVMA 3B9KD 3LN4B 3X1NA 2ZYHA 4OCWH 4HG4J 2DWEB 2D0HA 3O3AB 4X7CC 1TETH 2A9AA 1VZIA 3CXDH 4PVMA 1YHPA 4QT5B 5IFAL 1FC2D 1LILA 3GHBH 3NIFB 4X6FB 4OLXL 4XPTH 4UBDD 4JZJA 4MMXB 1KJ2A 3MRIB 1T5XA 3ZE0F 3O9WA 5D7IE 1INQA 1OQXA 3BPLB 3LH2L 5G5DA 1LMIA 3WTVA 2XJKA 1K8DA 1CBJA 4XGZB 2NR6D 4L8CA 3V4VA 1S7WA 1PEZA 1NCDH 3MA9H 5EB9A 4O2EB 2Q7YB 5E2TH 2K0RA 1N2RB 4LLAA 3U2IA 5DEJA 1E4XL 2QTEA 1MCPL 3HZYA 3T65A 4G42B 1G7IA 5TPWL 5DMJB 3HE7C 4UOW1 4Z0XA 1XD0A 3UO1L 43CAA 4FJYA 3FB7B 1CN4A 4EE2A 5FOBB 1SLWA 2EH8H 3VXUB 1J5CA 3NIFF 4U31A 4XRCB 3UGXA 1XSOA 5TD4A 4JFSA 4Q6IC 4XNMA 2W95A 3Q1EA 3ARFB 1X7TA 2DKSA 3U0WL 5IWLC 3RWHA 4LGSB 4PVBA 1RHHA 2Y25A 3GBEA 3KBPA 1F42A 2PW2B 4FYQA 4PRIB 5B39A 4WNSA 4GXVL 4FXLA 5ES4B 1INDH 3MN8A 2XN9B 2J25A 4AQ1B 3HS0C 1BHGA 1BZ9B 1HSBB 2OTUA 2VLKD 4MB1A 4Y8DC 2MCMA 1ZLSH 3AY4C 2DY2A 5DHYB 3EUUA 3UBXI 1DSFL 5GJTL 4TLSA 2VT0A 1CJYA 2R29A 3QDMD 5JDSB 5DHEA 1FUNA 4UOQA 4U1IA 3OF6D 4DF9A 2X9XA 3WBDA 3S9DB 2CHNA 1YN6A 1RULL 5L88H 3K4DA 4FKHA 3T6XA 5DJDA 4BZ2L 2GIMA 1X7QB 4KNUA 1DCEA 4J6RL 4RMUA 1PZBA 2AK4B 4CW1B 1A4BA 2ICES 2ZUQB 5KUKA 3FN0H 1BECA 4B27A 5KYWB 4HMEA 1FP5A 1FFPA 4KQ4H 1CFQB 2Q86B 1UKQA 4LPXA 4R4FH 2HP4A 3EYFA 3MV01 1GZQA 2DQIL 4Q0XH 4UUJB 4ZUWB 5AW8B 4AWJC 3HE7A 3DGGB 4G83A 1MFEL 1WWWX 2PR4H 3SPHA 2MPAH 4HQQL 5F9AC 2NY1D 3PIQA 1SMOA 2ZT9C 3I75A 4GQPH 3U1PA 3K8MA 4U3XA 1EX0A 3LB6D 5HVHC 2FX9L 1TG8A 2DQFA 2WZ6A 4RGNB 1EPFA 3ROOA 5I30L 4JRLA 2ZICA 4PAZA 5IWLA 4KUCD 4ANKA 4Y4KC 1H3WM 3E1F1 3MV9A 4P2QA 4TQIA 2P80D 4YDZA 1YY9D 5JLZB 1SQMA 1X4ZA 5IV2A 2JH2A 3HC4H 2X6CA 2B1HH 3F85A 3NJVA 4L3ED 1WO2A 5BS0A 3IDNB 2J44A 4H8VA 4NNPH 3JTTB 4QHMA 4KO5A 1P5UC 3TM6A 3VACA 4ONFL 4E68A 2P5EB 2XX1A 4NO3A 2O5XH 3AT0A 3K6IA 4DP2X 3ULVD 5EBGA 2X4TB 3HS0A 3I9GL 1T5WA 5DI8A 1JZFA 3AY4A 4NOFA 1I9RL 3IVKA 4QRRB 1F41A 1IM9A 5LWYL 1ZLDA 3SGDH 5ESQB 3Q8BA 1SMDA 3ARGC 4EI6A 4YSEA 5C0EA 2PXYC 4WO4C 3T0EB 1LK2B 4A7GF 1DN2A 3IFNL 1YMHA 4OM0H 3NCFB 4WJG3 4ZMXA 3MGOA 3LTVA 1BJMA 1FYTA 3ABGA 1TYEB 3QJRB 4HWUA 1GGCH 2DLFH 5E8PA 3E8UH 2YAMA 3QCVH 3WGVB 4HAKA 1ZWIA 5HYQB 3U0PB 1IAIM 2Y7SA 4HT1L 4KKRA 2DEWX 3BDXA 4E9XA 4HUMB 2YD4A 1U0QA 3IDMA 3L8QA 2IH1B 2DQDL 3T4YB 1TMQA 4MA8L 4X4ME 4YBLB 4XPAL 5A2BA 1NBQA 4B96A 2DTML 1IRAY 4MD5B 3RX7A 2LFGA 4H20L 5FUOH 2EDQA 2OW7A 3K81A 2BSRB 1R5WA 4XVOA 2IG2H 2AGJH 2NY0C 5DFTA 2NW2B 1ZRUA 1W0VA 1QSFA 4KKAC 3UYPB 4YSAA 2UZYA 1VEPA 1FGVH 1RU9H 2R0WL 3JV6A 2UV3A 5J9PB 4LIQH 1MXDA 4ZAKB 3TONA 4FDWA 4YJZL 3GBMH 2YQBA 3HI6L 5CJOH 4HWEL 5D7SH 2J21A 3OMAB 1BBJA 2EKSA 5CJ5A 2ZXQA 4X0KA 5FS5A 2JSFA 2F2HA 1DLFL 5K9KA 3FW6A 2UZXA 3OXRA 4PB9H 2XXFA 1RUQL 1H3UA 2VDKL 3JWOC 4ZTEA 3D25B 3SY0A 5I1AA 4U6XA 1NLBL 2YD0A 4CSTA 2VDQL 2CH8A 2XFXA 5DT1L 3K5RA 2VXSH 4YE4L 1PSKL 2CJTA 3ARGA 4TNWK 2WCGA 5C08A 2IMMA 2C9UA 1F18A 2PXYA 5E2VH 3E80A 4WO4A 3IF1B 2FBJL 4XP6H 4I9XA 1RKRA 3IJSA 1D7CA 1IBDA 2DQGH 4NRYB 3SPCA 1FL3B 4MRCA 4JQIL 4F27A 1BD2D 1BZ7A 3SE9L 4YNYB 3DWTA 5B39G 4R97C 4KKPA 1BFVL 3M1OA 2ZKHL 3NCCB 4M4PA 4OCNC 4OKVA 5TDNB 2X44D 4KMTL 1DQMH 2QKIB 4EIBA 3NCYS 4AQZA 4LSRH 4HH9B 1JK9A 1ZKAA 2H7WA 2MCG1 4BFEA 1QMUA 5IVXB 2M83A 1UJ3C 5EA0L 5EEUA 2G2RB 5C2BH 2CUHA 1WFOA 1G94A 1UT2A 1TPXC 5D4IA 1AQHA 3IMRA 3VNYA 2WOBA 2DRUA 3Q5YA 5J57B 1W72L 5F97E 4G6KL 3KH3A 3UG3A 2E75C 1M1XB 1DFXA 1OAZL 2E4FA 3C2AL 1AD9B 4TQEL 3MJ8B 4GO9A 1G87A 3S96B 3VNZA 2CIIA 3S37X 4TPRL 4XPBH 1TLKA 5JOEA 1M57B 4AUJA 5EEYA 3OSKA 3BP6B 3RUGF 4LHJB 4XXCC 5IUSA 3QP3A 2JFCA 2OAAA 1EEUA 1FBIH 3LNDA 5FM4A 5AEAA 4P2CG 1LE9B 4JDVB 2FLRT 4GYBA 2C3XA 3QGVA 3DHPA 1C5CH 5IVXF 4AL8H 3KLHC 3DJ9A 4MMXC 1G7MB 4IEFB 4B3VA 3FZUD 3Q1SH 2WQSA 2NMSA 4UTAL 3FAWA 1FLRL 4GKNA 5GGTH 4XI5C 1BOYA 3WI9A 3BPLC 2J1YA 3C5JA 3JWNC 1N0LA 3SIKA 3BKCL 3QFGA 4JFDA 4LARH 4ZO9A 3DBXB 2JKNA 3Q2VA 3RL2B 2P7TA 3B2UD 5BVJB 2ZXDA 3SPVB 5F7LB 1RK1A 3PQYB 1CT8A 2XQ0A 1BEXA 3WIFA 1UJ3A 1J12A 2XKSA 3MLUH 4XP9L 4D0CA 3FPYA 1OZTG 2VO5A 3L13A 2NTFB 3GSRB 4JJHA 2HX7A 1AHKA 3CX2A 3EJCA 3NDYE 4Z7QE 1TKWA 1XZ0B 3S5LA 4Y8AA 1MOEA 1ZS8A 4KDWA 2BVQB 3HC0B 5IG7A 1KXQA 3EJYD 4F2MA 5BVPH 1E40A 3CDZA 2GJ6A 2HTKC 4U1LB 1RJLA 2IDFA 3BWZA 1E5BA 4DO4A 3GSQA 5C97A 3ARFC 1CQYA 3ARTA 5HHXL 4XXCA 1KC5L 1FH2A 2KPWA 2VDOH 1JXDA 3LN4A 2DWEA 4QHLB 4XN8A 3QXDB 4OF8A 4MJ6B 5DDHB 4AQ1C 3OXSA 4QT5A 3FCGA 5L4JA 1FHGA 4FX5A 1PQZB 5E9DE 3VX1A 3U2SB 4TMPA 4X6FA 4MDIB 4MMXA 3MRIA 5JZ7C 3K46A 1VFAB 3E3QE 2RIKA 2XJLA 4KZDH 3MBXL 1W8EA 2L04A 3GUFA 1ZLWK 3RWDB 5DXWA 2NY3B 2FJGB 4KVNH 2JI2A 1UXMA 2B4CC 2YBRB 4XCEB 4XGZA 4L8BB 1NUDA 1FI8C 3F84A 1WFIA 1DDTA 3HI1B 5B4MC 2ZUQC 4O2EA 2Q7YA 4PU2A 3P0GB 1I4FB 5DHVH 4AIEA 1JPTL 1KN4H 1N2RA 2AJVL 1BSIA 4F8TA 5CR8A 4DGVL 4DPAX 1CDBA 3SQOH 4G42A 4J7RA 5IEKB 5F0MB 2H9GB 2V9QA 2WM0A 4IS6B 2EILB 3WD5H 5B22A 3FB7A 3UERA 4KHTH 1AE6H 1FL6B 5FOBA 5K59E 3ZL2A 3VXUA 4GINA 4X50A 1F02I 4YXKH 4XRCA 4HMDA 1NGZB 3N9GH 3W11D 3EOTL 3IXTB 1G7JB 3Q9QA 4OV5B 1EHXA 2BRQA 3ARFA 2E56A 3IFOB 4NENB 5EBWB 4YQXL 2Y7NA 1KEMH 2KMWA 1P84J 1MDTA 3TPUB 4OLEA 2HRPL 5D93B 1ACYL 4PRIA 2PW2A 2B14A 1QTPA 4U33A 1F11B 2DDQH 4H8WL 3A0OA 4U1JB 2XN9A 4AQ1A 1WC7B 3LZQA 1BZ9A 1HSBA 4PREA 3MNDA 3L6FB 4JG1H 5I6PA 5DHYA 4L4TD 3SN6N 2NNXA 1MCJA 2WSPA 3EG9B 2KLSA 3LY6A 3O2VL 4XO8A 5EIIG 4AQOA 3TJPA 5EBLB 5JDSA 3OB0K 3GQFA 2MQ3A 2EC9T 1BXUA 1BQSA 1F4WH 1O6TA 2QSTA 4AQ8C 4PBDA 4WHDA 2VLJD 3T0EC 1ETA1 2K9FB 3A6BL 4P9HL 1X7QA 4MCMA 1H3XA 2Z0BA 3AU1B 4NXSA 4NQCD 1PY0A 5JUEL 5BZZA 1G7QB 1F6AB 2AK4A 1PZ3A 3TBVB 1VGEH 4CW1A 4GBXD 5KYWA 2EIMB 2VQ4A 2KZ1B 3P3YA 1BQLL 1CFQA 1SFHA 2Q86A 4M6NL 5DZVA 5F3BB 3VFOB 2BJMH 4UUJA 2WQXA 1RIUL 4ZUWA 4UIKH 5FB8B 3DGGA 4YBLC 3TEWA 1D2OA 4LLQB 3ZQ9A 1PBYA 4HXAL 2QZQA 4ZX5A 4AV0A 3CFKB 3NYKA 3VX0A 1VERA 3OZ9L 1T80A 3HZMA 3U6XA 5ADOL 1CLYL 2YKLL 3OKEB 1G1YA 5J3HC 2BVTA 1NC2B 2LHAA 2RR3A 3ESVF 2APVA 2XZAL 3GMNB 4ABVA 1YNLH 1FDLL 4C56D 3QWNA 2W0KA 3KWWB 3TBSB 1A66A 1P7QB 4JFUA 1KG0B 3IFPB 5T3XL 1HZLA 2AW2A 4FNLL 1I1AB 4ZAKC 3MLXL 2ZUXA 5JLZA 1L9RA 4P06A 2ZX9A 1EAJA 3IDNA 1IKFH 3JTTA 2CBQA 4Y1TA 5IVOA 1XCQB 2P5EA 2LVEA 4M03A 1FO0H 4NS0A 4P2RB 5KJRL 4ONOA 2YGNA 4BE6A 1T03L 4WFFD 2X4TA 3I84A 3TCLB 3ESPA 5CMAB 4LASH 2J8UB 1J5IA 5DS8B 4QRRA 3QJVB 1FVCB 4NKQB 3MXVH 1PG7X 5ESQA 2PTTB 2BNRE 2X4OB 2P52A 3RVTC 3U7YH 4AQ8A 5GRUL 4ZMOA 5CD5C 3T0EA 1LK2A 2BH0A 2QLYA 3KGSA 5DC9B 1H15B 2O5NA 3DJZA 4G70B 5JR1L 1F1AA 1HOCB 4WQOA 3QXAB 5J4MA 2XXMB 5HYQA 5GRYA 3U0PA 2B77A 3O9WD 3B7YA 2RA1A 3RVUC 5EU7E 2IWGA 4ZSOE 2QKIC 2IH1A 2ZXEB 3T4YA 3HNSL 4FG6D 1CF8H 3ULSB 4J2QA 3NA4A 2WLHA 4I7ZC 3MU3A 3DXAB 2I26N 4MD5A 1XAUA 4L37B 2E9JA 3KE0A 2JELL 4P0DA 1MH5B 2BSRA 1GOHA 2F58H 2ID5A 2D8KA 3X1GA 2NW2A 5I0ZA 2WP3T 1EAOA 3UYPA 1MFAL 2OSLB 4XPFH 5J9PA 3BQVA 3S3PA 4YAQA 4ZAKA 1IAOB 2CNYA 3FSAA 3NQKA 4QWWC 2KBGA 1E2ZA 1V3KA 4CU6A 3QDGE 5JHDB 4WNQB 4QEGA 4LRIC 1UG9A 2VDOB 2EIBA 3VXPB 4LEBA 3TWCL 4AK1A 3B5TA 1CURA 3QEGL 3D25A 3U79A 2VM9A 5SWSD 5GGQH 4N2FA 2XACC 3N1GC 1K4CB 4L5FL 4LDOB 2MHAB 2VM3A 2OR9H 3IF1A 5DD3H 2XRAH 1A6VL 1TYRA 2GFBB 2ZYRA 4X7DC 3DYPA 1T22B 4U7MA 4LVOC 3BKJL 1W0WB 4NRYA 4YAQB 1FL3A 5E8EB 1Q9OB 1ZT4B 4ABUA 3HRPA 1L9PA 4YNYA 2YJQA 1H0DB 1TQBB 5IB3B 4KAQH 1TTBA 5TDNA 2Y07H 5HJDA 2QKIA 2QGCA 1X5ZA 4HH9A 3JXAA 5IW1B 5TFSL 1BMGA 3F12B 4UV4L 5DHVB 3EJTA 5IVXA 2BY2A 4XMKH 2ZF9A 1IBBA 5BUPA 2NNCA 2G2RA 2ZD0A 5IFHH 4AMKH 2VZTA 4DQAA 1KIPB 2IGFH 3H4FA 2MKLC 3EAKA 3QUGA 1X9UA 2MOQA 1M1XA 1IJNA 1AD9A 3PF2A 3MJ8A 4A67A 4Z7IA 1JDCA 3S96A 1XF5B 1G1KA 2XZZA 4P46B 5FOJA 3RHWF 4PCSA 1D5BB 2CK0H 3BP6A 5HJ3B 3CX5K 3OPZH 3WAKA 1NDMB 2Q2LA 4LCIH 4LRIA 4U1GB 4BSJA 4Q4EA 3L3GB 4KRNA 5I28A 1OLZA 2HFEB 3MLTB 2X4UA 1E7VA 5KJ4A 1LE9A 1MCQA 4JDVA 4UILL 3MV9D 2HWZL 4P2QD 1AAJA 3ARSA 2YEQA 4ZD3L 3VGAB 4G3YH 2X9ZA 4PJCE 4W70A 2D7TL 1G7MA 4IEFA 2ICWB 3QIBB 4IKKA 4MD4B 3LD8B 4MASA 3LIZL 5T8IA 1JRHL 2YLHA 2YOCA 2DM4A 4XPGL 3TNNB 2AJUL 2NY3C 3ATFA 3DBXA 3RL2A 1GHFL 3PJSB 4AYID 1SXBA 3NCJH 5CUSH 3VCLB 3F2LA 3NJMA 4UINH 1UZ6F 3UACA 5BVJA 4XPHH 3IU3B 3SPVA 4PGCB 1R75A 3NUKA 4M1DL 3PQYA 2PR9A 2ZUUA 2FQGA 4PUBH 1GIGL 1MCNA 2V6HA 3RL1B 3S5ZA 1E4HA 3MJ9L 4XZ4A 3BZEB 2NTFA 3GSRA 3P3TA 1G6RL 5CKGA 4B9JA 1XZ0A 2MMXA 4KJPC 1GGIL 1RSYA 1SXCA 2BVQA 3HC0A 4PJ9C 4F91B 4ZUVB 4IRSD 2Q87A 1Q9WB 2X2HA 3NEOA 4U1LA 1C9SA 1DJWA 2DV6A 2JCCB 4PRHB 5C7XH 3QCTL 4OFQA 3JV4B 3EGDB 1YYLL 2WHVA 3DX6B 2CA4A 1NPUA 3GSNH 4ADJA 2QQKL 5A2CA 1RIHH 1MNUL 3OQ3B 4PJFB 4PCTA 3PV6B 3D39B 1YEKL 3PHSA 1F4XH 5D93C 1A9VA 5HY9B 3P54A 2UX6A 2WLKA 5C9JB 3NA9H 4QHLA 3RY5A 3QXDA 3M7FB 3O2WL 2XG5B 4FLSA 4MJ6A 3AWGA 4DGYH 5DDHA 2NZ9C 1YCSA 5T1MB 4G6MH 1FO0B 3LNGA 3L9YA 4C4KT 4NFBA 1PQZA 1XZWA 2J20A 3U2SA 5BRPA 1NOLA 4MDIA 1A4AA 1XCXA 3BIKB 1VFAA 1IEAB 1I75A 1IE5A 1AR2A 5T1JA 3MRHB