4TMPA

Crystal structure of af9 yeats bound to h3k9ac peptide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
138
Chain Sequence
b'MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AF-9
publication title AF9 YEATS Domain Links Histone Acetylation to DOT1L-Mediated H3K79 Methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 138
sequence length 138
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4tmpA00
2NDGA 2L7EA 4TMPA 3FK3A 5D7EA 3RLSA 5IQLA 5HJBA 2NDFA 5IOKA 3QRLA 5HJDA
chains in the Genus database with same CATH superfamily
2I7SA 3UDWC 1KYDA 3PL6C 3O0RL 4Y2DC 2HJFB 5JW3L 1XMWA 5F9WB 3W0WA 3SPJA 4UQ9A 4AQEB 2IWKA 3BH4A 5I1IL 4A2DA 4F2ME 3NJLA 2ITFA 2V5TA 4LLVB 2XSKA 5D7LB 1X5IA 1E4XL 4NKDB 4M1CC 1T7VA 4P5KA 3MACH 1TQCB 3JVGA 3VU2A 5IJBC 5IB4B 1JF6A 2OSXA 2Y9RT 3IJSB 5FGBC 4HPOL 4GBXB 5DRZA 4ESKA 1AAJA 2UY7A 2XN0A 3Q8EA 2YSTA 1VACB 5GZOC 4AGNA 3J2PA 5F70A 1ORQA 2SEBB 5CKGA 2DY2A 2BSED 4GKLA 4NGHL 1WLHA 1ZLSH 2NYKA 4Y4HC 5GRUL 3PE9A 1PSKL 2B9AA 3KPOA 2YAFA 3P0YL 4QGYA 4U1SB 5J1TC 5CD3A 3L81A 5EDXA 4O58H 5KG9B 1CF8L 2VDML 3DDGA 4K2UL 1MG2C 1A3RH 1QBAA 3AROA 3DX8A 4F7CA 3MRPB 1NIAA 1OT4A 2HRHA 3FCTA 4FQCL 5IQNA 2A0LC 4JLRB 3MI6A 4F7PA 4OF7A 3JUYA 4C58B 3REVB 4JREB 2EXYD 2PCFB 1IGTA 1RHHA 1HNFA 3TVMC 3LNHA 3VXUB 4Z78B 5JIQA 2EH7H 2GIXA 3II2A 1IAIL 3LQAL 3P0VL 1A1OB 3D0VB 1E28A 5E8NA 1A6ZB 3ETSA 1HHJA 1FSKB 1IFGA 2Z8RA 3DROB 3TU6A 4C4KO 5I0WA 3EGDA 3MGOB 5FIEA 3V6FA 3W82A 3IETB 3EDKA 3VXMA 1XF5A 1FUNA 2OX5A 4UQCA 1L6ZA 2ALAA 5AW7B 1FYHB 4F93B 3EJYC 4EN3B 1E9OA 5D7LD 5BOJA 4JCLA 4PRIA 4XHJC 3RAJH 4A7GF 2F19H 4X0KB 1SBSH 2JV6A 3TO4C 2Z92A 4ORGB 2YGPA 5I9QB 1M57B 5FB8B 4JW3A 1O9ZA 1ZIBA 4E9QA 4GBXD 3DTUB 2GC7C 4K3DL 5JW4M 3SKNB 2ZOKA 4HT1H 3ZDYF 1EVTC 4JKMA 5B4MD 2EVHA 1MLCA 4AH2A 2VDKL 1KV3A 3P4MB 4AQOA 4JHWH 1LEIB 3UXFA 3RWIB 1GIGH 3HAEA 3TOPA 1R5IB 3RVXD 4WWKB 3I75A 4DNLA 4YSCA 3TA3A 3C5SB 3T0EC 5GS0C 2WBWB 3DX6A 2NSQA 4U6YA 2DLHA 2R1WA 3H3PH 4U6HB 5KYYB 4P23A 4X98A 3E0GA 4H5SB 2AEPH 4LBAA 2QSCL 3QS2A 3IJ8A 3U1QA 1G9MH 4CU8A 2R69H 3CXFA 2RJMA 4ZX5A 1FZOB 3UX9B 3BEWA 1DN0A 1L6XA 4XC1H 4QWWC 2VMCA 5C0CA 4Z7VF 3MCKA 1KSRA 2IFFL 4ES9A 3P0GB 1KLFB 1KTKE 3MRCB 4I0PC 2OYPA 3VXUD 2A6IB 3OXRA 2NY7L 3HBPA 4OVVA 5D1XA 4J3BA 2DJMA 2BJMH 2FL5A 3JWDL 1KBGL 3NA9H 4HZLB 3FJTA 4UT7L 1QI5A 2D3JA 4WJ5B 3CFBB 2VR3A 4I9WD 5I74B 4HS6A 4JPVL 1TXKA 4X50A 3C5ZC 5D4IA 1V3JA 3WHE1 5HHOE 3DUSA 1HH6B 1MI5D 4FMKA 5B1CA 4EN3D 4G8FB 2BZCA 2MKLC 3QIBA 1HEJC 4J6RL 4YDVB 5D5ME 4AT6B 1QQDA 3O6FC 3KYMB 4KX7A 3BE1L 1CS6A 5DMKA 4GKNB 1AKJA 4TQHA 1T0MA 4PCKA 3WTVA 1BLIA 5DFVC 3VG0H 1BBJB 4TOYH 4ATWA 3GGWB 6PAZA 1JGDB 4YPJA 3Q6FB 1CBVL 3L95A 3FO2B 1PKQA 3QDGA 4F57L 4E0RA 2XJKA 4NIYE 2HRLA 1QSFB 3GF8A 4L29A 5IZ7A 4WWKD 3EHBC 4F7TA 3RWHB 3EBAA 3HC0A 2QSVA 2ZCKH 2Y5EA 3HZYA 3VFRB 3RJQB 4DN4H 2ADIA 1NFKA 4APQC 1BEXA 4YDLB 3OWRA 1N19A 2JTYA 3LAFA 4PVMA 5B22A 5BV7H 1OSYA 3MX0B 1YEHL 4PJFE 2EABA 5D7KE 4HZ1A 1KPUB 1MREH 3FQWB 4G9FA 4Z8FH 1QR1A 1I9JL 2FB4H 4NENA 4R3SA 1FC2D 2ZTBA 2J5LC 3PWPE 2DQTL 3BKJH 1QRNE 1OF2B 5DGQA 1JK9B 3K46A 2VLRB 3L6FB 4G6ML 3A6CH 3V7AE 4P4KA 1SOKA 4WCYH 5KVEE 2W9DH 1L0XA 2NNXA 3RTQB 1KB5H 2V9TA 3OB0K 3C9NB 1CGUA 4KROB 4XWOC 1JPTL 4HIPA 3HI6H 1ACYH 5C9JB 3U4EB 4YE4L 1CICB 4FFWC 4ELDA 2W07A 1I9IH 1AQMA 3X1GA 3EYUH 3ZL1A 4DP6X 5DQDH 3MZTA 3ZL4L 5IVXF 4RZCB 5E2WL 3V0WL 2HB0A 4IRJA 2WP3O 3EJSA 3WKNA 1C16B 4Z3JA 3D0LA 1WFMA 4GQ9L 1NGYB 4PH8A 3FQUB 3RFRA 3NH7L 2N1KA 1CFBA 2JLPA 2A9ML 2I5YH 1KTJA 2ZIDA 2IAMB 2E6JA 3PJSB 4R8WL 4FXTA 4WUUE 4I3SL 5FCUL 2QV4A 1QSFD 3JVFC 2F6AA 4ZUWB 4DN3H 1E5BA 4YQXH 3QVAA 4M62L 2P24A 4N0UE 1WS7A 1OP9A 4L18A 1Q9WB 1PLBA 5GS0L 5KAQF 5HHPB 2ZXBA 3ABGA 4XCNB 5IMOB 1XH3B 4BH8A 1LDSA 2IGTA 4CSSA 2E9GA 4DCQA 1J9CT 1QW8A 3IMWA 2MPAL 4X4ZA 3E6FA 5DS1A 1VADB 4M43L 8PAZA 4G5ZL 4ZAKB 3ZYZA 5E7FA 3UYOD 2FK9A 1ADQH 4ODBD 3RWDB 5C8JB 1A7NH 3P4NB 4U1HA 1TZIB 4U6XB 2VR6A 4UM8A 1QWNA 4UDTA 4FQJH 1JXDA 2VLRD 1JYNA 1GMEA 4EJ1C 4HISA 5DA0B 2GK2A 1WHPA 2AV7B 5I23A 1SVBA 2YAEA 2EDHA 2D3LA 4M7KL 3RTQD 3SO3C 1DVFC 2C3GA 2DAVA 2EDYA 3HS0A 4IM8A 4JFQA 2R8SL 1G7QB 4KROD 3D18A 2QDWA 1RV6X 1QKZH 1Z9SB 3RPKA 4AE0A 2VDLB 5HHXH 2H3XC 2HG0A 1XZ0B 3CC5A 2G9HB 3HG0A 3ZR6A 5FUOH 3GMNB 5SX4H 2IH8A 1Q0EA 4DP2X 3S5LG 4FYRA 5CJOL 2B4CC 3VFPA 5CAYB 3O3DB 4B9PA 2R27A 5IEHA 2AJXH 2O6FA 2ZAHA 4OZGB 2YBRA 1WZKA 4HWUA 4ZO7A 5D7IF 2Z6FA 3GLDA 3Q44A 1MDAA 4OCSL 3KPRD 1HNGA 1INEH 2VTFA 2Y25A 3GUFA 4N0FB 2AJZB 4B7IA 5E9AA 4MAYC 1AACA 3RWGA 3CHPA 3DNKA 5K9KB 3OZLA 4H8VA 4NNPH 1FNSL 3S2CA 3RY4A 4S0TD 4Z1PA 4UQDA 4LVNB 1CD1A 2Y36H 4KNUA 2V17H 4KTGA 1V55B 4IBZA 3SJVA 1CLOH 1U92B 4I18A 5JHLA 4AM0A 1ZLDA 4BCYA 5EV7A 2BP0A 1DBML 3UAJD 1J9RA 2DBLH 2ZP9A 2R4RL 5E00A 3FB6A 5F9OH 5T1DH 4ZAKD 1ZJBA 2A74A 3N85L 5JYMA 5EIIB 4HIXL 4BFGA 1QBLH 5C2BL 1LQSR 2R29H 5FYLD 4DQOH 3MUUA 1HJCA 2WKOF 4YLQT 3FSWA 1RZIA 1T1ZA 3HKFA 3A4EA 5FUCC 4N2EA 4MB3A 4TL5A 2IQ9L 4HAKA 5FFLA 5J1SC 4XNQB 3TZVB 1IQDA 3WLWC 3BKYL 1QD0A 3O2VL 4Z95L 2D7OA 3IDYC 2DM2A 2WZAA 2NLJB 2JQZA 2YUVA 5D8JL 4F7MB 5C2UB 1HHKA 1II4E 1MFNA 3MROB 3NTCL 5EEXA 5DF0A 2H2SD 1ZK5A 2ICCA 3FMGH 5CZVH 4HS3B 3AMKA 1VA9A 4JPIA 5AOIA 2WYTA 1NCWL 3NJXA 2NZIA 4NN6C 2WSPA 2RCSL 1PL3A 5IR1A 4F2EA 1TZAA 1NGPL 1R3HB 1E65A 3FH5A 3ZL2A 1JAEA 3MC0A 2VQTA 2BY3A 1KCSL 4AGQA 1D5BB 4NNXB 2Q2LA 1FVEA 4Z3HA 1WFTA 4X8JB 3IJ7A 2DMBA 3OKNA 4JFHE 4DGUA 1L9NA 4G8EA 3RNQB 1KN4H 1YEGH 4I3RL 2UZPA 2DTSA 4PB0L 4R26H 4H8WC 4ZUUB 5JXAH 2SODB 4KKRA 4C56D 1Q9OB 4NPJA 3LYRA 1KYAA 1SY6A 5EORL 2V9QA 4ETQA 5A6IA 1F4HA 3RX8A 3MLWL 3CSBA 1UWXK 2UUDK 5EZOH 4DOHE 2AJSH 5I18H 1TKWB 1IEAA 2ZUYA 4IK7A 3MBEC 4PJXB 5I6PA 1W0YT 5E6RB 3RYMA 3AXLB 4M61B 2QKIB 2X4NA 1S78D 4LOUC 3Q8BA 4CC4C 4PY8J 5FYJH 3EJZC 3QG6A 1G7MB 5I2IB 4N5UA 3ROLA 1LP9A 4AEFA 2OJEA 1VFAA 4UOJA 2NW3B 1EAPA 4CC0A 2YKKA 2QPDB 3CPUA 4NQDA 4L8CA 2ADJB 2HKHH 3AJ7A 3OKLB 4KK9C 2NMSA 3B9KC 3TZVD 3TCXA 4PTTB 1PTZA 1I1FB 2Z0UA 4DKEL 2UX7A 3MLPA 1KV7A 5E8DL 3F7QA 3QUZA 4PVLA 4P2OD 2ZWSA 4PRBA 1D5XA 1CXLA 3L5XL 4TSCH 5T3ZH 1THCA 5I6OA 3A67L 1BZ9A 2AXFA 3O45B 3TV8A 1D5IH 4RETB 1AQKL 3G3LA 3QQ4B 1EBPA 1NAMA 3HNTH 4JZNB 4X6CB 3IMSA 1MEXL 4NZFA 4L0ZA 4PW9A 3V0HA 3MA9L 2F53E 1EHAA 3OXSA 4UDUA 1JNLH 3BD4A 4M7ZB 3EAKA 4M5YH 1TQBC 5B1AB 5G2NA 1GZHC 3ILDA 4UTBL 1EJ6A 1UYWL 4YDZA 1JWSA 5AAPA 3NSJA 2OPCA 4X5WA 3JQOB 1IU1A 1VFOA 4OR1A 2W5PA 4O5LH 4AQAB 4IDJL 5FECB 3WKML 4JMNA 4RGMB 2ICES 1WC7B 4PJIB 3MV9A 3RDTB 1CL7L 1XF4A 4HJGA 1KXQA 1DVYA 4L1TA 4ZFQA 2GIYA 2DMKA 5AW9B 4OD1L 3CFEB 2Y7QB 2AJVH 2Q3ZA 3FPYA 4DP9X 2JJTA 3KXFE 3L4WA 4G6JL 4OLXH 5L4MA 3U0WH 1DBBL 3KBHE 4LSTL 5L4FA 4GNKB 3SPVA 5EUKB 4KVNL 3NIGF 5C09A 3V8CA 5FKPB 2H0FA 3P4OA 5F9AC 3BGMA 3U82B 1TQSA 2G2RA 4UQ3B 2CUHA 3Q8CA 3AAZB 5E8EA 5BV7B 3ESMA 3SBWC 5HPMB 3CK0L 2VLKE 4N8CH 3SYPA 5HYSB 4KKAC 3MO1A 1HL5A 5T1KA 1I7RA 3LEXB 2XA8L 5FK9A 1RIHH 3IJEA 1P53A 5AZUA 1L0YA 3LPWA 4GUQA 1BIIA 2QQNL 1FNEA 2GTWB 2WVVB 1AG6A 5CGYC 4NQEE 5LWYL 1X5HA 3R4RA 2IBZX 2CGZA 2HKFL 1S9YA 4R4ND 1W0WA 1YEEL 4OFKA 1EH9A 1IC0A 4FNLH 4XNUL 3VFVA 1KB5B 1P1ZA 2ZOOA 1Y0LA 1KN2H 2DQCH 1GL4B 4PJ5B 1F2XK 4B96A 2B59A 3MCG1 4NCDA 4PJAE 2WWOA 5C1MB 1N3NB 4RIRA 4RA0C 1FBIL 3OG4B 4FCHA 3EJQA 5SWSA 1GJWA 3WFCL 1VIWA 4JHUA 4ZUSB 2F58H 3RDTD 1X7TA 3A22A 2W8CA 3GMLA 4MMZA 4H8WL 4TXVB 1M71A 3IDMB 3NPZB 3UC2A 1C5CL 2Q6WA 2UXFA 3TTYA 4JRXA 2HT2C 5TF1L 3D39E 3UPRB 3KLHD 1IE5A 1E4XH 2JE8A 3O4LB 1S7QA 1G84A 1AGBB 3BHBB 1WA1X 2FX9H 3KCWA 3OGCA 4U3HA 4YO0A 1SJVA 1IGIL 2IMNA 4OV6F 4NAJA 2F7RA 3EGXB 4QTHB 5SWZE 3RIAK 5ANMB 3ULUE 4HPOH 5CEXA 4M02A 3FK3A 4JM2A 4PD4J 2XVKA 3QBTB 1AP2A 1G9HA 2C4FT 1B0IA 2FO8A 3MBWA 4QXGH 5KBMA 5IJKA 1I8UA 2J8HA 1EMTH 3FYEB 3GNML 1SUJA 3ZTDC 5E5MA 3LVTA 5DYFA 2PXYB 1PZ3A 5LGJA 2W88A 3MGTA 4KI5F 5HYJB 3DI3B 3DIFA 1H19A 4ZUVB 1XV8A 1QWUA 3GIVA 4CN1A 1CR9H 3NSXA 5EBLA 1QBBA 4QYOA 4K8RC 1CF8H 5FDWB 1ZK9A 2VDMH 5IFJA 3B9VA 4K2UH 1A9EB 4U7MA 1A1NA 3OB0H 3DRQB 4GQPH 1DJWA 1IC4L 4TTGA 2YR3A 4MZIA 2EVGA 2EUWA 1XEUA 3L9RB 5JDJA 4YDIL 4RDQF 1ZT7A 3GMQA 1QEXA 1GH7A 3IDXL 1JVOA 4YSTA 3DO3A 4MTMA 1UT2A 3QUXB 35C8L 4QHPA 3L8QA 2W60A 4A37A 2CHXA 1TZOA 4TVPD 2V5RA 3BAJA 1Q0XH 1OGAB 1J9SA 2JCCF 3P0VH 4Z7WE 2VKWA 1SQMA 3QI9C 3ZXAC 1M4KA 1CI5A 3MRLA 1J12A 3HR5B 4M03A 2H3NB 4X7FC 2VDOL 2J43A 1TLKA 3PAUA 3M8OL 2XBZA 3MSPA 4WW2B 1E6JH 2FHCA 2NT0A 4U1MB 2AK4E 4ZPTB 4H1LA 1S5HB 3ARBA 4N9GB 5BQ7A 5BUGA 4YHLL 1KJ2L 2KHAA 2DMCA 2Q1EA 5L4IA 2ERJC 4U1GB 3JWNC 2BSEA 3LKPB 3CLEL 3HG1B 5A6MA 5D6DA 2W80C 1UD6A 1RK1B 1TENA 4A63A 5KS9B 4K3DH 4IK6A 5DVOA 4YFEA 4H25B 3EJPA 2WD0A 5I1EL 2PXYD 4TUJA 2F8OA 5HYJD 4H0GA 3OLEA 1DQJB 4PLKC 4TN9A 4MMXC 4PJDA 4P49A 4W81A 5CCGE 5I76B 1NOFA 5DJAB 1ZT1A 2C9XA 2ITCB 4IIZA 3VI3F 1JG9A 1IKFL 3WNPA 1BG9A 3GMRB 2EIZA 4NS0A 4XXWA 1E43A 4XMLH 3WG7B 1Q8MA 3OJ2C 2FIRT 2C1PB 3V0GA 4BFFA 3N6YA 1RFDH 5E2VL 2EE2A 2Y1VA 5F7UA 3QUXD 3VXNB 2IFFH 1ICTA 2YPLE 3TV3L 2HJFA 3RIFF 1HL9A 1PZSA 1WRFA 4JO4H 2KQNA 1OGAD 3B7SA 4AQEA 2HFFB 4HK0A 4G59C 3TJHC 1BVZA 2NY7H 4QTFA 2ZP8A 3E1F1 2BSTA 4LLVA 1RL1A 1CDCA 5D7LA 4NKQB 4OD2B 1LE9B 4OM0L 4YNYB 3QUYB 1HEHC 4Q9RH 5AOMA 3IJSA 1ZHKB 4GBXA 2RGSA 4RRPM 3ARGB 1XTMA 1VACA 4N4YB 1O6SB 4OCWL 4UTAA 3FHAA 4J6RH 5BZZA 4MS8C 4D7PA 2APXA 2SEBA 3BE1H 5FPIA 1HKLL 3KLQA 4FXGC 1WIOA 4KJYB 1D7FA 3VGGA 3TP4A 2APFA 3PGCB 3VFUB 4U1SA 5I1KL 4PLJD 4I8DA 3BCDA 4AVKA 4B0MM 2ICWJ 5KG9A 1CBVH 2KPWA 1W6WA 1HX0A 4ZFZA 3CHXA 5DMIL 1AC0A 1FAIH 2AQQA 4K3GA 4F57H 1D6EA 2VLJD 3PPEA 4OH2A 2E7HA 1BAWA 4QJ4B 3CXDH 3HE6B 3BZ4B 3UL4A 2J6EL 3K71B 4JLRA 4MRCA 4ZMVA 4X7CC 2WVUA 2ZUSA 4HC1A 3REVA 2NY6B 4BCZA 4LPYA 1NFDE 2OTWB 3AW5A 1J5CA 3C8HA 3CFCL 3VXUA 1DJXA 3IFPB 1M1XB 3L7FB 3TCLA 4K8RL 3D0VA 3DDFA 1F41A 4X4YB 1YEHH 3PUCA 1NCDH 1NL0H 3IU3B 4Z0BH 4EZLA 2QGCA 1J11A 5K9QI 1F1AA 3HG5A 3M07A 1I9JH 3UH8A 3IETA 3W57A 1HXYB 3CU1A 3S36X 2VXVL 4KX8A 3TIDB 1MI5A 4AOFA 1GVIA 2DQTH 4EN3A 1UTDA 3FTVA 5DMJB 5B7EA 5KYWB 1CDHA 1E6OL 3QUYD 4X0KA 2EACA 2PPCA 3LSOB 5J9PA 3H85A 1AMYA 1FF5A 2XT1B 3D7PA 1TYEB 4MDRA 4MA8L 3WJJC 2LTQB 3I2CL 3K91A 5EWIL 5L0QB 1M7DB 4F37F 1B0RB 1UA3A 2MNJB 3ARGD 1MAJA 1OHZA 2CK0L 2GSGB 3RFZB 2CBTA 2H0PA 3KBEA 1OGTB 1FGVH 2XDHA 4Z3IA 3V4VH 2X0UA 1JFQH 1QI3A 3P4MA 3RUGF 4HOWA 1LEIA 3RWIA 4PJBB 2PP9A 5CJBA 4NN7B 3ZL4H 4WWKA 3T0DA 3RVTD 5HI3C 1EAJA 3V0WH 4MQSB 5DJ2B 1FO0L 3SY0B 4U6HA 1BFOB 2FEDC 3WY3A 3NDZE 2UUDH 5KYYA 4OZIE 5GISL 4H5SA 2A9MH 2GJRA 3ZKMD 4RRPA 1T4KB 2XWEA 3ERXA 4KK8C 5CEYB 4D0CA 5FCUH 3FU8A 1FZOA 3ML9A 4WI2A 3UTTB 3SDXE 1F1DA 3KWVA 2B9BA 2JVUA 1QLRB 2BOCB 3S98A 5FYJD 2NY6D 3K2UH 3WUWB 4OF3A 2A6IA 3LMJL 3O2DA 4U05A 4ACTA 4IOSD 1MHPL 3D2UB 3L5WB 4W4NA 4Z3GA 4FLQA 3WD5H 1OCZB 3KEDA 1IGFL 3DSFL 3PDDA 1NMCB 4JHBA 1XGRA 2E74C 3FU7A 5A3IC 5KZCB 1TMCB 3MV8D 5J0BA 4M43H 4R2GB 1KBVA 4NFBA 2ZYRA 2D8KA 2F0CA 1X7SA 4MZ3A 1DCLA 3LPGA 4GFTB 3FOLA 5CLXA 1HH6A 1Z1WA 5AD0B 3I6GB 4FC3E 4ZOCA 1Q1JL 4B9CA 2XZCL 4G8FA 3GBMH 2JKRM 4DK5A 1RPKA 3HE7C 3RQ3A 3L16A 3QNXA 4NAMA 4RESB 4GKNA 4IS6B 3AY4A 4DKAA 4ODXB 3MJ6A 5BVPH 3IPBA 4YBLB 3FAXA 4Q4EA 2EP6A 1BBJA 2F18A 3BPLC 1OOAA 4BZ1A 3IRPX 5IB1B 3I6KB 3Q6FA 4H2CA 3CFJB 3KYOB 2EE3A 3FO2A 3GSQB 3KVDD 4DO6A 3T1FB 1K8DA 3C08L 5D4QA 2MCMA 1QSFA 5CJOH 5HGHB 2ZWNA 3VI4E 1E4HA 3OSVA 3LS4L 4UOW0 1R3KB 1U93B 5EO1B 3GSXB 3RWHA 5IFAL 5MENE 1LO5B 2W38A 1OAZL 3DSNB 3VFRA 1L0QA 4ELKB 2DWDA 2F9BT 2A7BA 2F8VA 3W37A 1ZVYA 3OQRA 4V2CB 1FAKT 3MX0A 4NQCD 4NXKA 3UTTD 4ZQTA 2AXJA 1DUZB 3QHFH 4BFBD 3C2SA 1ZS8B 4AXWB 1XH1A 1MG3C 3FQWA 1ET7A 3GLEA 1AS7A 4J7RA 4NRXB 4YLBA 2ZXWB 1UB5A 3INUL 3WS6A 1EXGA 3H9HB 3OC5A 4ZW3A 1AO7E 1S7RA 3D2UD 2AJUL 2RQ8A 1BQHG 1M42A 1KGWA 4FQ1L 5GPRA 3APDA 3L6FA 2VLRA 4GW5B 4MNQB 4NP4H 5E5LA 3NOIA 1X5FA 3EF4A 4DEUA 4P07A 4LRIA 1FJ1B 2Y3AA 3Q6GL 4KZEL 3RTQA 4XGZB 4OF5A 4HIXH 5FGSA 5C2BH 3CJJA 4ZW5A 2LLLA 2A77L 2MQ3A 5DZVA 4IBQA 5I0DA 5C9JA 4L8BA 3NIDF 5EU4A 3U4EA 3G6DL 5AVSB 5GRYA 5JPNB 5IKCB 4HWEL 3LXUX 1M7XA 3SGKA 4RGNB 4XRCB 2VDMB 4RZCA 2IQ9H 5HDBB 1C16A 2DLFH 5DD3L 1NGYA 4GUOA 3HBQA 3FQUA 2CXGA 5BS0B 1GXEA 5LDSA 2VRKA 4XMPH 2H8PB 4N22A 1RZ8A 3BKYH 1BQ5A 2F5AL 1MFCH 5J12C 3UTSB 1UVQB 4Z95H 5F0LB 3EDJA 2X1XR 3KPRA 4HPHA 3LH8A 4CADA 2CPCA 4QUOA 2VW7A 3GJEB 5D8JH 4ZUWA 4EI6B 1BEYL 1F4YL 4WI5A 3KDMB 5B8CC 3NTCH 2R0ZL 1QLEH 5FOBA 1GW0A 2FGZA 1ILUA 5KYUB 4TSAH 2B2XL 3BP7A 3HLAB 3OJDA 3BH8B 3WNJA 2WLNA 1TTRA 4GAAA 1Q9WA 2WXLA 3OJVC 2RCSH 4OTXH 4DHLA 3D6GA 5HHPA 4XCNA 1TEGA 4QRSB 1UH3A 3IPFA 2VR5A 3UAJA 1U8QB 4PWHA 2B8OT 2BZ7A 1YYLH 1KCSH 3CWGA 3FRPB 1VADA 4PJ9C 3VX0A 1AGCB 4ZAKA 4JFZH 4N90D 2R0LL 4S1QL 4B95C 4ZS6C 1XHHA 4KZDL 3RWDA 3P4NA 1BXAA 1CTMA 2PW1B 5H4ZA 1TZIA 4M4RB 4U6XA 4I3RH 3LIZH 5DO2C 4PB0H 4MNQD 4LU5L 1MCOL 2AV7A 4NN5C 5EORH 4CU7A 4E36A 1KTBA 4B9YA 5BW7A 1AQHA 2XVLA 3MLWH 5CCJA 1G7QA 1UH4A 3LRLA 1P2CB 3QISA 1PEWA 2C3VA 3GMNA 4RGND 1PG7H 5EO9A 4BSJA 4A6YA 2OJZL 2J21A 5FYKH 2IO5A 4OZGA 2NXZB 3ZDZB 1T66D 1XIWC 2PPDA 1H3VA 2WWKO 3LD8B 4P59L 3UTSD 2ARJB 4LSUL 2WXHA 2AAAA 1E4JA 3GMOB 5E8DH 4N0FA 2AJZA 1NBYB 1AHWB 2K45A 4J4PC 1GS6X 1K5NB 1BVNP 3KPPB 1JGLH 3L5XH 2B4CH 3UFIA 4ZMOA 3KR3L 3LN5B 3LZPA 3A67H 5E9NA 2BM3A 1A21A 1AYOA 5DUMH 3LJ3A 1AQKH 1S7XB 4J12A 1A7RH 2BIOA 4OGYL 1MHCB 1F3JB 3ILEA 4PVNA 4C56A 2WB1A 2V37A 3PL6B 1MCEA 3MA9H 4Y2DB 2K3HA 1E2VA 2YA0A 4HA1A 2EYTB 43CAB 3QHZH 5EIIA 4KKLC 5GRJL 4XP9L 1EVUA 1ZLVK 5ICZB 1AS8A 1G43A 5J06A 1VKXB 2WQUA 2AS5M 2MNUA 1I4FB 3ZRCC 2XICA 5E6YA 4YSDA 4TSBH 1A6AA 1I75A 2F54B 2NUTB 1U8HA 4OD1H 2PWGA 3RX9A 5HHQB 4DGWC 4PRAB 4XNQA 2FHBA 1DTUA 4G6JH 3TZVA 1RULH 4ZMNA 5E9DB 5A7BA 4FYTA 1N8ZB 4HOZA 4F7MA 1WSST 4Y4HB 3RWJB 3IU4L 5C07B 2WWNA 3MROA 4P2OA 1LEGB 2FYYA 2N0MA 4CN4A 3WE6B 2NXZD 4HS3A 3PWVB 5DCCA 1U8CB 3T6XA 2GKIA 3CK0H 3DMMC 1YMMA 2BVTA 1ETZB 5CIPH 3QW9A 2F8IA 2XA3A 4HMCA 5IEKB 1R3HA 2I7OA 1NBVH 5C0AD 4GKZB 2AF2A 2P80D 1E4KC 1HILB 1GPOH 1WT5C 3MUHL 2ICWA 1D5BA 4NNXA 2QQNH 5F88B 3BSZA 3SYOA 2X4RB 2X4SB 4IOFD 3TVMB 4X8JA 1DEDA 1KMGA 1ZA3B 1XXDC 1YEEH 3BVVA 4ZUUA 4JKPL 3TPUB 1ZGLB 5JW5B 4G6KL 1Q9OA 2UVFA 5JNYB 2AEWA 3PL6D 2X89D 4MAZA 1RMFL 1TQVA 5SWQB 2ARWA 5SV4A 1FG2B 3V4VB 3WTYA 1LK2B 4L5FL 1FBIH 3AXLA 4M61A 2QKIA 1DSWA 3WFCH 2TAAA 1BZOA 1E67A 1N9PA 4MDIB 3TO4B 4ZFOA 5I2IA 2I9TB 1HINL 3PXJA 2BHFA 3BMWA 3FT0A 4IKKA 3FB7A 2XJLA 1IQWL 3GC3A 2AMGA 4JFDB 2F54D 2NW3A 4MFHA 2R69A 3QZMA 4R7VA 5IJCC 3OKLA 2PPEA 5GZOD 4OJFL 4DEWA 1B9ZA 2NZ1A 5TF1H 4IHOA 1N26A 5AB1A 5TGBB 4HJJL 2WMPB 5E9DD 5H37H 4J2QA 3IAPA 5HGBB 4Y4HD 4A38A 3S0PA 1U58B 5C07D 2E75C 3L3HB 4F9LC 3T0EB 2CSPA 2UZIL 5B39G 2PP8A 4UT6L 1U2YA 1FDLH 4OFPA 4X83A 3O45A 2XQYG 3FU5A 2X4PA 4ZXBC 3GNMH 3Q1SH 4FI6A 3CQFA 2WANA 4E42B 3QIWC 4JZNA 1KLUA 4X6CA 5F6IB 1EAQA 4LVEA 5EU5A 2JNZA 5IB5B 5CEZE 3L17A 2IG2H 5KBLA 5FFOA 5AB9A 5LCVH 4MX7B 5AUMB 4TUOB 4ZDHB 4ZYKB 2ZXGA 3EZ8A 3VAEA 2APTA 5HI4D 3O6ML 4YSQA 1YQ2A 1PLGH 2EIJB 4IRZL 4AITA 4AQAA 5FECA 4TS6A 4YDIH 1WC7A 4PJIA 3RDTA 3IDXH 3KL5A 3WY2A 35C8H 1XGYH 1T7ZA 3C5ZB 1A47A 4LP8A 2GSMB 2X70B 3QCUL 5HDOA 1E9QA 3RTLA 4BKSC 1MCCA 3A4DA 3GS7A 4XHJD 3O6FB 2FH6A 1SXNA 4ZMLA 2BS71 5EUKA 1LQBC 1AGDB 5FKPA 3RGVD 2KZWA 4ODWB 4AK1A 1WAEA 2UZYA 4UQ3A 3Q01A 2CHDA 3AAZA 3M8OH 3P3UA 5JPMC 2O1AA 3TBTB 1IX2A 1KYUA 1I1CA 2FWSA 4YHML 5HYSA 4V2BA 3TEXA 3B7TA 3LEXA 1F18A 3H2WA 3EHBB 5I8KH 3CLEH 4JG0H 4CRPA 3T0ED 2YK1L 2P8LB 2Z8VC 3AREC 3GXIA 3HN5A 1H8OA 4TUKH 4ZT1A 4PGBA 3EO9L 2GTWA 2WVVA 2O72A 3D9AL 5GGRB 3UJTL 1JYVA 3IXAA 1UKTA 4LBEB 5FDYA 4X5XB 3UIYA 3PFUA 5DK3A 2GIMA 5HVGB 4YIQA 4QWWD 1JPSL 2RTTA 2YS4A 1OTSD 2Q9OA 2VRAA 2AK1H 3UJIH 4HEME 2EILB 4LOFA 3ZZ1A 4KH9A 3U4BL 5FUZH 1A7OL 1U3JA 1FH2A 1YPZA 2EYSB 5TDPB 3X13B 1MAKA 4JFFD 2J5LB 2A6JA 2IOOA 4EDWL 4KFMA 4ZUSA 1EAOA 4FADA 3WXWL 1REIA 1EHLL 2EDJA 1IBHA 4YZFF 4G7VL 3F00A 2NYYC 4MKTA 4PV9A 4Q2ZB 3TV3H 3IDMA 1MCLA 1H3TA 2CU9A 3FO9A 3QUKB 5I0XA 3ZLQC 3B5GA 3PWLB 5D7JC 1H8LA 4KTDH 5TDOB 5HVHC 1WBYA 1IIIA 2CXKA 2DQJL 3U2SA 1XH0A 3O6LH 1QLEB 2DQGH 2K70A 1H0DA 1AGBA 3BHBA 4KY2A 4J3WA 1DR9A 2IALB 4U3XA 5DFVD 2WBKA 2ICEB 3EGXA 4QTHA 4BGLA 4Y19B 4KRNA 4WAFA 4RMSA 3VWJB 2FLBT 4AVHA 3MRRA 4O51B 3JWOC 1F3DJ 4OCWH 4QRTB 1CN4A 2PXYA 4BZ2H 2APSA 1FPTL 3EHBD 4ZUVA 1HKLH 2PR4H 1ADQA 3O3AA 1C9SA 4J23A 3KZ8A 2PTVA 4XPBL 5B1JC 2AKRA 4WF7A 1OANA 5I1KH 4HWBL 2CHWA 5FDWA 1H6UA 1LJMA 3D25A 1A9EA 3N1MC 1DE4A 4XN9A 4LHJB 5DMIH 3ENEA 1RIUL 3L9RA 2GYSA 5F7DA 1R9FA 1D9KB 3N1PC 4HHWA 1BV8A 5A16B 2NQCA 1J0ZA 3DI2B 3QUXA 2IGLA 3OLGA 2JLLA 3HUJB 1X7QB 4XP6H 2BPBA 5SX5K 3S4SB 4LT7A 4NO5A 1OGAA 3RLSA 2Z7YA 4AEEA 1B4TA 3FOMA 1OAJA 2HVKB 4XWGL 2PYEB 1U8LB 4KUZL 1JVKA 3KPLB 3SE9H 3RB7A 2M26A 3X3FL 4BWWA 3HR5A 3SO3B 1DVFB 1JZ4A 2Q76B 3I50H 5CD5D 1BMWA 3IJYB 1SF3A 4LE8A 4U1IA 4XWOD 4BUGA 3M45A 4QRQA 1E5ZA 2VXVH 4WW1A 4WW2A 1VFBB 4U1MA 4ZPTA 1MCIA 4JZJC 4RFOH 4N9GA 5KVDE 2JKNA 4A1RA 4EI5B 4ZZKA 4EAEA 4ADIA 3LKPA 1U2HA 4MA8H 1NDTA 4MA7L 3SE3C 1K3IA 2DH2A 1RK1A 3I2CH 4Y19D 3ZT6A 3CVDA 3VWJD 3CIQA 2CK0H 2P9RA 3M1BB 1GGCL 1OP3K 4H25A 2IPKB 1A4BA 1DLFH 4EF3A 3H9SB 1DQJA 4MAYB 2VLJA 4FMFA 1T5WB 4KUCF 2VJ8A 2OI9B 2R29A 1IBGH 3JWNH 5DJAA 2Q8AH 5C6TL 4H0IA 1FO0H 3LY6A 3F85A 4JGJA 2ZAIA 4U1KB 1J9QA 4R9HA 3A21A 3GMRA 5E1AB 5FV2A 2VXQH 3STLA 3WY1A 1SMAA 5GISH 4BD4A 5DJ8B 1HSBB 1WWWX 3FCSB 5I1JH 1J8HE 2ZKHH 3CH1B 4JFEE 2C1PA 4PJEB 5L8JB 1D9KD 3NSDA 1CFVL 2CD0A 1P4UA 2QFPA 1G94A 2DQHH 5DC0A 2P8PB 3W2DL 5E24E 4UI2A 4BHUA 4EOWH 1SYSB 1H3WM 3N41F 3GIZH 5HDQL 4QRPE 3BQUC 2CJ3A 3GSNB 3QJXA 5FYKD 3CTTA 3U83A 2PYED 4OD2A 5C3TA 1LE9A 2FX7H 3IMVA 1IGFH 3AQYA 3DSFH 1TITA 3QUYA 4YNYA 5GZNC 5J3HD 1DVFD 4WJKB 3P3SA 2C9AA 1FFOA 1KCUH 1YECL 1TTBA 1LDPH 1XR8B 2DWSA 4OZ4B 4PB9H 4Y8AA 5AOKA 4PJ7F 2BX5A 1ZHKA 4WFFD 4KAQL 5CIPB 1DSFL 5E99L 3SQOH 5DLML 1NKGA 2X1OA 5ANHA 4C4BA 2P28B 3ARGA 3P40A 3DX1A 4YPGB 5C08E 1P4LB 4ZNEE 2XZCH 5IMKB 4WHCA 1O6SA 4MNGB 5CGTA 3VXRB 1PLCA 3OPZH 3IT8D 4QLRA 3GSVB 4B9GA 1UM4L 2E7CA 4EI5D 1M2VB 3OQ3B 3ARPA 3RJDA 3VFUA 5ESVB 3ASOB 5IROC 2MWCA 4FFZL 4NN6B 4I0KA 5L9DL 5ETUA 4KI5D 1SHWA 4DP4X 4FLHA 5HHMB 4N2MA 3QXWA 5ISZB 1Z3RA 4FNRA 3H9SD 1C5BL 1ZLEA 2VC2H 3JWOL 4MAYD 4URKA 1AZUA 1ZLVH 2YRPA 5EO0B 5BOZG 4F2FA 4L4TB 1EGJL 3BZ4A 7TAAA 5IFAH 4B6ZA 4UIMA 4G7YL 5E95B 2E3VA 1OAZH 1ITCA 2VZOA 1BQLH 3F6LA 3ECBA 3GBLA 3N43B 3F04A 4KHTH 4ZOEA 2OTWA 4BFRA 4DK6A 2PYFB 4L3AA 3IFPA 3L7FA 4IOSA 3MNWA 4ONOA 2O5NA 5FO9B 3IU3A 2EEXA 1E40A 4BH7B 2HFGH 2EE0A 4GSQA 2FATL 3K4DA 3MV8A 1BGXL 1S7UA 2W0KA 4IJTA 1A4AA 4JQIL 3FUIA 5INDA 3MBEB 4IBWA 1DBKL 1EO7A 2V8MA 3INUH 3RY6C 4XPGH 3NCJL 3TIDA 2LW3A 2R56L 1TTAA 3QUMH 4UQEA 3UP6A 3BRDA 2AJUH 3PHAA 1DVUA 3QEUB 5KYWA 2ZAGA 3S3SA 3EFDH 2UXTA 3LSOA 4MGXA 4L1HA 5CFAA 3Q6GH 5E6ID 3MRMB 4N2BA 4IBLT 4EPSA 3IDIB 3HHSB 3WHXA 3B9KB 3QJTB 4DKFL 3F84A 1UWGL 2H6UA 1OGTA 4LCCC 5I26A 1E4WH 3G6DH 3HTLX 3I3BA 3LVEA 3QC5X 4WVRA 4RISL 4HWEH 4FQLH 5BUPA 4M6OH 4PJBA 4JM0A 4HQQL 1RZJC 2GTZB 1P0SE 4QMEA 1MFBL 3NAAL 5DD3H 3D8MA 3MODL 4F3FB 2WTRB 1BFOA 4JFVA 4ONGH 4RQQB 1T4KA 4A55A 5ISZD 2F5AH 1NUDA 3GKWL 2EIKB 2CO7B 5DFWH 2D03H 4NQCA 3UTTA 1F4YH 3BKCH 4JDZB 4YXLL 5T33L 1QLRA 4IRZA 1YEIL 2BOCA 1TQBB 4NZTL 5CU9A 5FO8A 3ZOAA 3VFMA 3K8MA 4YSUA 2X4QA 3KWXA 2B1AL 4ZSOB 4GAYB 4OI7A 4QRUB 3D2UA 3L5WA 1MKFA 3MXWH 5GSRB 4H8PA 4XNZC 5ICXB 5A2AA 4POZD 4AY0A 5CR1A 2EVJA 1W16A 4B97A 2R0LH 2YD1A 3IBOA 4NWUL 4LOUD 3NG5A 4P9ML 1MCFA 1P9MA 3I6GA 4PJAF 4M3HA 5DT1L 5JW4N 3C6LC 3HZKB 4NZUH 4WU7B 1TZGL 4IS6A 3ESUF 3K0WA 5F1KC 4FJ6A 2R2HB 4KK9D 4X7TB 1MH5B 2FQDA 4GRLC 3B9KD 3JTTB 3I6KA 3LIUA 3CFJA 2XN1A 3KYOA 3GSQA 2G0LA 3T1FA 3OC8A 4AI7A 5HGHA 4B53A 2YAOA 4KDTA 3LNDA 3Q2VA 3QFJB 1R3KA 1U93A 5EO1A 3GSXA 4GSXA 3ZDXE 4XN4A 1LO5A 2DYSB 5IBUB 3WMSA 4OLEA 1OSZA 2I60L 3DSNA 1LEKB 3FSAA 5C0BD 4DK3A 4ELKA 4P59H 1JPFB 4RBPK 4WNSA 3ULUF 2FECI 1N59B 3K1DA 4LSUH 5TFSH 4BE5A 2VMFA 4OZFA 1A64A 2BH0A 4Z7VA 4PGEA 1DUZA 5E08H 2ZPKL 3QXTA 4FL4C 1KYOK 5ADOL 4AXWA 4E9XA 1WUNT 3D69A 4GP8B 4HLEA 4P2AA 1XZWA 4P46C 1RD6A 3OKKA 1WD9A 5F7KC 4NRXA 5KW9L 3VSUA 2WCSA 1EJOH 1EEZA 3H9HA 4OGYH 3BWZA 3SGJA 4CVUA 5HP5A 4PBDA 2AV1B 5JIHA 3UZEC 3U25A 3MMEA 1Y6NR 4MNQA 1AJ7H 4UINL 5JHDB 1INQB 2R39A 4GXUN 1P5VA 3N2JA 3T5WA 4N85A 4GXFA 1XF1A 4XGZA 4LGSB 2V4LA 3O3BA 4JFOA 2OKMA 4IBUA 4W9DC 1M6OB 4XP9H 1EEYB 4J28A 2P5EB 1JRHH 3ZO9A 5IKCA 5FA4B 1ANUA 2VB5A 4NHUB 4OLUH 2GG1A 3LKNB 2ZX5A 3S35L 4XRCA 5LG6A 2IADB 1BLNA 4FDWA 4JFXB 4Z7WF 1CFQA 4N6QA 5J1AB 3B1TA 3QXAB 1DBAH 4LLYA 2HUHA 1DQQA 3WFBL 4PGJA 2E27H 4CSPA 1Q90A 1QASA 1WO2A 1WWAX 2H8PA 3UTSA 1UVQA 1LXMA 3RX5A 5F7BA 5FLVA 3GJEA 4EI6A 1K72A 3KDMA 4R4FL 4AQ1C 1H3XA 3Q2WA 4UMGA 4S0SD 4LPWA 4P2YA 5KYUA 1RZJL 1C8QA 1QACA 1D5MB 2H47C 3HLAA 3BH8A 2WHVA 1XBDA 3N9GL 1KGCE 1EK3A 5EU6E 1ZV9A 5IIEA 3MBXL 2EDRA 3TH3T 5KVEH 2F5BH 5EA0L 1R3LB 1NUFA 4AV0A 3O3EB 1MCRA 1U8QA 3ISYA 5IV2A 3NSFA 4PUBL 1AS6A 5JXEA 1AGCA 3E8VA 4CGUB 4LQFH 4OCRH 3SKOB 4HUUA 5BRZE 2ESVE 4E5XB 1GA2A 4Y7MA 5D1ZI 3QO1B 3QI9B 4KXZI 4G6KH 1MFMA 2AQTA 5JHDD 3VD7A 3B43A 4CDHA 1KTCA 2I85A 3OKYA 3JYBA 4PYHA 1JF1B 3BUBA 5EIQA 3X1NA 4C8XA 5KSUB 1FGNL 5E1QA 3JV6B 4L5FH 2HT2D 1U30A 1M7IA 3F64A 5I5RA 5KBKA 1P2CA 2P5ED 3QWQB 2CLZB 3BJLA 4TM9A 3O9WD 4U3CA 3NJMA 3CFTA 2ZOWA 3KMDA 5DMGD 5IVXA 1FO0B 1RZFH 1FYTB 3LEVL 3KCPB 4PIBA 1IQWH 3CVIL 2FGWH 1YY8A 1X5GA 3ETTA 3FU0A 4NB7A 2F74B 4Y16D 3L3DB 2XG5A 5HHVL 5JQ6L 3ZQWA 4B9FA 2B1OA 3DHPA 4GINA 3MJ9L 3TGXA 3D34A 4HJJH 3GMOA 4MMXB 1N4XH 4LOVA 1WD8A 1SM3L 1AHWA 4PS8A 3D3VD 4KHXL 5C0AA 2UZIH 2P80A 3KPPA 3KWWB 4KO7A 4UT6H 3LN5A 2UV3A 1FH5L 3FCUB 1S7XA 4WKXA 4DP1X 1MHCA 1JS4A 1BD2B 1WFUA 5H8DA 1E42A 3SPCA 3DTXA 4HPYL 1V10A 2YSSA 3PL6A 2X89A 3DURB 2AFNA 43CAA 2EYTA 3TBSB 1LO3L 3DGGB 4YFDB 4LKCB 3VFNB 5C7XL 3O6MH 1OARH 4GQZA 1OP3H 3QI9D 3LPPA 1NFDF 4POUB 5C6PB 1VKXA 1I4FA 2V0AA 2F15A 1CGXA 3KPNB 3CFKB 3QQXA 2XTLA 5IVZB 1UASA 1OAKH 5E94B 1I3UA 2F54A 2O26U 2Z35B 3QCUH 2VC2B 4PRAA 5GZOA 1BXUA 4MJHA 2EKJA 4F1SA 4F2MB 4JANB 1T7YA 3ISWA 1VCAA 1Z9OA 5E9DA 4FXGB 1FYTD 4Y4HA 4XMWA 5C07A 1XAKA 4LKXB 5LBSH 2CIIA 3WE6A 4HP5A 1NGQL 1OAXH 3GLZA 3PWVA 5EB9A 4CN6A 4PJ6A 3S36L 4I1RA 3EH3B 4OIBA 4YHMH 1ETZA 3APFA 3FF7A 4PLKD 5JIPA 2CK2A 3CZLA 1T80A 5D96B 4XVUC 4JDVB 1IKNA 1U8MB 2YK1H 1HILA 1C7TA 2VZ3A 5F88A 3ZE2B 4TVUA 3KJ6H 1U41A 4FG2A 2X4RA 3QUMB 3SQBA 3D9AH 3UTPD 2DZEA 3MRDB 3LKSB 4D9QE 2YJQA 4PBXA 1BD2D 4JKWA 3QA3B 3M7FB 1ZGLA 4PI2A 4QKTA 4OZIF 1DJHA 1MCBA 1HQRB 3MQIA 5KVMC 1JK8A 3U4BH 2Y7MA 3V4VA 4KK5C 3GK8L 1QI4A 3BVXA 3IGFA 3WKPA 6PCYA 2Q7YB 3D48R 2OW6A 3FC8A 1E30A 1QPXA 1QVOB 1AD0A 4MDIA 3WXWH 1ZVSB 1EHLH 2BFVH 5JW4Q 4G7VH 3FSVA 4QRAA 3RGVA 3ZZSA 3VO0A 4A7UA 2L7JA 4LDLB 4Z18A 5HD8C 3QR1A 4PJXE 1LYQA 3B2DC 1E5YA 5IMMB 3OAYK 3RY5A 2DQJH 1V3LA 2XNAA 3HNVH 5TGBA 3FB8B 5C7ZA 3TN0C 3EJCA 3L3JB 4E9LA 3HVDA 4XVJH 3V6BR 5HGBA 1J0IA 2I69A 3L3HA 1A66A 1H3GA 2BOLA 4K15A 3EOTH 3T0EA 2YBGA 1K3ZA 3FNKA 4HJSA 3KPSB 3OHMB 1U8PB 4XPHL 5FC9A 5BNXD 3BAXA 2FR4B 1I8LA 5FYJU 1UC6A 2Z4TA 3F62A 3DWTA 3GZQA 4ZMWA 2V2TB 3QPKA 1BW8A 4OM1L 5CJQL 2XWJB 1EDHA 1IV8A 3C75A 1M05B 1FPTH 3HMWL 1MJ8H 1EHXA 5IB5A 1OE2A 5D2LE 4CUCA 4GKSB 4IRSD 4HWBH 4TMPA 4UNUA 2ENPA 3OKEA 4MX7A 5AUMA 4FABH 1BQKA 1DDHA 1IE4A 1TZHB 4JFFA 3NJGA 1TSRA 1ZV2A 2V5MA 5DS8A 2ADGB 3TWCL 2BNRE 3ETBF 1NCUA 4GP5B 4X6FB 2UWEE 5TK4A 2VKXA 3U9UB 3HMXL 2C9PA 1S7TB 2X70A 3HRZB 4TTDC 3OKDB 4Q14A 4IKIA 2YA2A 1G87A 2DJUA 2HZHA 3HE7B 1MW0A 3OM3B 4KUZH 4UT9L 3VG9C 3HC3L 4OFIA 1OAUH 3E6HB 4LSPH 2HX7A 5LGHH 3X3FH 1AGDA 1MCQA 4QXTA 3BPLB 3X1EA 3S3DB 2X9YA 3TC9A 3UMNA 2Z1KA 2OL3A 1QTSA 1ASQA 5HHOB 3LZQA 2XLLA 3D4CA 2H1PH 1WISA 5I1AB 5I30L 3K2IA 1SN2A 3HZVA 4PBWD 5D5MB 3VQ2C 3FT4B 2VH5L 3ZRFC 4WUKH 1CE1H 2HLFD 4NCC2 4P2RE 3RPIB 4J3SA 3MLYH 2FEDD 3AG4B 4OUUB 3KH3A 4JN1L 4OSUH 3COOA 5DJXB 1OM3L 5GGRA 5HDRA 3DOIA 1NMAH 2WKGA 2VWEE 4LBEA 1ACZA 1OSEA 3FQNB 3P30H 3WUWG 1A8ZA 5T3XL 4HKXB 4WY7H 1O9WA 3VXPA 3FKUS 1LK3L 5C6TH 2YXFA 5AL0A 5KJRL 1KCRL 3HFMH 4CW1B 4KU1A 5TDPA 3X13A 5K69A 4ZS7H 3LKQB 5EBMB 3VFOA 2X9XA 1JNHB 1A3LH 2LFGA 4AYFA 1UWEL 1BF2A 4DIXA 5A3ID 4ELME 2EC8A 2VYRE 4JPWL 4PJFB 2EKSB 4PJ5E 4R5TA 2A4ZA 4Q2ZA 3Q05A 1JPEA 1N68A 2X88A 1MF2H 4TNVK 2MCAA 3GD1C 3HC4L 1FL6B 3DVGB 5TDOA 3KYNB 3MRJB 3HE7D 5I75B 1NC4B 1QRNB 2XZZA 5B38A 3BRFA 5GGSB 4DFIA 2IALA 1GGBL 3FZUC 3T09A 2ICEA 4HUMB 1KWGA 4S1SL 3VGAC 7CGTA 2PR9A 4Y19A 4KAQH 5E99H 1DSFH 4ZD3L 1KCLA 3VWJA 3V6OA 2DYPB 2R83A 5HHOD 4O51A 2ZWYA 5J12B 1SNRA 3DYPA 1CVSC 1NCAL 2YPVL 2FUQA 3O4LE 1J0JA 1P7QD 4PFEA 3MJ8A 5ID0B 4WFEE 5B8CB 1QTYT 3GJFK 3L54A 1UACH 1NAKL 2FSEB 1YMHA 5ANME 2WVSA 4DPCX 4UNVA 3RIFK 4JX0A 3LIZA 2B77A 2ZWKA 3IBEA 5IP4A 5HYQA 3BW9B 3DECA 4O2EB 5KOVC 2JJVA 1C5BH 4YC2C 3JWOH 4N68A 4P2QB 3R8BB 5HYJE 4OLWL 3N44F 1D9KA 2EDXA 2CALA 3FT9A 2WXFA 4KJWC 4PJ9B 3UEZA 4XX5A 2YGQA 1NBZB 4N0UB 4HU2A 4CVXB 3VD5A 3L4XA 1X7QA 4AKOA 1KIRB 4D8OA 3H9YA 1UXMA 3FUKA 4W68A 3TBWA 5DGRA 3NP3A 1YUHB 4X5LA 4FZ8L 1WV7T 2PYEA 3RI5F 3UYRH 4BFEA 4NN5B 4G72B 1M7UA 1XSJA 4N8VG 5D7KD 3KL3A 1DVFA 1QO3A 2YFOA 3IJYA 4JQIH 1DBKH 3KLSA 5F6HI 4C4UA 3QUHA 3QRLA 4XZUB 1T1XA 1A6UL 1VFBA 3DUUB 4MD0A 1E2WA 2JKTM 4LQ1A 3PWPD 4GB9A 1QRND 2FLMA 3BN9C 2CO2A 5FS5A 1BVLB 4EI5A 1NJ9B 3L2NA 4J27A 4OZHB 3NUKA 4GO8A 4NFDA 4Z7UB 4IJ3C 3GYRA 4U4IA 2VXSL 2HG5B 3B34A 1XIWB 3ECQA 3RL1B 4NJ9L 4DKFH 2VN4A 2J4WH 2IPKA 1ETB1 1ORSB 3ALPA 4XO5A 4HJ0C 4ORZC 3RP1A 3H9SA 3HNSL 2QELA 2VR8A 4MAYA 4ODSL 1DQML 3C2AL 4UQ2B 1JZ2A 1HFUA 5A2JH 4HQQH 4NBYB 1G0XA 1AR1C 2GK0A 3HG1E 3K3QA 1KELH 1QA9A 2GJ6B 4HBQA 4AMKL 1EZVX 5I15H 2CJTA 4R7LA 1VZGA 3C60C 5KS9E 4KXAA 5E1AA 2VERN 1PBYA 3FRPG 1FRGH 3GSOA 1DLHB 1HSBA 5DJ8A 3IAGC 3GKWH 1A8JH 3CH1A 4Q6IA 2HRGA 4HEPG 5KVFE 1A0QL 4WUUD 2PO6B 1HQ4B 4HCGA 4MXVF 4PJ9D 5CWSB 4YXLH 3CDZB 1YEIH 1ZEAL 4NZTH 2FT6A 2P8PA 4KQ3L 3AWGA 5IREA 2DEWX 5DO2D 3T3PF 1Z5YD 5HPOA 4G1MB 3PWNA 4KKNA 2A38A 3GSNA 3P54A 3N50A 4UYPA 3ARDC 5DJ6B 5IB3B 1R46A 3DVNB 3QAQA 4BKLB 4FLOA 4XP4L 1OAQH 1RKRA 3OMNB 1YJDL 2W65B 4OZ4A 1M3JA 1Z9NA 2CBPA 4JO8A 4M5TA 5E6IA 5C0EB 1SLWA 5CIPA 5AOZA 4NWUH 3V5KB 1F45A 3S34H 1BBDL 4YPGA 5DT1H 5BVJB 2FYVA 4MNGA 5GRVL 3GSVA 5C0IB 4PGDA 3PF2A 1G7JB 4PJHE 2QT6A 3A6BL 1DJYA 1M2VA 1T89C 4XCYA 5EU7C 1AXSA 1URIA 4FE9A 3VX1A 2W9LA 5D93B 5ESVA 1T3FB 1XIWD 3DMMB 4KTEH 5IOPB 4RA3A 3VXTB 5AL8A 3CX2A 5EC1B 1AHMA 5ISZA 2D31A 1IBDA 5EZIL 1HC1A 4J4PD 3TEUA 4NRZB 2APVA 1OZTG 5DUPL 5EO0A 4YL4A 5AOJA 4OCYL 3WCYA 4Y9BA 3F65A 2I60H 5I76A 3H54A 4O02H 4LSQL 2PYFA 2ATKB 4HX1A 1MNUH 5HSFA 4AZ8B 2YOCA 1VLXA 1JI1A 1SHSA 2P46B 2PO6D 5FO9A 4PLNC 2ZPKH 2Y1YA 3EDDA 3KH4A 3NQKA 3QS3A 3QZNA 4BH7A 3RVWC 2J88L 3EXJA 1KBBA 3ROOB 1G4MA 4M8VA 5I1CL 2FWLB 1TJIH 1AHKA 2ZONA 1NMBL 4ODHL 4XC3L 1CT8B 5H37A 4OJEH 3T08A 3GHBL 4CU6A 1P7BA 2A9NL 2OMWB 3L4VA 4IMLB 1IEBB 5IOKA 5LDUA 1HT6A 3ARZA 4ONHB 4HXAL 3JZ7A 3KNBB 5F3BA 2KDGA 1PY0A 2FUTA 5F7AA 3MRMA 3R0MA 4EO5A 3DJSA 3IDIA 5AVTB 3HHSA 3E7JA 3B9KA 4DOHB 1QR4A 4K3EH 3T6ZA 1T20B 3BYTA 2APBA 3V10A 3KJ4C 5ENWB 5T3ZE 4GEJA 1S9XB 3S35H 5LCVA 2WQ8A 5MI0C 4FXLA 4N20A 1JPST 1BFVL 3ARYA 3MLUL 4XE0A 3WFBH 2WTRA 3DMMD 3S37X 5TDNA 2E7BA 4ZXBB 4W9LC 5L6YL 5C0BA 4RQQA 3QIWB 1UJ3A 4H20L 4XNMB 2CO7A 3AGVA 3L1OH 4QXVA 4JDZA 2XN9E 1MZYA 4PGZA 3GFUA 3JUZA 1GZHA 1NM4A 3K6FA 3N9GH 1OCOB 1TJGH 1DVQA 4ZSOA 4GAYA 3PWUB 3RA7L 3OAYH 1RJZA 5ICXA 4OT1L 1OM9A 3D4GA 3QFDB 1E7UA 2ED7A 3CQPA 3GZPA 2GTQA 4PUBH 2CCLA 1AZZC 3TONA 4PHXA 3F58L 2F53B 2MOGA 1C8PA 4BQCA 4TLUA 3U2IA 4JFHD 2OMBA 3CCHA 2DL9A 3H7BB 4YK4B 1GYAA 1R33A 2H3KA 1CJYA 3HZKA 4WU7A 1CYXA 1Z3GL 1GOHA 4P3WA 3P2DA 3MXVH 3ZTEA 3BT2L 1MFUA 5E70A 4LEOA 4P3CL 3PS6A 3SBWA 3IMBA 5JPMB 1ED3A 3JTTA 2O6PA 1BZ7A 1MRDL 1TLMA 4QHMB 3BZEB 1U3HB 3KXFB 4WHDA 4PMFA 1XF2B 5BZXA 5B21A 4XPAL 3J8F7 5DSCB 5DVKA 3AREB 1T2QL 1VGKB 1RK0B 2IDFA 1B0WA 1EEQA 2CCVA 3HHRB 1A4JA 4NOBA 4XX1G 5E4IA 4ZXBD 1LEKA 3T0WA 3VQ1C 1B4LA 1JPFA 4YN3A 3KD4A 1N59A 3MJ9H 2VLKB 3HN3A 5D4JA 4NKMB 3UROR 2QBWA 3EUUA 1SM3H 1B2WL 4M29A 4KHXH 3CMGA 4JJ5B 4XCCH 3NZ8B 3I9IA 3WFEH 3F7VA 5AWNH 3WDIA 1OP4A 2X42A 2EDBA 2I25N 2CO4A 2MQ0A 1B0GB 1FH5H 2Y7LA 1WZ1H 3QCTL 5GRVK 3S6CA 2R4SL 5TQ0L 1WZAA 4NQEB 5D70L 2WLLB 2EVFA 3LDBB 1IM3D 2X3AA 1JXFA 4JM2F 2AV1A 2CLRB 3KS0J 2G3NA 3ULVC 5JHDA 1INQA 1TNMA 2E9JA 2OA9A 2LV4A 3CD4A 4J3OC 3T4AB 4FQQB 4NDMB 3SZKC 4M9PA 2F53D 5E4EC 5D7JB 5DYOA 1LO3H 1RUKH 4BZ2A 1M6OA 1EEYA 5HVHB 2HA1A 3JV4A 2P5EA 1U4EA 4OF8A 2FJHA 3P2TA 4PI0A 3O9WA 1IRAY 5FA4A 4IQHA 1JD9A 1V7ML 3GSWB 4NHUA 2V7HB 3DV4A 3LKNA 4HS8L 1JV2B 1W0VB 4JFXA 5J1AA 1FQ9C 5SX4I 3QXAA 2V6HA 2FQGA 3IE9A 4GI9A 4Y16A 4QHNB 1OT2A 5TD4A 2JSFA 1MFAH 1N5AB 1U3HD 2VL5B 3KXFD 5D2NC 4A2HA 4XTRD 3SDAC 5FOJA 3UC0L 2VABB 4LASH 2XHNA 3D39B 4U6VL 5BRPA 5DR5L 4KDVA 1R0AH 5JUEL 3PGFH 2LLNA 2IH1B 3D3VA 5CSZA 4KVPA 1U8KB 2LU7A 4L8DB 5E5RB 5HDBE 8CGTA 1NGQH 1D5MA 4JPKL 4MCZB 2P5PA 5BS0E 3WIHH 1JERA 2YD2A 3QEQB 4A04A 1NIBA 2VLKD 3MTRA 4BINA 5JQIB 1R3LA 2J20A 3NZHH 3HBGA 4HDIB 1OXYA 2MPVA 4Q7DA 3RKDD 3O3EA 4AMWA 2FRGP 1DVTA 1TIUA 3WSQL 4HW6A 4X7SH 1UWYA 1I9RL 2Q86A 5BUAA 4MS6A 4QHKI 3QIUD 3SKOA 2PWDA 3VYOA 4NQED 2V7NB 3U1SH 4F8LA 1A14L 2X6CA 2ZG3A 4KKPA 4MJ2A 1NINA 1UUSA 3S5LB 3QO1A 2RIKA 3QI9A 2KLTA 3QO0B 3CH8A 4DVRH 2NR6C 2COQA 3O11B 2KT6A 1Z0MA 3GSUB 5C0RL 2OMXB 2GFBA 2R9HC 2ENQA 3GJFH 2ED8A 1JF1A 5D7JD 2BHUA 1MWAA 3JV6A 3NFSH 2EZ0D 3GK8H 2EXWC 1GGIL 1L4IA 2ZUQC 4PY7B 4G11A 1MLBB 4U1LB 5IW6B 2BCKB 4ZO6A 2K7QA 1N6QL 3GPSA 4NHCL 4D9LL 2KERA 1VERA 1FYTA 2OMVA 3AZUA 4OKDA 4W4OC 5ID1A 3KCPA 2IANB 2VXQA 3KLAB 3BAKA 2BP8B 5IJDC 2F74A 2CDGB 2IBZY 3FUFA 4UOQA 3NJIA 2HWZL 3GO1H 4LL1A 4LPCA 3K6DA 4P9HL 2HPTA 1JOIA 2WO4A 3D39D 4MMXA 2XTJC 4H4NA 1WEJL 1IBBA 3PQYE 2ENSA 2MQGA 4I3GA 4XO4A 5J11C 1ZHBB 1HZLA 3MLRL 1OPOA 1RP9A 2GVYA 1YSOA 5J6GA 4URTB 3KWWA 3ZBMA 2DYRB 5SWZD 3ULUD 4AQ8A 2YD8A 3S4SG 1BD2A 1HEZB 4DGIH 3F2LA 3KYKL 2OK0L 1SHMA 2E4TA 4HKBB 5FYKU 1U8OB 2DLTA 3G6JE 3MREA 1R17A 3DURA 3LNEA 2C34A 1CGSL 4DZBB 4DP0X 2M83A 3NN8B 1HESA 3DGGA 1A3ZA 5AW2B 3VFNA 2LE9A 4MXWH 3MDJA 3SOTA 4BK5A 1A6TB 4FP8L 1MRFL 3GRGA 1UM6H 5D7SH 2V5YA 1MVFA 1JSYA 1RLWA 3AU0A 4N25A 4LP5A 5KSAB 3KPNA 3CFKA 4PQXA 3GRBA 4U0QB 5IVZA 4YR6B 4ABUA 5E94A 3K1KC 1ZE3C 3ULVL 3AUWB 4K7FB 4YOKA 5CCHE 2WO2B 4L4JA 1J7VR 4L8SB 4CMMB 1GYUA 3OHXC 2WIIB 3ZN6A 4F2MA 5JO5A 2HTKD 1DP0A 2DTML 3IWUA 4HKZB 4OGXL 2QZ5A 2W0FA 1EUTA 4FXGA 5L2KB 3L3KB 2IAND 4I89A 3NJHA 4LMQE 4O02B 1C12A 3FBQA 4LKXA 2DQDL 1TO5A 4AX3A 2XCMC 4LEXH 4PG2C 4XPFL 1JDDA 1J5OL 2JKIS 4LCWE 1FN4B 2HAZA 2RB8A 5I30H 1Q72L 5JHAA 1ET5A 2AK4D 5AYUL 3B2VH 3WN5C 4BWUA 2VH5H 4HK3J 2YEZB 3NQIA 4R97C 1T04B 3MOQA 3I02A 4QGTA 3QUMA 4IRSA 3E2HB 4O00A 3MRDA 4M3KB 4XNBA 3U6RA 4JS7A 1A6WL 3LHPH 1A65A 4GQRA 4QPEA 3UPCA 4WRLA 5MEQB 1S3RA 1WITA 2BRRL 4HF5H 2CRMA 1HQRA 4J6IA 1LK3H 4LFHG 5KJRH 4MHHG 4AEIH 1KCRH 1JV5B 2IOIA 5K93A 1GGTA 3UO1L 3CZKA 5KSVB 1NFDB 5DEJA 2XXGA 2GHZA 1I1AD 2Q7YA 5ILTL 1UWEH 1O5PA 2B14A 5KSAD 1QVOA 1T22B 3TEYA 5FM4A 4JPWH 3L5JA 2EH8H 4OAWA 1KCBA 2H26B 4ZFFB 2YPLD 5TQ2H 2VXUL 2OR8A 3ZKND 3HC4H 3O2WL 4LCCB 3NCXA 4P06A 3P73A 4IBTA 5J6HA 1CYGA 1QBMH 5JMRA 1SMOA 3FB8A 5K9JH 1NCCH 4FHKA 5J8OA 3FQ1A 1JDCA 3VFSB 1FLRL 1CPUA 4JO2H 2EUVA 3ARSA 4G7RB 4JFDE 3W1ZA 4MD5B 5CJXC 4LF3A 4ENEC 2BNQE 1AR2A 2GJPA 4MMYB 1YEKH 1U8PA 1DZ0A 3U48A 4ZD3H 4JNXA 2FR4A 1FP5A 2HLAA 1NCAH 2H0JA 3CHOA 2D9CA 5G5DB 2XWJA 2AABL 1M05A 3QZWG 4YHZL 4UIKL 4XPTL 1KGYE 4FN0A 2ZG1A 1NAKH 3V4UH 4A2EA 3TF7C 4ATTA 2AP2A 1HYSC 1X5KA 4FQXB 2GPZA 4HWNA 4GKSA 3TIEA 4PPTA 5A6LA 2BP3A 4GW4B 4UTCA 4OJDH 5KTEH 3PP3K 4A2FA 3BWUC 4QJ5B 4KK6C 4OZIB 3QORC 4NQXB 4G43B 1FLTX 2Y6SD 5EUOB 4Z6AT 1NEUA 2ADGA 3NCWA 1BYOA 4KV5E 1CWVA 1B90A 4X6FA 1XD1A 2AW2A 4XX1E 3SDXB 3NT0A 4AMXA 1A9BB 4O2FB 3AITA 1TFPA 1BOGA 3HRZA 5JTWA 1FE8L 1BCIA 4U3SA 3EOAA 3UYPB 3C6LB 3H0TB 4FZ8H 2GB2A 4G70B 2VSKB 3SGDH 4JRYB 3Q06A 3CFUA 3E6HA 3MNZB 1DL7L 4MNHB 1USZA 1MFEL 1E4XI 3CZJA 4YH6A 4HFWB 4GRLB 3BX7C 5GRZA 4FXKB 4KQ4H 3T04D 5HHOA 1A6UH 2CKBH 5CEZH 3X1FA 1P7QA 5D5MA 1VEOA 3FT4A 1MCKA 2WQRA 5DD0L 2BC4B 3H7LA 3RPIA 4JR9L 2EE6A 2XY2A 3L5HA 2VXSH 1SJMA 2CCWA 1FFNB 3PABB 4ZX4A 3ZQ9A 3H53A 1ZLUK 4NJ9H 4XBPB 2XX0A 2IDSA 3SDDC 2FDBP 3IRZA 5BXFB 2IMMA 2OZ4A 3HNSH 5LG1A 4FQIL 4JVWA 3ESOA 4HKXA 3TXAA 2KC0A 4FL4B 5IQLA 3E8UH 1VB9A 4AMKH 1AGEB 3VI4B 4FQXD 1E8WA 4P46B 1R24A 4PJ8C 5MENB 1G7HB 1G6RH 3FUEA 3VB9A 5LLIC 1S9KC 2LAGB 3OPUA 5LQBL 3R1GH 2PCXA 3LKQA 4QYAA 1YDPB 4GQQA 3VWKC 3SDCB 1U3ZA 1JNHA 1HHGB 2ZCLH 3RZCC 2GY5A 1A0QH 4IEFB 1K2DA 3Q2NA 3OZ9H 3DGDA 3T4YB 4BFNA 1IAII 4PJFA 3P77B 2EKSA 4TULH 3SB3A 1ZEAH 4N2HA 4FGMA 4YXHL 2OYLA 3BKML 1W72L 3VMNA 4LPVA 4PU2A 3WIIL 4FFYH 3DVGA 1PZ2A 3KYNA 3MRJA 3C6LD 1KXVC 3CVHL 3QDMB 5DC9B 1AO7B 3PWPA 1QRNA 4B5ZA 3HJ0A 4NM8L 4RAVA 1IGJA 5GGSA 4XP4H 4YAQA 4N2DA 4ZQKB 1LWRA 4PJCB 4NPKA 3QRBA 2XBTA 4Z23A 1CDIA 1SGKA 4JZOA 3EBIA 4HLZH 3QSKB 3OJMB 1EDYA 1UOWA 3BUDA 4YHNB 3EYVB 1NCTA 3GKZA 3VNYA 4HIIB 3M6DA 1UH2A 5B8CA 3MUJA 3GDBA 3A6BH 4AQ1B 1MFVA 1NM9A 2CH8A 3NABL 4N0RA 4NQTA 5H4YA 4EN2A 2ALWA 2EDLA 2CWRA 3JVGC 1UUNA 3MJWA 1Q4NX 2N1TE 1DJGA 4HETA 4ZMZA 4DZ8B 3BW9A 4O2EA 4AEHH 3B3IB 1Y1UA 2Y6TE 3OMIB 4OGAD 3GJFB 1FNHA 4X9YA 4WUUA 3L7EB 5DUPH 3ZQXA 1LL1A 4PJ9A 4OCYH 1GC1C 5EOCJ 4P46D 5IB2B 4N0UA 4CVXA 3UIZA 5MEND 4P5TB 1KIRA 5FHBL 3VSTA 4LSQH 3CHSA 1BREA 3CBKB 3SDCD 4DO5A 1A02N 1YUHA 4OZGF 3S48A 3P3YA 4KY1H 5KVGL 4FJZA 5CILH 1RPUA 4XCEB 4X9HA 3EH1A 2J88H 1E9PB 2F1AA 3HUJE 1K6QH 4UYQA 2E56A 5EOCL 4XZUA 3GHBH 2DWXA 4WENB 1AO7D 4ERSL 4ZTEA 4PCYA 5I8OH 2BSSB 1NJ9A 1PAZA 4DKTA 5GJTL 4UV7L 5JMOC 4YEEA 1F58H 1Z5LB 2AAVA 2HG5A 1KXTA 1XIWA 2BO0A 4MB4A 3RL1A 1Q0YH 3V4PH 2FIKA 4JCMA 4MQ7B 3ZE1E 3UZQA 2F1EA 5JR1L 1I3VA 1OAYL 2KUTA 3K5SA 5I66B 1KGIA 2CR3A 1ORSA 2A9AA 4M7LL 4LMQI 4V1DB 3AXHA 5MP6H 5BO1H 4J4PA 4UQ2A 5C0ND 1AYRA 2R51A 2X1QA 5DJ0A 1F90L 2NDFA 5L6YH 1DLHA 1XFPA 3N44B 4H20H 4CSTA 5BZDB 5D1QE 4XN5A 1QEWB 5H2BB 2OXGA 2B15A 2PO6A 4K94H 4E5XG 3DETC 5CWSA 3AG2B 3SBPA 5GS2H 5KVDH 3CDZA 1NIDA 3BWAB 3MRNB 4P5TD 1XCTA 2XWZA 3MA7B 3WXVL 4EVNA 2CNYA 4XVTL 1TYRA 3RHWK 3TA3C 2BWDA 2H1LM 4OVUA 4K23H 2YD9A 4IU2B 3OVUB 3RNKB 5IB3A 5DJ6A 1BJ1J 5F93C 3W9DB 3RA7H 2JXMB 2V5SA 3DVNA 4KH2A 1RXLA 4P23C 1FNGB 4PJEE 3GHEL 5LBSA 2HRPH 1JTOA 2BK8A 4OQTA 4WI7A 5FFGA 4ZUTB 5DFAA 1IAKB 3VGHA 3MNVB 3F58H 3OKMA 1S7VB 1EZSA 5H35B 3L3OB 4K07A 4K3HA 1RJYB 5BVJA 3QEGL 5ESQB 4ZBJA 3HI1B 2WO3B 3NCMA 1URLA 4HAGA 1PMYA 3N3EA 5F1NB 4RMTA 1Z3GH 3WHE0 5C0JB 1G7JA 5D1XC 2FJFA 5FUCE 4WU5A 5AKSA 5T5FH 4I77H 3VFTA 1OL0A 1JPGA 2VZSA 4LSRH 3KWUA 3EZJB 3DYMA 2PUQT 3DMMA 1TVDA 4GRMA 5IOPA 2X4UB 3FTXA 3VXRE 3D08A 4PJXF 2P42B 2ZWZA 3VU1A 4FF9A 1MELA 4NRZA 1IM9B 1UG9A 2O30A 3QIBC 1E4KA 4BQBA 2O61B 4S1DD 2XFXA 1QHQA 4QF1B 4D9RE 2EO7A 4L37A 5E2UL 1PZBA 2CGRL 2ATKA 2ENJA 5GGUA 5HHME 4D0DB 2R7EA 2KKQA 4PCSA 3QJVB 5CM1A 4H44C 4TQPA 4FFTA 2VN3A 1MWOA 1B2WH 2CNZA 4L4TE 2F7QA 1N12A 2GEQA 2P4AB 3C6SB 5GJSH 3TFKC 3VA2C 3ROOA 3SYQA 5I0VA 2WXMA 5FF6B 1GC1L 1OKEA 1XB6A 3QCTH 2ZUXA 4FD0A 2Y07H 3FTYA 3X3GL 2OMWA 4IMLA 1IEBA 2WGNB 5I6NA 2X4OB 3RVVD 2E7LC 3D4YA 3EKCA 4ONHA 3B56A 1IC5H 2CMRL 2MHAA 3KNBA 1ZDSA 1WWCA 1RK7A 3QULB 4Y5YB 4OBRA 1HL8A 2N56A 4S0HA 2G3XA 2BINA 2H45A 4OFVA 2FJSA 4HKJB 3PFQA 1T20A 3ZTNH 2L8AA 3TN0B 4QXWA 3WO3B 3MRQA 1AD9B 1S9WB 2WINA 5ENWA 2WJ5A 1BIHA 1K4CB 1S9XA 2IGFL 3M17A 3V52L 5KJ7E 1M1SA 2MTPA 3JV5A 2L7EA 1T21B 3ZE0B 3L3IA 2YHGA 4PJIF 3VYPA 5IG7B 4P4KC 4W1TA 1TT6A 4ZXBA 4UV4H 2ZX6A 1SVCP 4U6VH 1AXTL 1NLBL 3AWFA 4XNMA 4XVUD 1V05A 3VD3A 4JDTL 1Q9KB 2DI7A 5DEFB 4HOMA 3HFFA 3BUYB 5A2BA 1IBYA 2DQUH 2XIBA 1AIFA 3T8MA 1KEMH 4U6TA 2VN6A 4ZMXA 4OD3L 3PWUA 2CIKA 1IM3A 3FB5B 2CHNA 5F21B 4LLWB 4AIXA 3WSQH 2DW5A 4WNJA 5BMFL 4PWJA 4IOIB 2CKBB 3VRIA 4KK5D 2F53A 2UYLB 3D09A 3LPFA 4GI8A 1A14H 2WBJD 1PGRB 1HCVA 2HJKB 2FHFA 1A6PA 1MRCH 4MXQC 3VG9B 3WEAA 4K3JL 1PY9A 5E2TL 3H9ZA 3UTQB 4BXVA 4NOFA 5HD8D 1NFIB 3RGHA 1CLYH 3HBZA 4LAQH 4EZKA 5ADPL 3IKCB 1QSEB 4ONFL 2OV0A 4YE0A 3O8XC 3PP3H 4QHMA 3FCBA 3BZEA 1U3HA 4JE4B 3KXFA 1K4DB 1IIKA 4D9LH 3AABA 1XF2A 3HZMA 1QRKA 1G6RB 5DSCA 2YN5A 1MHHB 3REWA 2QTEA 3W39B 2DI8A 3BP5A 1VGKA 2H32A 1RK0A 4G5AA 5EHFA 4ICXA 5FCSH 3IJ9A 1SQ2N 3OX8A 2Q87A 3EBGA 5DZLA 3EJUA 3Q8AA 3NCYS 1BQHB 3J7HA 4YFLI 1N5YL 2VLKA 1U6AL 4NKMA 1TDQA 2E47A 1J05A 2Z4QA 4BWTA 1WEJH 1IZKA 1I53A 3ETBJ 4IGBB 3EH2A 1HI6B 4B9JA 2AXHA 3QFJE 4OLZH 4JJ5A 2V3FA 3NZ8A 4ZTPH 1JZ6A 3UJJL 1KJVB 1EO8L 2VDRL 1TNNA 3ABMB 1B0GA 3QIUA 5EBWB 4NQEA 2WLLA 1MDTA 4PBVC 1JZ5A 2IDCA 4K5OA 1W72A 2CO6B 3KYKH 2BVOB 4MBOA 2CLRA 3S7GA 1CGYA 1GZPB 3E3QC 3ECVA 2VR9A 5DRXB 3T4AA 5EEVA 4NDMA 5CEZD 3K0YA 1BPVA 4PJAA 5D7JA 4YHOL 3HIZA 7FABL 4JBSA 4CBZA 3G9AB 2CKNA 2UVEA 3CAFA 4FP8H 3MOBL 1MRFH 3GSWA 2FH8A 3MLXH 2V7HA 4GMSH 5DUJA 3NCFB 4I18C 2GHWB 3VGAB 1A5FL 5JOPE 2QVIA 4RMQA 2RAMA 1GJUA 4LSSL 4QHNA 4G42B 1PX4A 1XD0A 1GKOA 2A74C 5D9SB 1N5AA 2VL5A 2VDPL 4MASA 4HG4J 2DTMH 1BVKB 2VABA 3D39A 4OGXH 4S10A 3ZYJA 1X6LA 2FJUB 4DESA 3FTGB 1Y18B 2IH1A 1U8KA 4KFZC 3UG5A 2WLHA 4L8DA 4R4BB 5SWZA 4N2OA 4R7NB 4RAUB 4MCZA 1J5OH 2VJ0A 4GAFB 1R3IL 1Q72H 5GGVL 4YC2B 2BVQB 3TT1L 1KJMB 3DARA 2NY2C 5AKVA 4IGBD 4HDIA 5DWUL 5HGAB 2BSBA 4WW2F 2YMOA 2VR4A 1CXHA 4TQIA 4L0YA 2ITDB 3LX9A 1O9VA 1FI8C 4QAWA 4P0DA 4W70A 1AZCA 3CSTA 4ODTH 3ARFB 1IL1B 3F12A 3IFLL 4RWYH 5KS9F 5F89B 4KO5A 4JQVC 4LLMB 2CJSA 1QMUA 3S5LA 4ZNCD 1CE6B 3SQRA 3QO0A 2BRRH 4UMSA 3OLIA 3BXNB 4AV4A 3ECWA 3O11A 4IDLA 3V4PB 2OMXA 1F4WH 1UA7A 2CLVA 3BZDA 4X4ME 1Q38A 1CL7I 4YZWA 2E59A 3UO1H 3LQAC 4PY7A 4UQBA 1MLBA 4U1LA 5IW6A 2BCKA 5ILTH 1NFAA 3D12B 4Z7WA 2P49B 3U4KA 3TCTA 2G5BA 4IJ3B 3GRWA 5DHYA 4WWOA 3SE3A 2BP8A 5ACZB 1XMEB 2CDGA 1SLUA 4JFUA 3O2WH 3T2NL 4MHHI 2L0DA 2V3EA 2AK4A 3BPCB 3KGRA 3QZOA 4LPUA 5IFHH 4X4KA 1FLRH 1VFUA 1XAUA 1ZHBA 1AR1B 1CK0L 2FCBA 3AVEA 1C5DA 1ZTXL 3AC0A 4NWTL 1MAML 3SKJL 3U7YH 1E50A 3C60B 2RALA 5TE6H 3VSQA 1K85A 2O5ZL 1XB3A 4F58L 2BS8A 3B83A 2IOMA 1QFHA 1U2CA 2IQAB 3DX9B 3U46B 1L7IL 3QWRD 4CA4A 3PU7A 1QNZL 5CLWA 1MCWM 2AABH 5MERB 1B9KA 2WWMC 4FQPA 4XPTH 4PTUB 3CFMA 3QYMA 1MW3A 2ZOUA 2PPFA 3AT8A 3D51A 4U1JB 4WEEA 4DZBA 3NN8A 4K55A 3ARFD 3LNIA 2W9EH 1WBXB 3ARDB 3FUMA 4A2LA 1L7TL 4KRLB 1I1AA 4NYLA 1A6TA 4K0OA 1J8HB 1JZHA 3IGAB 4F80A 4JFEB 5KSAA 3ME0A 1QG3A 1H8NA 2J2ZB 4JO1L 4UAOC 3T65B 1QFWH 5MEPB 3T3MB 1DQDL 4V11A 4X8XA 4YR6A 2RH0A 1RUAL 2YPLA 1HSAB 1I3GH 4L8SA 3RILA 4CMMA 3JWDC 2WIIA 1XT5A 3BIAX 3BN9D 2VDQH 4QRPB 3STZB 1RJLB 3VGFA 4Z7OE 4HKZA 4DP5X 4FFVD 5F96L 4AGMA 1AH1A 2Y1ZA 3AFLA 3L3KA 4I4WB 4O02A 1MFEH 2DS4A 4Y88A 2VAAA 5HVWA 3GMPB 3P11H 5JHLL 4NNYA 1CFTB 1ZE3H 5GS3A 5C08B 4MQXD 5IWLA 2VMEA 2ZOLB 2ZQKA 1N0LA 1XGQB 4JDEB 3RDJA 1XQ4A 1YRKA 4KI1A 2JJTC 2YEZA 3LCYA 3W81A 2CM6A 2W59A 4DFHA 4JR9H 3ZRSA 3C60D 1T04A 3ZKXB 4FHBD 3TO2B 1CZ8L 3CDGB 3V0VA 4LNRA 4EIUA 1I7ZB 5MEQA 3T8VA 4Z76B 1GAFL 4FNSA 1SDAB 5C86A 1I85A 3ZE2E 3EO1A 3UPAA 1JV5A 2JJUA 2X4TB 4PJBF 4E9VA 2OTUB 5LQBH 2WUCL 4WNQB 4WTZG 3RY6A 4CMHC 1NFDA 4HGWA 3D87B 3T6WA 3ARDD 2EEDA 3F83A 2PW2B 4AYBA 1J8HD 3IMUA 4JFED 3SKUD 1T22A 3FU9A 5B39B 2EYRB 3QJHB 2VE6B 1KB3A 5AAWC 5D1ZD 1MFDL 2H26A 2E46A 2FE0A 3U0TB 5AG9A 4GRWH 3BKMH 4LIQL 1MJUL 2ED9A 4KZ0A 3VYNA 3WNKA 1KJ3H 3CPLA 3WIIH 5I19L 3NEEA 4QRPD 3CVHH 2NY1C 4HG4K 3KJ4B 1XTLA 2X3CA 2XU9A 3FQYA 1OEZW 3UBFA 1ZMYA 2ZZUT 5KN5A 5AZ2H 2BVEA 3MU3A 4MMZC 1ROCA 4LSVL 4G82A 5DD1L 1Q94B 4I1NB 2NNFA 3GT6A 5C08D 3BPOC 1SY6L 3Q13A 1U42A 2EDDA 4MA3B 4G7QB 4NC1C 2HFEB 1GJIA 1D7BA 2OYKA 1XCQB 1ZPLA 5K1JA 5IHLB 2DIAA 4FERA 3CLFL 4NO3B 4FQXA 4QNPE 3KPSE 4GW4A 5IM7B 1SEQH 1IZJA 1S8DB 3QPQC 1I8AA 4PLOB 1ZRUA 4OZIA 2P8MB 3FDWA 4NQXA 1BM7A 1SOQA 3AQDA 3B7UX 3L2MA 4I48A 3PP4L 5IJKC 2V3DA 3K6SB 2A6KB 1H8SA 3AU1B 3PV6B 4HCRA 3SDXA 1DQLL 1A9BA 4O2FA 3WEOA 4N2NA 3SDYH 2XYCA 5FHBH 2YD4A 3SOBH 5KWYC 3UYPA 1YAZA 1N70A 4GSUA 1HL4A 3C6LA 4YS4A 5KYNA 1RUPH 5KVGH 4LCVA 4PS4L 5JIMA 2D3VA 3TA4D 3VXSE 3MNZA 3PJNA 3QRGH 4MNHA 3RIKA 3EYFA 1H6EA 1NAML 2F08A 4AYMC 1S3KH 4FXKA 3NIFB 3OAWA 1D6VH 2ZUVA 1UZ6E 3IGLA 4Q9BA 2WAQA 3H3BC 4G8IB 4UV7H 3K6NA 2YUXA 3UO8B 3L08A 2QVMA 4GT7A 1FFNA 3CN4A 3PABA 2B1HH 2Z93B 5E6UB 4XBPA 5JR1H 2ZXAA 1OAYH 3TNNA 4M7LH 5A40E 5CINH 4UNIA 4PRNB 3QB7C 5KANG 3OR6B 1MUJB 3ARBC 3GB7B 2EVIA 3VI4A 3TBCA 2WTOA 4P46A 3ZDXB 1FNAA 1G7HA 5C0DB 5MENA 1CXFA 2NXYC 3LQZB 1F90H 3K5RA 2XX1A 4YJZL 5LNGA 3KAAA 5HDBF 1YDPA 3SDCA 3UZEA 2Y22A 2R0WL 4LOEA 3OLDA 4MYPA 3VW3H 4HUVB 5IW1B 3IDUA 5BZWB 1W8OA 1NGXA 3P77A 3ZKSD 1ZJAA 5E4EB 5I24A 3M1CA 3WXVH 1EERB 4NPYB 1ODAA 2VO5A 4XVTH 4K71C 5T5NG 1AE6H 1OF0A 4GKOA 3VXOA 4D3CH 1CTOA 2R1XB 12E8H 4BBWA 1OIOA 3NACH 3EO0B 3MKKA 2EXYC 1AO7A 3WNOA 3GHEH 5F71A 3H4FA 3WIHA 1MJ7H 3U36B 1GOFA 2DKMA 1SDDB 5E1IA 3P9MA 5FX3A 5IMLB 2Q2EB 3GBDA 2WUBL 5D2NB 3OZKA 4YHNA 3QEGH 3SDAB 3WAKA 4H88H 2Z34A 2OMZB 3HG3A 1COBA 2O5XL 2NY0C 2QADB 4NEHB 4AQ1A 1TVHA 1RURL 1U8JB 3EYSL 1V3MA