4TMPA

Crystal structure of af9 yeats bound to h3k9ac peptide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
138
Chain Sequence
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AF-9
publication title AF9 YEATS Domain Links Histone Acetylation to DOT1L-Mediated H3K79 Methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 138
sequence length 138
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4tmpA00
3FK3A 5HJDA 5IQLA 3RLSA 4TMPA 2NDGA 5IOKA 5HJBA 2L7EA 5D7EA 3QRLA 2NDFA
chains in the Genus database with same CATH superfamily
4J3TA 3U0PB 1NGYA 4B50A 4WI9A 5JDSB 3QS2A 3UO1H 1NGZA 3GSOA 4WV1B 1TJIL 4I1PA 4JO1L 2YO3A 1G6RA 4H40A 5HHXH 2DIJA 2DY2A 4HG4J 3TT1H 5F6IC 1SHXA 3K6SA 1JYVA 2HX8A 4Z7UA 5C0ND 4G59C 3LS4L 5DS8B 5DA4A 1UD4A 4NBXB 3HAEH 5HGBB 3TPKA 2CKBL 3M7OA 1HWHB 3VSQA 5BCAA 1FFRA 3MLVL 3TJEL 1HHIB 2PW2B 4ZYKA 1E90A 3DBSA 5DJCB 5H37H 4FQ2L 1IEBB 1NGWA 5FYKU 4R3SB 1FGNH 2ROYA 2KPWA 2XU9A 3SDXA 1D6VL 1RZJC 4E68A 3NPZB 4UM8B 2JQZA 1Q1JL 4JKKA 4NQVA 5CEZD 3DVFA 4ODXA 4F3FA 4A2DA 4WTQA 3MRMB 4RDBA 3O41B 4Z7OB 1KGYE 1E4XI 2X2IA 4KTDH 4MX7A 5I6XB 4IBZA 1QSFA 2JTYA 1B4JL 4LDLB 4OBRA 4R0LC 5K93A 4MZ2A 3RIFK 1C9SA 1PKQE 4Y1SA 3Q06A 1YEDA 2V0AA 1YPZE 3J07A 4Q2ZA 1UFUA 3ZE2F 3B7RL 4ZFOA 4OF7A 1TPXB 1NKRA 4NQCA 3LIZH 1E2VA 5EEXA 3CXDH 1U8CB 2NOYA 2ZXGA 1KIPA 5E08H 4ZBJA 3OR7A 3ZTJG 1NGYB 5GRJL 4LASH 3VXPA 4FLHA 3REVB 1NGZB 4XMPL 5JNYA 3GSOB 3D3VD 5CF3A 3D18A 1G6RB 3VXOA 1CI5A 3EH3B 3K6SB 5EMYA 4Z7UB 5TF0A 5DSCA 4JDVA 2VR6A 3SGKC 5D2NA 3V4UL 1MAJA 2XWEA 4ZDHA 4BQCA 1TZOA 5I82A 3WTVA 2PCYA 5FYJL 1HXYA 4ZYKB 2BP0A 4Y4KA 2QPEB 5ALCH 1NUGA 4DGVL 1NGWB 1OCWL 5D71H 5GGTL 4NXSA 3TVMD 4URKA 1P6FA 4XPGH 1F13A 4JCLA 2EJ1A 4IKLA 3JQOB 2EH7L 2XZZA 4Z7NF 4CU6A 7FABL 4Y16A 3CK0H 3HI6H 3UG4A 4NQVB 2AQQA 3ZJAA 1PZBA 3TCLA 4CBPA 4ODXB 4IGBC 4F3FB 3GI9L 4DPRA 4R90H 1RK0A 2YAFA 1CUOA 3RGVC 2PPAA 5DEGA 4LLMA 4MX7B 1RMFL 5E1HB 3ZIYA 5I75B 2Y23A 2WVUA 5C1MB 1QSFB 1O7VA 1WUNT 4HCRL 1KOAA 2F0CA 1D5RA 4IW4C 4JPVL 4TL4A 4XODA 5LO7A 4HAGA 4MXVF 1B90A 4L8DB 3RY6C 1YEDB 2ZCLL 3TF4A 1WYJA 4Q2ZB 3BP7A 4ZFOB 4NQCB 4ECNA 2YRLA 3LSOA 2FO1A 1KIPB 2KC0A 4UNIA 3FJTA 3OR7B 2GG1A 2ILLA 4LCWA 3VH8A 4NBZB 3UMNA 3VXPB 1S78C 4TUKH 1DBMH 3RJDA 5JNYB 2EYRA 3W38A 3F62A 3GS7A 1NCAH 1N12A 1JGDA 3ZE1E 4JDVB 3ZDYB 2AK4A 5CCJA 3WEAA 4A66A 1UEMA 3K1DA 1KFGA 1E5AA 5D2NB 5ACMA 3S35H 2A77L 4ZDHB 2XXFA 3DUUA 2WVTA 4LAJH 2AJUH 2ATKA 4OSUL 4NSKA 3TJPA 1HXYB 3VMOA 1RZGA 4S0TD 5D8JH 2VN3A 2BP0B 4Y4KB 5D7SH 4HUWA 4LAQH 5I74C 4R4NC 1FF5A 4GG8A 2DF3A 5A40E 3HI5L 3JWNH 2WSKA 4RMBA 3HBPA 3KPSA 5KSUA 3WLWD 4Y16B 3HC2A 1CFMA 2R4RH 2DEYX 2K3HA 1J0HA 1IBFA 2G0KA 3TCLB 3T4AA 2KT6A 3TNMA 3V10A 4GMTH 4QMEA 1QTSA 2PTVA 2YQGA 4XAWH 3MROA 1RK0B 4PRHA 1JTPA 4PRID 5DEGB 15C8H 4LLMB 4JB9L 2HTKC 2OMTA 1TTCA 2QFRA 2B15A 3AS1A 1RJLA 2VSDA 4M5YH 3IDIA 3L1OH 3BVWA 1XMEB 3BP7B 4JFXA 1ZJAA 1AANA 2H6PA 3ULVC 1VA9A 2QMKA 3QIWA 5CKGA 3LSOB 3IPEA 4KFZC 2ALWA 1LE5A 1IGIL 4Y19D 3W0WD 1U8QA 4UBDD 3MLWH 4LCWB 2IV9A 1I3GH 4P5TC 4HH8A 1EJOH 2A7BA 3MKGA 2EYRB 2XX0A 2FJFA 5E0FA 2FX9L 5A2LH 1AZZC 3TGXA 3WTUA 1JGDB 2AK4B 3BLKA 5FO9A 5DWPA 2D4FA 1JCKA 1MG3C 1Z3GL 3NJGA 3NSYA 3VTTA 2BHFA 3BCDA 2CBPA 2ZUUA 3NCFB 3ARBD 3DUUB 2DMCA 3F7YA 4OLVL 5JA9A 1T83C 4I3SH 3RBGA 5JQ6L 4NSKB 1FVCA 4S1DC 2GSIA 4R4FH 1RZGB 1ZV2A 4GRLD 2DQGL 4HUWB 4R83A 1CURA 2GBUA 4OTXL 1EX0A 2G0LA 1UOWA 1GTNA 3FH7A 4N6QA 1TPXC 2B4CH 3VRJA 4GG8B 1Q9KA 3K5RA 1HL9A 4NNYA 3KPSB 5KSUB 1S3KH 5KW9L 5HHOA 3O9WD 1GSKA 2IBBA 3T4AB 4XBEL 3TNMB 3N1PC 3NIGE 4ZZFA 1NWPA 4N25A 1B2YA 2XV3A 1UFGA 3NIDB 4PRHB 1GCYA 4ZZKA 1S7SA 4CC4A 2ORBL 5IHZA 1DQQB 3QPKA 1RH8A 4JPIA 2OMTB 2AEQL 3OLGA 1UCBL 5D55A 1RJLB 3UAEA 3IDIB 3UP6A 4B6ZA 5CGYD 1YNKH 1IGCL 3N42B 1CE1H 1LEIA 1ASOA 3UOAB 4OIFA 2BNQA 4Y4FD 2H6PB 2WKOA 3BH8A 4OI7A 3QIWB 4I9XA 5E9AA 4JKPH 1LE5B 3NFSL 1U8QB 2D3JA 1CFQA 3R19A 5F1OB 4K3JH 5B38A 5DWUL 1S3RA 3C8KA 3WJLA 4KX8A 4U3HA 4TNWF 3DRQA 3G9AB 3IFLH 2FJFB 3M6DA 5BVPH 4UT6L 4PJBE 3V8OA 1FZKA 3F6IA 5HYQA 4KRPD 4WY7H 3IRPX 5DF0A 4NQDD 5FO9B 4XPAH 2FLBT 1L9SA 3L3DA 3QZWA 3F7YB 1R24A 5I75C 3VD0A 5D7JA 1YQ2A 1FVCB 1WISA 3DUSA 1NEPA 3VXRA 2GSIB 2DQJL 2DEWX 3ZT7A 5DD5H 3SO3B 3RFRA 2R15A 4HF5H 1DVQA 1MRDL 3CMOL 1NCWL 4N0UE 25C8H 4ADGA 1Q9KB 2APXA 4NNYB 1YA5A 3OLDA 1QLRA 1QTPA 5HHOB 2QSQA 3EYOA 3DX0A 4IBLT 3OXRB 4Z3GA 1ITCA 2HX7A 4HUMB 4LVHB 4ACPA 3QCVL 2VR7A 4GAGH 4PGBA 1WWWX 4G71B 5IHZB 1S7SB 1KB9K 1RUQL 1BX2A 1U21A 2DB8A 2JELH 4JPIB 4ZTEA 4AJVA 4N3UA 1X9QA 1GGBL 5JHLL 3HCVA 3PHAA 5AALA 1MJ7L 5D2NC 4N5EC 1U6AH 5CP7A 5KBKA 3QZOA 4JL1A 1TMQA 1LEIB 2BP3A 4HX1A 2BNQB 4FOMA 3BH8B 4OLUH 3OSVA 2C3WA 1Q38A 3AXIA 3NN8A 1CFQB 4WHTA 1PBYA 3B9KA 5B38B 1H9DA 1FL6B 3FFOA 3C8KB 1ACYH 2GUOA 2LLLA 3DRQB 5F7DA 1V7NH 3LKSA 4YOKA 4DUWA 2V2TA 5A1AA 1FZKB 4FNTA 1JUFA 5HYQB 5L0QB 5F7FA 1MZYA 3T3MF 2YQ2A 4L0YA 4H1LH 1A3QA 3QZWB 1R24B 4ZOAA 1S5HA 2Q87A 3EHBC 3DUSB 3QXTA 3VFRA 4MAZA 2HT4C 3VXRB 1GY1A 1UM5H 1CZ8H 3BKYH 4HLJA 1TQTA 4XC1H 4RWYH 1BLIA 3C87A 1EXHA 2EEAA 4GRWE 4ZS7H 4FADA 3VXTA 4MAUH 1QOKA 3PNWA 1QLRB 3BEVA 3M1OA 3EYOB 2QPDB 1O6TA 3C6LD 1NAKL 3QUXD 4DUXA 3JTBA 1A0QH 1NCOA 4Z6AT 3E9UA 2R29L 3B9EA 3IMUA 4PGBB 1NLDH 1QX1A 1J0ZA 4X5WA 1KJ2H 5I15H 3B5GA 4WK4B 3U1SH 1BX2B 2E3VA 3F7QA 5TFSL 1IE4A 3HCVB 2CBTA 5CP7B 2X4SA 5TE4L 1YJDL 3NA4A 4WI6A 5H35A 2WXFA 4HX1B 3BP6A 1GMIA 2BNRE 1G4RA 4PBVC 3MAWA 1FP5A 2AJSL 3NN8B 1TNMA 4MWFA 4WHTB 1A21A 1XH3A 3B9KB 2M2DA 1INEH 3H9SE 2UYLA 4FNPA 4KFMA 3RNQA 4H8QA 2GUOB 4L9DA 4MNQD 1U3HA 1PNDA 2H8PA 5F7DB 1WBZA 4N2GA 3V5KA 3LKSB 1CGWA 2XWRA 3KLSA 3QO0A 4GQZA 5I8OL 2V2TB 4BCYA 1JUFB 1SOQA 3T4AC 4UAHA 3T8VA 3ZYOA 1ZANL 4JN2A 5H2BA 1L3WA 1MAMH 1VGEH 4G3YL 1M2OA 2VLLA 3SPHA 2DLGA 3VWKA 2CK0H 3WSQL 4XN7A 2RJMA 3HFML 4FP8H 1S5HB 4PHZA 3KM2A 2WUBL 1BF2A 1DO6A 2NR6D 3VFRB 5I19H 3LPPA 5LCVL 1ZXKA 2QQLH 4FNQA 5GGUA 3GBMH 3O8XD 4PJ7E 1EQWA 2Z92A 1U4EA 1TZ8A 3ARRA 3L4UA 3P0YL 3K6NA 3QIWC 4Z7AA 2R4SH 4K94L 3VXTB 4CNIA 2JJVA 3PNWB 3Q2LA 3BEVB 1VEPA 2OZ4L 4RISL 4NJ9L 2BOLA 4MA8L 4YL9A 1BD2E 2ZJSL 4X5WB 4WWOA 2E8ZA 4Z7VE 4QJ5B 3WXVL 4WWID 5FM5M 4WENB 1EEZA 4RGNE 4BFOA 4CBZA 1CL7I 1WBYA 2X4SB 3AU0A 3GGWA 5ICYA 5B7MA 5H35B 3BP6B 1CICD 4S1SH 1MFCL 5D93C 4JHVA 1I8AA 2WGNB 3FYIB 1E4KA 5PAZA 1HAWA 3M88A 4MWFB 1FVEB 1XH3B 2MKWA 2V33A 3PY9A 1ZA3A 3QIUB 1K8DA 1ZT1A 2UYLB 3RNQB 2AQTA 1IAII 4UDTA 1SJEA 1N18A 3NIFE 1ASPA 1U3HB 1WFIA 2H8PB 3EF7A 1WBZB 3V5KB 3A3YB 1Y1UA 3QO0B 3AVEA 4ODWA 4Y5VC 3NACH 4LVHC 2IOOA 4HS8H 4JN2B 3K3QA 2VQ1A 3BQUC 2BCMA 2VLLB 4YZWA 1Y7VA 2YPVL 1NCHA 5ECGA 2F5AL 4CC4C 4DAGH 4AYEC 4NWTH 3RAJL 4BD4A 3EJSA 3F7LA 3MU3A 5CCHE 4J5VA 5GGUB 1M7UA 2W59A 4YVNA 4IDJL 4GAJH 2Z92B 4ZMZA 5B1KA 5KVFH 1IFGA 2O6FA 2F74A 3BKMH 2CMRL 4KJQD 3W3BA 3IDXH 5DMJB 4CNIB 4WI4A 4X7DC 3ESUF 2HLFD 4TNVK 5BQDA 4MRCA 2A9NH 3V4VL 3WJLC 3RUGF 1BWWA 5E2JA 5CJQH 1F1GA 1JGUH 3GQFA 1IQDA 2ZUXA 4NFDA 1AG0A 1ZOXA 3ARXA 5FUCC 3KAAA 3TTYA 3HMWH 4Z7NB 1EEZB 4YHKH 4LP5A 1WBYB 3TBTA 3K4DA 1W0WA 4DWHA 4PGEA 3GGWB 5ICYB 2DOCA 1FIGH 2L7JA 2NYYC 4R7XA 5D7JC 5AW7B 1ID5I 4MS6A 4PP1D 1X7QA 5C09D 1ZA3B 2KDYA 1K8DB 4APXA 2DJMA 3MV8A 1ZT1B 1CBVL 4H2CA 3QYNA 4IRSA 4UDTB 1SJEB 5KBNC 1FJ1A 2AQSA 3IBOA 4BFEA 2O5XH 1ZAGA 4ODWB 3QDGD 4JFEA 4PRAA 4OVVA 3KW8A 5L4FA 3F6LA 2VQ1B 2HT3D 2ADJA 4K3GA 4U6VL 1IC4H 3S9DB 1PAZA 3LEVH 4JDZA 1UXSA 1RU9L 2VDKB 3GIZL 2NMSA 2B2XH 1T04A 3JBG7 3IU3B 3ZLQC 4PLNC 2A4CA 1NUNB 4JG0L 3G6JF 4LEOA 2AJVH 4AL8L 1CB4A 5DUJA 5I0ZA 1W91A 4G8IA 1TETL 4YBQD 4JW3A 4E5XA 2CR6A 2IWFA 1MCWM 2F74B 4JN1H 4XNZB 3LS5H 4AGQA 1YEEL 3O6LL 2NCEA 3IFNH 1IGMH 3O0RH 1UUNA 3V0HA 4CGUB 4AJ0A 3BZ5A 3TZVC 2W95A 1XO8A 1U8HA 3IMTA 3BKJL 3LHAA 1DVTA 3T0DA 4P5SA 4BZ1L 4WIQA 4N5UA 2C9RA 2AQ2A 2Y7SA 1J0KA 2ZTBA 4MS8C 4L4VD 1XCWA 5ABZA 1JPGA 3N41F 1BM3L 3TBTB 1W0WB 4PGEB 1M9SA 1E50A 4FS0A 5HDBE 3ZTJH 5AVWB 4C83A 1UATA 5ITFA 2VJXA 1X7QB 4KDTA 2I32A 5AW4B 4APXB 4ODVL 3MV8B 2EVHA 2ROXA 4IRSB 4U31A 3QGVA 1MEXH 2BRRL 3VXSA 1FJ1B 1NMBH 4K7PH 3Q1SL 3MYJA 4P49A 4UWQB 3ZL1A 3H53A 1MFDL 1QFWH 4JFEB 4PRAB 2P8MA 4LFHD 4GBXA 4ODSH 1YEKH 2Y07L 1MW3A 4GKNA 5F0LB 3VFNA 3ALWA 2ADJB 5CZVH 3EYFB 1MREH 4MJ6A 1M05A 1P5UA 4JDZB 1UXSB 4BEIA 4UILL 1RZKH 1XAKA 1T04B 5F7NC 3B9AA 1RUKL 3LS4H 4P23A 4DQOL 1SJVA 1SN5A 4OJEH 4JO4L 4LEOB 1PG7H 4P5RA 4PW4A 3Q8CA 4M1CD 1N3NA 2FGZA 3QJTB 4G8IB 3D2UD 3UBXI 5GS2D 4J23A 3WKML 4JO3H 5ID0A 4KZDL 4BSWB 1DSWA 2J8UF 1IKNA 4FNUA 4AMKL 3QT2A 5C0BD 2Z8VC 2YGQA 4Q9RL 3QI9D 5J11B 4QT5A 3G9VA 2IV8A 3ARZA 3C8HA 1U8HB 3L1EA 1U3HC 4XMLL 3T4YA 4Z8FH 3F7RA 3QUML 5FYJE 3I3BA 3O3DA 2IPTL 4HUUA 3SPVA 3BO8A 1E4XL 4E41D 2GHZA 4NWUH 2HJFA 2X12A 3BFWA 1N6QL 1JPGB 4XNYH 4NI6A 3VWKC 5IESL 4NT6A 4BWWA 4NKIL 4HZAA 4YX2H 1G7QA 1XTLA 1V27A 3SYOA 1N4XL 2VDLL 2A2QT 2Z7WA 4U1GB 4GT0A 4C83B 3FL7A 4GI6A 5ITFB 3LRKA 2EIJB 4H0IA 4BUGA 1SVZA 2PYEA 1Q8MA 2Z1KA 4GXVL 4QTIH 5LDSA 1X7TA 4F8PA 4OF8A 3VXSB 3GXUB 2X0WA 1RZFL 2I26N 3MYJB 1MFBL 5KBLA 2X1QA 2YS4A 3SPGA 2CGRH 4ZXBC 2P8MB 3FF7A 2NXYD 4Z7IA 4GBXB 3EBAA 1JS4A 3VFNB 4GKNB 5GZOA 1HOEA 4BHUI 2P4AB 5C0IA 4EOWL 3FO9A 4MJ6B 1M05B 1P5UB 1WITA 1S7WA 3AFLA 3WDJA 4GKLA 3MC0A 4L3EE 2HJKA 3LPOA 3G04A 4P23B 1KBKA 1MWAH 3EYVA 5FCUH 2B1AL 5IROD 1CU4H 1N3NB 4QYAA 2AMUA 2K4WA 3OAWA 5ID0B 4RFOH 4JEGB 3F05A 4X6DE 1JK9A 3HFFA 3QWNA 3DOHA 2J25A 4HS3A 4IIQA 3HAEA 4U49A 5ICUA 3SYAA 4QT5B 1XR9A 3RHWK 3T3PF 2O5ZL 3AMLA 3FQRA 4PB9H 4KQ4L 3T4YB 1WA1X 2CCVA 1PIFA 3D25A 4HUUB 1Y18A 3O3DB 3SPVB 2IFGA 4D9LL 4KO9A 1YN7A 4P2QD 3BO8B 1ES0A 5H37A 1GRWA 2HJFB 5CSGA 2QQNL 2QKSA 1NGQH 2FEJA 3LPWA 3ARFD 4NT6B 3FU0A 1G7QB 2EYSA 3CZKA 3O2DL 4XVUD 1F4WL 5INDA 3RU8H 4KUCF 5IOPA 3H2WA 4AQ1A 1E8ZA 4NGHH 3RL2A 3QULA 2FBRA 5CJ8A 2H26A 4LOFA 5LKNA 2PYEB 2UZPA 5I0DA 5HVHC 2DEXX 1NC2D 3F3HA 4YK4C 4Z95L 1T03L 3ZKMC 5AEAA 3BAJA 1P4BL 3VQMA 4ZD3H 3KZ8A 4TQIA 5KVMC 3MGOA 1DYZA 4CDGC 3KPNA 4TKWA 4LO9A 3LCYA 1R5VA 3X3FH 1QBLH 3H2QA 5C0IB 5KVGL 3FO9B 1RZ7L 1T6VN 1F86A 4ZNCD 4HSAC 4LVOC 1S7WB 2IMMA 2HJKB 4P46D 4F8QA 2YKKA 3F85A 1UKQA 3P3RA 3T3MB 2YR3A 3AT9A 1OSPL 4KXBA 2A77H 3QORD 5JQIB 1V05A 4OKVA 3PLYA 1JK9B 1MFVA 2F7RA 2XSKA 2DN7A 1G6VK 4IIQB 3HAEB 5D6DA 2YA0A 1XR9B 4IRSC 2V9TA 3FQRB 2Z0UA 4DUVA 1NGPH 5FO7A 4AQAA 4CC0A 2IALA 4F1SA 2UZIL 1HTYA 3US1A 3MLSL 2D2OA 2EDBA 3D25B 1Y18B 3P73A 4JHZA 1YN7B 1UT9A 1ES0B 1VFAA 5FOBA 4FYSA 1IAMA 1XEUA 2XWDA 1W8OA 4PRNA 1SRDA 1YMME 2IPUG 2E9WA 2J1YA 3CQQA 4KNUA 5I0XA 3SKJL 2EYSB 3NFNA 5INDB 3BVVA 5IOPB 3IGFA 4JB9H 3P3SA 4AQ1B 4LB8A 5F8RC 3RL2B 3JT0A 3FO2B 1NFAA 3QULB 1PKQA 3NCMA 2H26B 4UQBA 3OJ2C 3QXAA 5JPNC 1H15A 3GXNA 4PUBL 3AG1B 4XHJD 5I1JH 4HMEA 3DGGA 4CILA 4AQOA 4JR9L 4UQDA 1S9VA 2VDPH 3B3BA 3BOVA 3MGOB 5J11C 1DZBA 1MJ8H 3KPNB 3U48A 4NAMA 2VM9A 5LDUA 3ATBA 3QFJA 1R5VB 4JDEA 3EOTH 2ITCA 2FX9H 5I18L 4M5ZH 2F8XC 4ODUA 5F89A 1KCSH 1WFTA 2QBWA 5B1JA 2XRAL 4PJDE 3TA4D 3FZUC 4F7TA 4OKVB 4DQAA 4UB0L 5E1QA 2FQEA 4XOAA 1AKJA 3GSRA 3BIKA 4KDTC 3E8UL 4PY7A 5FOJA 4OM0L 4HP5A 4LU5L 2VR9A 3UTTD 2PPDA 3O3BA 4L1DA 2W88A 3BSZL 4P3DA 3EGSA 5FO7B 4AQAB 2IALB 4CC1A 1ZLSL 1D6EA 3P73B 4PJAF 3SPJA 2VLJE 1VFAB 5FOBB 4ZUUB 4GBXC 1OANA 2TSAA 3HNVL 3SYPA 1EVTC 2X1XR 4PRNB 1KB3A 2W0KA 3B2UD 2FEEI 4ABQA 4XE5B 4ZG1A 1EV2E 1P5UC 3NFNB 4YDMA 3CXHK 2BSEA 3VFUA 4X4YA 4CDHA 3I6LE 4P23C 3QWOA 5ISZA 4NO0D 1PKQB 3CLFL 5G55A 3ZE2E 4LGSB 4K2UL 1J8HD 3QXAB 2XJKA 4OF5A 1H15B 1WFJA 1KDIA 3PP3H 3EXJA 4LQFH 1NANI 5HY9A 2FT6A 1ZTXH 4MHHG 2WJ5A 3S7GA 4IBQA 3ARSA 5GGQL 4U1HA 3DGGB 4WUUD 1S9VB 1JPTL 3ZKQD 5JHDA 1OALA 1QACA 3QFJB 2AHIA 4WK0B 4JDEB 2ITCB 1R9FA 3V5DA 5HPOA 4O02H 1LGVA 1RZPA 2XZAH 4NDMA 4ABVA 1SXBA 4ODUB 1HEHC 4W81A 5F89B 5BRZA 3WY4A 2OAAA 2PPCA 3DHJA 4F5CE 3HZYA 4R97B 5CEZH 4X4XB 3KPRA 2M83A 5CNHA 4M6NH 4P9HH 4F7TB 3CDYA 4WCYH 1KV3A 1CF1A 3VCLA 4OGXL 1AKJB 3GSRB 3MV7D 2IEPA 3BIKB 2H9GA 4PY7B 3TEXA 2D03L 1E6OL 3MZGB 5HTSA 4Z7WF 3O3BB 1UA6H 4OZIA 4P3DB 2VLMD 2AQ1A 3EGSB 2OSWA 1TTFA 4YDIL 3D4YA 2VKWA 1D6EB 5TDOA 4YPJA 1CGYA 3D12B 3KJ6L 1R33A 3FC8A 3U83A 2WD0A 1JFQH 1GC1L 5C3LD 3IDMA 3L4VA 3OJDA 2N7SA 3VFUB 1RUQH 4X4YB 2YN3A 3PWUB 3QWOB 4Q4EA 4OIIL 2YFOA 4XI5C 5ISZB 3EDKA 4RZCA 2GJZA 1KUMA 2XA8L 4C56A 1VESA 4AH2A 1DUZA 1BOGA 4U1HB 4HD9A 4LFHG 4S1QH 2Z3FA 2VN6A 5J89A 1RP9A 2EDRA 5JHDB 2VL4A 3AADB 3AUVA 2VXQH 3Q01A 4I1RA 4X80H 3BH9A 3OJMB 3BUYA 2QDWA 3V5DB 4YXHH 2D7PA 5DD0L 4LLVA 4NDMB 4HK0A 1BW8A 5BRZB 3HZYB 1R75A 1TO5A 1BJMA 3KPRB 2WNGA 3ARGD 4YWGH 4O9HL 4FQXC 2W0LA 3N43F 2I25N 3ULAB 4AQ1C 4AUUA 1JGLL 1E28A 3FH8A 2Z7ZA 4N8VG 1T0OA 3MSPA 4IRZL 3VCLB 5CN1A 4WK2B 4NUPA 5FFGA 3H85A 4KMTL 3PWPD 1EJFA 4W9KC 2CDEA 2NZ1A 3GSNA 4OD1H 3SDYH 3HW7A 3V9FA 3MCKA 4FFYL 5D70L 3CSYA 4OZIB 1WSST 3STZA 2F58H 3V4PL 5TDOB 2DKMA 2DAVA 3WBDA 5C0RL 3GD1C 1U3JA 2P8LA 3PAVA 1T7XA 5BV7B 1JTTA 1G43A 2VSKB 4U33A 4ZPVB 3LZRA 3IDMB 3UIYA 2XBZA 4F57H 1H6EA 4RZCB 2FR4A 2BVQA 1JZ2A 2IBZY 2GJZB 4GQQA 4C56B 3EH2A 3JYCA 5CAYB 4AH2B 1AOHA 1DUZB 1GA2A 3GKWL 4KY2A 1BOGB 3FO0H 1QBML 3O11A 2BS8A 1N7MH 2WO3B 1OT1A 4UV7L 4IBTA 2JXMA 5D6DC 5FV1L 2B16A 5CMAA 3H1ZA 3LYRA 1CD1A 1Q9LA 2ED6A 3UCRA 1RZ8A 1ADQL 1SVBA 3HPJA 2ZKMX 3BH9B 2JF1A 1QBAA 2BFGA 1QRNA 4ENZA 2V8LA 2E4FA 4HK0B 2DWTA 3SE4A 5JLZA 2BNUB 2J1ZA 3CC5A 3IMWA 2WK2A 4OIAA 1A4BA 1S7XA 4HT1H 1CK0H 4KI5D 3HFMH 2AEPH 1A9EA 1J1OL 1X4XA 5LXGL 1Z0NA 1L9RA 1KF9B 5E9DE 3TV3H 4H1LA 2CDEB 3GSNB 2HFFA 3MCKB 4N0UA 4F7MA 3CSYB 3P0YH 4OJAA 5AYQA 4XMTA 5E2WL 3CBJB 4X8GA 3L5XL 2DLIA 1PY4A 3STZB 3ILEA 2XN9A 4J2QA 5KOVC 1TCMA 3NIGB 4QGYA 1ZV5A 1F4XL 4NJ9H 4ODTH 1QLEH 2DM4A 4K9EL 5AQ0A 1XD1A 2WUCH 5SWSA 1AXTL 1CL7L 5FW6A 1QI3A 2NNXA 1T20B 1A14L 2H6OA 5B1JC 2ZIDA 2FR4B 2BVQB 4BCZA 1ZGLA 3MACH 3PWNB 1QFWM 2K8MA 5T1JA 5AB2A 2F54A 2WYHA 5H4YA 3O11B 3MCLL 3UL4A 1BP3B 4U4BA 1MLBA 2JXMB 4FLRA 5CMAB 2EDEA 4QO1A 1ZHBA 4XCNA 1CD1B 1WWCA 2VC2L 1RZ8B 5I5IA 3HPJB 4R7LA 3U30B 1WZ1H 2HT2D 1QRNB 2XWCA 1OAKH 5I1EL 3O4OB 4S0SD 5AOZA 3CC5B 3K2UH 2WLKA 4MJJA 3EUUA 2B1HL 3JWNC 3C5ZA 1S7XB 4Y8AA 3O6KL 2L04A 1OE3A 4P4RA 1A9EB 3HI1A 1UZ6F 3FTXA 4G5ZL 2WP3O 4H1LB 2XWJA 2HKFL 2CIIA 2Z7YA 2EH8L 2HFFB 4N0UB 1WTLA 4NNPH 4PWHA 5EFIA 3ZMRA 4F7MB 1F2QA 4RH4A 4GSUA 3US9A 1IC7H 2FHBA 1J9RA 1KCUL 2XN9B 1IEHA 3L17A 4YBLB 3RKPA 4JFOA 4U1IA 2P1YA 3T3PB 2J8HA 3KVDD 5SWSB 3U1QA 4GPVA 2L7EA 3RJQB 3Q2CA 3ESMA 4AY0A 6PCYA 3QQXA 5D1ZA 5EO9A 4DIXA 1ZGLB 2YEQA 4P3CL 3SB3A 5E7FA 5AB1A 4ZMWA 4HEPG 2F54B 3UTOA 4OZHF 1T1ZA 3QNFA 3BH4A 1KPUA 4NC2B 3KGUA 4FLOA 1Y6NR 1MLBB 1LO2H 3GXMA 3L3IA 2E47A 4ZUWA 4QO1B 3X3GL 1ZHBB 4XCNB 5T3XD 5F1NB 2YWYA 5AVUB 3CSTA 3ZL2A 1E30A 2A1WL 1TG8A 4BH7A 3A67L 4J7RA 4Q0XH 1MFAL 1D9KD 1GOFA 1SXZA 1YCSA 2YRBA 5HJDA 3BUTA 2XPGB 1L9OA 4XPBH 3JZYA 2B4CC 1XHHA 5GRUL 3C5ZB 5L8KB 2DMKA 4XNMA 4P4RB 3EDEA 5J7CC 3QARA 4L1LA 4OQTH 3QC5X 3VW3L 3HI1B 3LTVA 5AOJA 1JWSA 3L6FA 1JD9A 4RNRA 2XWJB 3NTCL 4PJXF 2CIIB 3RIAF 1JF1B 4U1SA 5EFIB 1L0PA 4NBYB 5C0DA 4UNTA 1J11A 3GMPA 3BE1H 1BQRA 5KJRH 2RCSL 4RBPK 1HESA 1KCKA 3D9AL 2AK1L 3OKKA 4QXTA 2XQYK 3TO2B 4JFOB 2Y1AA 2NY0B 3HZ3A 2QTEA 4NQTA 3HC4H 4U1IB 4MB3A 3N40F 4QYOA 4R96A 2O26U 3RY4A 2LOEA 3BPCA 3QJOA 4MKMA 5D1ZB 1C1EH 2GITA 5BNXD 5J06A 2OK0L 1H8OA 1INDH 4PJIF 2H2PC 3V0WL 4NPKA 4FFTA 2YD2A 3QRLA 4PV1C 1T1ZB 2D7MA 3DTXA 2Y3AA 5AYUL 4GFXA 5G4NA 1KPUB 1FNAA 3GPEA 4ZUWB 3L3IB 2NY6D 2P44B 2QJDA 2Y5QA 5CCKH 3BW9A 4M8RA 1QUNA 1CDJA 4AGMA 2DPKA 1L9TA 3NRFA 1DFXA 1XB6A 3PHQA 1FLRL 3LRHA 4ONGH 3WELA 1CMOA 4XVJL 5D1XA 5KOMC 5JR1L 2HRPH 4XNMB 4YGVA 4UILH 1JZ6A 1I9IH 1I8UA 4KKBC 5KANG 1PAMA 2NYZA 1JWSB 3L6FB 3KH3A 1NEZA 4JFZL 1TTRA 4X6FA 1WAAE 4LVNC 2WB1A 3FOLA 3D08A 4U1SB 3GYRA 5C0DB 3P3YA 3GMPB 1N5AA 3AG2B 3KWVA 1XGZA 1EANA 5L4IA 3OKKB 3ETSA 2O6EA 2Z4QA 4QXTB 5CUSL 3C08L 4Z7WA 1Q72L 4HIPA 3B7YA 3VRLF 1XVSA 3A21A 4QYOB 5F7EH 2MCG1 4BXSV 5LQBH 1YSOA 4Z7VB 4TNGA 4R96B 1TTGA 4AYBA 1HXKA 2PTUA 1OE2A 1SHMA 4JQIH 4W9CC 4AEHL 1A1OB 4RGNB 5JTWA 2OL3A 1IJNA 2XIBA 5FW8A 4M48L 2GITB 4HZLB 2DWDA 3HB3D 2CG9X 4KKLC 3RDTA 1Z6JT 2QPSA 4N6RA 2D73A 3CSPA 3I6GA 1DQTA 3BGFC 5DLML 4PV9A 4RWHA 4PGJA 3GHPA 3UAFA 4B7LA 1MRFL 1NOAA 1TVBA 3TYGL 3NIFB 3WIFA 4XNBA 1F6FB 4KTEH 3HEIB 3BW9B 1QUNB 2E59A 2OA9A 3LRMA 3TM6A 3BUIA 3V79C 2RD0A 3N44F 5EEYA 5TH2A 4ABWA 2C8NA 1MCCA 4GXFA 3PHQB 1CGSH 2NTSP 4UINL 1T2JA 2WLMA 1IILE 5D1XB 1GSMA 2IDTA 4LPVA 4YGVB 2QGEA 4MD5A 1MF2H 3N04A 4C57C 4P57A 1HS6A 3SQRA 2DD8H 1NEZB 1UACH 3RYMA 3VD4A 5TPWL 4X6FB 4PJCF 2JMRA 4M3KB 5KVGE 3FOLB 2ZX7A 2OMNA 4B95C 4F2FA 1TFHA 1N5AB 5EG6C 5F8QC 2VSMB 2WQUA 2Z9TA 4FQPA 2OP4H 1HL5A 3HG4A 3P4NA 4YC2B 3VYNA 2BP8A 5IOKA 1QR4A 4KX9A 4OLXH 2Z4QB 3RKDC 2GI7A 3NJIA 4M43L 4BINA 1HWGB 2YPLD 1YEJL 2P45B 4D9RE 4CSTA 5MENE 2Z93A 4PPTA 3GJFH 1M42A 2VDQL 2OL3B 4X7SL 5EU7C 1SJMA 2XIDA 3C5ZC 3O2DH 4FEIA 1YEIL 2DWDB 3WY2A 2EADA 5DC0A 3VWJA 3RDTB 3CSGA 3JSSA 5D7LD 4N6RB 5AW5B 3BRDA 1SQ2N 2VMJA 2K7QA 1XGQA 3I6GB 5BO0D 5FKPA 1F41A 4PV9B 3FQXA 2R1YA 4UM9A 1AJ7L 2NY7H 1BQUA 1JDCA 1J48A 1TVBB 3WIFB 2D7TL 4F15B 4NUGH 2PPEA 3KJ4C 1IZJA 4GW5A 5TH2B 1ERNA 3MRRA 5GRVK 5D7IA 3LB6D 5GJSL 3DTUB 3GHEL 1EAPA 2NY0C 1PQZA 4Z3TA 5IHBA 3IEAA 4GXUN 3ZTEA 4QXUL 4YDZA 5A43C 1PX4A 4MD5B 5CM1A 4PBWD 1KTJA 1OCOB 3P2DA 4YS4A 3UPRA 4OCYH 4P57B 5D1ZC 1M4KA 5EU4A 2V9QA 1K3ZA 1EJ8A 1UWYA 4H20H 3DIVA 2LE9A 2GBAA 2XKNA 3KXFD 5G5DA 4LF3A 1H8LA 4TLSA 1VHPA 3DK2A 1MWAA 3P4NB 4YUEH 3TCTA 5K9KA 2BP8B 2LU5A 2VZSA 4Z1PA 4DP1X 1UGKA 2NY5L 4QDGA 2A9DA 2Y24A 4IU2B 2Z93B 5IJDC 1HYSC 4IHBA 2G3ZA 3M1BA 3US0A 2IFFH 2NY4C 3UH8A 3RVUC 5CR1A 2GHWB 1J5CA 3VWJB 2ZF8A 3ET9F 3I2CH 1XGRA 1Z2KA 2E6QA 4IIZA 2V5YA 4M62L 4WI3A 1XGQB 1PW3A 3UTSE 2W9DL 3N85L 5FKPB 1YEFH 1KWKA 3FQXB 2R1YB 1J5OH 2MFNA 3FU5A 1JNNL 1S5IH 1LE9A 3AS2A 1LWJA 4DGUA 4YAQA 4QXGH 4QJ4B 3PIQA 3MBED 5ESAA 4L8SC 3KR3H 5TGBA 3RWHA 1AP2A 3MRRB 4X8XA 4HGKC 1R3JA 5D7IB 3AM8A 2V3DA 1JV5A 3DJTA 5F96L 5C07D 1FGVL 1IGFL 1PQZB 4I3RL 1JL8A 1EDYA 4R4ND 3FSOA 4L23A 3UPRB 4F7PA 1W6LA 4YZFE 4KKCD 1FYHB 5EU4B 1JZFA 2J8UE 3B83A 1AHMA 1QWHA 5F7AA 2XKNB 3C60B 4PRPA 5G5DB 4LF3B 3IS0X 1MWAB 5K9KB 4KXZH 4XP5H 1BYPA 4JFFA 3BSZH 3ZGIA 5C08A 5DUML 2FEEL 3H54A 4JFQA 5FM8A 3NVQA 2WHVA 3INOA 2VMCA 1ILUA 3B2PA 3IN2A 3NUKA 3M1BB 4YE4H 3CD4A 4X5LA 2XG4A 5D1XC 5T5FL 1YHPA 1MI5A 4MKTA 1SF3A 1XGRB 3T2OA 4I9WD 1UYWH 2ZQKA 4PJGE 3VD5A 1SMOA 3ULUD 4PJ9D 4HV8A 1LE9B 2C34A 3FU9A 2XY2A 5C0FA 3DI3B 4HIEA 4YAQB 2FCBA 5E4EB 3PIQB 4OZHA 1CG9B 4IYKA 2R0WL 4YC2C 2FQFA 3AZUA 5ESAB 3ZDXF 5GS2H 5TGBB 3RWHB 1AP2B 1X5ZA 1I85A 1R3JB 4EDWL 1JV5B 1TO4A 2GSGA 2WQ8A 4HJ0C 5ENWA 3RNKA 5G4MA 1TCRA 1OVZA 1Z9NA 1WO2A 1OF2A 4HBQA 5KYNA 1WBXA 4F7PB 3AQDA 3AXHA 4WHYG 4P99A 1H0DA 1ZY9A 2D0FA 3S2CA 1FC2D 3GDBA 1TJGH 1LILA 3EAKA 4PRPB 3RDTC 3S8GB 4OF6A 1AHKA 3V95A 5F9WB 2CD0A 1PX3A 3BMWA 3IPFA 3VQ1C 4FG0A 4M3JA 3MKKA 4PIRF 4JFFB 4XWGH 3FUKA 3CAFA 4K15A 5C08B 5TTRA 2FWLB 1EXUA 3MNVB 1LDPH 5GZNA 2NT1A 2XKUA 1TYJA 4JFQB 4FTVE 1ET5A 3AY4A 2DQIL 5EN2A 1F58H 3TYFB 2XG4B 4RAVB 3I50L 4OQ1A 3V6OE 2HYMA 1GS7A 4YSPA 1MI5B 2DM2A 3ZYJA 4BQ6A 4Z23A 3LRGA 2GVYA 5BXFA 1MRCH 4ALAH 4C4UA 3LZOA 4XB3A 1V55B 3S35X 3QG7H 5CLWA 4HV8B 1RK7A 2X6AA 1U8IA 1E9PA 4YO0A 3LZFH 4HIEB 4OZHB 5EOQH 4AGLA 1BAGA 3C2SA 4XX1G 1OLZA 2X2YA 3E3QE 1T80A 5IMKA 4N8UA 2GSGB 3RNKB 3WUWG 5ENWB 3HJEA 1USQA 4DZ8A 3OMIB 4U6TA 4OCXL 2ADGA 1TCRB 3WIHL 1TXKA 2VDPB 2FSEA 4JRXE 1OF2B 3MA9H 2HTLC 4LSPH 2AC0A 4N2BA 3GEWB 3QBTB 1WBXB 4JPWL 2WXHA 3KMDA 1H0DB 4PJDA 2LFEA 3UJJH 2VLKD 4XMKL 1UKSA 2GSMB 3VWJC 4O02A 2YLHA 1A5FL 4XP1L 2XTJE 4IRZH 2WZPA 2CRMA 4AGNA 4XBGA 4QJ3B 3ZZSA 4OLYH 2NXZB 3D34A 3N1FC 3RVVC 3UEQA 1LM8V 5D70H 1M3IA 5IBLC 1HKFA 3N1QC 4H7VA 2P5EE 1R19A 2IANE 3QDAA 1EXUB 3QDJE 4FFWD 1QFUL 4Q58C 5E4OA 1G0YR 1CS6A 1D5IL 4LLWA 5C0RH 3P11H 1IKOP 2R59A 3MMEA 1SLUA 5BW7C 2DV6A 1MFEL 3A22A 4Y4KD 3LH2L 5DJ2A 5KWYC 1HZKA 3S4SG 5BXFB 2WB7A 4YQXL 3D4ZA 1XCXA 3K72A 4GG6E 3MXWL 3X2QB 4ZUVA 4Y16D 1MXDA 1U8IB 1E9PB 3D3VA 3GDCA 4YO0B 1J87A 2YSSB 3MPCA 2V5MA 1QBMH 5BOZG 1OGSA 1ETJA 2J6EL 4NQEE 5E2TH 3GSWB 3VGAB 5IMKB 3OPZH 3LEXA 2IWKA 4DZ8B 3ZT6A 2A0LC 1KXQA 2HT4D 2ICEC 3OKDA 2ADGB 5D7KE 5GS0L 1LD9A 2ZYRA 5HYEA 1SNRA 2FSEB 2X4QA 3PAZA 4NN7C 4WJKB 5JQHC 5K9QG 1X5YA 4K3EL 1E8WA 4GT7A 4PJDB 4QHKJ 2PWHA 1UXMA 4OZFG 4S11A 1HHJB 3OWEA 5JOEA 4O02B 1R0AH 3KPPA 4KO7A 5KVEL 1P2CA 4M7ZB 1P7KA 3EZJB 1JWMA 2HMID 4UTCA 4XBGB 4J39A 4N26A 3CVIL 2OXHA 1DBAL 4YHZL 1CN4A 3U2SA 4PJAE 2WW8A 4HIXL 4TTDC 5E4EC 1KLGA 4POZD 2R0LL 3B2DC 2FATL 2AK4D 5E5LA 4Y5XC 4Y9FA 4POYA 2MSPA 1JZ4A 3AM8C 3GBNL 3HE6B 3OKNA 4LLWB 4CAGA 2Q1EA 3FQUA 3MMEB 4N2NA 3C75A 5FA3A 5DJ2B 5F7LB 2J2ZB 2CRZA 1KB9J 4ATTA 3OXSA 1C5DA 4WQOA 3K72B 2R29A 3N2JA 2NT0A 3NCXA 2PO6A 4ZUVB 1FFOA 5KUMA 2WGXA 3UGEA 3D3VB 4PRBB 1IAIH 4DKTA 1G1YA 4UMSA 2AKRA 5E51A 1CVSC 2FH8A 4XPFH 2WXMA 4LSVL 2LHAA 4FQ1H 2OBGA 3P4OA 3LEXB 4CRPA 2I9LA 4OD3L 2GIMA 3ZGHA 1PD6A 1GZHC 4B9IA 2X4RA 3OKDB 1JXDA 3N3EA 2PXYD 5JW4N 4ODBD 1HINL 5J6GA 2X4QB 3FO1A 3FKUS 1J1XH 3GM8A 4LK4A 5IFHL 3APMA 1U91B 2W9LA 3UZEC 1KXHA 4ZTPH 5B3SB 4DO4A 1KGXA 1NL0H 2B1HH 5KG9A 4DSYA 1GYCA 1YECL 5CZRA 3KPPB 1VFBA 1P2CB 3LIUA 3MODH 1P7KB 2DBJA 4M03A 3VFPA 1JWMB 3VYOA 1IE5A 1HAUA 4G5ZH 1FHNA 3LN4A 3VVVA 2OXHB 1YVLA 1C5CH 3EG9A 3MVSA 3U2SB 1UA7A 4YDVA 1RSYA 5GQBA 2BSCA 4ZT1A 4X42A 4MNGE 1KLGB 1NC4A 3S88L 1LEGA 3OLEA 1UC6A 2Y25A 1I85C 2A6KA 5GGSY 3OKNB 2Y0SA 3RIFF 1AGBA 4OUUA 2EDTA 3FQUB 4TYUA 5B22A 2PPFA 4M7JH 3BC9A 2QVMA 5FA3B 4W9FC 4PHXA 1XFPA 1N2RA 4Y19A 5E8EA 3MNWA 3W0WA 5A2KH 1C5DB 2EP6A 2VR4A 2X4PA 2A4EA 1M53A 2VDNH 1B0RA 4UTBH 3IYLW 1ASQA 2PO6B 1FFOB 1DJIA 5I28A 3FHQA 5DMKA 1LK3L 1SUHA 1MCIA 3QEGH 1R4XA 2AKRB 3FUJA 3U7WH 3WGUB 1OARL 3OAYK 3X3GH 2LTQC 4I77H 5HJGA 3P4OB 2I9LB 3TH4T 2MOVA 3CZFB 4X4ME 5IV2A 1IB5A 5FYLL 2JQMA 5FGSA 2X4RB 1OTSD 5GZNC 3A67H 3MREA 3X14A 4V1DD 3AY4C 3FO1B 4JRFA 3ATDA 1MCDA 4GRLA 3APNA 1P84J 3LN5A 1QLFA 1SQMA 3LD8B 5KG9B 4OJYA 4RA0C 3EYQC 2ZP0T 4HPYH 3PGFH 1VFBB 4DGYL 2DQ6A 4B0MB 1ORQA 5HD8C 3VFPB 2B9AA 5K59F 3LN4B 4F37K 4C4KT 1HX0A 3NTCH 4LKXA 2YPVA 5DQDH 3EG9B 5HHME 5FO8A 4YDVB 5F1IB 3VXUE 3WD5H 1NC4B 5J13B 1LEGB 1FVDA 3NESA 1TZGL 5IQ7H 2RCSH 3OHMB 3V0AC 2KH2B 4LP4A 4ZMQA 5C0NC 2A6KB 3V2AR 3VGAC 1AGBB 4OUUB 3FK3A 2AEOA 4LZKA 4JJHA 4EDXA 5IHHA 1WG3A 5KSBF 5FEBA 1DL7H 3MLZH 4HOXA 4YXLH 2GJ6D 2BY2A 3IMSA 1ADWA 3HN5A 1BFVL 1N2RB 4WTZA 4Y19B 5E8EB 3MNWB 3V4VA 3W0WB 4X7CC 1JI2A 2X4PB 1KWGA 1B0RB 5F21B 1TF4A 1F6AA 2OSLA 2XQBH 3MNDA 2CR0A 4G8FA 3SQOL 1OGAE 3GSXA 4M7ZC 3VSTA 5DMKB 3S34L 3UC0L 3ZZ1A 2DJSA 4KHXH 3NGBC 1NLBH 3RZWA 2QQKL 4KWUA 3OMNB 1J1PH 2CO2A 1N6VA 1I75A 4NQDA 1II4E 1TDQA 1FO0H 1SYVA 4NFCA 4Q6YA 4NRYB 5IV2B 3IRCA 4D0BA 5EU6D 2I5YL 2EVGA 2OW6A 3MREB 3X14B 3UAJA 3BPLB 4PJFF 4X9IA 4F2EA 3MJ6A 2DQCH 4GRLB 2FX7H 4BK8A 2ZKYA 1LP9E 3LN5B 1QLFB 1MJUH 3HN3A 3W2DL 2HVBA 4KUZH 3B9KD 2J1WA 4XVJH 3WU1A 3QISA 4GQ9H 3WNJA 3EYSH 1PLGH 5D2LE 1YDPA 1ORQB 5DEJA 2FJGA 2VDRH 1W16A 5EC2A 2A9BA 3OB8A 1GYUA 4FLQA 5EU5A 2XN1A 4LKXB 4ENEC 1JMXA 1RIHL 4L4TE 5FO8B 4NCC1 2OSXA 2BDNL 4OQTA 4RQQA 1NMCB 2VN7A 4ZX6A 3W37A 3KNBA 2CRIA 4LNRA 4IJTA 5JW4R 1A6PA 4FXTA 1NFDF 1DVYA 3GRWL 5HP5A 4B60A 1H3PH 4NB7A 4EDXB 5T1DL 2H32A 3AUWB 3VQLA 1J8SA 1FORH 3VO0A 3DSFL 1T5WA 2NYKA 3D07A 1ZLDA 2LU7A 1LL1A 3SBRA 4HA1A 3ECWA 2Q86A 3V4VB 2X0VA 2UWEF 1NQBA 1QR1A 3LN9A 4XCCL 3MBXH 2EEBA 3TVMC 4LL4A 1F6AB 2OSLB 4G8FB 4BZ1A 3GSXB 4G1MA 1B4TA 3MLRH 3FB6A 1A6UL 3CCHA 4RETB 3FCUB 2PNDA 4KKPA 4RGOH 1S46A 2EDDA 4MB1A 5BJTA 3UP1A 1P4IH 4NQDB 5GGVL 1ODUA 2E75C 1SYVB 3GB7A 3ATFA 3PPSA 1CBJA 1UWEL 4D0BB 3IU4L 4HPOH 3GINA 3ZDXB 2E76C 4QWWC 1GJIA 3LQAL 1KYOJ 3GBEA 4B41A 3TIDA 3ASOB 2I07A 3QIUD 5T3ZD 1OOWA 3L13A 4QKXB 2FJGB 4QOKD 5DVLA 5EC2B 3T0EE 5EU5B 2QSCH 3C6LA 3QUXA 1FIEA 4XPTL 3RJOA 5IJCC 3QQDA 3TT3L 2EO9A 2EIKB 5IB1A 4RQQB 4UOW1 2HJLA 4Y7MA 2B14A 3KNBB 4LNRB 1YJDC 3QCTH 3QNYA 4I85A 1PZ3A 3GWJA 3MHZA 4TSCH 2Z0BA 2H32B 1T5WB 5DQ9A 3VB9A 5ECJE 2H1PH 3B5TA 1PLCA 3FT2A 5I8CA 1NFKA 4K23H 2EDLA 4QHMA 4Z0XA 2Q86B 4YDLB 1JAEA 1QR1B 4NZTL 1CFVH 3LD8C 4FEMA 5ABDE 3QUMA 3IDNA 3BT2L 1GH7A 3EBIA 4LL9A 4G1MB 2ERJB 3FB6B 4K55A 1Z9SA 3O2WH 3CCHB 2DQMA 1CXIA 1NUDA 1T6BX 2MPVA 1C5BH 5AZ2H 2LLGA 5BJTB 1EBPA 1HNYA 3GB7B 4Z7QE 2ICCA 1JGVL 3ZDZE 1X5XA 4M6MH 1QSED 2NR6A 5E94A 1K4CA 3GHEH 1BVKB 4A2HA 3HTLX 3TIDB 4JDTL 3ZE0E 2I07B 5E1AA 4X83A 4AV4A 1KELH 5FYKL 2F7IA 1EZVX 4H4NA 3GT6A 4OH2A 3B9VA 3DC0A 3H55A 2O5YL 5L9DL 3VFVA 5DHYA 3CLEL 1WAAA 1XIWD 3QUXB 1N5YL 3BFOA 4M9OA 1CXLA 2EZ0D 3QQDB 2JV6A 4OFKA 4WU7A 2GKIA 3HUJE 3HG1E 4GB9A 3MGAA 5IB1B 3CIAA 2HJLB 1I8MA 1OZUA 3D33A 4PYGA 1KBWA 3QNYB 4ADJA 2QEJA 3JVFC 4K7PX 2A99A 3GMQA 1OV8A 3ARBC 1B6DA 5T3XH 1DJGA 1L9QA 2X3AA 5DQ9B 1HNGA 1SDDA 2B59A 1BZQK 5GGVY 3S37L 3HA0A 3BPLC 4O51A 1U2CA 2GW5A 1UM6L 3FT2B 2VW6A 3FTYA 1DQML 2WSPA 4GRLC 4QHMB 4U1KA 1G7LA 4Z0XB 5CS7A 2O72A 1FCCA 1XDTT 2CO4A 5F93C 2WC7A 5SWZD 3QUMB 3IDNB 2ZD0A 2HKHH 4D3CH 2CALA 1CLYH 1Z9SB 3NJHA 2RMNA 4KOBA 1PG7X 3HRZA 4XXWA 5I1KH 1R47A 3QJFA 1WWBX 3FTUA 3O2DA 4N68A 5MHSE 3VSUA 2V5RA 2VDLB 5AVRB 2XG5A 3BVNA 1K8IA 5GIRA 4XXDA 3FQ2A 1VKXA 2ADYA 2F15A 3W39A 4WHYH 4HHWA 3UGUA 2ZUWA 5E94B 1K4CB 5CGYC 1U33A 5EF2A 1Q0YH 1GYWA 1NM4A 2OXGA 3POHA 4KJWD 3VG0L 4MMZC 4B97A 4Y4FC 5E1AB 1MIML 5CEZE 3E80A 2UZXA 4U05A 1G7IA 3QHFH 2IDUA 4NKMA 4CVZA 1ZVSA 1I3VA 4APQA 5DTFA 3VFVB 5DHYB 5DO2C 5HHQA 1HIML 1YO4A 3I02A 4DEPB 4TQHA 2R0KL 1NKOA 2NUPA 2VWEE 1H3GA 4G43A 4JFED 1FPTL 2NNFA 4WU7B 1IRAY 3WO3B 4EBQL 2JCCE 2PR4L 3Q8EA 3S5YA 1I8MB 2KPNA 2ENQA 4QRPE 4UF7C 3GXFA 4KRPC 4K8RL 1AXSA 1G9NH 4NAQA 5A6MA 4JFPA 4M7LL 5AKVA 4BELD 3FT3B 4ZFGL 3GMQB 4N8PA 1O7SA 4O4YL 5I71B 5IF0B 5MENA 1SDDB 2B59B 1WUZA 1G9ML 4O51B 1ID2A 4U1KB 3BAEL 1G7LB 4PG9A 5C0CE 1LNUB 4OFDA 4OCSL 2B8OT 1EO7A 4IKJA 2C9XA 1ET7A 1F4YL 3BZFA 5A7EA 2YAHA 3IKCA 3VG9B 2YD0A 4OI9A 1DBKL 3U6XS 3HRZB 4JGUA 3WNMA 3QDGA 4IMKA 3QJFB 1TZHA 2BHUA 3A6BL 3IGUA 4CGTA 2XG5B 3BVNB 1K8IB 5GIRB 3OB0K 4XXDB 3DJSA 1VKXB 4D9QD 2VXUH 4W9GC 4AL8C 4F8OA 3WNLA 4GOSA 1SN2A 3FZUD 3KEDA 4EDWH 2K7PA 1DFBL 4B9ZA 3DHUA 4PB0L 2UVEA 2R7EA 4EZMA 2UZXB 3ESVF 5F3BA 3IAQA 4Q8BA 4NKMB 4CVZB 1ZVSB 2HAZA 3APCA 5DHXB 3VXSD 1E67A 1ZJBA 1NBQA 4APQB 5DTFB 4ETQA 5HHQB 4Y5YA 3I02B 3V6FA 2NUPB 4G43B 2ERJC 1TJHL 2HLEB 5GISH 5IKCB 4GBXD 1GOGA 3LAFA 1AXSB 1S6NA 2VLRD 4AI7A 4Y88A 4JFPB 4A04A 4DPCX 3TOPA 3ZTNL 2O93L 5MENB 1L6ZA 5E6UB 1KTCA 2VZ1A 3BP5A 4PD4K 4PG9B 4ONFH 3BSZA 5KSBA 2CK2A 2R39A 3DJ9A 5GSVA 2FJUB 3MRDA 4OJFL 3BZFB 1CGXA 3UTSA 2Y1YA 1AIZA 1G1OA 4NYLA 3QDGB 1DBJL 4Q9QH 2LQRA 3C6LC 3QUXC 2J57A 1TZHB 1FRGL 4OLWH 1A7OH 2ZSVA 2WXNA 4UQEA 2W9EH 1K6QL 5HI3D 4R9HA 1UB6A 1WHOA 3HC3H 2BVYA 3DYMA 1P5VA 4Z9KB 4OZFH 4N86A 2X05A 2D4DA 1KXVA 1LTXA 2ICWJ 3T9WA 4EPSA 4JFTA 3JWDL 4IK6A 4PJEF 4F27A 4N22A 3D2UA 1NZRA 4FF9A 2QR0A 2R7EB 5F3BB 2WBJD 3PGCA 4NQUA 3K74B 3I84A 1P53A 1BZOA 4PRIE 4A67A 4ETQB 3LZNA 4N8VA 5CINH 3QI9A 5HDQH 1JTOA 1JRHI 4Y5YB 4DW2L 5F1KC 5LUMA 3V6FB 1BQLL 3IMRA 3VI3E 4N90E 4WRLA 1P9MA 1RUAH 1SBBA 3N91A 4E9SA 3JWOL 4HKZA 5GZOD 3GZPA 3KPTA 1U4FA 3LVEA 3QEQD 3CHRA 1KC5H 2GEEA 4N20A 4YR6A 5JIPA 3WLBA 3UERA 4XI5D 2GT9B 5KVEE 1IKFH 3UBFA 3ISRA 1DSYA 2NR6C 3KDPB 4N85A 1KCVL 3BP5B 1NFDA 2C3VA 2IH3A 3KEHA 1WD9A 3EW3B 3O8XC 3GMNA 5FHAH 3GBLA 5KSBB 5DGQA 5GSVB 3QHZL 3HNTH 4S1RL 3MRDB 4PS4H 3UTSB 2BM3A 3IVKA 4NYLB 3PAYA 5HGAA 4AK2A 1BQHA 4PM1A 1MVYA 5C9KA 2NSQA 4DEPC 3MFGB 4JPKL 5IW3A 3MJ9L 4KI5F 1GYAA 5AKTA 4HH9A 1UB6B 4AE0A 3ISYA 1P5VB 3Q6GH 4MD0A 3HR5B 4N2HA 4YXKL 3LKRA 5T1KA 3T6ZA 2ZG2A 3NEXA 1XF3A 3LV3A 3ZQ9A 4LDCA 1CICC 4AKQA 4OFVA 3D2UB 4L37A 2GK0A 2QR0B 3T2NL 4JL2A 1G84A 2JWYA 1KB5L 3PGCB 5ICZA 2JI3A 2QT6A 1OAXL 5ADOH 5DD3H 5HYSA 2VZ3A 4N8VB 3QI9B 1YNLL 1A1MA 3GK8H 1YG9A 3WEMA 1V10A 2PWEA 4G7YL 3L48A 1KSRA 4HKZB 3HRZC 5CILL 1XGYL 4P2QA 2PN5A 1KEGH 3CVIH 4NM4L 3L4XA 1ESOA 3FB5A 4YR6B 1BGXL 4R8WH 1A7RH 5EOCH 1TR7A 1ZIBA 3QYMA 1FSKB 3WLBB 2MMXA 2FATH 4IRZA 4PEEA 3WTYA 3UC2A 5GJTH 1IVTA 4FTVA 3T2QA 2BVEA 4XP6L 2VERN 2GQHA 1NFDB 1Z5LA 2C3VB 2YBRA 2IH3B 5JHAA 3I74A 5EBLB 3IAGC 3GMNB 4MDJB 1QPXA 3O6MH 3U2JA 2EDMA 4AOFA 1OAUL 1A8JH 4KJQC 5EIIG 1JPFA 2XN2A 2VITA 4ICWA 3IVKB 1URLA 2HLFC 5HGAB 5EUOF 1BQHB 2IQ9L 2ZKXA 4PJGB 5TE7H 2ZUVA 4NOBA 2NXYB 2CJSA 5CIPA 4DNLA 1Q0EA 1WHPA 1LEKA 3WS6A 1W8EA 4PBXA 1HOCA 4EF3A 2V8MA 3FBKA 4JZJA 4HH9B 2AXJA 2IG2H 4LPYA 4RCAA 1S9YA 4P46A 3S3BB 43CAA 4MD0B 1O7DC 3LKRB 5T1KB 3K6DA 4OD3H 3ILDA 1XF3B 2VTFA 3LV3B 1TQUA 3QORA 3S36H 4L37B 2GK0B 4NC1E 1AGFA 4J4PA 5AW0B 3G7TA 4LCYA 4PP1C 5AAPA 5ICZB 4MDIA 5HYSB 4FQQA 4UOZA 2HZHA 1A1MB 5FYLE 3TWCL 5FFOA 5IP4A 3ELAT 3J8F7 4P2QB 4IMKC 1NCDH 1AGDA 1EK3A 2BPBA 5B39A 3B4NA 3SN6N 3FB5B 2YMTA 1WEJH 2GBTA 2HT3C 1TITA 3ZRCC 2DLFH 2V2WA 2XPZA 3ULUH 3I9IA 1THCA 3HMXL 3LH9A 4BA0A 3DXAE 4FTVB 4M5TA 5FUZH 1BFSA 3WFBH 1BJ1H 2DTMH 1IT9H 1A3RL 2O5NA 3R4RA 5K1JA 1D5MA 1Z5LB 2YBRB 3BDBA 1ZLUK 4Q9BA 5CZXC 2WZ6A 2XZQH 1B9ZA 3A4DA 3PL6D 4FQJH 4IKNA 4E0RA 1RURH 1JPFB 3TASA 2VITB 4U3CA 2ENYA 4GG6A 2YXVA 3Q0HA 4H0HB 2HH0L 4Y5YC 3M8OH 2Y5TA 2BVOA 4MA7H 5F1SA 3QRGL 5CIPB 4YHML 1LEKB 2VRKA 4YGAB 1GIGH 1BJ1J 2P46B 1HOCB 3K6OA 1OHQA 4OGYH 5DHMC 5AVSB 3RA7L 4G70B 4G9FE 4JZJB 4NZ8A 2VDML 4NQEA 5EPMA 1VJSA 4FL4B 3T6WA 4ZAKD 4P46B 2C7UA 5C6WH 2RIKA 5BO1L 1DJZA 1FBIL 2YKLH 43CAB 1A7PH 1KCRL 1FYTE 1G6RH 1HH6A 4XO4A 2COVD 3B8SA 3QORB 4KTYA 2FAUA 2J72A 4G1EA 5TE6H 1AGFB 4AW7A 3CSBA 4JRXB 4LCYB 3QYCA 4MDIB 3FPXA 4JY4A 3UTTA 1X9LA 4KOCA 4FQQB 4HFUH 5I1HL 3M45A 3FFDA 1SM3L 5A2AA 3RHWF 1FDLH 5IB5A 5IJKA 5HPMA 5IJVA 3MRJB 3SE9L 2XTJB 4DGYH 5JHDD 2QMJA 4DETA 4JVWA 4DPAX 1UJ3A 2IDQA 2WLYA 1AGDB 2YXFA 2OTPA 1AY1L 1GZQA 4GI8A 5B39B 2DL2A 3PXJA 3BXNA 2V2WB 3DX2A 4H26A 3R1GL 3RZCB 4FMKA 2BZDA 3N0AA 3TNNA 1M7XA 1EFXA 3GSVA 1MOEA 4DVRH 3CFUA 1JHKH 4NO0A 1D5MB 2G60H 4TQPA 4F92B 1J8HA 4M1CC 2H4EA 3HRPA 2IOIA 3Q2VA 3G08A 5L88H 5BS0E 4E0RB 4AYFB 3BPOB 3H9ZA 1JXJA 4GG6B 1EO5A 3QI9C 1YY8A 2A74C 1DDTA 2Y5TB 2BVOB 2GJJA 1NSNL 3PGDA 1KYFA 4RMSA 4Q97A 1CLOH 5DUPL 1P9MC 3O2VL 5I8KH 4EZLA 1KN4L 2X3CA 2E27H 4NQEB 5DJ8A 1KIQA 5EPMB 3R7QA 4DN3L 1Q94A 2DKUA 1JE6A 2C7UB 4HAKA 3LKPA 2WXJA 4GMSH 2UUDK 1TEFA 2IWGA 4QKTA 1HH6B 2BJML 2OR8A 4KAQH 4AUJA 4H8UA 3OAZH 4QHUA 5EF0A 4G1EB 1U58A 5I1IH 2Y6TE 4C56D 4ILDA 3K6FA 2WXQA 2VC2B 3MCYA 4JY4B 3G5ZA 3UTTB 1F8TL 4G7RB 3FFDB 3WFEL 5IB5B 5IJVB 1YEGL 1HI6A 3NA9L 1UJ3B 2IIJA 1A7QH 1NBZA 32C2A 3EH5B 3NCJL 4WVRA 4YH6A 5ERWA 3ZIMA 2HG0A 2NXYC 5BZWA 1Q0XL 3I75A 1GZQB 2MOQA 3MOAH 1IM3A 3BXNB 2CUAA 4UDUA 5D96B 4H26B 4ALAC 5E56A 1C7TA 4OCLC 3RP1A 3AY2A 2DWSA 4KK6D 3TNNB 1KFAL 3UYRL 5IJBC 1EFXB 3GSVB 4NO0B 4JZOA 1M56B 3DURA 1W8NA 5IROC 1BFOA 3GPSA 1J8HB 3C2AL 5T1DH 1BCIA 1GL4B 3G08B 1YYLL 1SDYA 2J3SA 5EV7A 2FYVA 1I7UB 1XSJA 4AIXA 1YY8B 2BIHA 4XC3L 3PGDB 4NQQA 2P80D 3VA6A 1S9XB 1OK0A 4X8CA 1KYUA 1OD7A 1KYAA 5DJ8B 1KIQB 1Q94B 2VDNB 3UDWA 4ANUA 3LKPB 3ARFC 1OY3B 1XF4B 5EA0L 4XVUC 2ADFL 3QJHA 1BOYA 2MTPA 4QHUB 1U58B 2XY1A 5KBMA 3QXWA 5IGXL 3JV0A 4Y89A 4B7IA 1ZSHA 3G5ZB 3INUH 2E7HA 4MVBC 2DQDH 4NLHA 1A6WH 1EO8H 3LOWA 4PJEA 3PS6A 2YWZA 1IFHH 1RJCA 3LNDA 1HI6B 1NBZB 2BOBA 5ERWB 2EDNA 5BZWB 3I75B 2Q3XA 4TF4A 5E6YA 1QRND 1IM3B 2A83A 3WS6C 2QZ5A 4UDUB 5IMLA 5DK2A 5FYKE 4JZJC 2W07A 2F19L 3EYUL 4IEFA 4U0RB 4Y2LA 5TDNA 1NCBH 5FECB 1FH5L 4P46C 4PFEA 2GYSA 3NJFA 1KJMB 4JZOB 1VCAA 1JPSL 1YQVH 3DURB 3QZPA 1BFOB 4M02A 5H94A 3ZN6A 4ADIA 3N40P 2Y06H 2RQEA 3QORC 4YHNA 1CPUA 1NIFA 2OZNA 2FEDD 4CVXA 4AM0A 1CFBA 1DLFH 3BKCH 2I85A 5EZIH 1MQKL 1AGEA 4LSSL 1ZLWK 4XH2A 1WT5A 2OM5A 4YPGA 5DFVD 4G6FB 2FX8H 3L5IA 2XN9D 3ZHNA 3FB7A 3SDDD 3BT2H 1BXXA 5HI4D 4EN3A 1BVNT 2AF2A 4PJHE 3T0XA 4XCYB 3VXQA 3T08A 5CZKA 4NLAA 4HD5A 1UURA 3OGCA 5ANME 4JVPA 4FQIH 5F7YC 5IHLB 1OWWA 3QJHB 3MLUH 3ZW3A 1JCVA 2VR3A 3RTLA 3FULA 3EDJA 5DJ0A 2R69H 4FNRA 3TESA 1LP9A 2IAMD 3NDZE 3ZZLA 1BIHA 3FT4A 3H42H 4KKZA 5LN8A 1IV8A 4PJEB 5FGCE 4BHUA 3U0TA 4XHJC 4L4VE 1H6FA 4WUKH 5I73B 1A3LH 3DVGA 5D5ME 1AS7A 1GHFL 3BPOC 3MRCA 2XNAA 2BOBB 2FH6A 4K9EC 4MBRA 5HHMB 4AG4L 2A83B 4FQCL 4WHDA 4CSPA 4NO2A 5IMLB 2EDKA 5DK2B 5JIMA 2W07B 5TDNB 4IEFB 3UBXB 2VDRB 5E2VH 3C5ZD 4IMLA 4CSZA 4N0FB 3I6SA 1QVOA 4BWTA 4NKQB 3VSVA 4C55A 3DOSA 5I1AA 5CD3A 4YHNB 1QI5A 3SD2A 4X5PA 4CVXB 2FJHA 4AM0B 3S3DB 5CLXA 1AGEB 2WN2A 4XH2B 4R5XA 2ZXBA 4EQ3A 4YPGB 5IJKC 3OBAA 5BQ7A 3FB7B 2B77A 1GGCH 3MRGA 5EC1A 3O6FA 3TBWA 1CIDA 1UJ3C 2NY0D 4LLDA 3VXQB 3CN4A 4EN3B 2YD1A 3BUPA 1W72L 3OGCB 2ZXAA 4JGMA 3K2MC 3B2UC 5D96C 4W4NA 4PJFE 5KJ7E 5C0BE 5DVKA 1AFVH 3LXAA 4Z0BL 4PGZA 4YSSA 3AC0A 4B3VA 5DJ0B 2BNRD 1RSFA 1FNFA 1LP9B 4LPTA 1EUTA 2NX5E 3L9RA 1AMXA 5E8DH 3BVUA 5K39A 3RDJA 3U0TB 3H9SD 2Q20A 3G6DL 5I9QB 2WINA 3WFDL 3DVGB 3FUIA 3NEOA 1Y1DA 2YA2A 4TXVB 4HS6A 2WZ5A 3MRCB 2XNAB 1GKEA 4PWEA 2AABH 3DO7A 3X1EA 2XVKA 2ZPKH 4NO2B 1UB5A 4HXBH 4YFEA 1ZT4A 3OC5A 4IMLB 3PHOA 5T1LA 4K8RH 1RIVH 2XT1B 1KZYA 1QHQA 1QVOB 4GEJA 5I0VA 2ODIA 4PTUA 3VGBA 3ZKND 1E9OA 3ULUF 4NJAH 1F6LL 1XB3A 3DOSB 5I1AB 2YK1H 5CD3B 4GO9A 4GW1B 4NHCH 2UWEE 2FJHB 5AZEH 3ARPA 4TVPL 5IIEA 12E8H 2GB2A 1MJJA 2AI0H 1JNHA 4LKCA 3A23A 5LBSL 5BQ7B 4OLZL 1LO4L 3MV9E 1F4YH 3MRGB 3N1MC 3QRBA 4KDVA 5EC1B 3O6FB 3SYQA 3TBWB 3ZR5A 5HXMA 4LLDB 2IWEA 4P59H 4MLSA 1BD2D 1DBKH 3OAUL 5DT1L 3RWEB 4AIZA 4AQZA 4R7NA 1CVRA 1U8NA 1BZ8A 1X5FA 3A6BH 3LNGA 2HVJA 1PLBA 4UOQA 3Q13A 4ZFFA 2ZONA 3CHOA 4RGND 4FJYA 2ZWSA 5T1MA 3DJZA 3OKLA 1B0IA 4XP4L 4Z77A 2TRHA 3OKOA 5D1QA 3X1BA 1LO0H 5J8OA 3PP4H 3D4GA 3L9RB 4K71B 1R46A 5K39B 1T2QL 3TP4A 2WINB 3OG4B 5EHFA 1IVLA 4HS6B 2KS0A 3S97C 3FH5A 4G6KL 5ILTH 1KGWA 1PX8A 3DO7B 4QHNB 3H9YA 2JFCA 3DDFA 3KHOA 4B5EA 2EDJA 1UB5B 1WFUA 1QFOA 3N50A 4P9ML 2JKIS 1ZT4B 1U8MB 1KGCE 3I9GH 3NCEB 3PHOB 5T1LB 4KTGA 1S7RA 2B7DT 4ODHL 1G94A 4PTUB 1L3NA 4N0YL 2BSSA 3ARGC 3MUY1 3U4BH 1KIUA 3CU1A 2YMXL 3S3JA 2RQ8A 3FSZA 1RZJL 3JT2A 5IIEB 1MJJB 3RWFA 5EZOL 3RFZB 1JNHB 3LXCA 4LKCB 5MEOA 1GCFA 2QV4A 4WW1A 1X7SA 2Y1VA 5I73C 2XBTA 4ZK8A 1AYRA 4ZMPA 4L5FL 2L4OA 2IDCA 3KL0A 3CG8A 5T3ZH 3SGDH 4AIZB 1OT4A 4FKEA 2AJXL 4R7NB 1U8NB 3GF8A 3WO4B 4TRPL 2Z34A 1NIEA 4QCIA 2HVJB 1PDKA 5IF0A 1I9RH 4ZFFB 1JZ5A 3GMMA 5T1MB 4HLEA 1OP3K 4HW6A 1REIA 3OKLB 4WGKA 3U4AA 4JO2L 3OKOB 4L4JA 5D1QB 1ROCA 3B1TA 1BDYA 3VX0A 5IB4A 3JWDH 1CQYA 1YUHA 1BEYH 5C0AE 1JRHL 2VXTL 2OYLA 3ZDYF 5LN4A 3RI5F 3TTSA 4WU5A 5IG7A 1AIFA 1WT5C 2W81C 5FM4A 5B21A 3EO9L 3EH4B 4WHCA 4UMGA 3T6XA 3G3LA 4LCIH 3LHPL 3UIZA 5AL0A 5I1GH 1B0GA 2XTSA 4A6YL 5E2UL 1IMHC 1JK8A 5F9AC 3H4HA 2JCCA 3AWGA 1GAFL 1KTLA 1BQ5A 1F4AA 3NP3A 1TMCB 5CLZA 4FX5A 4ZNEE 1S7RB 3NJJA 1CDYA 5IFJA 4NN6B 2MCPL 3F00A 2BSSB 4KI5C 4YFLF 1KIUB 3H7LA 1X44A 2BVTA 1OP5H 3WMQA 4GUQA 4KQ3L 5ACZB 4FHBD 4LIQH 2H45A 3RWFB 3VFGH 3T09A 2BY3A 1J9TA 3QSKB 5MEOB 1KGUA 3AACA 3S4SA 2AGJH 1C16A 4WW1B 5AD0A 5I9QC 4OT1L 1HZHL 4KPHL 3U0WL 3L9YA 3UYPA 1CDIA 4M4PA 5T33H 4KXDA 2XN0A 4AVJA 5I6KA 3R18A 4HDIA 3UPCA 4QCIB 1MCKA 2ARJQ 2LW3A 2VDOH 4L48A 2Y4SA 1PDKB 5C2UB 3E7JA 4P07A 3GMMB 1E5CA 4MAYA 5EEUA 2ZAHA 2C3GA 4MASA 3BVXA 1G87A 1SHSA 4KROD 2Q9OA 1ZK5A 2YSTA 4Z76A 2OMUA 5IB4B 5F9OL 1R3IL 2PWFA 1ZS2A 1YUHB 1RVFH 3BYYA 4XZUA 4AE1A 1KB5H 4WU5B 5IG7B 1AIFB 3QIBD 1OAXH 4WSGA 4YDKH 1MCOH 1OAYL 2VMEA 1AG6A 1PZCA 2M26A 2R2BA 4TLUA 1TSHA 1B0GB 2OMZA 4FG2A 4I87A 1BFTA 2CO1A 1JK8B 3O6FC 3PJSA 2YPLA 2JCCB 3PQYE 4JG5A 4YLQT 1KTLB 2HT2C 4NM8H 5G4OA 5IHUL 5I1CH 2CPUA 1JBJA 1JVOA 4W68A 5FKAA 5IFJB 3HS9A 4OBSA 2C9UA 1FAIL 4WUUE 1OL0A 4HWZA 4NKDA 4JUSA 4IBWA 2IDFA 5D7LA 5L4MA 1RFDH 2N1KA 3NIDF 4JE4B 4GP4B 2TAAA 3C60D 3D06A 2HFGL 4K71C 3S4SB 3QCUL 4PMFA 4KX7A 4DH2A 1ACCA 1C16B 1W6WA 4HWEL 2YXWA 4NXKA 1NPJA 5TQ0H 1QFPA 5AD0B 5KYXA 2F2HA 1R6VA 2DQFB 1G7PA 3UYPB 4XVSL 3RY5A 1Q90A 4MJHA 4UT9L 4KJPD 5FYJD 4HDIB 4BK5A 4D8OA 1E2ZA 4DN4L 1L7IL 1LMIA 4H0LC 4MAYB 4PGDA 3ULVL 3I3DA 1R3LA 1I3RA 4UT7H 4F2ME 4F33A 4WDIA 4TV3A 4XAKE 1JHLH 4Z76B 2OMUB 2Q8BL 4H88L 4EUPB 1KZQA 1R17A 4OJCA 4XZUB 5AWNH 2NW2A 2J6EA 1A6VL 4FZ8L 1QPPA 1RERA 2WV3A 3BUQA 3NABH 3FRPG 3K7UA 3S3PA 2FBJL 1CR9H 3LZLA 1QHOA 2NY5C 1NA8A 2R2BB 3VI3A 2XXMB 2OMZB 4TQEH 3PJSB 2YPLB 1IC5H 1D9KC 1MCJA 2WCPA 3F12B 3WO4C 5L6YH 1FE8L 1YYMH 1XBDA 3NZSA 1DBBL 3BUBA 5FKAB 2WYIA 4HWZB 1SEQL 3T04D 2ENJA 4NKDB 5TF1L 2DQHL 5D7LB 2BCKA 5D1QC 1KJVA 5AB0A 4WJ5A 5CU9A 4F80A 4ZSOE 4OLEA 1U8JA 5KYXB 2WYTA 5J57B 1MCHA 5LNGA 1G7PB 4JFFD 5CU5A 1PZ2A 4Y2DA 1QYGL 2WKOF 1T22A 4S2SA 1NBYA 3CDFA 2DS4A 2E7LC 1S9KC 2ED9A 3PWPE 1RV6X 4L1SA 4PGDB 1L7TH 2A9MH 2X70A 2E46A 3WXWH 1I3RB 1KJ3H 2YMOA 5BO1H 4F33B 3MLYL 4NN6C 4WDIB 1N26A 3FT9A 3IGAA 1T6WA 3SBQA 4L2YA 2NW2B 1INQB 3GSUA 3MXVL 3QDME 1DQDL 1G9NC 4LSRH 2R8SL 1BYNA 2X2JA 1YAZA 2BINA 3HNSL 5AKRA 3RX8A 1TENA 4P2OD 1SF5A 3VI3B 3Q8FA 4FXKC 3J27A 1JJUA 3SE9H 1DVFA 3RWGA 5IFAH 4FGMA 2NUTA 2ZUTA 3SQBA 3WV0A 1U92A 2YD9A 3UABA 1OQOA 3EADA 3IGLA 1U42A 2WLIA 3HS0A 1IGTA 2J71A 5MI0B 3QK0A 4H8HA 5DMGC 5IW1B 4LGPB 1RKRA 1TEYA 2BCKB 1DQLH 2AJYL 5KYYA 1KJVB 3CHPA 5DC4B 3RLSA 4C4BA 4WJ5B 4PJ9A 1SMAA 3V0JA 4AVHA 5J4MA 3KYOA 1U8JB 2CA4A 2NXZD 4AIEA 2J88H 4O58L 4XPHH 1ULVA 3GXPA 3WEXA 3TX4A 1KTKE 1HSBB 4Y2DB 2ZXWB 3SBWA 2VSCA 1WIOA 4S2SB 4HZ1A 3SOBH 2AFNA 3PWJA 5C8JA 1UT1A 1A2YA 1KCLA 1SBSL 3H56A 3IDYB 3SDAA 3SE8L 4GUCA 1GW6A 2X70B 4G7VL 1AO7E 3GS4A 1HL8A 1MNUL 1UWFA 2ATAA 1M1XA 3VD9A 2JI2A 4B9JA 2UV3A 4B27A 3IGAB 2BJMH 3HB3C 3BFQG 4G6JL 5IUCA 1O0VA 2DM7A 2MPAL 3GSUB 4NENA 3REVA 2G30A 3CHXA 4PY8J 2L7QA 1LO5A 4X4ZA 4ELME 3VDBA 1F8TH 4YHOL 3FONA 3F65A 4WKXA 2AXHA 1T5XA 1DVFB 1H3TA 3RWGB 2QKIA 3H6JA 2NUTB 4JY5L 3SQBB 4K7FA 3SGEI 1JN6A 3KBFA 1U92B 3PJLA 2KKQA 4OZGE 1PSKH 1NDTA 2WLIB 1ZHKA 1NEZG 3GM0A 2K6ZA 3HS0B 1KLFA 1IGTB 4Y1AE 2PYFB 4M1GH 1X5AA 4MAYC 5IBTH 3OLIA 1AE6L 4U0QB 2APTA 5KYYB 1WQVT 3HHSA 4N8CL 1BBDL 1H19A 1AHWC 2WZPD 1D2OA 2EO1A 3RG1C 1BEXA 1PZ5A 4PJ9B 2BW4A 1YYLH 3QVAA 4ZTOL 5EUOE 3KYOB 5J56B 1DJXA 2DQUH 5D9SA 5DVMA 4JPQA 4M6OL 4UIKL 3WEXB 1E6JL 4HEMA 3PWJB 5C8JB 1EEYA 2VLJD 4K5PA 1MCPH 3D6GA 5JHMA 1IBGH 1A2YB 1KEMH 3NJMA 4E36A 3HE6D 3S48A 3SDAB 3GI8L 3ARDA 2XHNA 4L8DA 5JMOC 4DO5A 1M1XB 3I6LD 1KTDA 2ARWA 5I1LA 3HG2A 2V17L 2VLKA 3CVHL 1F00I 4Z5RA 2FE0A 1GY2A 4IJ3B 1FQ9C 4A1RA 4ENED 4NENB 1XR8A 3WDHA 4DKEH 2VH5H 3PCYA 1LO5B 3F83A 3WE6A 4BBWA 3FONB 2ZCKH 1EHAA 2VM3A 5C7XL 1T5XB 4L0ZA 3OJVC 1JYWA 2QKIB 4GAFB 4K7FB 1JN6B 3LB6C 1KBGL 1JYNA 3LEYH 2OYMA 3GLZA 5FGBA 4HUCA 4WSJA 1ZHKB 2G9KA 4NCC2 1KLFB 2Q7AA 1ND0A 4UNUA 3IDUA 4WEBL 1AI1H 4U2YA 4OI8A 3CFCH 1JXFA 4NN5B 3ZHDA 1BXUA 4OCRH 3HHSB 2QPUA 1YLBB 3JVGC 1MCEA 2YPKA 4TSBL 3TBCA 1PZ5B 2DQTH 2FUTA 3MNMA 4X5XA 3T8MA 2DMGA 3LPFA 5D9SB 4M1DL 2N01B 4X6CE 3GRWA 3QPXL 4WF7A 3N1GC 3TEYA 1AQMA 1BQKA 5ADPH 1EEYB 4KK8D 1THAA 2OQJA 4FQLL 1YRKA 4QWWD 4YJZL 4XTRD 4G9FB 3P9LA 3ARDB 4BGDA 5IVXE 3IRZA 2CJUL 2VM4A 4MXWL 3IJYA 3V52H 4GSDL 1QABA 4NEHB 2ZXCA 1KTDB 1E7UA 5I1LB 4G6ML 5MI0C 1I1FA 3B2VH 2VLKB 2BFVH 2BOCA 4NZUH 4H0GA 4Z5RB 1Y0LA 4OR1A 2YUXA 2XZCH 4HBCL 3FCGA 1QKZH 3NAAH 2PO6D 4KY1H 3U6RB 1XR8B 4F91B 3W9EA 3WE6B 1MCBA 2NY1B 3D52A 1E8XA 1TZAA 1C8QA 1XGPA 2DIEA 1PLAA 4PBDA 3IJ8A 3MBEC 4I89A 1RL1A 4ZW6A 2YQ3A 2DLEA 4Z3IA 1L0YA 4Y2DC 4HOZA 2FL5B 5F0PB 3MUZ1 3CFBA 2OLDA 5TD4A 3GMOA 5MP6H 4JM4H 3IDYC 2XQYA 1ND0B 2XXCB 2HPOA 3B7SA 1Z3RA 3WNKA 3L1GA 4LSUH 4JRYE 1NIAA 5JIIA 1XD0A 5PCYA 1HC1A 5CHNA 1JZ3A 1GJUA 1GOHA 1E4WL 1XSKA 2YPKB 3RX9A 4KKCC 3T77A 3K6IA 1COBA 3QQ9D 4KVCL 4HJJH 3VI4A 2Q8AH 3S8FB 3QJZA 4X5XB 5BS0B 3OL2A 4TUOA 1MIEL 3THML 4JHAL 5JHBA 4WV1C 1JGEA 5L7XL 3TURA 3TXAA 4M8UA 1NC4D 1DQQA 2ZP9A 3U9PH 1SPDA 3CVCA 2OQJB 3VXME 3MLXH 1WZAA 4TVPE 4XGZA 3P9LB 4LARL 2PXYA 3L2LA 3ZL4H 2BWQA 3D39E 4X50A 3IJYB 2YD8A 3HS0C 2HLAA 1AQKH 4LOEA 4HXAL 1I1FB 2W94A 3GHBH 2BOCB 2JLPA 4KHTL 1Y0LB 2OJZH 4JCWA 2CM6A 2J20A 3FUNA 4EVNA 5DK3A 4FNLH 1JG9A 3W9EB 3CJJA 3EFDH 4PJ9C 3ALPA 2UX7A 3ULUC 4HFWA 1XGPB 3QQ4A 3SYCA 1JZEA 3ABGA 4HAFA 1EMTH 2R69A 2IGTA 1IQWH 5L2KE 2F8IA 3SBWC 2CHZA 5I6XC 4JHUA 5K9JH 3CFBB 1BMGA 3GMOB 5DO8A 2IOMA 4PGCA 3SDAC 1F11A 4LEXL 4PS7A 3OZ9L 4OGQC 1I8KA 3TO4A 5DZPA 5CHNB 2CAKA 4TOYH 5BV7H 5CSBA 5CGTA 3T77B 3VI4B 2C1OA 5E9DD 1CWVA 4IJ3C 2VXVL 3UX9B 3OXRA 4TUOB 1CYXA 4A68A 2J56A 1JGEB 2YUWA 4U7KA 2BZCA 4NZRL 4ERSL 1UWGL 3E38A 1TSRA 3P2TA 3FMGL 3SPIA 4KZEH 4JKMA 3KE0A 2FQDA 4Z3HA 1OAZL 2QKIC 2DI7A 4XGZB 5EO0A 2PXYB 1VGKA 2BC4A 4QRRE 3FQ1A 4V1DA 1J88A 3A6CL 4V2BA 3B1UA 5FUOL 5ANMA 2HCZX 2Y2YA 4U7MA 1ZLEA 5I2IA 2F5BH 3BWZA 2HLAB 1WGVA 1ZEAH 4OGAD 1NAML 5JW3H 4OJDH 4L5FE 2EVJA 1FL6A 4DTGL 3NSXA 5JW4Q 5DO2D 3C5XA 5D72L 4EVNB 4QNPE 2D7NA 1PTZA 2CUIA 1ILSA 1A7BA 4HFWB 2HWZH 3PPEA 2H6UA 3P30H 3QQ4B 4J1UA 2XBDA 1G5GA 3GSNH 4LSDA 4P2RA 3RWIA 1F90L 4H8WH 1XMWA 2K6YA 2C1PB 4K5OA 3UAJD 2YUZA 5GGRA 2E7MA 2RGSA 2A9AA 1CYGA 3NZ8A 2RHEA 1F11B 1MW0A 4PGCB 5EWIH 1KENH 5AVTB 2GJ6A 3MOBH 1OE1A 3CZJA 4RMUA 1I8KB 2ZOUA 2GJPA 3BCFA 3TO4B 3P0VL 3K1KC 4P3WA 4D2NA 4TPRH 4N0YH 4HC1L 2C1OB 4OM1L