4TMPA

Crystal structure of af9 yeats bound to h3k9ac peptide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
138
Chain Sequence
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title AF9 YEATS Domain Links Histone Acetylation to DOT1L-Mediated H3K79 Methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein AF-9
total genus 22
structure length 138
sequence length 138
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4tmpA00
3FK3A 5IOKA 5D7EA 4TMPA 3QRLA 3RLSA 5HJBA 5HJDA 2NDGA 5IQLA 2L7EA 2NDFA
chains in the Genus database with same CATH superfamily
3L6FB 3ETBJ 4YFEA 5CBAB 1MI5B 1FLRL 2EKJA 2G30A 2NXYB 3B2DC 3QQ3A 4R26L 5E1IA 5CP7A 2F18A 2P28B 3ETTA 1BCIA 2CNYA 2Y36L 1EX0A 4PS4L 1D7CA 5HVWA 1RVFH 2FATH 5EO9A 3X2QB 5DJ8B 4E42A 4E5XG 1WZAA 5CIPB 3PHQB 4EOWL 3QULB 4IS6B 5GGRB 5C07D 3CFCL 1SEQL 2VJ8A 4LIQE 4Y2DB 3D69A 2VE6B 3CVDA 3QZLA 1N18A 4TSBH 3VYNA 3UTTB 1C08A 5DD0L 2F5AH 3QUKB 2FNWA 3ORJA 4ABWA 1PGRB 2CLRA 1OLZA 4JVPA 1YA5A 5DJCB 1S7RB 5DJAA 3FB8A 3O4OB 4JRLA 4LEOB 3L4XA 3V9FA 3BFQG 1SOKA 3CH1A 1FORL 3D05A 5EOTA 1T66D 1ZT7A 1E6JH 1RI8A 2P5ED 4P57A 3EH2A 3QRGH 4FZEL 4LF3B 4AQAB 2UWEE 3IN0A 4BSWA 3NJVA 4X6EB 5IB2A 1OAUH 3WIIL 4QOKB 4WRLA 4LCCA 1RUAL 15C8L 3CZLA 1QBLH 2BSRB 3D9AH 1T2XA 3D2UA 1AXTH 2PLTA 1VAHA 3T6QC 4PY7B 2MQ0A 4JO2L 3VVWA 1FFNA 5MP6L 1TZHB 1C16B 1R3IH 1WIOA 4H0IA 2D0GA 2WSKA 2QTVA 2EO9A 4QY8A 1GZQB 3AU1B 5ETUA 3T2NL 5JXAH 2VL4A 3CFEB 4G6ML 2WVSA 3W39A 1OW0C 3L5JA 1IKNA 2ZKXA 4I9WE 5I1EH 3FQNA 4XC1H 3B56A 3UEQA 3EFFB 4X7FC 1AD9A 2JELH 4KKRA 4P23B 2ADJA 4ZOEA 2AJYH 3VGAC 3KZ8A 2B15A 4GSRA 5B1KA 3BRFA 1CFMA 1SF3A 3BZ5A 3CZFB 4G7VH 4PYHA 3VFVA 3MR9B 4P9MH 5C08B 3HI1B 5GRYA 2HTKD 4D9LL 1XCXA 5JDJA 1SMDA 5EC1B 2VC2H 4HJJH 2HTKC 1RIUH 3WJLC 1MHCB 2EDNA 2PCXA 3I84A 5CP7B 1A1MB 1V54B 1AQKH 3E8UH 1Z0NA 2AQ3A 3GSXB 1K85A 1LEKA 3W3BA 3QJQB 1DSWA 2CBMA 3OLEA 4R7DA 2H9GB 2NPLX 2YD4A 1FZJA 1UJ3B 4G7QB 2VMJA 3AAZB 4OQTL 3AADB 4GQPH 3TN0A 3KM1A 4Z7IA 1F58H 3LNDA 2IVFC 2WWKT 5K9JH 4A6YA 4JFEB 1AE6L 2WKLA 4P2OD 1VGKA 2PPAA 1FIGL 4YVUA 4Y2DA 1UH2A 4TL4A 1LEIA 5LGJA 1IGFH 4XXWA 3TBTA 4IDJL 3PV6B 2NR6A 1HEJC 3IVKA 4MB3A 1UH3A 1TLKA 3H7BB 4Z7UA 4YXHL 1U3HA 3M7FB 3QUXB 3CIQA 4XVUC 2XY1A 1AQKL 4QDGA 2Z93B 1U9KA 1S7RA 4OZFG 4ALAH 4XXCA 1K8DB 2GJ6B 3ILPB 4BFJA 5DLMH 2AJVH 5E0QA 3AFLA 3QUKA 2Q76B 4DW2H 1NMBH 3RVTD 5I1JH 4GEJA 4X4XB 1P6WA 4Q9QH 3TBYB 3JSSA 2Z34A 1KJVB 4XVSH 5IREA 3DROA 3DRQB 3N43B 5JA8B 4MMXA 3BUDA 3GB7A 5LDSA 2YXFA 3UTPD 5IQ7H 3U2IA 2YA1A 3BKJL 4I18A 4L4TE 2IH1A 1ZLUK 1BIIB 1ADWA 5G5DA 4NZUL 4U05A 3CQPA 3BVNB 1WBYB 1RMFH 3B1TA 3QNFA 4FQXD 2ADGA 3FQXB 1QWHA 1CFSB 3QZWG 2HKAA 4HALA 3FUMA 5I30L 4IBVA 3S98A 3PDGA 3BKYH 1E28B 4IBSA 2O6PA 1L9MA 3Q8BA 1FZMA 3NFSL 5JYLA 1Q0YH 5MP6H 1JYXA 4P2OB 3SBWA 4B9PA 2AQSA 4QRPD 2CCVA 2A9ML 3OKDA 3X3FH 2BSBA 5CWSB 5B1CA 1E8WA 1QTYT 3QHFH 4LSRH 5HVGB 1C5DA 4MD4B 3AREC 1WT5A 3Q1SH 2YD9A 1CD8A 4DCQA 4ZS6C 1YQVH 3QG6B 4XN8A 1S4IA 4GUPB 4K9EL 2X41A 1AGFB 2JKSA 3QUZB 1UD2A 3BRDA 3LIZL 1FORH 1T20B 4NWTL 4LRNH 2HJLB 4LPUA 4UQAA 3WLWC 2HRPH 1UZ6F 3QC5X 2HT4D 3FSOA 4MQ7A 3POCA 4EIGB 3MREA 4NUPA 3ARYA 1U95B 2XVGA 1T3FA 3ZN6A 6FABH 4HLEA 1U58B 3V0JA 4BDVA 1LK3H 2VN3A 4R2GC 2KZ1B 3FT2B 4L4VE 3WFEL 2PYED 1MRCL 3VI3E 3HAEB 4X5RA 5EZIH 3BDYH 5DMGC 4OJYA 5F6HJ 5HY9B 2X4TA 4J5VA 1INQB 1TQBC 1GOGA 3IE4A 3C5SA 1H9VA 1Z2KA 4FFZA 1MJ8H 1BFVH 3HA0A 5EZLB 3JV4A 3LNGA 1BD2B 4AXWA 4NKQB 3MXWH 4WLCA 5DJ0A 4H20H 3HG3A 5TPWH 3TO2A 4QRPB 5ICYA 4KV5F 1G9NL 3QJRB 5I0VA 1B88A 4NQUA 1VIWA 3V4PB 2Y0SA 3OGCB 1C1EL 4MVBC 4ZTPL 1HQ4A 2R83A 4HKXB 3HCVA 3VXRB 2YAQA 4MMXC 3QJSB 2ZOKA 3KMDA 1QSFB 1KTDA 1X7QA 1SF5A 3O2VL 2QMJA 1BJ8A 1G5GA 1KTLB 3CFQA 1KGYE 1W72H 1NAMH 1BQSA 2EEXA 3DPBA 4TUKL 4K8RC 1SVZA 1KJVA 1TXKA 3PP4L 3GSVB 2P46B 1FO0L 1UH4A 4FTVB 4G8GE 4I5BA 2ZOWA 4OY9A 4FHKA 2AQ1A 4W4NA 4YDVA 2XWXA 4RAUB 4LSTH 1E6OL 1DBAH 3IM1A 4ODHH 4M3KB 3FXIC 1QLRA 4OF7A 3HZYA 3VDBA 4G1EA 2AHIA 1B4RA 4HD9A 4JPVL 4NN6B 1NBVL 1OE3A 3K2KA 4CVZB 4KHTL 1H0DB 2D73A 2CKBH 1Z3GL 2WBJC 4D3CH 3BQUD 4K71C 1ZGLM 2DN7A 3FTUA 1EHNA 3APMA 4HPOL 4KQ3H 4MNGA 5HJGA 4KTGA 5F9WB 4EXPX 2V0AA 5ENWA 1E27B 1KGCD 4IIQC 3EYFB 3FF7A 4LLWA 3FOLA 3W37A 1WO2A 2YMOA 4UV4H 3SE3A 3ECBA 4A2FA 2O4EA 2F1EA 2ZWZA 3BAJA 1BQLH 5KJ4A 4A2LA 3BSGA 1HHHB 2E7DA 3KPMA 2BO0A 5D1QA 3W2DH 5AOKA 2UZYA 4GRLB 1HDMA 3ISWA 1AO7D 1BF5A 1QSFD 4KZEH 2ZOLA 5ERWB 4ISVA 1KENH 5HXMA 4XPTL 1F11A 4NPJA 3HNVL 2VR7A 4XH2B 1JZ4A 3VXUA 1BREA 1TETL 1TQVA 4Y19B 4GIOA 3WE1A 4W6YB 3BAXA 5AB1A 1KIRA 4TL5A 4ZQTA 1FGVH 1FNSL 3B7YA 4BXSV 2A73A 3WS6C 1YEGH 2WHVA 5F9JB 3BSHA 3JT0A 2ZCKH 1SGKA 3MJGX 4GY4A 5BV7L 1MN4A 3S37L 5EB9A 4XO4A 1JVKA 4M5YH 4ZXBA 5I2IA 3QB7C 2WAHA 1KXTB 2X4OA 4GSDH 4EI0A 1FHNA 3QSKB 3AREB 1YECH 2FWOA 1BZQK 2E74C 2AFNA 2OTWB 4NO2A 4G6AD 4NNXA 5IKCA 2PYEE 3CZNA 1WQVT 3P69A 4FNUA 4WV1A 5E8NA 3V5KA 1S7VB 3DSFH 2ITFA 1D6EB 5B3JE 2OP4L 3F6JA 1J8KA 4UV7H 1A9VA 4L8BB 2WTRB 4NQCD 2A77H 1SEBA 1ZLSH 3SYQA 1FLTX 1N70A 5INDA 3O11B 1EEZA 3D6GA 4PN6A 1MWAL 1R5IA 5C7XL 4FZ8L 1TQWA 4A55A 4RSVA 4E9RA 4PREA 4JDZA 2BK8A 4KKPA 3I3DA 1FNGA 3PFQA 1JDAA 5HGHA 3A67H 5BPPA 3NZUA 3RNKB 3SKOA 1RY7B 4WEBL 2WC7A 4CNIA 2NY4B 5D93C 1VESA 1GGTA 1CL7L 3KWTA 1Q9OA 2AQPA 4CVZA 4ONOA 2HFFA 4NUJB 3SE8L 1NBQA 2WP3T 2EE9A 4K4KA 2KYIA 4ZMVA 3GQFA 2V2TA 2YIHA 1THAA 2N7AA 3FCTB 4NQSB 3D3VB 3MLRH 4QXVA 3JV4B 5ANMB 3WN6A 5CJXA 5HD8C 4UTBA 1PZDA 1YN6A 1F0LA 3D0LA 3KVDD 3MRMA 4LLWB 3PL6C 4M8RA 4DKTA 2APBA 4AE1A 3RIKA 1NJ9A 1J8SA 2YUWA 3ZYIA 3BT2L 4L8SA 4M1GH 3FUHA 1FHGA 1RUQL 3ARED 4LXFA 5F72S 2YKLL 3OWRA 3UJJL 4JG1L 4M56A 3I6SA 2QSCL 1RUQH 5EBMA 5MEPA 1J5IA 1C12B 5FYKL 1JTTA 3EJZD 2VXUL 2OCFD 3T0EC 1IM3D 2ZWYA 4NQCB 3VFTB 4U0QB 3KH3A 2VDMH 3N42B 5D96C 3KPOB 5I76A 1XCQB 3BI9X 4H4NA 1E65A 2WXIA 4QF1B 3GZPA 4YGVA 4R4NC 2ZWSA 2VUOA 3MLRL 4JRYB 3DOHA 4L2YA 4S2SA 3S3DB 4I5BB 2KHAA 1DSFL 4GAJH 4LQFH 2BNUA 4N0FB 2PCFA 3OKOA 1HSAA 4M7LT 3CLEL 1G9HA 1FDLL 5DS2A 1EHAA 3KHQA 4BXVA 2B1OA 1AY1H 3RUGA 3L4WA 5FGCB 2WXQA 4X4KA 3WE6A 1F6AB 3GZQA 3KG5A 1IGIH 3F04A 3IPBA 4NS0A 3FHAA 1LO3L 4BZ2L 4F7KA 4WI4A 1T4KB 3P4LA 4LSUL 5CZKA 6PCYA 4A63A 4OLXL 1WFMA 2OXHA 4KQ3L 5DR5H 4XXWC 3G08A 4KMTL 3BPNC 2BHUA 2IXQA 3WFBH 2W07B 1HHGA 1WWWX 3RVWD 3RY6A 5INCB 4BWWA 4APXB 2R56L 1FRGL 3EO0B 1A7NH 4ONGH 5F7EL 5GISL 5TF1H 3H9SB 1KBGH 3ZDYF 4ZX6A 1KB5A 1UACL 4ZO9A 5E8NB 4M4RB 3RTQD 2ARJA 5ACMA 4TUOA 1JE6A 3DJ9A 4MA3A 5LKNA 2PO6A 3KVPA 4Y1AB 1TTCA 1AKJB 4OZHE 3QO0A 4KRPC 1EHKB 1G4RA 1EBPA 2JFCA 2VDPH 3NN8A 3L4VA 2Q86A 3OX8A 4J1UB 4FE9A 3CFJB 3X3GL 4X7TA 4X80L 2UWEA 3T4AB 3V0DA 5EZOL 2ZOUA 4ZTEA 4OZ4A 4QGYA 3GMQA 1OCCB 1U8CB 2YMXL 2K70A 4Z3FA 2DLEA 4KNTA 4OD2A 1HINL 2EYTA 4A2GA 2DF3A 2Q7AA 1KJMA 2OM5A 1M7UA 3IETA 2ICCA 3HG2A 5KSBE 4IRSC 3VXPB 3IDMA 4AKPA 5B21A 1OHQA 1YEDB 5I28A 4Y4HC 5C07E 3STLA 3VTAA 1V10A 4X5WB 2C1PB 1ZA3B 3F01A 2ZCZA 4L3EA 2QV4A 4ELMB 1IC7H 3CZEA 4RMRA 1FFRA 1Z9MA 4UV4L 3UH8A 1U91B 2OZ4H 2VISB 2WO4A 4U1SB 4FA8A 1BOGA 3L5IA 1CDJA 4GOSA 1M1XB 2HN7A 1KEML 4KAQL 4J27A 3MRJA 3D0VA 4MCZB 2PYEA 1I8IB 3H9ZA 5M94B 4X7SH 1PG7H 3IKCA 1P4LA 1DO6A 4OD3H 3QNZB 4PGEA 4U7KA 4I18B 2R0ZH 1VEPA 3TFKC 2RR3A 2MNWA 2WBWB 4UQEA 1BLNA 1BV8A 2DWYA 3U83A 3BAWA 3NCJH 2B39A 3NJGA 1FGVL 1H19A 3MFFB 4B7LA 4F5CA 4FQIL 2B20A 2G5RA 3E6HB 2H3KA 3HMXL 5D2LF 2XWTA 3NIGE 1JNJA 4P2QB 5C0EA 1IC4L 1RK7A 4F9PA 3QIUC 5AENA 4PB9L 4Z6AT 5D93B 5IROC 1T4KA 5DK2A 1KB3A 3A4FA 3ESMA 4LLAA 4ZO6A 3QGVA 4S1RH 3HG5A 1I31A 5CILL 5D8JH 2OS7A 4G9FE 4IJ3C 4U1JB 5ESVA 1YYCA 2FQDA 5KYWA 1IKOP 3VXTA 4N5UA 5E1HB 2X9YA 4HJIA 4P46B 3IF1B 1G9NH 3ZVVA 1MNUL 3DX3A 3ZQWA 2DQFB 4HETA 5CEZD 3IDJB 1LWRA 4MQXC 3V0IA 3NABH 3AY2A 1JF5A 4DP6X 3TYFB 2XN9E 4MNGE 1ZVNA 1CICC 3QDMD 5E0FA 5HYJB 4Y1AA 4I4WB 3FNKA 1ACXA 2CCLA 4JRYA 4ATTA 4LDCA 4MAYC 5ICXA 2A9AA 1QUNA 2Y5TA 2EDKA 3MUY1 5GJTL 2DQTL 1A7QH 3H8NA 1JP5A 5SWSB 2ADIB 1A3LL 3TPUB 3ULUF 1M7XA 3O9WC 1TQCC 3HNTL 1SMAA 1Q9LB 1MFAL 1Z9NA 5T1LB 4U33A 3L1EA 3P2TA 3NCJL 3DIFB 1WBXB 1PCSA 1OT2A 1FGNL 1HNYA 1JPFA 2WBJA 1MJUH 1NKRA 3U6RA 3VFUB 4GJTB 2ODHA 5SX4H 2G60H 4ABQA 2GPZA 5FKPB 3RHWF 3TVMD 4XBMA 4HKZB 1ZTXE 1ZJAA 5SX4I 1WH0A 4JGUA 1YSOA 4ZFZB 4K9EH 1JPST 3TNMA 1MHEA 4HHAA 1ZPUA 1X9RA 4JN2A 3P30H 3DVFA 1L6ZA 3RA7H 3RU8L 3ZYOA 3NIFE 1J8HA 2VZ3A 3AMLA 3I75B 2FJHA 2CKNA 4NUQA 4XNBA 3KNBA 4RVBA 3UIZA 1TSHA 2E59A 3QZOA 3KGUA 1JUFA 1D7FA 1H8LA 1LM8V 2PYFB 2GYSA 3HJ0A 1J0IA 2RB8A 1EO7A 4K5OA 1I7RB 2BVPB 2YPVL 4Y5XC 1KTJA 2IDUA 5E70A 1TFPA 4RZKA 5JDSB 1DEEA 3QNYA 4Y4KD 1OAZH 4PJCE 2MEJB 3O81A 4KXAA 2A38A 2M8XA 2CDGA 2ZUXA 3DX9A 4LQ1A 4OVVA 3THMH 4DK5A 2P5WB 1Q1JL 3L3KA 4DP5X 4S0HA 2P8MA 1D9KA 1SN0A 4OZFH 2WD0A 3BDYL 1CK0L 3HZYB 3II2A 5SWSD 3VJ6A 1R75A 5L4FA 2XFXA 3BWAA 3FO9B 3NZHH 4XVJH 1KULA 3RZCD 1AGDA 4UM8B 1YCSA 1NDMA 1ZS8B 1CFVH 1MF2L 5FDWA 3CWGA 2NYKA 3D4YA 3O6LH 4OCRL 2HLAA 2AMGA 2X4SB 1MJUL 4PLNC 1DBJL 2FQFA 1G7PA 4L9LC 2EO1A 3VI4A 3R1GH 2Z7UA 1P6AB 4NZJA 3GTVA 5ID0B 1GOHA 2LAGB 5J1AB 4XNAA 1AXTL 3N3EA 4IHOB 4H1LB 5LLIC 3Q1SL 2IOOA 1J11A 4I0KA 5F7EH 5CEYA 3CZFA 3Q7JA 5D4IA 3VFVB 1XTLA 2PPFA 2HN7B 4OZHB 1IMHC 1IZJA 2GSGA 4E0RA 5DFVD 4LSPH 2JKWA 2VQTA 4MCNA 1Z9SA 2JIXA 4KMTH 3AS3A 3ZIYA 4PJFA 3B7UX 3OB0H 4X9IA 1LE5A 5DZAA 1BLNB 1MNUH 4ODUB 5KSAB 1FBIH 1RPQA 1A1NA 3PNRB 3C87A 4H8QA 4DZ8A 2EQDA 3DIFA 1EXUB 4LVHC 4IYKA 5DGQA 4PRNB 3NSJA 4EZLA 4GAGH 3WEAA 4PCTA 4HIEB 4Y5YA 1BZOA 4JB9H 4DWHA 1GJIA 1QASA 1TQBB 1T0OA 4LEXL 4YDIH 4OCSH 3CHQA 5IMOA 2CU9A 4W93A 4Z8FL 1UA3A 4NO3B 3UGUA 5HSFA 2AXJA 3APFA 3RWHB 4M6NH 2ZPKL 2QFPA 4L0ZA 4PJ9B 2DIEA 1E43A 2GFBA 3PGDB 5A6LA 4GG6E 3SE9H 4N85A 4U1JA 3NK3A 3Q5OA 3VGFA 2JH2A 1JPGB 1JN6B 5CD3A 4NRXA 4PJ5D 5KVDH 4HFWB 4ZFZA 1G7MB 1G6RA 5F89A 3GKWH 2PETA 3WXWL 1C5BL 2ZXGA 2E75C 3HRZB 4P9HC 5I6OA 5IHLB 3CLFL 4G72B 3QP3A 5EN2B 4FDWA 2DJMA 1RLBA 2JI1A 1X5YA 4X7SL 3OKEA 4F93B 3FPYA 3DO7B 3DX9B 5I1HH 3TV3L 5DZPA 3D18A 5IB5A 2RIKA 1FI8C 1NL0H 1ANUA 5HYIA 2Z1KA 1W8EA 2OMVA 5EUKA 3QFDB 3KYKH 1I7RA 5JDSA 3LKOB 2NUPB 1Q9WA 4WF7A 2YO3A 3BVNA 5HJDA 4EF3A 5J3HD 4U4IA 4YO0A 2ADIA 4JZJB 4O2CA 5D2NE 5AVXB 5FKAB 2HT3D 1AFVH 4X6DF 3MX0A 4AIEA 1DQJA 1Q9LA 2BVYA 3PGFH 2FX8H 4Y16C 1V3LA 4QXUH 4YX2L 4Z7WB 1C7SA 4PG2A 3UJTH 5ANME 2F7PA 5FECA 2WQRA 4HBCL 1J05B 2F5BH 2GK0B 4XR8C 4FNTA 3EJTA 2D4FA 1OLLA 5CEZL 3A67L 4Y8AA 5HHOD 1YYLL 3V4VB 3SBWC 4IBZA 2ZF8A 3MGTA 1TR7A 4UQ3A 4Y2DD 4NBZB 1NGQL 3IJ7A 4WGWB 3G7TA 4JFDD 2NR6D 2XX1A 4ZK8A 3W9EA 4J3UA 4OFVA 1UC6A 1VEMA 2J1KA 3RGVA 4PRID 4QAMB 2CJ3A 3HE6D 3KEDA 3S96B 1EO8L 5DUMH 1B0IA 2GBVA 3VMOA 3MRNB 5IFJB 4IIQB 4PJ5B 1TU2B 1HSBA 1EFXA 5FM5O 1ET5A 2AJZB 1Z9SB 4GUCA 4N68A 1ECZA 4JMXA 5CGYD 4ECNA 4MNQE 5IR1A 4FI8A 4XTRD 4XVTL 2WXKA 3WTWA 3T2LA 1MCWW 2B08A 1GIGL 3UJIH 4YQXH 1A66A 4U0RB 3LKSA 2BX5A 4HUVA 3OKOB 2OL3B 4BH8A 5D7KE 5I6KA 1INQA 1KCSL 1MXDA 1OPOA 2YD7A 5GRVL 4HS3A 5L2JA 4GXVL 2VW4A 1U2YA 2JCCA 5HGBB 2GUYA 4F2ME 2AEPL 2EP6A 2NT0A 2R0KL 3IJEB 5EC1A 1OW0A 1UOKA 2X6AA 1OF0A 3LNFA 3PWUB 5GGUB 1BYNA 2VB5A 3ULUE 1XGQA 5IQ9A 1WZLA 2AXFB 3PL6D 2H1PL 2DZEA 4MZIA 4F7EB 4RBPH 2VO8A 3MNDA 4HJTA 3W2DL 4RGOH 2NY3D 3LN5B 4PSRA 2JB5L 3X17A 1DCLA 4UMGA 4PJXA 4B9ZA 3LIZA 1O7DC 3DX7A 3JWNC 3DX8B 1ACYH 4KXBA 2J56A 1H8NA 2XTJD 1ZIAA 5JW4R 2EKSA 4OGZA 2CMRH 1PPIA 3STZA 3R06A 1IFGA 4HQQL 3VWKA 4AQOA 4U1LB 2MCMA 3QFDA 3FUNA 3L45A 1JNHB 3VG0H 4QRRA 3H2PA 3EJUA 2AQRA 4FKKA 1ZT4A 4K7PY 3D2TA 3GI8H 1ZEAL 2MWCA 2K1MA 3B2UD 3KPRB 5JHLA 1C8PA 1NA8A 1WUNT 2W0FB 2Z93A 5F1KC 4A38A 2R2EA 4N2DA 1E4XI 2YQGA 5E5RB 2GIXA 5GRUH 4PS4H 4WQOA 1J0KA 2DKUA 2MOQA 4UUJA 5FHAL 1A3RH 2QQKH 3P77A 5GS2D 3T3PF 4CN6A 3Q2LA 1WISA 4IQHA 4KROD 4YVNA 5GGTL 2EIBA 3H2QA 4R2GD 4HG4K 2BSTB 3LQZA 4PJ7F 3W0WA 1AGBA 4YFLF 1V55B 1CD9B 4FHBD 5C07A 1A14L 1XH0A 3X1NA 4BZ2A 1VFBA 3IRZA 3K4AA 5F93C 3FQXA 1V8HA 1K9TA 5DD5L 1IRAY 1DUYA 1A7RH 3VQ1C 3RHWK 1CL7H 3N55A 3AM8A 2W9DL 5I0YA 1MVUA 3ATBA 3ZL4L 3L5WA 3IAGC 2BNQE 2VR6A 3KPMB 4HV8B 4YDNA 4KKLC 2Z8WC 1LYQA 2XTJB 1I9IL 3OKDB 4L1LA 4AG4L 4P5MA 4H20L 4Q74A 2VDLB 2I7OA 3MXWL 2KERA 2KQNA 5JIKA 5TE4H 3DTXA 5LG1A 1RZ8B 5MHSE 1J5OL 1TZ8A 2YLHA 2PWFA 5IBUB 1RZIA 2F53D 2HWZL 5DD6A 4DZBA 4X6FB 5E6ID 4A6YL 4OF6A 3BVWA 4JQIA 2AXGA 5DVOA 3DC0A 3NFNA 5E6IC 3IXAA 4GG8A 2DIAA 3L3IB 1PY0A 3BD3A 3DMMC 4JL1A 3B2VH 4AZ8A 5DJYB 5I8KH 1ILSA 1FFTB 5D4JA 4PGDB 5F44A 2OSXA 3ZHFA 5L2JB 1EEQA 1OCOB 1LEIB 3GBNL 4AK1A 3FO0L 4OIAA 1SDYA 5DK2B 2YEVB 1A6UH 2AK1L 4KGJA 1A5FL 1KOAA 2HMIC 5FCUH 1R47A 3LSOA 3PGCB 1XB8A 2XG5A 2W88A 4AIXA 2ZCKL 3GLAA 4L3EE 3S6CA 3LKNB 1ZK5A 4HSAC 2PNDA 3POHA 4L4VB 2Z4QB 4JKKA 5FC9A 3V4PH 1JFHA 3V4PL 1Z9OA 4DO4A 1HSBB 1V05A 1JK8A 1ZGLP 4GBXB 5EULV 4AQEB 3L2LA 3BAEL 3MODH 3QHFL 5C7ZA 1HEHC 4Y4KA 2EDQA 1MIEL 2ESVB 5F9OL 4Z0XB 1AZCA 1IX2A 4BFIA 1AO7A 4QXWA 4PGBA 2D7NA 1AQDA 1YMMB 3QPQD 4L9LB 1M6OB 2AK1H 3P3UA 3F7YA 4QO1B 5DHVH 4XPAH 4L37B 4YXKL 1IZKA 2GBTA 4FP8L 4L8DA 3VGBA 3WXVH 4RESB 1AYOA 3RP1A 2PW1A 5B4MD 4UQIM 2GJPA 3OR6B 4L1BA 5KN5A 3L6FA 1CGVA 4R7VA 3ALPA 1BOYA 1ZTXH 4UT6A 2ZCLH 2AK4A 4WWKC 2VLRE 4H8WH 1MELA 1SFHA 3VQLA 4NI3A 5H4YA 1R24A 2W95A 3JV6B 4MB4A 4H8PA 1JL8A 1SBBA 5DT1H 2XQ0A 2CKBL 1OOAA 1U30A 1IQWH 3VRIB 1TFHA 3VXMD 2YKKA 1NICA 5IIEB 1QRNB 2I27N 1O6TA 3TBSA 5D7IA 1HYSC 1N8ZB 1QLRB 1I4FA 3DMMA 5D1XE 4TLKA 2YEQA 2EC9U 4FLOA 3HMXA 5T3XD 3KPLA 1N12A 3EO1A 3NFPA 4NZRH 4JPSA 4R8WL 2OMTA 3PS6A 2HJKB 1Z9PA 3L5WB 4N2NA 3RJQB 2VN6A 3AS1A 3VFTA 3ECUA 1A22B 1W0VB 2A4CA 5T8IA 1G7HA 4LL9A 1PX3A 1MCRA 4Y5VB 4DSYA 4OVUA 1IBZA 2EZ0C 5JW4M 1JIBA 2IDSA 1NUFA 2IBZX 4Z3HA 4UB0L 2Z64C 1GGIH 5ACZB 4LNRB 5BRZA 3AMKA 3K6SA 3L95B 3MLXH 4LEEA 4IOFD 1JNNL 1IC0A 3FJTA 2QEJA 4MS8C 8FABB 2DQGH 1HHIA 1BHGA 4TNEA 2VN5A 2XJLA 2X10A 2GJZB 4X6EA 4FFZH 4YSOA 5I1GH 2Y7MA 2HLAB 2AJ3A 3JTSB 3I50L 2ZUSA 3G08B 2FSEA 2YUVA 4RGNC 4BFOA 1MVYA 4YHIB 5ADPL 3C5XA 3TJEH 4XHJC 2DTSA 1JGDB 4H7VA 2HX8A 2XVLA 4HW6A 3V4PA 4WEMB 1NKGA 5HHPA 3WTUA 4M43L 1CJYA 1UCBL 2ILLA 4U1IA 3SDDA 3CFEA 3IGUA 4QRUA 1ACYL 1OAJA 3Q2NA 4WWKA 3T3ME 4UM9B 2ENJA 3I6LE 5H37G 3UTSA 3GHEL 3F7PC 4PJ6A 4X6CE 3QXAA 1QEWA 2Q2LA 1WBZA 4B9KC 3GSVA 1KCLA 3TU6A 4B97A 1EXHA 2CJTA 2Z92B 3HTLX 2BNRE 3P4OB 1NFDB 3EYVB 3Q6FB 1YC7A 3QWRD 4R90L 1RZKL 3IGAA 1UENA 3K1KC 3RGHA 1VPOH 5INDB 4I89A 4NQDB 4RWYH 3NCWA 2Z8SA 4L8DB 1KCSH 3L1FA 3KPPA 3UMNA 1DLHB 1FFOB 2DMBA 4UTAL 4KMLB 1YHPA 3H9HA 5D6CA 3T8XB 2VERN 2JF1A 1NCHA 2IPTL 3U9PH 4KI5D 4E9XA 5DS8B 2VOTA 2D31A 2G5UA 1FH5L 1ZSDA 4GI9A 1PD0A 4KI5C 3WFHA 1TYEB 2HFFB 3VE0B 1EFXD 3NCBB 2FZ3B 4I8DA 5AVUB 1UXLA 1KLUB 2OMTB 4I1RA 4BUHA 2A74A 4XBEL 4LSDA 4XP1L 3F00A 3EZ8A 4U4BA 4IRJC 2BSSA 1ZY9A 3V6FA 4ZG1A 1MFDL 3D06A 2WYZA 2DQIH 1Q9KB 2LAAA 2NZ1A 1DJXA 4EI6B 3SQBB 1Z9LA 2EDHA 3CTTA 3S8GB 4OF8A 4BGLA 3OKNB 3ILQD 2NUPA 2X7LB 1I3GL 4PJEF 1BWMA 1LNUB 2QDWA 1LVEA 4AYFB 1S3KH 1WHPA 1MWOA 4OM0H 4XMZA 1D6VL 4OSUL 3X12A 3D09A 2AEQH 3SY6A 1JMXA 3WY2A 1WWBX 3GPEA 2CBOA 3B8YA 5T33H 4GRWH 4GSQA 3RZWA 5F7DB 4ES8A 2BNQA 4JG0L 3D4ZA 1T5WA 5CZXD 1I1FB 2XXGA 4GSXA 5C0CE 2P24A 5I2IB 4KO9A 3S3PA 1J7VR 3BQUA 2DYRB 5EO1A 2GY5A 1R4XA 3BGFB 2LOEA 1U3HC 4PYGA 5ANHA 4FF9A 4MNGB 3IU4H 1HKLL 4JQXC 1BFOA 1L4IA 1W9XA 4WWKB 5D7IB 3TF4A 1NM4A 1AZRA 4HU8A 2DYPB 5HHPB 2CXGA 2VCOA 2OMNA 3AQDA 4F24A 1MW0A 2FUQA 3T0XA 5CWSA 5LVEA 2PCPB 1VENA 1I8KA 4EUPG 5LGHL 1BF8A 4DCQB 3KYNA 3WV0A 4DFHA 5HGHB 5TDNA 2EUXA 4DUVA 2UZYB 3PREA 1T2JA 4J3OD 3PNWB 1DBJH 3O2WH 3PWVA 3UZQB 2A4ZA 5IOKA 1LEKB 3VXUD 4BK5C 1FG2A 1JI1A 3FUFA 3B4NA 1YY8A 4PJ7A 5BRZB 1TTFA 4HS3B 2BOCB 2AJYL 1DO5A 3AS0A 5SV4A 1ULVA 5BNXD 4JY4B 4TM9A 4ZPVA 3UFIA 2X4UB 5IVXE 1LDSA 1ONQA 2PWHA 1N6QH 2X2UA 1ORSA 3SYCA 1KPVB 3PWUA 4GW5A 1AP2B 1P1VA 1J86A 2CWRA 4LVHB 5B1JA 4TMPA 1KC5H 2FHFA 3GIZL 4XI5D 3MBEC 4ZXBB 4GRWF 5A2FA 3ZXAC 2TSAA 2GJ6A 2IPTH 2TAAA 3ILPA 5EWIH 4XI5C 5F9DC 3V0WH 4YSUA 2YGVA 5DD3H 5CJ5A 1XF3A 4U3SB 5MENA 4G7YH 4GXFA 2QPDB 1UB5A 1YYMH 2FYYA 2YAFA 2ZXEB 3KYOB 2YD6A 4GXVH 5GGRA 1XVSA 3VFWB 5C3LD 4JO4H 2JKTM 3FRPA 3OJDA 3UBFA 4ZQKA 4AVKA 3FQTA 5EU7C 4XBGB 3ZRCC 1GS7A 5DMIL 3WKYA 3VCLA 5JLZB 3CC5B 4G6JL 2F53A 2K7PA 4IBTA 1AD0B 2IPKB 2DYSB 4L4TD 4JDZB 3WJMB 1G6VK 3T6ZA 2EE6A 3CHRA 1JHKH 3RJDA 2Z0BA 2W8CA 2BFVH 4LIQH 5C09D 2A83A 1QFWL 3VXNA 1XSJA 4JVUA 4DKEH 3A3YB 3EXLA 1SQMA 5A7BA 1PEZA 4KWUA 4XMVA 5TFSL 3U7YL 4TSBL 5IG7A 4F1SA 4Q9BA 1J1OL 1F4WH 3RIAF 3SKNA 5KW9H 2WJ5A 1ZPLA 1JI2A 1E9QB 4BQ8A 4F8NA 5I8CB 1B3IA 5FAAA 3DTUB 2FWLB 1E5AA 4WCYL 5F3HA 3N1FC 4MSWA 2R7EA 3P4NA 3T8VA 1CGSH 1OP4A 4I77L 4YEEA 3TVMA 3TYGL 3S5LB 4NJ9L 1VZIA 3INUL 4N8VG 1ED3A 4NKMA 3CUPA 5D96B 4AI7A 3L3JA 4N2EA 4TUJB 3UYPB 2NNRA 3LVTA 5FXCH 1N4XL 1RULH 4GQ9H 2UZXB 2A9NL 1XH1A 3RU8H 1KCUL 2XN0A 2XTJC 4G9FD 2XPGB 3P0VL 1MCDA 3LJ3A 1J8HD 3G5ZA 3JTTA 4D0BB 4P5MB 3F12B 2ADJB 4NIYE 3LOWA 2NSMA 5CHNA 2ERJC 1IM3A 5IHZB 1O0VA 2CR0A 2X12A 3ECBB 4J3VA 5H2BB 1YNKH 4S1RL 1AR1B 1HNGA 5EORL 4GT0A 1QSEA 4X6BA 2IAND 4NHCL 3DXAD 4HLZH 4J8QA 1BQRA 1Y1UA 4RFEB 5I17B 3IF1A 4N0FA 2DQ6A 5B1JC 4G5ZH 1WUZA 5JNYA 2FX7H 2R2BA 3EOYG 2ROXA 1OV8A 3L17A 2O6EA 3JV0A 3QO1A 4U2YA 5F7DA 3SJVA 4H1LH 4WEUD 3T65A 1OCZB 1KFGA 1LO5A 4HZLB 7PCYA 3TO2B 1MLBA 1ZHKA 1TQCB 2Y1VA 5F2FA 4G9DB 1S78D 3GJFA 2AJSH 5KJRL 4XN1A 4ZFOB 2EXYD 2Y23A 3DVIA 4AXWB 2IV8A 3ZT7A 1VFUA 1R33A 4JFEA 5DF0A 1PG7W 2W9LA 1NFIB 3ZT5A 3TTYA 4CVXB 2K7QA 3BGAA 4WEEA 3EUUA 2ZKHH 4XP6L 3UBHA 4GAGL 5DA4A 1P5VA 5C0JB 2V8MA 4AUJA 4IU2A 2VSCA 3MRHB 1X5GA 5I74C 3WJJC 3MLPA 1IEHA 4JUSA 4K94C 4L3AA 5G4OA 5J4MA 4ZUSA 4HKJB 1UGKA 3ECVA 4C56D 2AQTA 2WOBA 3G5XB 4YDVB 5HYJD 3SDAB 1FJ1B 1ACZA 4BWUA 3NTCH 2ZQKA 4FYQA 5EIIG 1HHJA 4RMWA 4Q9RH 4CU7A 4U31A 2P3YA 2Q76A 2D9CA 3C6LD 3K4DA 4JRXE 1AD0A 3LS5H 3ZPDA 2UUDH 5FYJE 4KRNA 1FO0B 4OUOA 1NAMA 4YO0B 5DC4B 4B5ZA 3MODL 3GLEA 2IANB 3KHOA 4XCCL 5E9AA 3ARBD 4DGVL 3A21A 1GZPA 5IJKC 3HI1A 1FNEB 4JMNA 4RDQG 4C58B 4PJ9C 1HE7A 4W1TA 4Z7VA 3BUYB 4PBXA 3LKPB 4FRWA 1J1XH 5B38B 2HUHA 3EH5B 4I2XE 3D7PA 3H54A 2YBRA 3J8F7 3B37A 4EQ3A 4FQ1H 3RDTA 5B3SB 2WIMA 4BSVB 2DH2A 4G2AA 4G5AA 4M7ZB 1E9QA 3VXPA 1ODUA 2B77A 3DV4B 4X5QA 2OULB 4JFZH 1A21A 1I3VA 4MJHA 1F3DH 1AHKA 4L3ED 3TBSB 2F54B 3TN0B 2AI0L 1LD9A 1JPSL 4HIIB 1WS7A 2ZG1A 3KYOA 3VFWA 2ICEB 1KLGB 3V79C 1I7ZB 3AQYA 2XKSA 2C9SA 1KZQA 5BW7A 3LQAC 4LHUG 1OARH 1E3FA 5MEOA 4QMEA 4ZMOA 4Y5XA 2FLMA 3PV6A 3BVVA 4E41B 4F27A 2UY6B 3A6BH 4FX5A 5IOPB 2B9AA 2OJEB 3FTXA 3O3UN 4RFNC 5FF6B 2OZNA 1JVOA 1OSEA 1N0XH 3SDAD 3WTXA 1I8IA 4TNFA 4WHTA 1AJ7L 2R4SL 4M48L 3IJ9A 4J3OC 2VDQL 5L7XL 1UUNA 2EDMA 4BCXA 3Q06A 1J18A 4DKAA 1BAFL 1MCFA 1CPUA 3QI9A 2MOGA 3EJRA 2Q8AL 3VD7A 4F57L 2Y7QB 1KACB 4IGBC 1NEPA 1AY1L 1AOZA 2YAHA 5F96H 4XCNA 4PLKC 2ICEC 3EO9H 5D5ME 3GMOB 3C5SB 4KRMB 3QZNA 2BNRA 4YL4A 1F00I 1JGEB 4GKSA 1E4KA 2EE2A 2KDYA 3S5LA 1U92B 1YVLA 2J5LB 3NDYE 1JYVA 2DRUA 5D7IE 1YN7A 4PBVC 4WWNA 1J0ZA 5DJ0B 1CXIA 1ZHLA 4M62L 1UACH 4ZNEA 3G6DL 4N2LA 4ZW3A 1V7MH 1NCTA 3ZW3A 1JHTB 4GS7B 2WZ6A 4JANB 1JNLL 1QMUA 1MAML 5IHZA 2WW8A 2IH8A 1RLWA 1TT6A 3C2SA 4QRFA 4FABH 1A7OH 3F62A 4FYTA 4JG5A 4P9HH 4FG6C 4JVWA 4BQ9A 4K9EC 2PO6B 3MACH 1RJYB 3QDGA 3TZVD 2AQ2A 3RL2A 3SQOL 4XNUH 4BZ2H 4CSPA 2BIPA 2FJGA 2VSKB 3NIGB 5C0IA 2A1WL 4LU5L 2J3SA 1UXMA 3H55A 4RISL 1WIUA 4M7LL 5CJ8A 4BIKA 2XV6B 1AQ8A 2X1WL 3O4LD 2VLJE 3W82A 2AEQL 2A1WH 1VFMA 4Q4IA 3IVKB 2QPSA 5EUOE 5DZLA 3GMQB 2O5YL 3GEWB 5I24A 1JZ7A 4TPRH 3C60C 1MWAB 3HMWL 3QARA 4OLVH 5FOJA 4XOEA 3UZVA 1N0XL 3RWIA 1TNNA 1MVUB 3BP5A 4FCHA 5L4IA 2HTLD 3A6BL 3T1FA 3A4AA 3AACA 4G6KL 4G7SB 2CCWA 4TNVF 4BRJA 3G6DH 4DGIL 3QUHA 2BDNH 4N22A 1N2RA 3ATEA 2V9UA 5FV1L 2HRGA 3HUJA 2Z35A 2F1AA 1N64H 1WFJA 3H9SD 3TA3A 4E41A 4XPFL 3QI9C 2UZIH 1HT6A 4BFNA 4PJHE 3SDXF 3TURA 1UB6A 4APQB 1U8OA 3QG7H 5I15H 3S34H 1EXUA 4ZFQA 5ABAA 4R0LC 5HDLA 2P5WA 4N8PA 1J1PH 1QWNA 3OLIA 5E4EC 4JCWA 5L6YH 1DCEA 2CLVA 3P2BA 1VPOL 1R3HA 5DZ9A 2Y7QA 4U2ZA 1XT5A 3FTGA 3QIUB 2R69L 4GO9A 3RDTB 4N2AA 5FDWB 1B90A 4PS3A 1TVDA 5AYQA 1BAFH 1JS4A 1U92A 5JXEC 4XCCH 1M7DB 5DUPL 5EPMB 4CGUB 4GW4A 2V2WB 4KZEL 1YYLH 3BVDB 2J1YA 1OB1A 1SM3L 2B3RA 5DHDA 2PTVA 3BKCH 4HBCH 2HJLA 4P46C 5IQNA 1WFNA 4N6RA 4FNSA 5AYTA 4X7TB 3CK0H 3T4AA 3NJHA 43C9A 5CMAB 4ELKB 3EOBA 5IB3A 3VD4A 1BBDL 5KYWB 1HCVA 3CN3A 1N19A 3QDJE 1JPSH 5I1CH 4H8HA 3WHE1 3MYJB 3VFNB 2HPTA 3EIFA 3VFPA 4M5YL 4DFIA 5H35B 3TWCH 3ZDZB 5BV7H 2Q3XA 4YHPB 5HDRA 4APQD 4YSAA 4WUKL 3UX9B 3ZKMD 4HXAL 5CINL 4F8LA 3X13B 5C0BD 1I3RB 5JHAA 2QDVA 3ZKMC 5CZXC 1XWVA 1VLXA 2XKNB 3MKKA 1KBVA 2HKHH 4YHOL 1WGVA 5C3IA 5C0CA 1Y0LB 5A6IA 3DA0A 2WGNB 1V3MA 4ODWB 4RETB 3SDYL 3PP4H 3AY4A 1KB9J 1OWRM 2HG5A 3U6XA 1SJVA 1WZ1H 3U1SL 5F9JA 1QFUL 4I0PA 4O02A 3UDWC 1ZD6A 4PJ5A 3TNNA 4JB9L 5E9DA 3CX5K 3PHAA 2JXMB 5L8KB 4PVLA 1ZGLA 1XAKA 1CBVL 4NENA 2E46A 3TJHD 3VSQA 1E9PA 2W38A 3IDUA 43CAB 1H6EA 3HRZA 1KXTA 1PDKA 4JFPB 3JTBA 3CDGA 1RULL 4E9QA 2YRLA 4UBDD 5CBEB 3O6FA 1LHZA 3EBHA 1ZRUA 3KR3H 3T1WA 2BRRH 4X98A 4ZUVB 1JWUB 2IQAB 3S88L 1Q9WB 1T1WA 1SHMA 3QK0A 1SZNA 5J89A 2VQ4A 1ZE3C 2OSLB 3OXSB 1VRSA 3WGVB 4M1GL 4JKPL 3RNKA 2OMXB 3OB0K 4C57C 2ICWB 3GBDA 1I9EA 1I8LC 4GI8A 3UPRA 4PJAF 1QBML 3EH1A 5T5FH 5F9AC 1KCVH 4JFDA 3DYPA 4GO8A 4X0KB 3VWJD 5HGDB 4O2EA 1JCVA 3HE6A 3K3QA 4WJKB 5BJTA 3WKNA 2X3AA 4A1RA 4EDWH 4Z7QE 3WTSA 5EBWB 1OP5H 2E7HA 1G87A 5TH2A 2Q1EA 2FWSA 3PHOA 3QDAA 4FADA 2J1XA 2ENQA 3BAIA 4TVPH 4I3SL 2X2IA 2DTMH 1TEYA 3PY9A 4HOMA 4LGRB 1NEZA 3ARFB 3QUYB 4G7YL 4KI5E 4DK6A 3VDAA 2I24N 2OSWA 1B0GB 5EWIL 1ETB1 3HG1B 3H1ZA 3M8OL 4NM4H 4LO9A 2IGFL 1CN4A 3ZO9A 5T1MB 4NCDA 1GAFH 5IBTH 4LOUD 1KFAL 2R23A 3BZDA 3MDJA 2CA3A 3VVVA 1MY5A 4QHLA 3LKRA 1XCQA 2KMWA 4ODUA 2XXMB 3KWWA 4Y9CA 4EDWL 2ZD0A 2NQ3A 1A8JH 3ZTNL 4XPHL 2HWZH 3CSYA 2BNUB 4KUZL 3NDZE 4QJ3B 5C0CB 2VO5A 4OZFB 1A6ZB 3W9DB 3BGMB 5E4EB 4R7NB 2FCBA 4DP4X 5DMJB 2ZG2A 4L4VD 1A4KB 1QBMH 1H3XA 2PW1B 2QSQA 3ZMRA 3E1ZA 2B4CH 3FQRB 4EXKA 1XGRB 3K2UH 1KPUB 2YC1B 4P2QE 1PDKB 2DQUL 3WU1A 1R34A 2NCEA 4OGYL 2LU7A 3KPNA 3G5XA 3Q44A 4F7TB 1EGJH 3CH8A 3CSBA 2HFTA 1BBJB 5CS7A 4M9PA 4MAZA 1JZ6A 3QCTL 2CDFA 3IKKA 3QIBD 3V7AG 1HHJB 3UTSD 3PQYB 2HFEA 5IW1A 2FO4B 2ZUQB 2EDOA 5K1JA 4C4UA 4UILL 3P02A 1T1XA 2F2HA 1ZT4B 5DTFB 2C3VA 3QI9D 4M8UA 5BVJA 1QRKA 1T1WB 1MJJA 2C1OB 1OSPL 1ACCA 2Q7YB 5GGTA 3US0A 2WTPA 4KMQA 1ETZB 2LW3A 2OMXA 3K0WA 5BW7C 5F3BB 4BD4A 4LPWA 1FC2D 2WINA 2J72A 2NZ9C 2QVIA 1PIFA 1CCZA 1NFAA 4JFOA 4J3TA 1NDMB 4RGMC 2FR4B 4AIOA 1KDIA 1MCWM 2V8LA 1PW3A 2QQNH 4QOKA 1HX0A 4HUWA 5CILH 2H1XA 3NACL 4QRQB 3MOBH 5J6SA 5D7EA 5C07B 3NCCB 3CHSA 1F4XL 4RRPM 3BZFB 3Q8CA 5FUZL 3BPNB 2VDKB 4H25A 1UADC 4NDMA 1EJOL 5E2WH 1ZJBA 2NNCA 1NFDE 4ZI8A 4OCMC 5GSVB 3RZCC 2GUOA 1OT4A 2EO7A 5MI0B 4MMZC 4H8WC 4PW3A 3IWVA 4FQIH 3T3PB 2FIKB 3QRBA 1I8AA 1QPXA 3JQOB 2B9BA 4NZTH 4EVNA 2CD0A 5K9OA 1BYPA 2UY7A 1QFWH 1FAIL 3B2UC 3MV01 2NDFA 4YE4H 4EZMA 3QDGD 4WHTB 4TNVK 3PWLB 3ILDA 4PREB 3TWCL 2P5EB 3L16A 5IMLA 1ZV5A 3MLTB 4ANKA 4W9GC 4M4PA 4M6MH 5HBBA 12E8H 1DJIA 1G7JA 4UCFA 2O5ZL 5MENE 1D3CA 2UWEF 2BIMA 4A2HA 5DURD 1SDAB 4OGQC 3QA3A 4DAGH 3DWTA 1NIFA 2XPZA 3BMWA 4R83A 1ORSB 5DHMC 2NX5B 1MW1A 3IRCA 1VKXA 1NCNA 1P53A 2WUCH 4OLYH 4DUWA 3EHBC 1Y07A 4JY5H 1XB3A 2FEDD 5B3JF 5GGQL 4ANXA 3BIAX 4KPHL 1FZJB 1X3DA 4NQED 5I1AA 4XN9A 5D5MA 4TKWA 1BM3L 2V5TA 3MFFA 1MQKL 4AM0B 1QR1B 2M1KA 4N9OB 5SX5K 3APNA 1JGUL 5DUPH 1TF4A 1G7QB 4OUUA 1UOLA 2YSSA 3ZE1F 3IDIB 4FXKB 4PGZA 5E08L 2YMXH 1II4E 3FTYA 2QZ5A 4MJIA 2R9HD 5E2VL 1CF8H 4HHWA 4MD5B 3BH8B 1G1YA 4GBXA 1B6DA 4YMPA 2F74A 4IRJB 4IRZL 5BVJB 5FFGA 3FFOA 3AXHA 4C55A 2N3JA 2NNAB 1UCBH 5C0DB 4LOEA 1QFOA 1B9ZA 3VXTB 2V37A 5TDPA 1WYJA 3H7LA 4X9FA 3R7RA 4UT7H 3RRQA 2PUQT 4IHBA 1JUFB 3U9PL 3P73B 3IDJA 3BSZA 1DQQB 1OIOA 3A47A 2X2JA 1NIEA 1UD5A 1P4IL 1WG3A 2XCMC 3TLRA 3D1MC 2H6PA 2AS5M 2H8PB 2KUTA 1E9OA 1AR2A 3F3HA 4PEEA 4AQ1C 1PZ3A 1BFSA 4EIZC 2M83A 5F3HB 2H3XC 3HC4L 1HCFX 4AYFA 4WIQA 1NL0L 3L13A 1VB9A 1D5ZA 1A6TA 1ZVYA 2A6KA 2PR4H 3LAFA 4BCYA 5TQ0L 1JDCA 5T5NF 3WEXA 4FXLA 4K55A 3BAYA 5KG9B 2JJTC 2X6MA 3NRQA 3QJUB 4YDLC 2AZUA 3KDMB 3IDGB 3VTTA 4W9LC 2ZX7A 1DJYA 1C5BH 4HIHB 1NGWA 3MRJB 4HK0B 1TJXA 2WQVA 4JGMA 2V6HA 1BQHA 4F20A 1T83C 4WDIB 3BLBA 1XF4A 1WFTA 2AVFA 1BG9A 1I8MA 3JV5A 4X6DB 3CVCA 4Q97A 2BOBA 5EUOB 4B3VA 1R19A 3S4SG 4AW4A 3VO0A 4FHJA 4KX7A 3VWJC 3RYMA 2QT6A 2ZPKH 1GW0A 4DPAX 2OL3A 3WBDA 5MEQB 3LRSA 1TVBA 2AJVL 4M7KL 1E4XH 3U4KA 3ZDYE 5EG6C 4XNDA 4MXQD 2XNAB 4YXLL 5AFAA 5J1TC 1JNLH 2DLHA 3E3QC 5CEXA 4FQXB 1QI4A 1T3FB 3ZDZF 1ZTXL 3QXVA 1IAOA 3B2XA 1L5GB 3EGDB 4WHYH 1HFUA 2JJSC 4GIPD 2OMUB 1XGQB 2IG2H 5IQ9B 5BOJA 2BERA 2X9XA 3HHMA 3T8MA 1OOWA 1E5ZA 5IVNA 1TLMA 1UXWA 3RWCB 4LSPL 2YGNA 1EA9C 7CGTA 3SPGA 4NQXA 3DBXA 3R4RA 2X4UA 1H6UA 3JBG7 3UXFA 2IH3B 3AUWB 4K07A 1A9BB 2YAOA 1HK6A 1UVQB 4PG9B 5IV2B 2OQJB 2J88L 4JO1L 3TIEB 4AH2A 4WHDA 1RP8A 3D69B 1E2ZA 2ZP9A 4JFYA 3VI4B 2BXYA 5C0AA 5TDPB 4MYPA 4OGYH 2VAAB 1DN0B 2VDNH 3TASA 3ARDD 4N20A 4HJJL 1T21A 5A2CA 4ZAKA 3STBA 4XGZA 1F4AA 2NQCA 2CH8A 2F7OA 2IANA 3QJTB 3C6EA 5C08D 1OT1A 4KO5A 4PHZA 2YQ3A 3BMVA 2WYTA 4MD0A 4HLJA 3TCLA 3U1QA 3H0TB 5EU6B 5IVZA 4CU6A 1PYWB 5B38A 2PTUA 4M6OH 4TQEL 2CK0H 3TCXA 1MCNA 1WC7B 4N8VA 1FIEA 2QVMA 4N25A 4FP8H 3S9DB 1SBSH 2QQLH 3CN4A 1Q0XL 3FCSA 2PW2A 4I3RL 3EOAB 1FH5H 1OAZL 3WEXB 2BS71 4YLQT 4IBUA 4NX0A 2WP3O 1GVIA 5D1ZD 1NBCA 1R3IL 3L4UA 3LXBA 4I0PB 4N24A 4O02B 4IBQA 4H2CA 3KJ6H 4OIIH 3N1QC 4B9GA 3MA9L 1CDIA 4XPGL 2R0WL 3ESOA 2YBGA 1S78C 3GD1C 5KG9A 3S8FB 2EXYC 3K6FA 1FFPA 2UXVA 4YHNA 4YSPA 2BVPA 32C2B 1VFAB 4HFUH 4WWID 4LASL 1EV2E 4TQIA 2X1OA 4LMQE 5HHNB 4U6HA 5EMYA 1I8LA 5KVDE 4IIQA 1BMWA 3I02B 1HOCA 2RALA 4JO1H 4NOFA 5JHLH 1CDUA 5AW6B 4DO5A 4MAUL 1JZ8A 2DS4A 4ENZA 1W0WB 2JVUA 3I6GA 4V2BA 5AKRA 1CWVA 2Y06L 5J9PB 2OV0A 3BKMH 4N4YB 4KQ0A 1SLUA 1CICA 2OK0H 3GBNH 2QZQA 4HUMB 3WUWA 1KJ2B 5FO9A 3DDFA 4XAWH 2CGRL 4P48A 2ZXWB 2VRQA 1G7PB 3EGXA 1P0SE 5I6XC 2BRQA 2H9GA 2J44A 3PRZA 1H6FA 1SEQH 1ZE3H 4I3GA 4K5LA 2J6EL 1WS8A 3F5WB 4HWBA 1EEUA 3GRWL 4JFFD 1NIBA 5J1AA 2QGEA 3U6XS 2GJZA 1BX2B 1PD6A 1Z3GH 1P7KA 1FG9C 3DVGB 4TQ8A 4ORGB 2JI3A 3BCFA 4DKDC 1QEXA 1BD2E 1Q1PA 3U2JA 4U6VL 5KVFL 5AVRB 5B22A 2VABB 3B5GA 2WQAA 4OJDH 5TH2B 4F3FA 4FJYA 2EUZA 1PZBA 1SHXA 1INDL 2CMRL 1JV2A 1GZQA 2FT8A 4GNKB 4XB8A 3MLXL 5D2LA 5L2KA 4PJFB 2CE6A 3VH8A 4GRMA 4UB0H 4AMXA 4MS6A 5EUOA 1XEDA 4XZUA 1TJGH 4S1QH 3GFUA 5I1LB 5CN3A 1X4ZA 4RGNE 1K8DA 1INEH 35C8H 4CSZA 4NERA 1FC1A 2PPEA 3WS3B 4K7FA 2YPKA 2E9JA 4OZGB 1TVBB 5G4NA 3IGLA 2WIIB 4JFQB 5D71L 1W6WA 1BGXH 5C0BE 4JM0A 2X1PA 4NO3A 4LHQB 4HYTB 5AAPA 2AK4B 4CGTA 5I8OH 2Y5EA 5AW3B 2XXCB 5CLWA 5C6TH 5FHAH 3E8VA 1NCCL 2HVJA 4OZFA 4WNQB 1IGYB 1BVNP 2XA8L 3BO8B 5ABZA 1S7UB 1SRDA 1ORQB 3C5ZC 3C60A 3DGGB 4M7JL 3MRBB 3QQ9C 4NSKA 3IXTA 1E8ZA 1NEZG 1WE5A 3AAZA 2ID5A 3GI8L 4MZ3A 3UZVB 2V17H 4JDTH 1U41A 4NQXB 4YFLI 5J11B 4W9EC 5E1QA 3N0AA 3D3VA 4KOBA 3SKJL 2QJDA 1DVSA 4EDXB 4Z7UB 3O3EA 1ZOXA 4D0BA 4LLVA 1A6AB 2IDFA 2P43B 1GW6A 1KCRH 2QV2A 4ZQKB 3V6OC 5C0AB 3I9IA 4G8GD 5DS1A 1J9QA 5DHVA 2XQYA 1G6RL 3MHZA 4A37A 1IEAA 1FSKC 3GMPA 1VFAA 2XX0A 3FB7B 2E56A 4YGAB 4XX1E 2X9ZA 3OKKA 2X4QB 2A74B 4JLRB 4CW1B 6FABL 5FKAA 1JV5B 1DJZA 4ZSOE 3DHUA 5DFAA 1MW3A 5DHYB 4F7PB 1S7SA 3GO1L 1JCKA 3FSWA 3LRLA 4MMXB 3EDFA 4YSRA 2A83B 3L8QA 3D85A 5JR1H 4L0YA 5HTSA 3MREB 1RPUA 2R1XA 1JZJA 2F5BL 2YEZA 1ADQL 3MFGB 1U8JB 1T89C 3HG4A 3ELQA 3GSOA 1RZKC 3AU1A 5ETUB 4YHYB 1NDTA 2MKLC 3V0VA 2X40A 1XD1A 1G0XA 2J4WH 3NJLA 3G5VB 3O4LA 3NFNB 5JUEH 3FU3A 3Q2WA 2XIDA 4MWFB 3VXSE 4CBPA 4HAKA 1NCGA 5SV3A 3L54A 1ZTMA 4OIIL 3M88A 3KYKL 3MMEB 4JHZA 1D5MB 3OZLA 4L05A 2VDPL 4NZFA 3LXAA 3RVUD 4GKZA 5AOZA 3CUPB 5JIDA 3BDBA 1N64L 3VW3H 4JQIH 1MH5B 5SWZA 5IB1B 5IEHB 4Q2ZA 4EEEA 2CK0L 4S11A 2ESVE 3QFJE 4WI0B 4BH8B 3HCVB 3VXRA 4FS0A 3MCKA 3I9PA 2W9EL 5C0NC 2MTAA 5FGCE 4R7DB 1YPZE 4C8XA 5HYSG 4C4KO 5DR5L 1SHWA 4YSEA 2HCZX 3RTQC 4DW2L 3EJYD 3QORB 3QO0B 4KH9A 5HDBB 3T2PA 3EDKA 1PCXA 4JFQA 2VL5B 3PWVB 4W81A 4LCCC 5DS8A 2WCPA 1XV8A 3S5ZA 3EOTH 3T65B 1FV1A 1A7RL 2G9HA 4M7LH 2P52A 4RAUA 2KH2B 4AC2A 4UZGA 1MZYA 3GMMB 5A3ID 2ZUWA 1J0YA 3VH8G 3SE4A 3SOBH 3UTQB 2OJ1A 4PJEB 1T1ZB 4FLQA 2XZCH 2IQ9L 2L04A 4J8RA 2Y9RT 3LZFL 4FFVD 5FW8A 1XQ4A 2X42A 5B7FA 4CVXA 4X2UA 1CZ8H 2BHYA 3VE0A 4YDKH 2AITA 2N0KA 2DL9A 3PAVA 1AE6H 4FNRA 1KBWA 3IWUA 4V1DB 4TXVB 2CIKA 3QHZH 4KH2A 4OQTH 4R96A 2HUEA 1QZNA 4Z18A 4G43A 3RI5K 3JZYA 2HA1A 5KUKA 3RTQB 1MCPH 2GTQA 3V6ZB 3MRFA 2NDGA 4LLYB 1PZ5A 3ZE2F 2DI8A 5JMOC 1L3WA 3L4CA 1GIGH 3FQ4A 3REVA 1HC1A 1XO8A 1NANH 3QQDB 2VW7A 4GAYB 3ZLQC 1ODAA 1PZ2A 3FU5A 2WWMD 1PU0A 2ED9A 4G8EB 5GGRY 3SE8H 4P4RA 5B1AB 2VR5A 1ASPA 2KC0A 5M7QA 3TT1L 3GJFK 5AKTA 4PWJA 3E38A 4UIMA 2WXRA 3VFRA 5EZJB 2R0LL 4G80A 2WN3A 2QELA 3G04B 3CQQA 4Q9CA 1TEGA 3OF6D 5H94A 3CVHB 4CJ0A 3DV4A 1W2KT 5BZWB 5TE6L 3VFGH 2EH7H 3WIFB 1LILA 6TAAA 2PP7A 3OV6A 3L7EB 3N44B 1DFBL 1KB5H 3RNQB 3F65A 2WKOA 2MCPH 3HR5A 5HPMA 4WU7A 1WZKA 4WW1B 1QHPA 2JTDA 2OP4H 3JWNH 4OAWB 4PJDA 4AJYV 4U1IB 4TF4A 4Q2ZB 4NN5B 2XACC 3NG5A 2J8OA 4NNPH 4B50A 1LO4H 3HBZA 2AI0H 4PVNA 3K71B 3M7OA 4NAQA 4HX1A 2JSFA 3F12A 2J6WA 3Q3GA 5ECGA 1MFUA 3IE9A 3SKMB 2OW6A 1LP9E 2OPCA 3CLFH 3IMWA 4IRZH 2D8KA 1MF2H 2BP8B 1RZFL 3T0EB 4FN0A 4E9LA 1G7HB 4D94A 2XVBA 1BWWA 4XVJL 4BFFA 4Y4FB 3HNTH 3CU7A 4KGLA 4LLQB 4M29A 2C9RA 4PI0A 4JG9A 2WLIA 2WLZA 4LCUB 3FS9A 2EVIA 2DV6A 1U8HB 1JGUH 2ZWNA 3F58H 4ACTA 4F2MB 4HVBA 2X4NA 4GLRH 1U4FA 3VQMA 3RX7A 3L3DB 1MQKH 5D7HA 1UJTA 3FOMA 3NACH 4I87A 2CRZA 1QPPA 1WFOA 3CC5A 3D0LB 3V6ZA 4H26B 1Y6MR 2ZX6A 1BMGA 4EN2A 5J06A 2BS9A 5EU4B 4YC2C 2V7NA 1E4WL 1G0YR 4IEFA 1HI6A 3HHRB 4XBGA 3EFFA 3TH3T 1JNNH 5I6XB 3H7BA 1YDPB 1DVFA 3QXDB 5I75C 4M03A 4NQVA 4YSSA 1GGIL 2L4OA 2BSDA 1FVEA 4F33A 5IHBA 2ZKHL 3Q5YA 4XP6H 2WLJA 1TKWB 1F1AA 4HEME 3BUQA 4G6FB 4FYRA 4N0CD 1HH9B 3M1CA 4OKDA 5CIPH 3WAKA 4ZS7H 4QLWA 25C8L 1N5AB 4ODVH 4KK5C 1P2CB 3DXAB 4DF9A 3AY4C 4JM2C 1I7UA 3MCG1 5T1LD 5FM8A 2EIJB 4WKXA 1CLOL 2KDGA 2P8MB 4WK0B 3SE9L 1EJOH 1E4HA 3NP3A 5E2WL 1NCBH 3K2UL 2GG1A 4M3HA 4MSWB 3ZY7A 3QH3A 3IN2A 3SQRA 3CVHA 2CRIA 5CGYC 2YD3A 5C09E 1NCAL 4KZDH 3B9KA 3ZMNA 1TQUA 1UWGH 3H9HB 4L1TA 4OI7A 2E5EA 2R1WA 2XFGB 5HHME 3RL1B 1YLBB 2PN5A 3FQYA 2YZ1A 5C0AE 2ORBH 1QBAA 4EN3B 2NW2B 5ERWA 4EZJA 3SGDI 5KYUB 3MYJA 5JA9A 3N85L 5EBMB 5MEPB 2EYSA 3FZUC 1M7IA 2FT7A 4Z95H 3PJLA 4M9OA 1AKPA 5D7LD 1BLIA 3ARFC 2CR6A 1XGPA 5DC9B 1ES0A 1M05B 1KELL 2P5WD 1TENA 1FL6A 4Q6IB 3IT8D 3ERXA 5D9SA 5D1XA 4MMYA 1LO0L 3SJVB 5JQ6H 1XCTB 2BZDA 5DO8A 2WB1A 1FG2B 1TJMA 1DVFC 4FYSA 2GW5A 3FUJA 1J9TA 3ZSSA 2Z8RA 4EUPB 1X5MA 1QFWM 5AVSB 2X1QA 3ET9F 1S9WA 4S0TD 2DM4A 3CSGA 2HG5B 3BN9D 3F84A 3UYRH 2NUTA 3ASWA 2A6IB 4ELDA 1MFVA 3C8DA 3VWJB 2ZSVA 1J1PL 2HH0L 5K9QI 1NGZA 1RHFA 5E2UH 4P2QD 5E9DB 1JHKL 1J9RA 4OZGE 3LH9A 4U6YA 5KVEH 1I1FA 3MLUL 4HU2A 4KDTA 1CFVL 1HHGB 5LO7A 1S9YB 1BVLB 1O7VA 5C70A 4L18A 4M02A 1M2VA 3I9AA 2COQA 4JW3A 4PB0H 4TUUA 5DMIH 2DQJL 5JO5B 4DK3A 5CMAA 2NX5E 2CSPA 3CFBB 1OAKL 1KBGL 1OSZA 1YAZA 2XYBA 3IJSB 3MZGB 4Y7OC 4A6YH 2ITDB 3HI5H 3B1UA 4P46D 4N0UB 4KKZA 2PWDA 4ZZFA 1XXFC 1A8ZA 4ODBD 2MPAL 1KCKA 4AZUA 5GJSL 2WLYA 2CDEB 2H32B 2EDLA 3V95A 3ABZA 1GZPB 3HC0B 3BKYL 4P5KA 2JKXA 3GRBA 4HJ0D 4L4TA 3VYOA 1CD1A 2ZWKA 2BP8A 3S2AA 1M3JA 2BVTA 1DL7L 2XWEA 5C0BA 1A2YA 4PS8A 1IIKA 1WEJL 3BC9A 2LU4A 4OV6F 5IJKA 1ICTA 4PJBB 4DEUA 3VXNB 2NYYC 5IHHA 1S7WB 4AYEC 3TT1H 1YEEH 5DD5H 4X6CA 3B3IA 3GZOA 4JFWA 1EAJA 1KLUA 1DSFH 2XT1B 1UEYA 3ARTA 4XVSL 1CGXA 1A1OB 2CK2A 3ZZLA 4F5CE 4MJ6A 3VRLF 1PY9A 1XGYL 4J3OG 4PQXA 1TSRA 1E5YA 3W1ZA 4P9HL 5E9DD 2ICEA 4AJ0A 4YC2B 3LHAA 1NCBL 1MWAA 3RPKA 3OM3B 1PQZA 4RX4A 3N44F 3VGEA 3A24A 1ZGLB 2XZAL 2CGYA 2CO2A 2OMWA 3K46A 4ZMZA 3QISA 3DV6B 3S35X 2WSPA 2VISA 2EICA 3W9EB 2CUHA 3FTZA 3NT0A 3QUZC 3HI6L 4JFPA 2YPLE 2H26B 3FQUB 4NWUL 25C8H 1BEXA 2TRYA 1OCWL 3QI9B 4JO3L 5AAMC 4UNVA 1PG7L 1ZEAH 4JZJC 4K8RL 4ODXA 3B43A 4FQLL 4XN4A 4KY1L 5LNDA 4NP4L 2CUAA 4O00A 1O5DT 5DRZA 1H3UA 1GOFA 2IPKA 4I7ZC 4POUB 4MB5A 3TZVB 5JW4Q 4G82A 5TGBB 1E5UI 1K6QH 3RX8A 3RAJH 3GMOA 4NLAA 4P3DB 5ID1B 5IFHH 5INCA 3SCMA 4FFWC 2ZP0T 2Q8AH 1D5MA 3QIWA 4K23H 3RWFA 4WUUD 4MRBA 1G9NC 1KY6A 5J12C 1HCYA 4OZIF 4GI6A 4KXCA 5KBMA 4D9LH 3F58L 1T4WA 4BEIA 1HH6A 2WMPB 4NGHH 3WFCL 2R1WB 3WY4A 3BIKA 2DB8A 4JN1H 4DTGL 1FZOB 2ROYA 3OL2A 4CKQA 3DSFL 4RAVB 2VKXA 3I6LD 2MPVA 4BKLA 4ZW7A 1I1AC 4JE0A 4WUKH 5D2LE 3AITA 1BAGA 5E9NA 2F8VA 4NXKA 4BINA 1G7QA 4K7PL 1D6EA 1YPZA 3MV7D 1F1DA 4BWTA 3SGDH 4Y7MA 3RL2B 2Z7WA 4XHQA 4JKWA 4OJCA 1LO4L 2XQYK 3O3AB 4BFKA 1G1OA 5DXWA 1VCAA 2Z3FA 2JJUA 3IETB 1OAQH 4O4YH 3MBXH 4JFSA 3KYAA 3QDJD 2TSBA 3JVFC 1QSEB 4X6BB 4EI5B 3CK0L 2VR9A 4RWYL 1DVTA 5D5MF 3RWIB 4KTYA 1HAUA 4Y0GA 5TTRA 4F37F 2AC0A 1BQHG 4R90H 5LG6A 3OHXC 1DQQA 3JUYA 3VFOB 2GHWB 1DDHB 3K6NA 5E2JA 1B0RB 4L1HA 3TBTB 1I7TB 1L3NA 4NQSA 3MRDB 1MCIA 2J71A 1TMQA 2HT4C 4K23L 3JWNG 3TV8A 2WSDA 5C1MB 2QFRA 4XP9L 1U4EA 2ENPA 4Z7NF 3NJIA 4JAMB 5DQ9A 1XF2A 3SCMC 5L6YL 1EBAA 4X42A 4P5RA 3PQYA 5I18L 4HHGA 2IAMA 5EZOH 3MRKB 3O6KH 3UTZA 4HHAB 1ZSHA 2IBZY 3KDMA 2OJEA 5FF6A 2BW5A 4MXVE 4AYBA 4RNRA 3JZ7A 3QPXL 1Z5YD 1I53A 4UOZA 2VSMB 1RU9H 4U6TA 2JIXB 2VQUA 2P80D 2YJQA 5LDUA 3ME0A 4LHUB 2FATL 1D9KB 3EGXB 4FFZL 4X98B 3BD4A 2XN9D 2Z1PA 3QIWC 1LXMA 2HYMA 4R5VA 5CF3A 1V7ML 3WE6B 3T08A 3ZL1A 4YLCA 3FB5A 2R56H 4DZ8B 4QHMB 1IFHH 2XRAH 3FBKA 1MW2A 1QHOA 1RJZB 3U4BL 4XCYA 3V7AE 1AXSA 3ZK0A 2K78A 4UZUA 2DKSA 4GW4B 4BK8A 4NGHL 3EXJA 2EEBA 3F64A 1ZLEA 2XA3A 5D1ZA 3ZE1B 2R51A 1RK0A 4GUQA 4WI7A 4U1MA 3E1F1 1XH3B 2XOTA 1D5XB 1H3PH 3ULSA 4I9XA 2BNRD 3PABB 5IK3A 1JXDA 1CDBA 4NZRL 4R8WH 3CFIC 4IMKC 1E5BA 1U8IB 2APFA 2YQ2A 4HFWA 2B5IC 1QLEB 4WEBH 4U3CA 5AW9B 2QMKA 2YLKA 3J7HA 4KKCD 4Y1AE 3HS0C 3VXOB 4DGYL 3S35H 5JPNC 1VZHA 3QFJA 3MACL 4HOZA 4Z7NE 4YSCA 3F83A 5IM7B 5KAQG 4MJ4A 5KTEL 3UAEA 3FQWA 3VNYA 4D8PA 4BZYA 1GR7A 2FJUB 4Y4FC 1P4UA 2AV7A 1SLWA 5L0QC 3ULVF 1MI5A 2Z31D 1WICA 4OU3A 2PCFB 5LWYL 3HC2A 3OKLA 4A2DA 2IBGA 4Z7OE 2QKIB 2QTEA 1OHZA 3WXVL 1XB6A 4PJFF 5EEZA 3IDMB 3C5ZA 4BZ1H 2W92A 7FABL 3HN3A 3MTXA 2IOMA 4G8IA 3BGFC 2NNFA 3V4VA 2WV3A 3MBWB 3FT3B 2HRPL 2JXMA 3MJ9A 5EO0A 1MFEH 3O8XC 5JUEL 1GKEA 4TNWF 3F05A 3ARDB 2VXSH 3Q2VA 1HQ4B 3U9WA 5FA4A 5EOQL 5IIEA 4RMQA 2F74B 5C0RH 1MSPA 3ZBMA 1U2CA 5MEQA 3D39A 4Z23A 4GKNB 4LSRL 1TKWA 4BQBA 3TA3C 1JF1B 1KXVC 5D1XD 3LS5L 5JZ7D 4O02H 5EU6D 3LS4L 3TA3D 5ISZB 4X5PA 3EYUL 4M00A 1NCOA 5EOCL 2FH6A 5KJ7E 1KLFB 1T1XB 4KJWD 4P5TC 3A22A 1G6RH 2Y2TA 3ZRSA 5I30H 2J57A 2P5PA 3ZDXB 1KJ2L 1OB0A 1PLAA 4AEFA 2EE0A 3ALXA 4DETA 4PH8A 1KYAA 2BSRA 2Y07L 1IQDA 3DX1A 4FC3E 4PY8J 3UPRB 2L3BA 1MUJA 1NANI 2PMZA 3R0MA 3WFEH 2VDRB 4RZCA 1CU4L 4WTZA 1GMIA 4GKZB 1V5JA 4UAHA 1ML0A 4PTUA 2CPUA 3TIEA 3BEWA 3VXQA 4E9YA 1Q4NX 1KN2H 2NT1A 3QEUA 2XA8H 3HPLA 2NXYC 2HJFB 2BXZA 3LY6A 4FFTA 4OJFL 2ZIDA 2YRBA 4MGXA 4FG4A 5A1AA 2E27H 1DN0A 3Q13A 4L4JA 4PV8B 4P46A 1OXYA 5LGHH 3DSNB 5DZOA 3RVXD 3X1FA 2J55A 1SXSA 4G8GA 2FX7L 1A6PA 2UYLB 3ZQ9A 3P3YA 1BOGB 4HOWA 3FFCD 2PXYD 5IB3B 2L7JA 4PJFE 5IR1B 2G2NA 4FD0A 4ZS7L 3IFNH 2YD1A 3NSYA 1JHLH 3EJZC 4R4FL 4ZODA 1SVCP 1A14H 2BCKB 2AV7B 1IGFL 5T1MA 1A9EA 3NIFF 1JV2B 3KL5A 5LUMA 1SXCA 1QEWB 3QUMA 4PRPA 2I69A 1OAXL 1P4LB 3FQWB 4PGEB 3NJMA 3BUPA 1F1GA 5CFAA 2QQQA 4JX0A 3OVUB 4Y19A 2A7BA 2FHBA 2ZKYA 4Y1SA 4JY6A 3T2QA 1IAOB 5LXVA 2YD8A 4JFFB 1INDH 1G7LA 5AVYB 2AJXH 1SNRA 3NCFB 5HYJE 1OE2A 4PJCF 1VGEH 4HT1H 4CRPA 4HAFA 1OO2A 2LR4A 3VXSA 2K8QA 2Z6FA 1Q8MA 2RD0A 3QDGE 1EXGA 1ECYA 3PPSA 2KT6A 3KBHE 3ULSB 1OGSA 2XTJE 1M56B 4Z78A 2AJSL 1CDGA 2WQUA 1IC4H 4YN3A 1RZGB 5L4JA 3D5OF 3IDYB 2OL3H 5EUKB 3IDIA 2D7QA 4G5ZL 3OQRA 2ZUTA 2JELL 3IFPB 4ZAKD 2IIJA 4TUKH 1QSVA 3MA7A 3GUTA 4JZJA 4O2CB 1Z3RA 1U6AL 3MLZH 1R3KA 3ZR6A 5KVEL 4PRIE 1SOXA 4J3OH 2XV2A 4KVNH 4ETQA 4N2KA 4L1SA 5C0DA 2CNZA 1QVOA 5DVMA 3EF7A 3T0BA 1HQRA 2B5IB 5FO9B 3VG9B 3QR1A 1A4AA 4MJJA 4O51B 4C83A 5KAQF 5HI4C 3LYRA 5GSRA 2A99A 4KNSA 5F1NA 5BO0D 1WWCA 3EHBD 4YIQB 3EJQA 1XBDA 4JCLA 4NBXB 3SCMD 4AT6B 2ATKA 3BZ4A 2XFXB 1F3RB 3BWAB 4B95C 4CVUA 2X4PA 3QIWD 4Z7VE 2APSA 2ADGB 2F7IA 5E95B 3LB6D 4ONHB 2L7QA 4GRWB 1FE8H 4IGBA 4MX7B 4HXBH 5L0QB 3QEUB 3KJ6L 1MKFA 3GMRA 3KPRE 2OJZL 3P9MA 3GS0A 4D9QE 4YBLB 3OB8A 3HFMH 1JZDC 4HGKC 3GPSA 5I66A 4NDMB 4HWUA 1EFXB 4LL4A 3ZYZA 4BHUI 5EO1B 4FTVE 3ARDC 1T6VN 4G8GB 1CYWA 2WXJA 4KK8D 4P4KB 5IUSA 5CEYB 3ZYJA 4MCMA 4HK3J 5I73C 4ZUWB 5IQ7L 4H0GA 4OBSA 1HL9A 3EYQC 3CX5J 4F92B 4K2UH 4XO8A 2O6CA 4WHCA 1S9XA 5BS0D 2GITA 4MCYA 3S3CB 3QEGL 5T1KD 3SO3B 2ESVA 4Q89A 2O72A 3BQUC 3X14A 4EKJA 1NOFA 2MQCA 2KZBA 4ALAL 3HAEA 3F7YB 4KPHH 1W91A 3D07A 4RFOH 3BO8A 4Z9KB 5I1GL 5FUCC 4TVPE 3T4YB 4ODVL 3SCMB 1MCPL 3LV3A 1CT8B 1QW9A 1XIWC 3SODB 4M93C 2L0DA 5EZLA 3N42F 2E9WA 4N6RB 4LARL 3FOMB 2APVA 1E6JL 2XG5B 3VA2C 1CZ8L 2FJFA 1D5RA 1IGCH 3VI3B 1YEFL 1RD6A 2NYYD 2LLNA 3CMOL 3MNZB 1X5ZA 2V9QA 3E3QE 5AW0B 5GIRB 4PGCB 4GIAA 5GGVH 4Z78B 2XETA 4OCNC 4PJ5E 4YE4L 5CJOL 3AABA 3ULVL 4NEHB 1SOQA 1S2EA 2MQGA 3OGOE 1M4KA 2G5BA 3L4ZA 1SJMA 1QBBA 1TZOA 4OGAD 4P4KD 5T33L 1S7TA 4YXLH 5FW7A 3MJ8B 4NC0B 5B38G 4EBQL 1ZT7B 4XMKH 2JQAA 3Q43A 1FVDA 1FF5A 1FCCA 2FYVA 3MRPB 3VGGA 3C9NB 3QZWA 5KANG 2NY4D 3GK8L 4OZ4B 4N9GA 5FYKH 2MQ3A 2DLGA 3DX6A 3MRFB 1MAJA 1SN2A 5E1GA 2V2XA 1H3WM 4C83B 4JRYE 5CZRA 4FXGA 2GCYB 1A6WL 1G9ML 2LTQC 1JVLA 4G42B 1MIML 3BP4B 3SOTA 1BQUA 1S7QB 4HIQA 4N28A 4XOAA 5F3FA 5FO8B 4R7LA 4QXTA 3WN5B 3MRBA 1PSKH 2AJ3B 3JTSA 3KCWA 4V1DD 5IBUG 5KN5B 3N91A 1OSPH 4K0OA 2J8UF 5JXEA 2OTUA 3EW3B 3P1VA 3SD2A 4TVPD 3MRQB 2OBGA 1UWXH 3MGTB 4UQ3B 4G80B 3BZFA 3S36L 5BQ7B 2CKBA 3A4EA 2IAMC 3UADA 4Z3IA 1XAUA 3KPLB 1Y6NR 2Y1YA 3WKMH 1EAPA 3GSUA 4L8SC 1RHHB 2QGDA 2WWKO 5TQ2L 1KPUA 1MFMA 3OAZK 4UI2A 4GEIA 4K94L 2I26N 4A39A 4JRYD 1PLCA 3LD8C 4FMVA 4DEPC 2X70B 3WDJA 4YBQD 2XBTA 3LN9A 1EGJA 4WKZB 3G6AA 5JPMB 2WTOA 3P11L 3AWFA 3NUKA 4XP5L 4RMUA 3HC3L 1KIQB 5E2TH 1ASOA 1ZKAA 1T2QH 3WL9B 4LKCA 4UNUA 1XSKA 1KTRL 3KYMA 4KJQC 3MLVH 3UOAB 1ZHNA 5CR8A 5HGDA 2A5UA 1AIFA 1XSIA 1YNLH 1U2HA 5FFLA 4P3CL 5E8EA 5C0GA 2ATPB 3ES6B 4H0LC 1N7ML 1UYWL 5GIRA 4OZIA 2NXZD 3L5XH 2A6DB 5ADPH 2CM6A 4Y4FA 1E4JA 3LD8B 5JHMA 1SYSB 4L8CA 4P2RD 3DVGA 3IMTA 2J7LA 3ZZ1A 1G43A 1I9IH 3MLWL 3LEYL 4AVJA 1S7VA 3MJ8A 3ZE2B 1IBHA 1M6OA 4MJID 3IFLL 4GBXC 4MZRA 3ZL2A 4FKEA 1AZNA 3SDDB 1AI1L 1CXEA 1WDAA 1WAPA 2VDOB 5HHMD 4JGNA 3TWYA 5DU7A 2D0HA 4EI6A 1ID5I 2FIKA 2HSIA 3M1BB 4ONFH 5AL8A 5GRJL 4CDGC 1CD1B 5LQBH 3VFSA 4M1CD 4PP1D 4ADJA 1INEL 3MNVA 3MTRA 1R24B 3JV6A 2DWEB 5AW5B 2P4AB 1NPJA 4JJ5A 4KOCA 2D7PA 3RFRA 1H15B 1A4KA 2V2XB 1KN4L 5DEGA 1A65A 1KCRL 2ZT9C 3LPPA 4WU5A 2QQKL 2P5WE 5DUBB 1DQML 2BSTA 3L7EA 3W0WB 2OAAA 4M5SA 4F80A 3H9YA 3OPZL 3ARBC 3T09A 1A4BA 4AIZA 1KXVA 3QDME 3LH2H 1VJSA 1EDYA 1N5YH 1D7BA 2NOYA 1U8MB 4JDTL 3ZE0B 1YN6B 1WHOA 1NCWH 2AXFA 4PP2A 4IBLT 4A04A 1GYUA 1Z0MA 5EHFA 4ZXBD 4A7UA 1PKOA 5FYKD 1PAMA 2H1LM 4L23A 5I1AB 2AABH 1RVFL 2JCCF 2DWSA 2FECL 2ZCLL 3GHBL 1OD9A 3RVVC 1MJ7L 2FGZA 1UA6L 3LZLA 3ABMB 2VZUA 1QO3A 3WI9A 5E8DL 1BG1A 3QULA 2EEDA 2XV0A 2Y72A 1T20A 4X4ME 1DUYB 4BHUA 4FCAA 1BGXL 1U36A 4NHUA 4AX3A 4JHWL 4MJIB 4BFEA 3II1A 4JO8A 5DHVB 3LTVA 1JZFA 4UQBA 3CN2A 1QQDA 3MRPA 1TPXB 2FR4A 2RGSA 1H3PL 3FSZA 4LOVA 4AENA 4BYHA 4ONFL 1AVAA 4HIXL 4Z3GA 4CW1A 4LP5A 3PWPE 5JHLL 3GXMA 4XP4L 4OFPA 4I2XB 2AAAA 2IH1B 2MCAA 4KJYB 2DQDL 4QRSB 3OKNA 1KMGA 5T3ZD 5I6LA 2ZXCA 3GIVB 5EZJA 5K69A 3TF7C 3P73A 3G6JB 4XRCA 3UAJA 1ZS8A 3MLWH 4IJ3B 3ZGHA 5JHBA 4U6VH 3GO1H 4PRHE 2BS8A 4DPRA 4B3EA 3HVNA 1E3XA 5D6DA 5EU4A 5I5JA 5B39G 2YPLA 2W07A 2CUMA 5ICYB 4F9PC 1AS7A 1CQKA 4LCYA 4YK4C 5EBGA 1NPUA 1CE6A 2YRZA 4BKSC 4CAGA 4RAVA 2VN7A 5IEKA 3QZBA 4ADGA 2H0EA 3WFZA 5EZIL 2JJVA 2MJWA 4G9FB 4RSYA 5IFAH 2HFGH 4P23A 2G2RB 4QT5A 2D3JA 3IBEA 1XD0A 5BVPH 1AR1D 3G5YA 2ERJB 3WNOA 1IAKB 3ATFA 1U58A 3HLAA 1NCCH 3HZ3A 4GRLD 5F71A 1PKQE 3U9UA 3CBJB 5EOQH 1PYWA 4YX2H 2D0FA 2DQDH 4PBDA 1GGBL 4W9DC 4AL8L 4NNYB 1MHCA 3TO4C 4IS6A 4MDJA 1EZUA 2DBLL 4KDTC 3HJEA 1YY8B 4PJ7B 1VERA 5CUSH 4FTDA 4Y1TA 5I1IL 4P2YA 1LWHA 3X3FL 3DVNA 2EUVA 4OCXL 1ONQB 2ZYIA 2GFBB 1CLZL 3I3BA 3N40F 4MA8L 4H44C 2R7EB 1BZDA 4PCYA 1RK1B 4CADA 4UDUB 4K7PH 3MJ7A 1T5KA 4DP1X 3FB8B 3KLHC 1QD0A 4FNLL 1RH8A 3CFUA 4DGIH 3FQTB 3HRPA 1MJ7H 4LL1A 1UJ3C 5KVMC 2VLMD 1T04A 1QQDB 4UANA 4X8JA 4ZOCA 4ELME 2K9UA 5EU3B 2NTFA 2OMYA 3RTQA 4HUUA 2FQGA 5HDOA 1QNIA 4FQ2L 2AERT 3MV7A 2GTZB 3VG9C 4PVMA 5ESQB 4CL7A 4LNVA 3P2DA 4DKFH 4Z77A 2KZKA 5F7UA 3NH7L 3AT8A 5KSBB 3SDAC 3HMWH 4PJGE 1EWHA 3NPSB 4MXWH 1JZIA 1LO3H 1EJ8A 3GWJA 5F70A 3PG2A 3LVEA 3IMUA 4P04A 2XHNA 3ZL4H 3MX0B 1U33A 1YEHL 4JDVB 3ESNA 1COBA 2J73A 5C0EB 4LU5H 3PL6A 4B6ZA 3WNPA 2A0LC 5E8PA 1WC7A 1DBMH 3GJEB 2HKFL 2N4IA 2NXZC 4Z7UE 3W57A 2OCCB 1I82A 4KJPC 4NO2B 2PW2B 1GZHA 3NIDE 4MBOA 2BY2A 3IJSA 4WY7H 3U4BH 3DX0A 3WEMA 3MRIB 5C0JA 1JGLH 4CKVX 5LHDA 1UD8A 3GI9H 3NPSC 2Y7LA 2H4EA 2X88A 4KDWA 3CFDA 4RRPA 2XZZA 3QXAB 4O9HL 3RBSA 1NQBA 5JOPE 3US1A 3HKZA 2YGQA 1JGVH