4TMSA

Plastic adaptation toward mutations in proteins: structural comparison of thymidylate synthases
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
316
structure length
316
Chain Sequence
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plastic adaptation toward mutations in proteins: structural comparison of thymidylate synthases.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase (methyltransferase)
source organism Lactobacillus casei
total genus 103
structure length 316
sequence length 316
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1992-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4tmsA00
4ISKA 1VZEA 2KCEA 3JSUA 4XSEA 3N5EA 1BKOA 3ED7A 2A9WA 3IX6A 2BBQA 3CL9A 2G8XA 1JMIA 1TLCA 1BJGA 3DG8C 1TLSA 1JMFA 4PSGA 3TMSA 2FTOX 1DDUA 4KNZA 1TJSA 4IQQA 2OIPA 4XSDA 1TDUA 1J3IC 4EB4A 4H0RA 1HVYA 1NCEA 2FTNA 1JTQA 3EBUA 1THYA 3K2HA 4G2OX 1KCEA 3B5BA 3IK0A 3BZ0A 4GEVA 4XSCA 1NJEA 3BNZA 1BP6A 1EV5A 4IQBA 1JG0A 1FFLA 4KYAA 1VZCA 2H2QA 3UM5A 4DPHA 3KJRA 3V8HA 1F4EA 1I00A 2TDMA 1TSXA 3DL6A 1BO7A 5HS3A 1TYSA 3BHLA 1TVVA 1F4FA 1JUJA 1TSNA 3KJSA 3IJZA 4KY8A 1AXWA 1AIQA 3UM6A 1TISA 1BP0A 3BHRA 4E5OA 3B9HA 3H9KA 3QGTA 1TSLA 3BGXA 1JU6A 4LRRA 2FTQA 4Q0EA 4ISWA 4FQSA 1BIDA 3EAWX 1KZJA 3DL5A 4UP1A 4DPDA 1AJMA 1TSYA 1TDBA 3EHIX 4FOGA 1JMGA 2RD8B 4GYHA 1HZWA 2G86A 1EVFA 1AOBA 3CLBA 2VF0A 1EVGA 1F4CA 4IRRA 4DP3A 3EF9A 3IRNA 3C0AA 2TDDA 1NJDA 1QZFA 1YPVA 3UWLA 1JUTA 3HJ3A 1TSZA 3GH2X 4JEFA 4G6WX 1BPJA 1BO8A 3BFIA 1BKPA 3N5EB 1KZIA 2AAZA 1B5EA 4FOXA 5WRNA 1TSDA 1HW4A 3I3RA 1NJAA 1B5DA 3IK1A 1VZBA 2G8AA 1J3JC 3UM8A 1LCBA 1F4GA 3HBBA 1EV8A 4F2VA 1HW3A 1F28A 1RTSA 4H0UA 4DQ1A 1FWMA 3EDWX 2TSCA 1BQ2A 4O1UA 3C06A 2G8DA 1BSPA 4O7UA 5BY6A 1TVWA 1QQQA 4EINA 1JTUA 1TDAA 1LCEA 3EGYX 1F4BA 3OB7A 4KPWA 1TVUA 3HB8A 1LCAA 2VETA 4O1XA 4ECKA 1B49A 3IHIA 3GG5A 4KY4A 4O1XD 5H39A 3BYXA 3GH0A 1B02A 4TMSA 1JMHA 3UWLB 4Q0DA 1TSVA 5FCTA 5H38A 1ZPRA 1TSWA 4EZ8A 3IROA 3IRMA 4FGTA 3INVA 1TRGA 5H3AA 3QJ7A 1TDCA 1NJCA 1J3KC 1BDUA 2G89A 5J7WA 3QG2A 1NJBA 1VZDA 2RD8A 4H1IA 1SEJA 2ONBA 1BSFA 2RDAA 3N5GA 4FOAA 1BQ1A 4E28A 4EILA 1DNAA 3DGAC 1VZAA 3KGBA 1CI7A 2TSRA 3EJLA 4GD7A 3NRRA 1F4DA 1TSMA 1SYNA 1AN5A
chains in the Genus database with same CATH superfamily
4ISKA 1VZEA 2KCEA 3JSUA 4XSEA 3N5EA 1BKOA 3ED7A 2A9WA 3IX6A 2BBQA 3CL9A 2G8XA 1JMIA 1TLCA 1BJGA 3DG8C 1TLSA 1JMFA 4PSGA 3TMSA 2FTOX 1DDUA 4KNZA 1TJSA 4IQQA 2OIPA 4XSDA 1TDUA 1J3IC 4EB4A 4H0RA 1HVYA 1NCEA 2FTNA 1JTQA 3EBUA 1THYA 3K2HA 4G2OX 1KCEA 3B5BA 3IK0A 3BZ0A 4GEVA 4XSCA 1NJEA 3BNZA 1BP6A 1EV5A 4IQBA 1JG0A 1FFLA 4KYAA 1VZCA 2H2QA 3UM5A 4DPHA 3KJRA 3V8HA 1F4EA 1I00A 2TDMA 1TSXA 3DL6A 1BO7A 5HS3A 1TYSA 3BHLA 1TVVA 1F4FA 1JUJA 1TSNA 3KJSA 3IJZA 4KY8A 1AXWA 1AIQA 3UM6A 1TISA 1BP0A 3BHRA 4E5OA 3B9HA 3H9KA 3QGTA 1TSLA 3BGXA 1JU6A 4LRRA 2FTQA 4Q0EA 4ISWA 4FQSA 1BIDA 3EAWX 1KZJA 3DL5A 4UP1A 4DPDA 1AJMA 1TSYA 1TDBA 3EHIX 4FOGA 1JMGA 2RD8B 4GYHA 1HZWA 2G86A 1EVFA 1AOBA 3CLBA 2VF0A 1EVGA 1F4CA 4IRRA 4DP3A 3EF9A 3IRNA 3C0AA 2TDDA 1NJDA 1QZFA 1YPVA 3UWLA 1JUTA 3HJ3A 1TSZA 3GH2X 4JEFA 4G6WX 1BPJA 1BO8A 3BFIA 1BKPA 3N5EB 1KZIA 2AAZA 1B5EA 4FOXA 5WRNA 1TSDA 1HW4A 3I3RA 1NJAA 1B5DA 3IK1A 1VZBA 2G8AA 1J3JC 3UM8A 1LCBA 1F4GA 3HBBA 1EV8A 4F2VA 1HW3A 1F28A 1RTSA 4H0UA 4DQ1A 1FWMA 3EDWX 2TSCA 1BQ2A 4O1UA 3C06A 2G8DA 1BSPA 4O7UA 5BY6A 1TVWA 1QQQA 4EINA 1JTUA 1TDAA 1LCEA 3EGYX 1F4BA 3OB7A 4KPWA 1TVUA 3HB8A 1LCAA 2VETA 4O1XA 4ECKA 1B49A 3IHIA 3GG5A 4KY4A 4O1XD 5H39A 3BYXA 3GH0A 1B02A 4TMSA 1JMHA 3UWLB 4Q0DA 1TSVA 5FCTA 5H38A 1ZPRA 1TSWA 4EZ8A 3IROA 3IRMA 4FGTA 3INVA 1TRGA 5H3AA 3QJ7A 1TDCA 1NJCA 1J3KC 1BDUA 2G89A 5J7WA 3QG2A 1NJBA 1VZDA 2RD8A 4H1IA 1SEJA 2ONBA 1BSFA 2RDAA 3N5GA 4FOAA 1BQ1A 4E28A 4EILA 1DNAA 3DGAC 1VZAA 3KGBA 1CI7A 2TSRA 3EJLA 4GD7A 3NRRA 1F4DA 1TSMA 1SYNA 1AN5A
chains in the Genus database with same CATH topology
4ISKA 1VZEA 2KCEA 3JSUA 4XSEA 3N5EA 1BKOA 3ED7A 2A9WA 3IX6A 2BBQA 3CL9A 2G8XA 1JMIA 1TLCA 1BJGA 3DG8C 1TLSA 1JMFA 4PSGA 3TMSA 2FTOX 1DDUA 4KNZA 1TJSA 4IQQA 2OIPA 4XSDA 1TDUA 1J3IC 4EB4A 4H0RA 1HVYA 1NCEA 2FTNA 1JTQA 3EBUA 1THYA 3K2HA 4G2OX 1KCEA 3B5BA 3IK0A 3BZ0A 4GEVA 4XSCA 1NJEA 3BNZA 1BP6A 1EV5A 4IQBA 1JG0A 1FFLA 4KYAA 1VZCA 2H2QA 3UM5A 4DPHA 3KJRA 3V8HA 1F4EA 1I00A 2TDMA 1TSXA 3DL6A 1BO7A 5HS3A 1TYSA 3BHLA 1TVVA 1F4FA 1JUJA 1TSNA 3KJSA 3IJZA 4KY8A 1AXWA 1AIQA 3UM6A 1TISA 1BP0A 3BHRA 4E5OA 3B9HA 3H9KA 3QGTA 1TSLA 3BGXA 1JU6A 4LRRA 2FTQA 4Q0EA 4ISWA 4FQSA 1BIDA 3EAWX 1KZJA 3DL5A 4UP1A 4DPDA 1AJMA 1TSYA 1TDBA 3EHIX 4FOGA 1JMGA 2RD8B 4GYHA 1HZWA 2G86A 1EVFA 1AOBA 3CLBA 2VF0A 1EVGA 1F4CA 4IRRA 4DP3A 3EF9A 3IRNA 3C0AA 2TDDA 1NJDA 1QZFA 1YPVA 3UWLA 1JUTA 3HJ3A 1TSZA 3GH2X 4JEFA 4G6WX 1BPJA 1BO8A 3BFIA 1BKPA 3N5EB 1KZIA 2AAZA 1B5EA 4FOXA 5WRNA 1TSDA 1HW4A 3I3RA 1NJAA 1B5DA 3IK1A 1VZBA 2G8AA 1J3JC 3UM8A 1LCBA 1F4GA 3HBBA 1EV8A 4F2VA 1HW3A 1F28A 1RTSA 4H0UA 4DQ1A 1FWMA 3EDWX 2TSCA 1BQ2A 4O1UA 3C06A 2G8DA 1BSPA 4O7UA 5BY6A 1TVWA 1QQQA 4EINA 1JTUA 1TDAA 1LCEA 3EGYX 1F4BA 3OB7A 4KPWA 1TVUA 3HB8A 1LCAA 2VETA 4O1XA 4ECKA 1B49A 3IHIA 3GG5A 4KY4A 4O1XD 5H39A 3BYXA 3GH0A 1B02A 4TMSA 1JMHA 3UWLB 4Q0DA 1TSVA 5FCTA 5H38A 1ZPRA 1TSWA 4EZ8A 3IROA 3IRMA 4FGTA 3INVA 1TRGA 5H3AA 3QJ7A 1TDCA 1NJCA 1J3KC 1BDUA 2G89A 5J7WA 3QG2A 1NJBA 1VZDA 2RD8A 4H1IA 1SEJA 2ONBA 1BSFA 2RDAA 3N5GA 4FOAA 1BQ1A 4E28A 4EILA 1DNAA 3DGAC 1VZAA 3KGBA 1CI7A 2TSRA 3EJLA 4GD7A 3NRRA 1F4DA 1TSMA 1SYNA 1AN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISK A;  1VZE A;  2KCE A;  3JSU A;  4XSE A;  3N5E A;  1BKO A;  3ED7 A;  2A9W A;  3IX6 A;  2BBQ A;  3CL9 A;  2G8X A;  1JMI A;  1TLC A;  1BJG A;  3DG8 C;  1TLS A;  1JMF A;  4PSG A;  3TMS A;  2FTO X;  1DDU A;  4KNZ A;  1TJS A;  4IQQ A;  2OIP A;  4XSD A;  1TDU A;  1J3I C;  4EB4 A;  4H0R A;  1HVY A;  1NCE A;  2FTN A;  1JTQ A;  3EBU A;  1THY A;  3K2H A;  4G2O X;  1KCE A;  3B5B A;  3IK0 A;  3BZ0 A;  4GEV A;  4XSC A;  1NJE A;  3BNZ A;  1BP6 A;  1EV5 A;  4IQB A;  1JG0 A;  1FFL A;  4KYA A;  1VZC A;  2H2Q A;  3UM5 A;  4DPH A;  3KJR A;  3V8H A;  1F4E A;  1I00 A;  2TDM A;  1TSX A;  3DL6 A;  1BO7 A;  5HS3 A;  1TYS A;  3BHL A;  1TVV A;  1F4F A;  1JUJ A;  1TSN A;  3KJS A;  3IJZ A;  4KY8 A;  1AXW A;  1AIQ A;  3UM6 A;  1TIS A;  1BP0 A;  3BHR A;  4E5O A;  3B9H A;  3H9K A;  3QGT A;  1TSL A;  3BGX A;  1JU6 A;  4LRR A;  2FTQ A;  4Q0E A;  4ISW A;  4FQS A;  1BID A;  3EAW X;  1KZJ A;  3DL5 A;  4UP1 A;  4DPD A;  1AJM A;  1TSY A;  1TDB A;  3EHI X;  4FOG A;  1JMG A;  2RD8 B;  4GYH A;  1HZW A;  2G86 A;  1EVF A;  1AOB A;  3CLB A;  2VF0 A;  1EVG A;  1F4C A;  4IRR A;  4DP3 A;  3EF9 A;  3IRN A;  3C0A A;  2TDD A;  1NJD A;  1QZF A;  1YPV A;  3UWL A;  1JUT A;  3HJ3 A;  1TSZ A;  3GH2 X;  4JEF A;  4G6W X;  1BPJ A;  1BO8 A;  3BFI A;  1BKP A;  3N5E B;  1KZI A;  2AAZ A;  1B5E A;  4FOX A;  5WRN A;  1TSD A;  1HW4 A;  3I3R A;  1NJA A;  1B5D A;  3IK1 A;  1VZB A;  2G8A A;  1J3J C;  3UM8 A;  1LCB A;  1F4G A;  3HBB A;  1EV8 A;  4F2V A;  1HW3 A;  1F28 A;  1RTS A;  4H0U A;  4DQ1 A;  1FWM A;  3EDW X;  2TSC A;  1BQ2 A;  4O1U A;  3C06 A;  2G8D A;  1BSP A;  4O7U A;  5BY6 A;  1TVW A;  1QQQ A;  4EIN A;  1JTU A;  1TDA A;  1LCE A;  3EGY X;  1F4B A;  3OB7 A;  4KPW A;  1TVU A;  3HB8 A;  1LCA A;  2VET A;  4O1X A;  4ECK A;  1B49 A;  3IHI A;  3GG5 A;  4KY4 A;  4O1X D;  5H39 A;  3BYX A;  3GH0 A;  1B02 A;  4TMS A;  1JMH A;  3UWL B;  4Q0D A;  1TSV A;  5FCT A;  5H38 A;  1ZPR A;  1TSW A;  4EZ8 A;  3IRO A;  3IRM A;  4FGT A;  3INV A;  1TRG A;  5H3A A;  3QJ7 A;  1TDC A;  1NJC A;  1J3K C;  1BDU A;  2G89 A;  5J7W A;  3QG2 A;  1NJB A;  1VZD A;  2RD8 A;  4H1I A;  1SEJ A;  2ONB A;  1BSF A;  2RDA A;  3N5G A;  4FOA A;  1BQ1 A;  4E28 A;  4EIL A;  1DNA A;  3DGA C;  1VZA A;  3KGB A;  1CI7 A;  2TSR A;  3EJL A;  4GD7 A;  3NRR A;  1F4D A;  1TSM A;  1SYN A;  1AN5 A; 
#chains in the Genus database with same CATH topology
 4ISK A;  1VZE A;  2KCE A;  3JSU A;  4XSE A;  3N5E A;  1BKO A;  3ED7 A;  2A9W A;  3IX6 A;  2BBQ A;  3CL9 A;  2G8X A;  1JMI A;  1TLC A;  1BJG A;  3DG8 C;  1TLS A;  1JMF A;  4PSG A;  3TMS A;  2FTO X;  1DDU A;  4KNZ A;  1TJS A;  4IQQ A;  2OIP A;  4XSD A;  1TDU A;  1J3I C;  4EB4 A;  4H0R A;  1HVY A;  1NCE A;  2FTN A;  1JTQ A;  3EBU A;  1THY A;  3K2H A;  4G2O X;  1KCE A;  3B5B A;  3IK0 A;  3BZ0 A;  4GEV A;  4XSC A;  1NJE A;  3BNZ A;  1BP6 A;  1EV5 A;  4IQB A;  1JG0 A;  1FFL A;  4KYA A;  1VZC A;  2H2Q A;  3UM5 A;  4DPH A;  3KJR A;  3V8H A;  1F4E A;  1I00 A;  2TDM A;  1TSX A;  3DL6 A;  1BO7 A;  5HS3 A;  1TYS A;  3BHL A;  1TVV A;  1F4F A;  1JUJ A;  1TSN A;  3KJS A;  3IJZ A;  4KY8 A;  1AXW A;  1AIQ A;  3UM6 A;  1TIS A;  1BP0 A;  3BHR A;  4E5O A;  3B9H A;  3H9K A;  3QGT A;  1TSL A;  3BGX A;  1JU6 A;  4LRR A;  2FTQ A;  4Q0E A;  4ISW A;  4FQS A;  1BID A;  3EAW X;  1KZJ A;  3DL5 A;  4UP1 A;  4DPD A;  1AJM A;  1TSY A;  1TDB A;  3EHI X;  4FOG A;  1JMG A;  2RD8 B;  4GYH A;  1HZW A;  2G86 A;  1EVF A;  1AOB A;  3CLB A;  2VF0 A;  1EVG A;  1F4C A;  4IRR A;  4DP3 A;  3EF9 A;  3IRN A;  3C0A A;  2TDD A;  1NJD A;  1QZF A;  1YPV A;  3UWL A;  1JUT A;  3HJ3 A;  1TSZ A;  3GH2 X;  4JEF A;  4G6W X;  1BPJ A;  1BO8 A;  3BFI A;  1BKP A;  3N5E B;  1KZI A;  2AAZ A;  1B5E A;  4FOX A;  5WRN A;  1TSD A;  1HW4 A;  3I3R A;  1NJA A;  1B5D A;  3IK1 A;  1VZB A;  2G8A A;  1J3J C;  3UM8 A;  1LCB A;  1F4G A;  3HBB A;  1EV8 A;  4F2V A;  1HW3 A;  1F28 A;  1RTS A;  4H0U A;  4DQ1 A;  1FWM A;  3EDW X;  2TSC A;  1BQ2 A;  4O1U A;  3C06 A;  2G8D A;  1BSP A;  4O7U A;  5BY6 A;  1TVW A;  1QQQ A;  4EIN A;  1JTU A;  1TDA A;  1LCE A;  3EGY X;  1F4B A;  3OB7 A;  4KPW A;  1TVU A;  3HB8 A;  1LCA A;  2VET A;  4O1X A;  4ECK A;  1B49 A;  3IHI A;  3GG5 A;  4KY4 A;  4O1X D;  5H39 A;  3BYX A;  3GH0 A;  1B02 A;  4TMS A;  1JMH A;  3UWL B;  4Q0D A;  1TSV A;  5FCT A;  5H38 A;  1ZPR A;  1TSW A;  4EZ8 A;  3IRO A;  3IRM A;  4FGT A;  3INV A;  1TRG A;  5H3A A;  3QJ7 A;  1TDC A;  1NJC A;  1J3K C;  1BDU A;  2G89 A;  5J7W A;  3QG2 A;  1NJB A;  1VZD A;  2RD8 A;  4H1I A;  1SEJ A;  2ONB A;  1BSF A;  2RDA A;  3N5G A;  4FOA A;  1BQ1 A;  4E28 A;  4EIL A;  1DNA A;  3DGA C;  1VZA A;  3KGB A;  1CI7 A;  2TSR A;  3EJL A;  4GD7 A;  3NRR A;  1F4D A;  1TSM A;  1SYN A;  1AN5 A; 
#chains in the Genus database with same CATH homology
 4ISK A;  1VZE A;  2KCE A;  3JSU A;  4XSE A;  3N5E A;  1BKO A;  3ED7 A;  2A9W A;  3IX6 A;  2BBQ A;  3CL9 A;  2G8X A;  1JMI A;  1TLC A;  1BJG A;  3DG8 C;  1TLS A;  1JMF A;  4PSG A;  3TMS A;  2FTO X;  1DDU A;  4KNZ A;  1TJS A;  4IQQ A;  2OIP A;  4XSD A;  1TDU A;  1J3I C;  4EB4 A;  4H0R A;  1HVY A;  1NCE A;  2FTN A;  1JTQ A;  3EBU A;  1THY A;  3K2H A;  4G2O X;  1KCE A;  3B5B A;  3IK0 A;  3BZ0 A;  4GEV A;  4XSC A;  1NJE A;  3BNZ A;  1BP6 A;  1EV5 A;  4IQB A;  1JG0 A;  1FFL A;  4KYA A;  1VZC A;  2H2Q A;  3UM5 A;  4DPH A;  3KJR A;  3V8H A;  1F4E A;  1I00 A;  2TDM A;  1TSX A;  3DL6 A;  1BO7 A;  5HS3 A;  1TYS A;  3BHL A;  1TVV A;  1F4F A;  1JUJ A;  1TSN A;  3KJS A;  3IJZ A;  4KY8 A;  1AXW A;  1AIQ A;  3UM6 A;  1TIS A;  1BP0 A;  3BHR A;  4E5O A;  3B9H A;  3H9K A;  3QGT A;  1TSL A;  3BGX A;  1JU6 A;  4LRR A;  2FTQ A;  4Q0E A;  4ISW A;  4FQS A;  1BID A;  3EAW X;  1KZJ A;  3DL5 A;  4UP1 A;  4DPD A;  1AJM A;  1TSY A;  1TDB A;  3EHI X;  4FOG A;  1JMG A;  2RD8 B;  4GYH A;  1HZW A;  2G86 A;  1EVF A;  1AOB A;  3CLB A;  2VF0 A;  1EVG A;  1F4C A;  4IRR A;  4DP3 A;  3EF9 A;  3IRN A;  3C0A A;  2TDD A;  1NJD A;  1QZF A;  1YPV A;  3UWL A;  1JUT A;  3HJ3 A;  1TSZ A;  3GH2 X;  4JEF A;  4G6W X;  1BPJ A;  1BO8 A;  3BFI A;  1BKP A;  3N5E B;  1KZI A;  2AAZ A;  1B5E A;  4FOX A;  5WRN A;  1TSD A;  1HW4 A;  3I3R A;  1NJA A;  1B5D A;  3IK1 A;  1VZB A;  2G8A A;  1J3J C;  3UM8 A;  1LCB A;  1F4G A;  3HBB A;  1EV8 A;  4F2V A;  1HW3 A;  1F28 A;  1RTS A;  4H0U A;  4DQ1 A;  1FWM A;  3EDW X;  2TSC A;  1BQ2 A;  4O1U A;  3C06 A;  2G8D A;  1BSP A;  4O7U A;  5BY6 A;  1TVW A;  1QQQ A;  4EIN A;  1JTU A;  1TDA A;  1LCE A;  3EGY X;  1F4B A;  3OB7 A;  4KPW A;  1TVU A;  3HB8 A;  1LCA A;  2VET A;  4O1X A;  4ECK A;  1B49 A;  3IHI A;  3GG5 A;  4KY4 A;  4O1X D;  5H39 A;  3BYX A;  3GH0 A;  1B02 A;  4TMS A;  1JMH A;  3UWL B;  4Q0D A;  1TSV A;  5FCT A;  5H38 A;  1ZPR A;  1TSW A;  4EZ8 A;  3IRO A;  3IRM A;  4FGT A;  3INV A;  1TRG A;  5H3A A;  3QJ7 A;  1TDC A;  1NJC A;  1J3K C;  1BDU A;  2G89 A;  5J7W A;  3QG2 A;  1NJB A;  1VZD A;  2RD8 A;  4H1I A;  1SEJ A;  2ONB A;  1BSF A;  2RDA A;  3N5G A;  4FOA A;  1BQ1 A;  4E28 A;  4EIL A;  1DNA A;  3DGA C;  1VZA A;  3KGB A;  1CI7 A;  2TSR A;  3EJL A;  4GD7 A;  3NRR A;  1F4D A;  1TSM A;  1SYN A;  1AN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...