4TMZA

Translation initiation factor eif5b (517-858) from c. thermophilum, bound to gtpgammas and potassium
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
b'HMNKDNLRSPICCILGHVDTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords eIF5B
publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tmzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tmzA01
1U9IA 3ZVLA 4HYYA 3M1IA 2V55B 3L8YA 5FR2A 2GBLC 3A1UA 2C77A 4W5HA 1TMKA 4UXJA 2J41A 1DAIA 1ZM9A 221PA 1G9XA 5JWOA 4TMXA 3WNBA 3RWMB 3CCMB 1M2OB 3EIHA 1N5IA 1QFZA 2F6RA 3PUXA 1JPJA 2JLZA 1E64A 1J7KA 3H0KA 2QA5A 2WAXA 4WBSA 1OFTA 2DYKA 2ODEA 5CJPA 3KB1A 2ZI3A 3M4YA 2EWVA 4TMKA 1F48A 2GDJA 2R6FA 1H42A 3KKNA 4LCBA 3NBZC 4PX9A 2IUUA 3ZS9A 3UK6A 4TTPA 1QGAA 3TVTA 4XTCS 1R8QA 2Z6VA 1KOFA 2ZE5A 5C46F 4NCJA 2OCBA 4PPGA 3K0CA 1ZNXA 2FF7A 4GFDA 4M9ZA 3TRFA 1XJQA 4LHVA 3W5HA 3AVPA 1GKIA 1YZLA 1S1CA 2AFHE 3RDPA 3KFXA 3ZDQA 3A58B 5IF9A 1FTSA 1YZUA 1VQMB 1MR3F 1NN1A 2J59A 3SN6A 3L82B 1HT2E 1Z6AA 3PUVA 3QPWA 2F55A 2D7DA 2ZU0C 1RC8A 1M34E 2ANBA 3I5YA 1E2FA 1E69A 4LJ6A 2GEDA 4NCNA 2QT1A 4QJ4A 2Q9AA 3WHKA 1EWQA 5E95A 3C41J 4HUQB 4IKEA 3N2IA 4M9QA 1G7SA 5DN6A 1U9IC 2VF7A 3LAWA 2OSBA 2QPAA 2JLWA 4P4SB 5JJKA 1IY0A 2GK6A 1EWRA 4AWXA 5JCZA 1E9BA 2XNSA 1WRBA 2ZETA 2BM1A 2WJYA 4K8OA 5JI2E 4QM6A 3R7WB 1QGYA 3CC7B 4XWAA 4EJSB 2AKAB 2BPOA 5JHGB 1DAHA 1E4VA 4JSTA 4KFSA 3TW4A 4LX0A 5G40A 3CLVA 2VP5A 3LY5A 3RS4A 2W00A 3I55B 1GZSA 3BXZA 2ZJAA 2QM7A 3LBHA 3BC1A 1SHZA 2D74A 2BEKA 3GJ7A 3I8SA 3HJNA 3M0EA 3AVVA 3PUZA 4Q1FA 4M9XA 3GLHB 3QFTA 3CB4A 4OBEA 4ON9A 3QXJA 3K0CC 5AUOB 2X77A 1MT0A 1N6PA 3OEHA 2VNIA 4KBFA 1Z6XA 2QT0A 4M8NE 4R71A 3CCQB 1NVWQ 2QTVB 3QOFA 2H7VA 2J9RA 5TVKA 4N0EA 3I61A 4ZCIA 5EE9A 5LB2A 3RVBA 3WNCA 1ZMXA 1VQ7B 3L0IB 2O8CB 1GL9B 2PX3A 4LGMA 5FPSA 2BF4A 3CF6R 4DB2A 1Q22A 3KKOA 4KCGA 4O3MA 2FX3A 1OH8A 5JRJA 4HB4A 2VA8A 4WVFA 3J81k 1KI1A 1NKSA 2ZRMA 2QM8A 2VHCA 2WWWA 3HYRA 4KU4A 4ZCMA 4PO8A 5G3ZA 4PC7A 1CRQA 3EA5A 3V9PA 2C9OA 1XEXB 5KPDA 5LD2B 4UAJA 3GLHE 4UNQA 2QE7A 4B76A 3U3RA 1N6LA 5K8LA 1X86B 3QKRA 4R9UC 4X8MA 1CIPA 4F7DA 1FX0A 4NPHA 3W5VA 2LKCA 1UM8A 1H85A 2VBCA 5B58C 2VNKA 1QHIA 3CD6B 3CCJB 1DELA 2JJ1A 4RY2A 2W0MA 3HWSA 2J0UB 4H9GA 3C14C 5JCPA 2RGEA 1B23P 2FN4A 2GTPA 3SFVA 2ZRIA 1YR9A 3IKJA 3QG5A 3UG7A 2R6HA 2F9LA 2DEUA 3FKQA 5KYKA 4EPWA 4TL9A 4MYCA 4TN1A 4RD0A 2YHSA 1TPZA 4XSGA 4DLXA 4DDWA 5C4MA 4PHTA 1Q86D 2GETA 1BJKA 1KKLA 1OKKA 4MH0R 4KYUA 1VQNB 1KJWA 1QHNA 2JLSA 2IW3A 4HLCA 4QBGB 3L8ZA 3Q7QA 3A1VA 1U8YA 1I4LD 2FZLA 2PJZA 2EIXA 2ZRLA 3GFOA 1N0WA 3SC3A 4B34A 4YXWD 4CT4B 1WXQA 3C4JA 1W2GA 1W0KA 3AKEA 4JLVA 2GILA 1IN6A 2IYLD 1ZINA 3GJ4A 4AF7A 4I1VA 4DQKA 1XMVA 3UXMA 3OF5A 4Y0AA 4Q5IA 4Z1MA 2VNHA 4JS0A 1E9SA 2CNWD 4FW9A 4PSVA 5C4GB 2W6JA 2YVUA 2CCJA 3RHFA 4CF7A 3EW9A 1OXXK 1M7GA 2V6JA 3CRZA 1HE1C 1Q1BA 1IXRC 1H8ED 2GZAA 4R7ZA 4CEHB 2GCOB 3BD9A 4QC2A 5E7IA 4XVUA 4LI0A 2O0HA 1XE1A 1W7AA 2EU8A 4DHEA 2AD5A 4G01B 2FJUA 2WPDD 3CPHA 2XJ9A 4KBGA 1G16A 1KI6B 1Z0DA 1DAEA 2CNDA 1SQ5A 3T5GA 3X1YA 4BLOA 2ZI4A 5JS7A 4AG5A 4EQ6B 5DYIA 1F2TA 4NYJR 4D4LA 3ECCA 3N2EA 4OQMA 4NCKA 2ZJZA 2OG2A 1N5KA 2Q0HA 4IFBA 3E1YE 1J70A 2VEDA 1VTKA 3W90A 1XCGB 4LJ5A 4TL6A 1OB5A 2AHOA 3K9GA 4US2R 2J3EA 2V9PA 3NTUA 2GZHA 3AP2A 3DZDA 1J9ZA 1E96A 3REGA 1ZAKA 3NHAA 2RGDA 4XD7A 5FPYA 2VHJA 4BRWA 2HJVA 1CR4A 4R2HA 1JR6A 1JECA 1VQ4B 2HMAA 1OIXA 2OBMA 3ADCA 1SGWA 1NLZA 4LHYA 4Y9UA 4N3NA 2GWHA 3MCAA 1CP2A 3JQQA 2D2EA 4QXAA 4Q1CA 2DY1A 2ZITA 2FDCA 1KO5A 3TNFA 2V54A 3VNUA 1IXZA 3W2IA 2ODBA 4O25A 4U5XA 4TMZA 3KXKA 3LD9A 1E1RA 4BZQA 2REOA 3R9WA 2GVDC 3SFZA 4JVNA 4KFRA 1I4TD 5LBIA 3P32A 5JEDA 4PC6A 3TW8B 2C98A 1EFHA 2B92A 1JNYA 4JLPA 4IOKA 3U5ZB 2ZAOA 4GOJA 4NZYA 5TR9A 3GLGA 4NP6A 4UNSA 2ZI9A 4KO8A 4C0BA 4B3GA 4LC1A 4OHYA 5CIQA 3W5UA 4ARZA 2VH5R 1YRAA 4XJXA 2WMNB 2ZRHA 5TDHA 4TLBA 3S1AA 1HY3A 4DCTA 5DN6D 4NYIR 1LNZA 1YJWB 4IDHA 1CR0A 3FB4A 4CEJA 1ZUHA 2FEOA 2TMKA 2VSOA 5AJWA 4D0GA 1VYUA 4M1OA 4OQFA 5H70A 3CONA 2PIAA 2FEMA 3DO6A 2EFDB 2YWHA 3UG6A 5JSZB 2CK3A 3ZD6A 3WBKA 1TUIA 1ONBA 1I4DD 2RGBA 4B73A 3HU3A 5CK5A 3KUDA 4S35A 1EESA 2JLQA 4TYQA 1YZNA 2D2FA 4OK6A 2CEAA 1AQYA 2C78A 1LS1A 1RRPA 5F9HA 3BIFA 2YOFA 2QORA 1WDTA 4DSUA 3A6PC 2WKRA 2ZE8A 3THXA 3OEHD 1G5TA 1RW4A 2KJQA 3KKQA 4K46A 4OL0A 1Z6YA 2LWIA 1IJEA 3CUEF 1UBCA 1G5RA 3ADKA 4JLJA 1OGJA 4MUAA 4RKEA 2DWQA 2CVHA 1W4RA 2VRWA 4C43A 4BEBA 1I2DA 3I32A 4IFEA 1AS2A 4HATA 4DIEA 1TX4B 5TY0A 2FZ4A 4MKHA 4Q9HA 4XOIA 4RFSB 5KU1A 1E9EA 1GKUB 1NN3A 2G88A 2H8KA 3D8BA 2Q3FA 1L4YA 4NDZA 4OI2A 4KVGA 4ACBA 1ZNWA 2AWNA 5HTKA 1E62A 3TGPA 1T0HB 1S2MA 1U94A 3W5JA 2DFNA 4A36A 2ANCA 1ZM2A 1ZD9A 2J45A 3L43A 1GIAA 4B3FX 2QGZA 2QE7D 2QGNA 1QGZA 1VYTA 1FOEB 2B21A 4JVSB 3P20A 1XTIA 3ZLJA 1GILA 1ZD1A 4HEJA 4BFYA 1NNEA 2NPFA 5DI3B 3DPUA 3LLUA 1NKTA 4QJ3A 3OJWA 4O2RA 3OESA 4M1KA 1N3BA 2I4IA 4PZLA 4BRUA 2IS1A 2JJ1D 4IDPA 2CHQA 1XXHA 2V1UA 2Z4SA 3Q9LA 2GJKA 4PTLA 5J4KA 4BPRA 2WKQA 2R65A 2ZSAA 2QI9C 3TAHA 5J4VA 3O8RA 5L3SA 1ZCAA 4U00A 4PO9A 3AVYA 4AYTA 2QSYA 1J2JA 4TQ9A 1JAIA 4IDOA 421PA 2DB3A 2O8FA 2J0VA 2GXQA 5J4YA 821PA 4P31A 1KMHB 2GAAA 3QE2A 3QKUA 3HPRA 1Z08A 4JJZA 5J47A 1P9WA 1TQ4A 1YKSA 1OKKD 1KDOA 2ASEA 4PANA 4UKDA 2F43A 4Q47A 5D3MA 3NKVA 4URZR 4UJ5A 2IYUA 4OK3A 3GP8A 1V5WA 4BFSA 3QPVA 1KI2A 2HXYA 2P67A 4ZI3A 5KUTA 2NTYC 3NH9A 2C04A 5HZHA 2OEPA 2KSQA 1W0KD 3MAAC 3KZ1E 1VIYA 3N70A 1ZJ6A 2YZ2A 3G0HA 3AUYA 4OI0A 2EFEB 4KODA 3UANA 3ICEA 2WV9A 5HE9A 5K8IA 3B1ZA 3SZRA 4Z1MD 2Q9BA 2OFXA 3FMIA 3G71B 1U0LA 1U2RA 2QNRA 5CLQA 4AK9A 5SZIA 2W6JD 1DAMA 2RCNA 4LYJA 3ETLA 2ZANA 2JCSA 3B5JA 2NZ8A 1JA1A 3RRMA 1GSIA 2ZJ5A 1XMIA 2REXB 2QEXB 1UJ2A 2RKOA 2D7CA 3I1FA 4G1UC 1E98A 1IHUA 4CGZA 2QTHA 1CEEA 2FA9A 3JQPA 2CJWA 5THXA 2VLIA 3FFBA 1YHQB 3VO1A 3V4FA 5CJ2A 1VPLA 3CX6A 1KAGA 5DYGA 1E2NA 4GOKA 3GEHA 5JBQA 1MO3A 3KL4A 2F3TA 2J0QA 4QHSA 1E9AA 5CIWA 3FDIA 4MRNA 4YC7A 1BX0A 3OJXA 1PVOA 3UMFA 1W0JA 5GJBA 2BDTA 1P73A 3BOSA 1CRPA 4Q02A 1G1MA 2DPXA 3QF4A 2F7SA 2KB0A 5EP1A 2BMFA 4W9MC 3H2YA 2K5UA 3Q7PA 1OIVA 4FMDF 1KDTA 4XD7D 1WP9A 2IYXA 1FL9A 4BLQA 1EFRA 5GVSA 2ZS8A 2QQEA 4CRWB 2YKGA 1E2GA 1YJNB 1EFTA 2XB4A 4PPNA 3CCRB 1BS1A 2GQFA 4GP7A 5TMPA 5AUQA 1JJVA 3I3SR 3T5DA 2ZXUA 4ZIRA 1G3UA 1LB1B 2JGNA 1JPNA 1MOZA 4DXAA 4D26A 1WE2A 4URVR 1Z0IA 4HAXA 3DMNA 1TU3A 3D7MA 3IBYA 5KSZA 4DJTA 3W3ZB 1CF4A 5DHAA 1S96A 1ZC3A 1E1RD 5DIFA 4ABYA 4K1XA 1OGIA 2QU8A 4LJYA 1HYQA 4WZBE 4A6PA 4C0SA 3SOPA 4AG6A 3SJZA 3EZ6A 1QG0A 1A2BA 3KJEA 3W2HA 1F60A 1NG1A 3CNLA 3O8DA 4A92A 5FA6A 3OW2B 1HE8B 3THWA 5LPNA 1ODFA 1Y3AA 2E87A 4GNKA 3WYFA 1KC8D 4DVGA 4QHYA 3RS2A 4LJ9A 1SVMA 2MMCA 4H1UA 4OQNA 1YITB 1KQSB 4QOSA 5KPJA 3WNDA 1E9RA 2AK2A 2ZYWX 3G82C 3VFDA 2Q3HA 3KXLA 2NPIA 3QFCA 1ESNA 1NRJB 1QVAA 4JL5A 2HDNB 1VQKB 5FFMA 4BQSA 3IGFA 3K70C 1ZD8A 3WY9A 1E2LA 1RE0A 2OAQ1 1OLOA 3QKRB 2WJJA 3CR8A 4XTRA 1G17A 2G77B 5EP3A 3BB1A 3LVBA 2CK3D 3AF0A 4HDQB 1E63A 4YMWA 2LKDA 4A82A 4IEEA 2ZR0A 5AJZA 1GM5A 2ZSBA 3DMDA 3VHXA 1GJRA 1G5PA 4DQLA 3NEJA 3FPKA 2X1VA 1ZC4A 1WMSA 3SEAA 3OFNA 1KKMA 4UNRA 2JAQA 5F98A 3X1DA 3K8YA 3RSLA 4L4UA 4E07A 2RH5A 2UVQA 2DERA 2ZRBA 1M7BA 3FHCB 1Q1ZA 3L2OB 4YONB 4D0NA 4DZZA 5JECA 4MITA 1XMSA 2ZI5A 4KFTA 4PXAA 2ZREA 1OW3B 2GNOA 1W34A 1DE0A 4DLSA 3NHBA 1AKYA 3U7FB 2PZEA 1VCNA 1KI4A 1AIPA 1ZCBA 3BORA 1T5IA 3ADBA 4LHZA 5FTMA 2QA4B 4GSYA 2PMKA 1K5GA 3CZPA 4LDJA 5IHPA 1LF0A 4HZIA 2YWFA 1DAGA 1MO6A 1XB2A 2XITA 4LZZA 1GOTA 5GJWC 4DEYA 3KKMA 1K9MD 2I1QA 4JLDA 3LQQA 521PA 3CCUB 3OE7A 3ZVNA 4LBVA 3CIOA 2A9KA 1N6OA 4BZXA 2RMKA 1R5NA 2YC2C 2ERYA 3GFTA 2BCJQ 3CW2A 2GAOA 1E32A 3FPAA 3BBPA 1QZXA 3PFIA 3KJHA 1DAFA 1NIPA 2JLRA 3T1VA 1ELOA 4Q21A 1WBBA 4M1MA 3AVQA 4LBYA 3U3JA 4HB2A 2C99A 2GZDA 2CLCX 3SHFA 1QHHA 3PEVA 4DEXA 1Q7YD 4HLUA 1JEDA 3MWKA 2OESA 5L3QA 2O8EA 1ZBDA 2ZRJA 2VYFA 3EZ9A 4G0NA 1AGRA 4EKDA 4PC3A 3U2QA 4I99A 1M1YE 4V0KA 1OXUA 1E99A 1W87A 3T1TA 4URXR 2OZEA 1LF5A 2EYUA 3AVXA 3EWAA 3MG9A 4M1TA 1P2TA 4F92B 1T3LA 2UZ3A 4HAYA 5LB4A 3FE2A 1J99A 1FPMA 1VKJA 1CXZA 4BE7B 2QSZA 5HPYB 3KFVA 1NVVR 2J7PA 3THYA 4XVQA 1LFDB 121PA 1NI3A 4MRPA 1N5JA 2FV8A 4TL8A 1R4AA 4U02A 1DARA 4F4IA 3QPUA 3LVRE 1UKZA 1BX1A 4Z8XA 3I4LA 4KV9A 2NIPA 3AF3A 1Z5ZA 2P3SA 1TQ2A 4TLDA 1Z2AA 2PZGA 3LO5A 5DH9A 3W3AA 1E94E 4QKQA 1JEEA 1SZPA 3DM5A 1KMQA 2WWGA 4UNPA 4GMDA 1SXJA 4NKRA 3WHLA 4M22A 1GAWA 1IONA 1I7PA 1VQ5B 2NOAA 2BHRA 2OTJB 1QRAA 2HLDA 2ZVPX 4OJQA 3EG5A 4WZ6A 3FMOB 1II0A 3DKVA 4HLUC 2IS2A 4ASUA 2DFKB 5KSOA 4D81A 2IWHA 2C5LA 3LWNA 2PCJA 1K5DA 1YZQA 1S1MA 2DR3A 2J87A 1E2IA 1NP6A 2FPLA 3U7HB 3EPKA 2QL6A 3WRYC 1XF9A 1VIAA 3KUCA 1T0JB 3W5IA 4LYAA 4GBMA 1Z8FA 1P60A 1G7RA 4JT2A 4AC9A 4BFZA 4EAQA 3CC2B 3K9HA 1GAQA 4MYHA 3B1VA 4Q9LA 1G3MA 3C7KA 2GXAA 1XTQA 2XEXA 1K73D 1DBSA 1P6XA 2DFTA 2QN6A 5KSYA 3AF4A 5DNYB 4ARZB 1W0JD 1WQ1R 3S1AB 4HUTA 2OUKA 3ZQJA 2H5EA 4F91B 3MWYW 1OPXA 2ZS7A 2VHUA 4CEJB 2BBOA 5KSPA 5A0FA 2G83A 4TL7A 3KQUA 2MSEB 2OXCA 4TYNA 5G53C 3K70D 1S3GA 1N6RA 2BJVA 1EFRD 4AY2A 3LA6A 4Q4LA 3K0SA 2QRNA 3SYLA 1BH2A 1EWYA 1IQPA 2N42A 4JLOA 3JVUA 1P7CA 5DISB 4GI7A 4PHHA 1VYVA 2ZJ2A 1G3RA 4FWTA 4DSOA 2O8BA 3H84A 1OF1A 2ONKA 1FRQA 3PEYA 1R5OA 2IL1A 1W4AA 3TUIC 1JAHA 3THXB 3MLEA 4PQYA 1KIMA 1JQJC 2R6GA 4G5QA 3K9LA 3T1QA 1P9RA 1VHTA 1YR8A 1II8A 1N2CE 1S9DA 2O0JA 4NONA 4LWZA 2GPJA 4O2LA 3CMEB 1QHSA 3R8FA 2YOHA 2FNAA 1M7HA 1CJTC 4LRWA 4PHGA 4IDQA 1IM2A 4L5BA 1KI8A 1QH0A 1QHYA 1EP3B 2IXEA 1XRJA 1E0SA 2ZUBA 3AGQA 2XXAA 5JEEA 3U7GA 2FH5B 2IYSA 5FH9A 5JI3E 2OLJA 2RHMA 4NYJQ 2YC4C 3ZC3A 4DLWA 2OV2A 1G3IA 1COWA 5BXQC 2XTMA 4KFUA 2JLUA 3ES9A 4U7DA 5BYJA 3PG5A 1P2UA 5D3QA 5EE3A 2D06A 1X3SA 4O0MA 5H8WA 3QEOA 3VX3A 4LHWA 4XVRA 1UF9A 1YIJB 3SJCA 1DDGA 1M1KD 3NC0C 2GJ9A 4RCYA 1M90D 1OHHA 1E79A 1S8FA 2IT1A 5FBLB 1N6KA 1JA0A 1BOFA 1XXHB 5FTJA 3QJYA 1QFJA 4NCHA 4OHZA 5FOXA 3OFND 4M1YA 5G3YA 3GLFA 4MDFA 3B85A 5EP2A 2UZIR 4ZDIA 5L3SB 4KJZA 4Q9KA 5JZVA 1W2BB 1A2KC 1KO4A 4NHOA 2O8FB 4M21A 5KDLA 3RS0A 3NBFA 2MSCB 4AKGA 1IN8A 1CBUA 3NDPA 4JLAA 5GJVC 4IRUB 3H4MA 4QGHA 2VTKA 4UXHA 4YMSA 4EFLA 3R9IA 4PAOA 5FTKA 3P1JA 2PLFA 3U3KA 5HXBA 3RYTC 2SHKA 3BK7A 5D3MB 1MO4A 3KQNA 2ZR7A 5L8VA 3RSOA 1D5CA 3MD0A 3BB4A 3CWZA 2JATA 1KY2A 2DHRA 3QKSA 1BIFA 2PH1A 1A1VA 3HPQA 1PUIA 2BJWA 3CNOA 3NEYA 1KK3A 4MUBA 4AURA 3OE7D 3EPHA 1OT3A 5BW8A 1XXHE 2C95A 4MQBA 4XWKA 3CKLA 4CIDA 3ZS8A 1FP7A 4IDNA 2IXFA 4NYMR 3CM0A 2QAJA 4JMPA 4XWOA 4HI0E 4QNMA 3ND8A 5FPKA 3RWOA 4RD3A 2IHBA 2JLXA 4LC0A 1KK1A 5EQTA 2BMJA 4NYIQ 5AR1A 3EC2A 3GCGA 5B30A 1Z28A 2Y8EA 5HE8A 4B2LA 3EZ2A 2WOJA 3I73A 1QHXA 4IOLA 4CDGA 5FOUA 4ESVA 3ZJYA 4CEIA 5L3RA 4B35A 2W2TA 2EQBA 3RS3A 1R8SA 1U98A 3BWDD 1QF9A 2XZPA 3OAAD 5DE3A 4OHVA 4Q7JB 3OZWA 1TUEA 2DBYA 3AKDA 4L9WA 2GJ8A 2ORWA 2GCNA 2CJWB 4Q1DA 1XD2A 4A2QA 1GL7A 1FNDA 3IBGA 4URWR 2YINC 2ZI6A 4XH9B 1R0ZA 2PEZA 5FOTA 1VQ8B 4OI1A 3AF1A 3VR3A 1KTVA 1KJZA 1MH1A 2VP0A 2ZJ8A 3VTKA 4QRHA 1G7CA 2C8VA 5DHFA 4MDEA 2IS6A 4TWZA 4G5GA 1Q3HA 2J7PD 2ORIA 2B7CA 4DLUA 1S0UA 4L9SA 1QHGA 1Q44A 3QXSA 1FUUA 3MWJA 3QF4B 4G3XA 5TV2A 4C0KA 4DKXA 5J5CA 3F3YA 4NTZA 2Q9CA 2WJHA 2G1JA 4A0HA 3FTQA 5EE1A 1VQ6B 1XBTA 3DVLA 4ZKEA 2GXUA 2QP3A 2AXNA 2AXPA 3AP3A 3K70B 3FYHA 3FKSA 4NMMA 1NSTA 4YALA 1VG1A 4FD2A 2BEJA 1G8HA 3L0OA 3VR5A 1XNJA 4YMUA 5KHOC 1XJCA 3OIYA 5AUPB 3ONWA 1SXJD 4B6EA 3Q5DA 1RKBA 5FR1A 2HLDD 4TMVA 4CYMA 4EFMA 4ZIRB 5FTLA 1TVCA 4IXNA 4Q4JA 4YDHB 5K8TA 1W36D 4BFVA 3GD7A 4ASUD 2JEOA 4H1VA 1ANKA 1KO1A 4QGGA 1ZNYA 1KRHA 1VHLA 1N0VC 5CB6A 3TR5A 2AL7A 2V6IA 4TLAA 3K09A 1I2MA 3QF7A 1OH5A 1EFUA 3X1ZA 4TMTA 3CH4B 4I81A 3B2EA 3FWYA 1XTRA 4UJ3A 4B2IA 4JL8A 3Q85A 3THWB 4FWIB 3MMPA 2OFOA 5EUQB 4FCWA 2B7BA 1GRNA 1OH7A 4DT1A 2ZAMA 4NE2A 2GKSA 4B3XA 1YQTA 1UDWA 4C0HA 3IIMA 4ACAA 2ZIAA 3LH5A 5FBQB 3T34A 1Z63A 4RD4A 1NJFA 4M4SA 1VG0B 2I3BA 2J46A 3IQWA 5FL7D 4PQFA 1VCMA 4Q4HA 3V76A 5K8UA 1W44A 3MJRA 4DCSA 3UPUA 2NMVA 3SNHA 3R9XA 1B0UA 1Q3TA 1S9HA 1SKQA 2J7KA 1L4UA 1RRCA 3OIWA 4DLTA 4II7A 1GP2A 2VF8A 3RRNA 4MYTA 4BLTA 4BZPA 2WOOA 2DETA 3KTAA 4JKYA 3WYGA 4I1SA 1R5BA 3CMAB 1KK2A 3ASZA 1T8TA 1GO2A 2H1LA 2O8DA 2WKPA 4G5RA 1A5TA 4P32A 2WTUA 2JLVA 4QGFA 1AZSC 3K09C 1MABA 4QL3A 2BCGY 1G8FA 4MRRA 4TT3A 1DAKA 4B43A 1QBKC 5KNBA 1UKYA 2YOGA 3REFA 1YI2B 1T5LA 4QBIA 5DGXA 4A4DA 1JQLB 5DLQC 5CITA 2QPTA 4Q66C 4HE5A 4EPVA 3VR1A 721PA 2ZRNA 5B57C 2HXSA 1P3JA 1N0UA 3LW7A 4TZ0A 2J5XA 4A1FA 1GWNA 3RC3A 1WB9A 4GDFA 3LQRA 2BV3A 4QJ5A 1XMJA 2G1KA 3OZVA 3VQTA 3VR4A 1TEXA 4G5OA 4JL6A 4LUCA 5JWRA 1Q57A 3I92A 2ZE7A 4P4SA 5FUXA 4OYHA 4BWYA 2GJSA 4BECA 4C3ZA 5LDDC 3DOEA 1NL3A 1COWD 2PMDA 2GK7A 1BMFA 2IBMA 5EXSA 3MRSA 2VHTA 4WZAE 3TUZC 1ZIPA 4B71A 3NIBA 1S72B 2VO1A 4QBFA 1FRNA 1K8AD 1ZNZA 1OFUX 5B2ZA 1OHHD 1E79D 1GNPA 1F6BA 2JDIA 1YRBA 3BFVA 2G0NA 2ZRFA 1QHHB 4ESHA 1Z2CA 3D3QA 4ERNA 3R8CA 2P65A 3QE0A 5L3QB 2O8EB 3CH5A 3SE0A 1HQYE 4BLSA 2W2VA 3SBDA 4AKEA 1UKVY 2WSSA 3GLHA 1U0HC 2CL7X 3CC4B 1W4CA 2PL3A 4PSAA 5UKDA 3KQLA 3GEEA 3KB2A 3C16C 2ZPTX 5GV8A 2OBLA 4JLNA 4KVAA 5CYPA 4EPRA 4C7OA 1EFCA 3RANA 4FN5A 1G8GA 1KO8A 4JSYA 3OZUA 4US0R 5EP4A 3O8CA 4HAUA 2F1IA 4PC1A 3QEJA 1G6HA 3LDAA 4IJMA 3E70C 3UKDA 3B9QA 2XTNA 1VQ9B 3THYB 1LTQA 1DS6A 4FXPA 2FFHA 2B5OA 4DWJA 4ZDJA 1N25A 3BH6A 1IN5A 2W83A 1CR1A 5BN4A 3ZBUA 3DL0A 1LV7A 4RKFA 2FOLA 3F5FA 5BN3A 2QQ0A 2Q3MA 3U3OA 3R20A 2ZS9A 4NCIA 1FNBA 4B47A 2FFBA 4Y9RA 4HAVA 1DO2A 2HCBA 2V1XA 1FZQA 5JMTA 5IK2A 2A2ZA 1JB9A 4DDUA 4B4DA 3ZZUA 1GAJA 1IOZA 3UWOA 1ZM7A 1DO0A 3T15A 2AWOA 4UQOA 1RPZA 1P2SA 4FCVA 1XCMA 2VQSA 4Y7CA 3ZZTA 2J1LA 3EC1A 4Z8YA 2JJ2A 1DADA 2D3WA 4MGIR 5C2JB 1W36B 1F3OA 1NVUQ 1Z83A 3PQCA 2EFHB 4D4MA 1XDBA 2GF9A 1XEWX 1JJ7A 2OO7A 5FBRB 2NQ2C 4G1BA 4LJ7A 4C0LA 1CLUA 4Q00A 2IX3A 2IYQA 2RGGA 4C0AC 1OV4A 2OILA 4Q7MB 1OXTA 1RFLA 1AJEA 2QUZA 3MHPA 3TBKA 2O0KA 2AFIE 4L8GA 3BH7A 3W2FA 4QM7A 1WBDA 4YAUA 4FMBB 2EW1A 2Q21A 3BAFA 1X8KA 1NSFA 1QDEA 1OFIA 4RJLA 2GRJA 3B1YA 4MRVA 2ZRCA 3CX7A 3G6EB 1GVHA 2IUTA 3U61B 1JJ2B 5HZKA 1DDIA 1R0YA 2Z4RA 1XZPA 4IHQA 3WP1B 5JS8A 1XFAA 3FKSD 4XIGS 2QPOA 3BERA 3P26A 2V7QA 4M1SA 4KLNA 2QTFA 3PUYA 3SU8A 4MKIA 4B2PA 2P6RA 3FHTA 3M6AA 1ZU5A 1JBKA 3FOZA 4ZDKA 2GVZC 5EJEA 4IVPA 1Z0FA 2P2LA 3HDTA 4AKHA 1OSNA 1VG8A 2O8BB 3E20A 4NU0A 2VZLA 1QVRA 2FGKA 1GDDA 3AF2A 3CRW1 2XNDA 1R2QA 2RGXA 2G6BA 2VL7A 3HYTA 4OI4A 3IEVA 1TQDA 3A4MA 3UIEA 4CZ2A 4KAXA 2ZTSA 2FWRA 2HCJB 2C9CA 3LXXA 1E0JA 1U0JA 2NO9A 3MUFA 3WRXC 2AKYA 1II8B 4ZO4A 2AD1A 3A4NA 2CCGA 2KWIA 2A5GA 3BB3A 3E2IA 6Q21A 3JZMA 1KSHA 1T3SA 3IHWA 1HT1E 5SZKB 3I56B 4OKSA 3F8TA 3PXGA 1UEIA 2H16A 1ETUA 2R6AA 4X8LA 4LPSA 4YAFA 4A2PA 2XXAB 1KJYA 4AIIA 5DO9A 1KK0A 3TE6A 2NO6A 4URUR 2F1RA 1L7VC 1E2PA 4E03A 3EZFA 1NVVQ 3TQCA 1Z22A 1G4AE 4GPTA 4DLVA 4YMVA 3I8XA 1E2HA 4WOPA 1VCIA 4C0QC 3TQFA 3OIVA 3IQXA 2R9VA 2ORVA 2E1RA 4IEIA 3DDCA 1E2KA 3QVUA 4Q7LA 4QGAA 1U90A 5JWHA 2OK8A 3K0AA 1JR3A 3UMRA 1XPRA 1E2JA 1P2VA 2R2AA 1Z06A 3CF0A 3GJ5A 1VQOB 2ODNA 2Z43A 3HR7A 4B75A 621PA 1GVNB 1EK0A 2F1HA 4FCTA 4BLRA 3SYKA 5JFGA 2OCAA 4YMTA 4I1UA 3PIRA 3WP0A 1XEFA 1ZIOA 3AM1A 3KJGA 4WIAA 4V0LA 1FX0B 3HR8A 3GLFB 3VU9A 4I4LA 3AVOA 4HAWA 2BWJA 4V03A 1LW7A 2ZVQX 2ZR9A 3K9NA 1E9CA 2BBWA 4ITRC 2HF8A 4TT3D 1PUJA 2YV5A 2VP2A 2ZRGA 1G19A 1P4SA 1UMKA 2C03A 4MGZR 4TQAA 5P21A 3KQHA 1BO6A 1NVXQ 4MKGA 1J8MF 1U81A 3T1OA 4Q9IA 3CRVA 1LS6A 1YVDA 4JZKA 3FMFA 3GJ3A 3Q72A 4OQLA 2WMOB 1XP8A 4OK5A 3LBNA 2QENA 4KI0A 3X1WA 4RVCA 3TVDA 3VR2A 3QFSA 3QKSB 4PR0A 4Z54A 3SQXA 5HCNA 5J4HA 1GRRA 1F2UA 2QDXA 3DKPA 3KXIA 3P4YA 4LY6A 2FE4A 4LBZA 2JA1A 3D31A 3V00A 2XZLA 3WMFA 1Q1QA 3SJAA 4B74A 4G5SA 1BMFD 1M6NA 1O87A 4KLZA 3GLFE 3DZ8A 5C1BA 3FGNA 3B13B 2WSMA 2BKEA 3GEIA 1FQJA 5JSZA 2CHVA 4C2UA 3RC8A 1P61B 2R8RA 5FTNA 2R6DA 4LV6A 4KSBA 5EXTA 2JDID 3W6NA 4HLQB 1G18A 3FJOA 4CEIB 2CDNA 2OAP1 3N5CA 1NF3A 5F9FA 4IVQA 3Q8XB 5FI1B 2N46A 4WXPA 3B9PA 5EE5B 2BBSA 2BMDA 2WSSD 4HLDA 2IYTA 4Q1AA 1BYIA 4W5JA 2OLKA 2FFAA 3IO3A 1OYWA 2BSAA 1AM4D 1RJ9A 4PZYA 2VYQA 3EZ7A 2H18A 5AWFC 5FBVB 3CNNA 4FI3C 4M9SA 2GF0A 3OAAA 3ZD7A 4QBHA 4Q7KA 4Q4AA 3B1WA 3ZVMA 5FPTA 2D4HA 3KJIA 1MRNA 2FSGA 3B7GA 2IF2A 1PZNA 4WQMA 3NH6A 1Z07A 2CE2X 5HKKA 5GV7A 1F2TB 4KSCA 1NLFA 4RD6A 5FUVA 4LSGA 5IK2D 1G8PA 2AK3A 2FU5C 1EGAA 3DOFA 3K0FA 2V3CC 3F0TA 5F3WB 2RGCA 1UEJA 4PQRA 3L0PA 2GEUA 5G41A 1TU4A 4YQFA 2CBZA 2CLSA 5KNDA 2WICA 4NL4H 4DBLC 1Q12A 3SS8A 1Z6TA 5E7JA 1C9KA 4TLEA 3VMFA 1DG1G 2H17A 1SM4A 4Q4JB 2WJGA 2JJ2D 1A4RA 1KHTA 4QG7A 5FOWA 1DEKA 4MGKR 1TL7C 1OB2A 4LV5B 1TNDA 1KDPA 3U6KA 2IYYA 5A5GA 3PCRB 1NLYA 2ERXA 1Q1EA 1QX4A 1UBEA 3P27A 1FUKA 5KOYA 1KZ7B 1E9DA 5AUNB 4YAWA 2R62A 2WBLC 2RHDA 4GZMA 1YZGA 2CCKA 2W6IA 1YHNA 4DT1B 2QROA 1RRGA 1XCPA 3OEEA 3CCVB 1Z3IX 3FMPB 1FW6A 2DWPA 1GTVA 2IK8A 1VQLB 4ZKDA 4FINA 2BIFA 1A82A 1SVIA 1E0AA 2BC9A 3QQ5A 4ZGQB 1GNRA 1BKDR 3RS5A 4JLKA 2HV8A 4MRSA 3GLGB 2ZUDA 2PEYA 2BKUA 4Q4HB 2V4ZA 4US1R 2QTLA 3ZIAA 1AS0A 3SR0A 1G41A 2IS4A 3AH8A 5CM9C 2OXRA 2VSXA 5HCIA 1EP2B 1WA5A 1JALA 2V7QD 4FMDB 1PJRA 2AN9A 1PLLA 2ODWA 3ZYCA 4HAZA 4BFXA 5FL7A 1MV5A 4GRAA 1PV4A 2XOKA 1FP6A 3GJ6A 4DLYA 2ZSFA 3AGPA 1Z0JA 4PC2A 1X1SA 4NYMQ 2O52A 1CQXA 3KTAB 5F2EA 1ESMA 2FFQA 2QRZA 4TSFA 2O8DB 2XNDD 2WAYA 3GJXC 2W0SA 4RFVA 2A5FA 2X19A 1SXJC 2WZQA 2YJTD 4V0OA 3ZQ6A 4EPYA 4MGYR 5BYKA 2RC5A 2QZ4A 1OXVA 1MABB 3SQWA 1AA9A 1KGDA 4RD2A 1ZVQA 1W36C 4PAQA 1IXSB 3NBXX 2VP4A 3GLGE 3U60B 3C8UA 4EH1A 4E09A 1BQEA 4FIDA 3AVUA 2JIZD 1W48A 3PEWA 1KNQA 1YZTA 1Z29A 5KTYA 3W6PA 1G7TA 4OJKA 3QFRA 1XPOA 3LNCA 5EE0A 3OHMA 1NMYA 3HU2A 4BEJA 2OTLB 4C0JA 1L2TA 4JVLA 4TYPA 4MYUA 5TARA 2QY9A 8OHMA 5J40A 5GADl 3GPLA 1AZTA 3NVAA 1QUEA 4TTQA 3VNVA 3Q3JB 2OE2A 4BFWA 2BGIA 3EA0A 3TSWA 4RD1A 1G21E 1XZQA 1JR3D 4PPFA 1T6NA 4C9BA 4JLMA 3CRRA 2G9NA 1SVSA 2PBRA 4EIWA 1AQUA 1SULA 1YR6A 4PFSA 1TQ6A 2XX3A 1ZM4A 5KDOA 1W46A 3NXSA 4X8OA 4A8JA 1RRFA 2I1VB 2ZSEA 5GVRA 2X2EA 3HU1A 4RZUA 1FNCA 2CL6X 4BUJA 4DUGA 4R98A 4BGDA 4JYCA 1US8A 3ZVRA 3NC1C 3OZXA 4D6PA 1CR2A 1NN5A 2EWWA 4Q9JA 4GT1A 2HUPA 4C2TA 1L8QA 1KDRA 4C7OB 4TYYA 4HB3A 4HZUA 3VKHA 2RAPA 2WIAA 3NWJA 2BM0A 4P0TA 1ZW6A 2ONJA 3QXHA 4HE6A 2A78A 3IHLA 3EAQA 1T9HA 3BFXA 2XB2A 5CDFA 2QAGA 4JBWA 1Z47A 3CR7A 3ICQB 3GFPA 4WW0A 4X8HA 1QUFA 1KI9A 3BJIC 4M0LA 1CNEA 2PZFA 3W2GA 2ZJYA 1CJKC 2EYQA 1IAQA 2A3RA 1HV8A 3IO5A 3LX5A 2F43B 2ZQ5A 2PJRA 3C5CA 1X6VA 4V0MA 1NJGA 3CXCB 4C4PA 3QBTA 1XD8A 3U4QA 5KSWB 4DSNA 3I62A 3AKCA 4DB4A 1QFYA 3FVQA 1FNMA 4BLPA 2FSIA 2MSDB 2BOVA 3H86A 4DCNA 2WWYA 3LVQE 3A36A 4A8JC 3EXAA 2WJVA 3P4XA 4DCUA 4QFMA 2CHGA 3KX2A 2W58A 3TUJC 3PUWA 1VMAA 2RB4A 1T3HA 2GEVA 4LV8B 3AV0B 3B1XA 5E4FA 2VIIA 3CO5A 4FK8A 3DHWC 1OIWA 2C9YA 5BQ5A 4YAOA 2QP4A 4FMCB 1EP1B 2C2HA 1UFQA 3T61A 3IPXA 2ZU6A 1T91A 4Q48A 3RS7A 3TR0A 3PR1A 2ATVA 1UPTA 1MO5A 2QAGC 3NBYC 4GZLA 2F9MA 2H57A 1N6IA 5IDVA 1B2RA 1J8YF 1P62B 3GLIA 3AVWA 2GJAA 1W47A 2PLRA 4RZ3A 2R6CA 1IJFA 5B64A 5HKKD 1HUQA 2FMXA 1UBFA 2HJGA 4EDHA 3AB3A 1A7JA 3NDBB 4PHFA 1Q82D 2ZJOA 3AUXA 4NBSA 3BGWA 2OM2A 5FUWA 3CPWB 4DRZA 4B32A 1KD1D 3IEUA 3QBVA 4WA7A 1G20E 1E6CA 3A1WA 3AEZA 4PO1A 3T12A 1GNQA 5EZ6B 4PSKA 3A1TA 2CRVA 3LRPA 4JT4A 1X8LA 4ZV4A 2AX4A 3UMSA 4M1WA 4PAMA 1NBMA 3TSOA 5J4LA 4GMXA 3AQ4A 1P5ZB 1SVOA 1XD9A 2QBYA 2FG5A 3W6OA 1NN0A 3QVVA 1G4UR 3JZAA 1S3SA 3QKTA 2NO0A 1E2MA 2A5JA 2FPKA 1CJVC 4E5UA 2XNCA 3PENA 2IC5A 2AR7A 4B44A 3TJZA 2CL0X 5CM8B 1C1YA 3WMEA 5KDDA 2W6ID 2QMOA 2X8AA 3SBEA 1K8RA 1A8PA 2GA8A 3IDQA 1G8YA 3OEED 1FNNA 1R0XA 5JRZA 3ZZ0A 4JKIA 5H68A 4CVNA 1GR1A 1NIJA 2N1BA 1UKEA 1JXMA 2UKDA 2YWEA 3U44A 2DFLA 4KHZA 3PITA 4ILEA 1D2EA 2XSZA 1ZP6A 3H1TA 3MWLA 4D82A 2HT1A 4BFTA 3ZIAD 2CE7A 1ZRHA 5E7MA 2P0EA 4A6XA 2A5DA 2GHIA 3K0AB 4OQXA 1II9A 2OCYC 3QUSA 2IF0A 1SVLA 3A4LA 1W35A 2VPPA 2XOKD 1P72A 2XGJA 3K1JA 2WHXA 2ZEJA 4DDTA 4TSFD 2YYZA 3VU9B 3QXCA 2ECKA 2Q6TA 3B60A 1H8HA 3LLMA 4PPQA 3TKLA 4F4JA 1G3QA 2J0SA 4N1AA 1TTTA 2IYZA 4B3DA 4XSHA 3W8NA 3MGCA 1XX6A 1UAAA 2KE5A 4Q03A 5ANRB 3LO8A 3TK1A 4U9UA 4L16A 1AMOA 3T35A 1IBRA 3RLFA 2DWOA 1HURA 3WXMA 1JR3E 2QTZA 3W2EA 1GUAA 2WM9B 1AN0A 3EIQA 5GJCA 1SVKA 3TLXA 4AYWA 1KY3A 1T4GA 1KSJA 1TF7A 1GKYA 2BN4A 3ZH9B 2G0TA 1F2UB 2V8OA 3CZQA 1TF5A 4DSTA 2ZUCA 3LBIA 1P9NA 4B33A 1Q81D 2IEZA 3LW8A 1RVDA 3ZBTA 3WBJA 4PGOA 3CPEA 1X1RA 1E1QA 1GRQA 3DM9B 4LJAA 4R2IA 5AN9A 5FOSA 1AK2A 3U6BA 2QG6A 5JJLA 2A30A 2XAUA 4HUQA 4IOMA 1TLLA 1XTKA 1Z0AA 2P5TB 2Z83A 1KYIA 5FOVA 1AGPA 4KITB 1QVGB 3AKYA 1CJUC 1W1WA 1DG3A 1T8UA 3CPJB 3EX7C 4M53A 2OHFA 2R44A 2DCUA 3BS4A 4TLCA 4D25A 3IIKA 5H1YA 2GESA 3R7WA 2ZYUX 3LXRA 4HB0A 3GJ0A 4EJSA 4NH0A 2JASA 3QXXA 1FTNA 4DUGD 3PEUA 4AI6A 3QSYA 3KKPA 2IWRA 2EFGA 3KQKA 5DSZA 1HH4A 1LY1A 4IVRA 4ZDWA 3RRZA 3CCSB 3CBQA 1X8JA 2NO7A 1KI3A 4F93B 1RJ9B 4JBYA 4Q1BA 2WVJA 2FGJA 2B6HA 4BFUA 1E2EA 1HA3A 4HDOB 4Q4AB 3RAPR 1FFHA 4DC9A 4LOAA 5CLLA 1W2HA 3EARA 2IA5A 5IRCD 1N6HA 3W34A 1XTJA 2HEIA 5EMNA 1VQPB 4E22A 5SZHB 2O8CA 4K81B 2D62A 1FDRA 4YLGA 3WMGA 3UATA 4D2IA 1R0WA 5BWMA 2RGAA 3LX8A 1E2QA 3SYNA 4LPKA 1ZM3A 1CS4C 1ZUNB 3K0FB 1HEIA 3U7EB 5E3HA 1E9FA 2XTZA 3TIFA 5CB8A 3A37A 1ZUIA 1D2NA 2KBEA 1C4OA 3B82A 1GITA 2NG1A 1XEXA 1OH6A 3JQRA 4Q01A 5HR5A 3TAUA 3JVVA 5EXPA 3CWQA 1YJ9B 2XNJA 3THOA 2VNJA 1R10A 2IYVA 1U8ZA 1NMZA 2ZYVX 3B6EA 1UBGA 2CMKA 2KBFA 4EJSC 3CF2A 1YZKA 1SXJB 1VCOA 2QMEA 2XZOA 5ELXA 1J90A 2HYDA 3CRQA 2JJ8A 4RZXA 5DI9A 4DCVA 1TF2A 1UDXA 3C15C 1W5TA 4D0LB 2FSHA 4J0QA 2J0UA 3D6TB 3EASA 3ASYA 1UADA 1MRSA 1VECA 1PLKA 3EIEA 3IPYA 4G1VA 3PV0A 4HDCA 1LVGA 1E4YA 3L0SA 4B3CA 4AYXA 2OCPA 2ZSDA 4A15A 4ZI2A 1P75A 1NDHA 1RYFA 3U3MA 2FPMA 4Q1EA 2BMEA 3K53A 4OHWA 1CULC 3QI2A 4QHTA 2X3UA 4JJKA 4IXMA 4D80A 2O5VA 3I5XA 5BN5A 1W4BA 2OFWA 1E2DA 2E9SA 4KYIB 2RC6A 4HSEA 1R6BX 1VG9B 2IYRA 1K6MA 1H65A 4IOJA 3W8RA 3SHWA 5JHHB 2OK7A 4N3GA 4M2LA 2B8TA 5C18A 1SXJE 2PT5A 1CKEA 2VP6A 3NG1A 4D4KA 1FMJA 3I72A 3IIJA 4A0RA 4ZGNB 1Q0UA 2OT3B 1OFHA 2L0XA 2BMWA 4CW7A 5LD2C 1M8PA 1U8AA 1U99A 2H92A 4LBWA 1NBMD 4F7WA 1HQCA 2QMHA 4DIDA 3MJHA 1IN7A 5SZJA 5AK0A 3SJBA 1TEVA 1E0KA 1EX6A 4A9AA 3VO2A 2ATXA 3OIUA 4TQUS 1QG4A 3K0EA 4DDVA 1IB0A 1Z0KA 3VR6A 4EUNA 1KSFX 1ZU4A 5AJXA 3RABA 5A4JA 4CEHA 3ADDA 2GCOA 4WAUA 2RGNA 4WXRA 1XU4A 2IYWA 1G6OA 2ZRKA 1IY2A 4BPBA 2A7QA 1GG2A 1KI6A 4TTRA 5EZ5A 4F4CA 3CCLB 1YU9A 1CU1A 1G64A 3T06B 4EQ6A 2IEYA 5EXXA 3CX8A 2XSZD 2JIZA 2P5SA 4L15A 1G291 4P6VF 4UNNA 3CRMA 4TMWA 5M04A 1O3YA 1QVFB 1IN4A 1OXSC 2ZRAA 1OJLA 3EWSA 2IHYA 1JXOA 1SKYB 4A0FA 3HP1A 3MFYA 4JYBA 3E1SA 5H5JA 5H59A 1SVWA 5JJIA 4BASA 4POAA 4GP6A 1XJ0A 1NJID 1KZGB 1TAGA 2G3YA 3W9YA 1DOAA 5EUMA 3O47A 2JLYA 4A8JB 1D1NA 2P6NA 2PX0A 1N8RD 2Z0MA 5FPHA 4AKIA 1AS3A 1KSGA 2X2FA 2MMGA 2REBA 3E5HA 1H8HD 2WIBA 1US8B 2ZROA 2IUSA 3TH5A 2B8WA 1DVRA 3QIAA 4LJ8A 3TSZA 1MKYA 3VKWA 3BRWD 4B6FA 2ZRDA 1W5SA 1WCV1 2NO1A 5AJYA 1CNFA 3G5UA 4HZUB 3BE4A 2RGNC 1YJ5A 2F3RA 2BVNA 2QEQA 2W2XA 2VHQA 4F38A 1KAOA 3EPJA 4V0NA 4YHBA 1EX7A 2VP9A 4A0GA 4LHXA 2QAGB 4V02A 1XTSA 2VSFA 1SKYE 3VKGA 1NMXA 5KNCA 3VAAA 1YR7A 1N6NA 4EPTA 3WYAA 1KO7A 3CCEB 4B3BA 4JVMA 2CXXA 1GL6A 4RZ2A 4Z51A 4B48A 2CLDX 4LK2A 1E1QD 4TYWA 5TB5A 2IXGA 2WWXA 1JB1A 1W49A 3U4QB 4P3YA 3B78A 2Z5FA 1CTQA 5AJVB 4A2WA 4ZCLA 1KI7A 1RZ3A 2P6UA 1GFIA 5FI0B 3PJRA 3AVTA 4GOXA 1RYHA 3KDSE 1D9XA 4OHXA 4W5WA 2BBTA 3RRYA 4EPXA 2HT6A 1Y63A 1N5LA 5CDFE 2WWHA 1ZYUA 4LYFA 4LYHA 4UXIA 1D8TA 1TADA 1XPUA 3A1SA 3QY0A 4MA4A 4GL2A 4Q19A 1DTSA 2ZI7A 2EVWX 1RIFA 2ZRPA 5JLJA 1E3MA 2NGRA 4S2EA 3FFAA 1EXMA 1OE0A 3GJ8A 3Q5EA 4V0ME 3SI7A 4TZ6A 4LJ4A 2WWFA 3BH0A 4P4TA 2ZM5A 2ZE6A 1VDZA 5FBWB 2PCLA 2PT7A 4RSGA 1BYUA 3MSXA 1WF3A 5CYOA 1NG9A 1XD2B 2HF9A 1FQKA 1D9ZA 2CVFA 4W7SA 4P4UA 2GCPA 3X2SA 3GLIB 1DPFA 1YE8A 4IW3B 2WWIA 1IY1A 1R7RA 3AP1A 2BGJA 1PLJA 4P33A 4YDSA 3VHLB 4AD8A 4D4JA 4RCZA 3RNLA 2GXSA 4I1OA 1SHKA 4DLZA 4RFSA 5FL3A 1D2MA 1Z6GA 2OBNA 4JIMA 1OYYA 3DEFA 1XWIA 4N0DA 3V4RA 2XJ4A 3X1XA 4YXWA 1Q21A 2EFCB 2GBLA 3TMKA 1Q20A 1M74A 3VX4A 1KNXA 4AF6A 1HTWA 2YWGA 1XEWY 4PZZA 4JBXA 4QNRA 3ZGXA 1F5NA 2QBYB 1QG2A 1S4QA 5IT5A 1JI0A 3BFKA 1EG7A 2ZJBA 4Q18A 3QENA 3IUYA 1F20A 2CNWA 3O8BA 4FMCF 5DI3A 3GLIE 2QP9X 5TXGA 4KXFB 4C30A 1V43A 4URYR 1CJMA 2ZYTX 3B8HA 3SDZA 1H8EA 1D6JA 2A5YB 3FHOA 1FMLA 4CT5A 5KO2A 1NY5A 3EPLA 4JLBA 3ND9A 5CK4A 2C96A 2QMUA 2WPDA 3QG1A 3QNUA 3U44B 2F1JA 2NZJA 3GQBA 4MKFA 4Y0VA 5L3VA 1KMHA 5FUYA 2KI5A 1NBME 1NY6A 4EFNA 2LCFA 2YNMA 3A8TA 3PVSA 4DLRA 1AKEA 3UWKA 3LFUA 2WJIA 2FSFA 2HYIC 3G4SB 3LV8A 3GMTA 3IILA 4ZPXA 3C5HA
chains in the Genus database with same CATH superfamily
1RQPA 4R8LA 4L73A 4HYYA 5CA1B 1VA4A 2GBLC 2VYND 4XE5A 3X1MA 2C77A 2R97A 3KUUA 3O2NA 1M5UA 4W5HA 1TMKA 1OMOA 1ZM9A 1DIAA 1JSZA 3RHSA 4OXQA 4W82A 4DBVO 4ENRA 3PVDA 1M2OB 4I1IA 2F6RA 1QFZA 2JLZA 3H0KA 1IE3A 2YJGA 3Q40A 4GP9A 4ZAVA 1RYDA 1T24A 2DKNA 4KQXA 4R8KA 2ZI3A 1CQPA 3W2TA 5MN5A 1U9YA 1AGYA 2R6FA 3D7NA 2JFOA 4LCBA 4BO7A 3P45A 5WRFA 1XLTA 1ZD5A 1GPLA 1I3LA 5C46F 2YV1A 5K0BA 3K0CA 2FF7A 4E1BA 3DFMA 3TRFA 2BEWB 5CT8A 3U80A 1H9AA 4KH1A 3AVPA 1GKIA 2M5SA 1XDWA 1Z3CA 3IB6A 3QV2A 3LPCA 4ZT2A 3ZW9A 5IF9A 5JQGA 1YZUA 4ZVNA 3SMVA 3LY9A 3FPHA 2J59A 2VPTA 4F1JA 4O4LB 2F55A 2ADFA 1BN6A 2ZU0C 4HJXA 1RC8A 3I5YA 4AP9A 1VCHA 5KJCA 1OLXB 1ESCA 9MHTA 4QJ4A 4YLEA 2BUBA 5C32A 5BSFA 5K6TA 4HUQB 3EQ8A 2FG6C 2OSBA 3A6LA 3VYTB 1XN4A 5IT4A 1IY0A 4AWXA 5ICEA 4OXIA 3GCWA 4KSYA 2ZETA 1UP4A 3D8NA 1O0CA 3UMMA 3MWEA 1X3LA 3EXHC 3MSCA 2GBGA 2H9AA 4L8WB 3WWEA 4ZEMA 2VQEB 1QGYA 3UJPA 1Z13A 3KYBA 4EJSB 5JHGB 1ZL0A 1E4VA 4KFSA 1L6RA 4O4HB 3ENQA 5D6OA 3CLVA 4YRTA 1S3IA 2XADA 3LY5A 3HA2A 1MG5A 3QTBA 3RS4A 2C7QA 3A8JA 2LUOA 2IYEA 3FLBA 1T5TA 5CTJA 3AINA 2HM7A 4DA4A 1BFDA 3BXZA 3KAJA 1IUPA 3IS3A 4EW6A 4JEUA 1KEKA 1SHZA 3M0EA 4PS1A 3F7OA 4MUKA 1VB5A 4R6WA 2PQ6A 1TCBA 3GLHB 4M9XA 4DREA 2C54A 4GM1A 1EJ2A 2QXUA 2H2GA 4ON9A 5AJHA 1AKTA 3IAS1 4B4OA 1MT0A 1N6PA 5IKEA 4ZVSA 1Z6XA 3TRHA 3L05A 5C1PA 4R71A 3OJOA 4W6ZA 1J97A 1HGXA 3DDZX 4X1KB 2H7VA 3RUFA 3BMCA 3RVBA 3WNCA 1RWWA 4NJOA 3T99A 3V8MA 5AVYA 1N5OX 1GL9B 2PX3A 4LGMA 2P8SA 2XCUA 3C3YA 1TM1E 2NVOA 4DB2A 1Q22A 1IQ0A 1QU3A 2P9GA 3MTDA 5LZ4A 2FX3A 2W9XA 3VJLA 4F71A 4HB4A 3CE9A 4WVFA 3J81k 2ZRMA 3UHFA 5EFZA 2NU9B 1SU6A 2WWWA 4KU4A 3HYRA 4DQXA 1IVSA 4PO8A 4KR7A 1CRQA 2G1UA 4WWVA 2PH7A 3IT0A 5IT9A 2FZVA 1IB6A 2UUCB 1QTRA 2MYNA 3PF8A 3GLHE 3PHIA 2ETXA 2Y9MB 3LLCA 1U2SA 2ROQA 5KYUA 2IV2X 5CD1A 2PWYA 1N6LA 4KUGA 5AQEA 4E51A 2OAEA 4RTOA 3G0OA 1CIPA 1IL0A 2I4RA 4RF5A 4DK0A 4DIFA 3GHYA 1T4MA 2GBFA 1H85A 4UZUA 2VBCA 3PC3A 3QVMA 4HAOA 2M9MA 1J2TA 4JYAB 4UTXA 1QHIA 2W6MA 3IDOA 4YAKA 1IK4A 1EPUA 2JJ1A 1X9GA 3GK3A 3H18A 2W0MA 3NQ41 2J0UB 4JN6B 4QYMA 5AOVA 2FR0A 1I9GA 3L3BA 4OLJA 1YUNA 4FZRA 5AVKA 5CFPA 4ANFA 2FN4A 2I7DA 4YIHA 1XL1A 2ZRIA 4W1PA 3ZY5A 3AESA 3DL7A 4Z4SA 4I5EA 3IKJA 5K51A 4ZICA 3ZX5A 4GMGA 1R0LA 1CRLA 3FKQA 3INYA 4EPWA 1X7GA 3AHIA 3RYIA 3SR3A 4RD0A 2PLAA 2GETA 3OD5A 1U8EA 4UUOA 1SUEA 1TO1E 4HCJA 7MDHA 4XYEA 4PIMA 1LVHA 4WK2B 5KWJA 1GQQA 4KYUA 1KJWA 1QH8B 1UKAA 2J4DA 2IW3A 4D5EA 3NUQA 3RYCB 4Q3OA 2EJVA 3I9V6 3LC2O 2IOQA 2WIDA 3U4GA 2FQXA 3SC3A 3EHDA 1IRIA 1JL3A 2KMLA 4J0KA 2QLMA 4QQFA 3TZCA 4PFJA 4BATA 2YW2A 3KOZA 2L17A 3W6ZA 2HDHA 4XPIB 4CM8B 1YA4A 3AM5A 1MX1A 4JLVA 1PR9A 5C8YA 2ID7A 1C30A 2IYLD 2XRMA 1KL7A 3C6ZA 3ND6A 1E89A 2HHJA 3QKIA 2F1OA 4DQKA 4I1VA 3FIUA 4B7UA 4JS0A 1UEXC 5B2FA 4OTZA 1E9SA 1W59A 4I7EA 1WKCA 1KVUA 4BAUA 3NJRA 4DPKA 4PSVA 4XKJA 1X7HA 3SX0A 4ZO6A 1EXDA 3EW9A 4WNCA 3V2IA 2IKQA 1M7GA 2W2MA 3K5PA 3KZVA 1HE1C 1JIUA 1I2BA 2WFLA 1W1IA 4RU1A 4FONA 4X61A 2G25A 3GG9A 1XELA 4QC2A 1KVSA 4XIIA 3UHAA 4XVUA 5I3CA 4RULA 2OBSA 2F3QA 4WEOA 3KP1A 3ZD9A 1UKBA 1TQHA 2LDXA 4OXYA 1RQNA 2GUWA 4QYTA 3AERB 4O2AB 1G16A 1XYVA 3DBRA 3ZTWA 1SKAA 4EJFA 2C5GA 4GXRA 2IKSA 4BLOA 4QTUB 4ZQIA 1UKCA 1JE0A 4I08A 5CR9A 4CM7A 4AG5A 5ALDA 1RQ2A 4LOLA 4NCKA 1MP0A 1V11B 2VRNA 4PYJA 1QYCA 1J70A 3DXZA 1U2QA 5CD9A 4LJ5A 4TL6A 4X90A 3AEUA 2H85A 3I6IA 3K9GA 4Q34A 3SVTA 2J3EA 2ZBRA 3DZKA 5B2EA 2ES4A 2GZHA 2NSLA 1J9ZA 2F9FA 2E2WA 1JDZA 3DD5A 1ZAKA 3LCJA 3NYQA 3Q7EA 2ZXIA 2B34A 2W98A 3VYSB 1FE8A 4GXQA 2QZSA 4QFBA 3MN1A 1JR6A 2C2XA 2HMAA 1HZZA 1LPBB 4BU1A 5ALLA 3UYLA 1Z7YA 1NLZA 1ZVKA 4L07A 1F0NA 1P2GA 4N3NA 3GAMA 4LHYA 4OO3A 2OWDA 3RYHA 2GWHA 3MCAA 4MINA 1I7DA 2DY1A 4KKSA 5H3LA 2FDCA 4H1HA 1PN3A 4UBMA 1YC5A 1WZEA 1IHYA 3B2NA 2IZ0A 3O83A 4LXQA 4N5MA 4EG0A 2XLBA 3NI2A 4QJBA 4MV8A 3W2IA 4PCUA 1XLVA 2GB4A 4TMZA 2YWBA 4O25A 1DJLA 3KXKA 4L4ZA 3DWFA 3UOAB 3KJQA 4BZQA 4MV0A 3K1AA 4LRQA 3V8EA 1E66A 3R9WA 4PZ0A 1LA2A 3SFZA 5JXHA 1I4TD 2NW6A 1NVKA 3UJ8A 1Y9ZA 1P2FA 2C98A 3FYTA 5IABA 2B92A 4NFHA 1EBBA 4XR6A 1RXIA 4UPVA 4AICA 1DUIA 3TYXA 4DE5A 4JB3A 3KVRA 3PQ7A 4QVIA 4WY5A 3GLGA 5TR9A 1C4WA 1HYHA 3BWCA 1DBRA 1PVDA 4NP6A 1NDUA 2ZI9A 2G7ZA 2ZTMA 5A6SA 3Q3VA 2C5FA 4YJGA 4DM3A 5CIQA 1I01A 1Z74A 2HFJA 5TDHA 2WMNB 3R0ZA 5I7UA 4TLBA 4MVYA 3NALA 4NYIR 1LNZA 1YJWB 3PFNA 1CR0A 3FB4A 2OPHA 3S3TA 4ARSA 5J43A 2VSOA 1KEPA 3SR4A 3KQTA 4L51A 1L7BA 4MUGA 5EJAA 3TTTA 2D2IA 1ADBA 1K27A 3IT1A 2ADMA 3CONA 4BOYA 3DO6A 1DOHA 5K3DA 1RBZA 2XTJA 4MA5A 5FBZA 1EUCA 2CK3A 3A3BA 2RGBA 2AC2A 1I2AA 3W04A 1NV8A 1FDWA 4OYLA 2C00A 3PDUA 1TMOA 5J2UF 1EESA 4YMGA 1YZNA 1ZO8A 1BS2A 5D3ZA 1UBKS 3IERA 3NBKA 3TNYA 3ZXSA 1AQYA 1RRPA 3HVUA 4N6GA 1DL5A 3PXAA 5A4IS 1EE9A 2I62A 3KSUA 3GLTA 4GH5A 5ICSA 5LYJF 3A6PC 4PTZA 4RABA 2WSIA 2IHKA 3OEHD 4GNRA 1ZR2A 1G5TA 4EKNB 5CXQA 4K46A 4LZAA 3BC9A 1LDYA 1LLQA 1Z6YA 2KHZA 2LWIA 1C3VA 5FNZA 1RAAA 1G5RA 3ADKA 5TGDA 4JLJA 5DTJA 1Q0ZA 1W9HA 1I2DA 4GKBA 3I32A 1CQWA 1R74A 4Y6RA 4ZZ2A 5AD1A 2QL5A 3HZOA 4HATA 1LSSA 1TX4B 2CD7A 2JFZA 4IXDA 4X24A 4CUKA 2NV0A 4H1WA 3JU4A 2NTVA 1E9EA 4M1EA 4TXHA 3OKPA 1SRQA 1UINA 1L4YA 1M8FA 2Q3FA 5IVKA 4ACBA 2P91A 1WM1A 4YP6A 2X6QA 4B85A 1T0HB 1U94A 2K4MA 1MJFA 3ABOB 3IV6A 3OC6A 2ANCA 1YS4A 1ZD9A 3GA5A 1XFDA 3M6UA 3GZNB 4EY3A 1RCFA 4K7JA 1YBVA 2FF5A 3GP5A 1GIAA 4B3FX 3NAQA 4I4IA 4MIYA 5AFSA 2ZWAA 1KEEA 2QGNA 1QGZA 3SSNA 5MHTA 2LP4Y 3P20A 1H6DA 4LFCB 3SKBA 3ZU6A 1VLQA 4DG9A 3OZSA 4EGJA 1NNEA 2NPFA 2JKVA 5AHWA 1PG2A 1BDMA 1Z4NA 4P3NA 3C3MA 3DPUA 1NKTA 3QVXA 3U1BA 1UC4B 2X42A 4O29A 4W63A 3ILHA 3D1JA 4TWRA 2EL9A 2V1UA 2XB9A 2I4MA 1CJBA 3D5EA 1FQOA 3RREA 5CEFA 2PBZA 1U6KA 3IUQA 1JEYB 4KQHA 2Q5EA 5KQPA 2QI9C 3TAHA 5J4VA 3LFHA 3O8RA 4YB8A 4XGIA 3AIKA 4U00A 5L3SA 1NW6A 2LW7A 3C1UA 4TQ9A 3K94A 3ZWCA 3PA6A 4IEFB 5J4YA 4NRDA 3G5AA 2YIVX 4ZV9A 4HWKA 1KMNA 1GCIA 1Y7LA 3NC4A 3WR5A 3QE2A 1RABA 3E48A 3KXDA 3QKUA 3SXJA 3HFJA 3ESDA 4DANA 1T8PA 2ASEA 4PANA 5D3MA 3PQ8A 3UMJA 3AJ8A 1JXAA 1W88A 4L75A 1YNSA 2JH9A 1X8XA 1NUHA 4UJ5A 4I5GA 2P2YA 3RTCA 3ZK8A 3GP8A 3AZPA 1V5WA 4CKEB 4BFSA 4BB0A 2OLEA 1XHEA 2WYUA 3GT4A 4ZI3A 5BQOA 5KUTA 3BXOA 1EQ2A 2FY8A 3NH9A 4MVJE 4MGHA 1DQRA 1GR0A 2KSQA 3MAAC 4FEGA 4BKQA 2VDJA 1TIKA 5BMVB 3DLHA 3AUYA 3NAGA 2PGJA 3NTVA 4KODA 2HHHB 2AEMA 2QVXX 2WV9A 5K8IA 3ICEA 4J7CA 3HWX1 4JXJA 3ITDA 2Q9BA 4KP7A 2FB9A 3BF7A 1JRLA 1XKQA 3IR7A 4NAHA 4AK9A 6LDHA 2CUZA 3I04M 5SZIA 1XGKA 1WHTA 2PNFA 3S28A 2VN8A 3LJKA 2JCSA 1EZZA 3WMRA 4CLRA 3C8HA 1C1DA 3IE0A 1JA1A 2ZJ5A 1XMIA 1C3LA 1ZR4A 1RJGA 1Y9EA 4LZWA 1AXRA 2RKOA 3V7WA 4D92A 3D8SA 3JD2A 1E98A 2ZSUA 3E6AA 3O9VA 2FA9A 4N5IX 4R1LA 4TV9F 4Z86A 5ELMA 1JYEA 3KOXA 2VLIA 3FFBA 2UUPA 4I55A 1ZLXA 4PNHA 3E8MA 1R37A 3TCNA 4Y9DA 4IDGA 5JQGB 2XE6A 3NM5A 5DYGA 2DT5A 3OCZA 3SIXA 4EYOA 5CG2A 3VPFA 2ZUFA 2AJ8A 3Q8WA 2F3TA 2OVFA 3MGAA 3TJMA 1E9AA 1VJDA 2OHIA 4DCPA 2IHJA 3FDIA 2VA9A 4MRNA 1E20A 2Q2NA 3OJXA 1ZBQA 4E6PA 2ZSIA 1DBQA 3UMFA 5CA1F 5KTTA 5A3JA 1PVOA 4ZALA 5JS1A 4BQIA 1VP3A 3B70A 1C1HA 1G1MA 3IYLW 1CRPA 2PKRA 2F7SA 2DX7A 2PZJA 3GJQA 4NV3A 3USZA 4X07A 1QP8A 1W6UA 4LRTB 4BB5A 4C22A 4HGPA 2C4UA 2OBYA 3FNIA 4LF8B 1ZA1A 4ZEVA 2NM0A 3ZCTA 1WP9A 3K32A 2IYXA 3MWEB 1ZJJA 4PNZA 3VV2A 1EFRA 4WA8A 3CHYA 3BM5A 1A77A 1GFZA 2YKGA 3GGSA 2B1JA 4BFCA 5CW2A 4L1KA 3RVPA 3LY7A 2XNHA 4FKMA 4P7FA 2GQFA 4F04A 4YRNA 5TMPA 2QN9A 1J39A 4NAVA 3T5DA 4OXKA 2C61A 2HBRA 3LL4A 4ISCA 4AB1A 1JPNA 1EJ0A 3WBFA 4DXAA 2IQIA 1WE2A 3SK0A 3P71T 5PNTA 3D7MA 1UIMA 1H0HA 3AJRA 3BXFA 4V24A 4U7WA 5DHAA 1T43A 1EDOA 1CZKA 2QRHA 2Q1XA 3TMAA 1ZC3A 1SVNA 3OM1A 5DIFA 5LUBA 3ZTYA 1KFJB 1PS0A 5CIYA 4RDIA 4BE9A 1MVOA 3B9BA 4BNIA 1CR6A 4AJ4A 4IQ4A 2M6KA 3KLPX 2AT1A 4O4LF 3KJEA 1FSZA 3O8DA 1F60A 1ULBA 3ZQUA 3UJAA 2PRZA 1GTRA 3BMCB 1D04A 4FJ1A 1Y3AA 2E87A 4NLLA 4RHEA 3EDRA 4DVGA 5G4LA 2XYHA 5B1SA 1Z18A 2OORC 5ISMA 2MMCA 4QQRA 4OQNA 2BISA 1YITB 5JYEA 2C1EA 2N75A 3RVQA 3VZCA 4CR8A 2UU9B 3K1YA 1UQUA 1AHNA 4X7BA 5ARDA 2FEPA 2JPDA 4XLCA 1GUYA 2CJXA 4JP3A 4N3CA 1WR8A 3GELA 3FNFA 1S2DA 4CTJA 2O14A 2VK2A 4QVGA 1NRJB 4BQSA 2C8KA 5FFMA 3G8AA 5B3AA 5KYUB 4O4HF 1MRZA 3Q12A 3Q3CA 3PLAE 1M6HA 1ZD8A 2VAPA 2AG8A 3A10A 4LKRA 1RE0A 2L2QA 1OLOA 4QGBA 4TTSA 2VQ3A 1SD1A 3OG9A 1G17A 2G77B 3IA2A 3BB1A 1GV1A 4E1AA 2HU2A 4DZRA 5LVAA 2NZWA 4KDRA 4HDQB 3CUVA 3KQPA 1TZ2A 1GARA 4HEA6 5HZAA 2ZSBA 4EB8A 5B7GA 2A0YA 1DJNA 5FWAA 1N7GA 1MQAA 3FPKA 3NEJA 5DBGA 3A3OA 2W6QA 3GCZA 1VL1A 3WLIA 2EWMA 4CM9D 5LXTB 5IEBA 1A4XA 2C3PA 3DBVO 4Q9DA 1KKMA 7ADHA 1DQZA 1V9LA 1KTIA 2AEEA 5F98A 1ZISA 3AESB 2ZRBA 2UVQA 3L2OB 3HJRA 1M7BA 4MJXA 1Q1ZA 2DBZA 4RPCA 3MMZA 4MITA 2XYGA 1XMSA 3EA4A 3DXXA 1TYCA 2YZNA 1QIFA 1OW3B 2GNOA 3W5AA 2K87A 4DLSA 3NHBA 3RYIB 1AKYA 2G63A 1N2JA 5LZ9A 1VCNA 3GA0A 1AIPA 3H5AA 3I2KA 3IT2A 3RJMA 2X3FA 4AY5A 2VT6A 4KK3A 2OSVA 4UTOA 3CZPA 5IHPA 1MO6A 4LZZA 1PRYA 3SX4A 2H31A 1GOTA 6ABPA 3KKMA 1K9MD 521PA 4CV2A 3LQQA 3JWPA 2Q2VA 2Q27A 3WK8A 3QWBA 3ZVNA 3CIOA 2Z2XA 1F7UA 2A9KA 2V9CA 5L4LA 1WVGA 1N6OA 1FW8A 4MQ6A 4TTTS 4BZXA 3CXRA 1FDUA 1R5NA 1F2VA 4PG6A 4YDQA 3GRFA 2YC2C 3GFTA 5C8YB 3PU6A 1C30B 1E32A 3I5UA 3BBPA 3PFIA 1KPIA 4Q4DA 3EVDA 5AKKA 2CMHA 4CMHA 1RU3A 2IELA 2JLRA 2OKGA 3L7MA 1NXQA 4Q21A 1Y5MA 4WNIA 4LBYA 4EITA 1Q0HA 4PCVA 3LBYA 4FOLA 5IVDA 3AOEA 1ZCJA 4TYMA 1RLIA 2CLCX 4JWTA 2ABWA 1KYQA 4V3BA 3MRVA 4YAGA 3GNSA 3I83A 3PEVA 4DEXA 4L8JA 3AY6A 1GZ3A 2WFLB 2OESA 3MWKA 2O8EA 3W1EA 4PNPA 2Y93A 3OECA 1ENOA 4G0NA 1YVUA 2C82A 4EKDA 4PC3A 4CF3A 4OHMA 1PAUA 3UJ7A 4FOSA 4BDTA 5IZCA 4EG4A 5JR3A 1NW3A 4UVDA 3TKYA 5HZBA 3I9JA 5HIAA 3PDIB 4KNYA 3A3PA 3VMMA 2QYTA 4RZIA 3HDJA 1T3LA 5JBNA 4EKIA 1AB6A 2CSUA 5LB4A 4RYDA 1DXHA 1NT4A 3IOBA 1FPMA 5DPMA 1Z6ZA 3KFVA 4EHJA 1WMDA 3VDQA 3LCCA 3EVGA 5I9IA 2J7PA 2I9PA 4MQ4A 3EOAI 3HK2A 4KMRA 3S2IA 3UWMA 3GI1A 1XNGA 1BDHA 2JBAA 3PRKE 5IDWA 3E9ZA 3H2KA 3AEUB 4C4XA 2FV8A 1DOZA 4H3SA 3DO5A 1RLMA 4P80A 1R4AA 3NCTA 4DYDA 4PIVA 4CKCB 1SH7A 1EHYA 1IJKA 1FMTA 3I4LA 4KAJA 1YULA 3LF1A 5DM2A 3RSZA 3VM6A 1OZAA 2X14A 2X5JO 4K2HA 5CDSA 4P38A 4KR3A 4OSOA 3W3AA 1YD7A 2H2IA 4HDSA 4V3CA 1X42A 2M1ZA 1T5OA 3JS5A 4L8FA 5GAJA 2XYRA 2HZ7A 3RYHB 1SXJA 3OLCX 4PQGA 5KVQA 3WHLA 2UXDB 1A97A 1T9GS 5IAOA 4RHCA 4FIZA 2OTJB 4WZ6A 4RBNA 4B84A 1II0A 3LZDA 2ONZA 4N0MA 5DW0A 4ALIA 5LIPA 3OH8A 4QOHA 5E9WA 1CUCA 3GFBA 4Z4WA 1OAOC 2DFKB 4PQEA 5H83A 3PYXA 3ROPA 2C2KA 5KSOA 1Y6GA 4JHXA 3E0QA 4XIFA 4ZCQA 2WUVA 3PTZA 3K1AB 3H5IA 2DR3A 3FI0A 4A23A 2FPLA 5AM0A 1ABEA 3U7HB 5JTUA 4E94A 2QL6A 2H2WA 1TYZA 3GD5A 1JVSA 3WRYC 4D8VA 1T0JB 2XUPA 4EHDA 3PWTA 3CUWA 4GBMA 4WNYA 5B3LA 4JT2A 4ISBA 1IU9A 1N1DA 5A5DA 4RTMA 2H52A 8MHTA 3CC2B 3M5CA 4D57A 4DRXA 3LXMA 4TV8A 1JTEA 3PPVA 3B1VA 4Q9LA 4XB1A 1G3MA 5DFAA 3NOXA 3VGPA 3C7KA 1MZPA 4YDRA 5A6SB 1AUXA 2GSDA 3RVLA 1EZ4A 3M8KA 4F46A 2XEXA 3OT1A 2GXAA 1DBSA 1P6XA 3HL4A 4QQ8A 4QXOA 1OASA 1H2WA 2WF8A 4YJGB 4AMBA 1NBIA 5KSYA 5ESXA 1ODTC 4WCFB 2OQ2A 3GNTA 1MO2A 3M5PA 1DIBA 4F91B 2PGNA 3E9MA 2HF7A 2YIMA 2VHUA 4F84A 3MHTA 2BBOA 4W5RA 1F9EA 2MSKA 2HPHA 3IA7A 3NHYA 5CH3A 1BE1A 1AB5A 2G83A 2HA7A 4IF4A 4N5DA 1N92A 2MSEB 4RORA 4TL7A 1Y1SA 2CLKB 5E1OA 3CA8A 3KQUA 1GLVA 3VH3A 1XZBA 3VRHA 4A6EA 3C3CA 5BQ3A 3DLIA 1NB9A 3TMYA 4IUYA 3TRIA 2YMPA 4L2IA 4WACA 3A4IA 4J76A 1EUCB 3K0SA 3TTWA 4B3RB 3VVLA 2Q2QA 3OZTA 3SYLA 1EWYA 2LNDA 4JLOA 4MWGA 1VYVA 2XCLA 3BK2A 2A6PA 2ZJ2A 2LIVA 1G3RA 3ZWNA 4DSOA 4EKEA 3ZDFA 3CNEA 3R3JA 4J2HA 3T6KA 1X2BA 4N47A 4Q3LA 4HTFA 1H2YA 1WOYA 10MHA 2ZAYA 4AP5A 1T10A 1F9AA 4CETA 1ZGHA 2F67A 3MLEA 2VR1A 3O4FA 1JQJC 1M54A 4WUVA 3GHHA 3K9LA 3GIRA 1F6WA 1QO0D 1PGJA 1VSQA 1V1JA 2HK9A 5EI5A 1P9RA 1VHTA 2IPAB 4NONA 1ZEJA 1W5BA 4LWZA 3GVXA 1LLUA 4O2LA 2FQYA 5CT5A 3CMEB 3LYUA 2BRUC 3P94A 4OJNA 1YA8A 1SIUA 5K7SA 5IWAB 1Y89A 1E7SA 1CJTC 1LBSA 4BTLA 4L5BA 1ITZA 1J8VA 2IXEA 1XRJA 3GPBA 1E0SA 3CG4A 3HVKA 2ZUBA 4KLRA 2C2MA 4L5CA 3AGQA 4WOCA 2XXAA 1T9BA 4M83A 4F92B 3O1LA 2ACWA 5JEEA 2FQ1A 2G9RA 5KTSA 3WA7A 1H5QA 5FH9A 5IM4F 2RHMA 4NYJQ 2GD6A 3R9KA 3RGWS 3TSYA 3VZSA 5KIAA 4IUBS 4G4JA 2YC4C 3GUUA 3ES9A 1KEEB 2H4JA 3Q0IA 1XSEA 1X3SA 4BNNA 1WXWA 2G06A 2HCTA 3DKIA 3NT4A 4MLDA 1N2EA 3FPPA 3QELA 1DDGA 1U3FA 1BWRA 4UPEA 1PJLA 2BZ1A 2P3QA 3DZBA 1M90D 2QIOA 3GF4A 4KGDA 1Z9BA 4OYRA 1S8FA 5FDFA 4FHEA 2DVMA 2CLIB 3I6QA 1S4MA 1GUZA 3IBTA 5EHNA 4FLFA 2EGUA 1N6KA 1JA0A 2FFRA 5FTJA 1YZHA 2DZDA 3QMWA 1QFJA 2GYVA 3E9YA 5SICE 1XV5A 2A88A 1RZRA 3TTXA 4ITVA 5G3YA 1JHDA 2HR1A 3SXUA 2CN1A 2HGSA 3IT3A 3P2IA 4OB6A 3QPDA 3B85A 5EP2A 3BPSA 5L3SB 1GQRA 2R7AA 1IHOA 4Q9KA 4F5DA 1KO4A 4QBKA 5CLHA 1MW9X 5HK8A 2OCKA 1C8VB 5AHRA 1C7FA 3KPJA 2MSCB 3NBFA 3RS0A 3S5JA 1GTZA 1NDQA 4NG5A 3C3XA 3H4MA 3RFTA 3RO7A 2Q46A 4EHAA 5FLKA 4Y2PA 1XTVA 2PLFA 5KI6A 4F11A 5A5FA 1Y3IA 2WM8A 3BK1A 4GYYA 2DLDA 5HXBA 2WB4A 3L41A 1G8AA 2YXBA 5J63A 3G0DA 5D3MB 3GVCA 3ONVA 1MO4A 1W88B 3OY2A 2HUNA 4HAIA 4FGUA 4KX3A 3RSOA 3TZHA 3KQNA 3IULA 8ADHA 1KY2A 2DHRA 2HH9A 2VDVE 3HPQA 4AW9A 3EPHA 2YWCA 3OE7D 3H3XA 2HSJA 3NKFA 5BW8A 3HXLA 5HM8A 3DTYA 4MQBA 5F3DA 4ID3A 1PHPA 4IDNA 4K9SA 2HLNA 4RJTA 2HWWA 3AZOA 3D0QA 2VF4X 4HI0E 4IF6A 2ZUVA 3ND8A 4ZQBA 5FPKA 3L4JA 2BGKA 4FBGA 2JLXA 2EHJA 1HSOA 2AOUA 2X8WA 5AR1A 2K7FA 1XNQB 1BQ3A 3KHUA 1PZMA 5AXCA 4I1YA 4M0KA 5P8WA 2Y8EA 4UEWA 5FCDA 4B2LA 3EZ2A 2LXNA 1C7JA 3OFJA 1WHTB 1HDIA 2WOJA 3ONEA 4IOLA 2VT7A 2ZFUA 1BE6A 1GAEO 4CEIA 4XR4A 4CLRB 4MQUA 4F6RA 1C9JA 3KAKA 1C1DB 4JAVC 4L7QA 3BWDD 3NJ8A 1U8XX 3N6XA 4H0FA 4P0PB 4PLCA 4DN6A 4EZIA 2AC4A 1N1MA 4OHVA 4FM9A 1CDZA 4JQYA 1W5EA 2GJ8A 2GRUA 3B7PA 1XRRA 4I55B 4QG3A 4ZOAA 1XD2A 2SBTA 3KEWA 3CYFA 1GL7A 1FNDA 3LCRA 4QU8A 3HDGA 4KZKA 4XH9B 3RKRA 1DBPA 4ETIA 1VQ8B 5SY9A 1HNXB 1WSAA 2GPTA 3HNPA 3I5AA 3NTXA 3AR8A 3QW2A 4OU4A 4ENVA 1MH1A 2VP0A 3PE6A 1O5OA 3VTKA 3SSOA 1KJJA 1CQJA 1UOQA 3L7IA 4G5GA 2ORIA 2B7CA 1KE2A 3A27A 1U2DC 1VIDA 2C57A 1QHGA 3UGQA 4FU0A 3ULKA 5HYVA 3NCHA 2H7CA 3IVAA 5CM2Z 5FP0A 4GLJA 3RTBA 3K4QA 3MTGA 5TV2A 3ELDA 3GMIA 1QZTA 3AG5A 3PTLA 4G3XA 1ISSA 4UUAA 5DOZA 3TDKA 4YMHA 1RTKA 4WEQA 1VQ6B 4EFDA 5T41A 4OF4A 2Y9PB 4Q12A 4QUEA 3QZUA 1NSTA 4YALA 3G2LA 1RCTE 4FD2A 3L0OA 3SEZA 1XNJA 2DOGA 2DHEA 3FCXA 3OIYA 3ONWA 3GG2A 4MUEA 3DOHA 5AW7A 3UV3A 4TVSA 3HYLA 5D7BA 5IBPA 1JFLA 1TVCA 4IXNA 1L5MA 2EP5A 4HQOA 4UU8A 3D4OA 5B4UA 4BYMA 3H1FA 4Q7QA 4ASUD 1TVKA 4CR7A 1WUKS 2N1MA 2XUZA 3BGVA 2X5KO 3AILA 4DEVA 1KRHA 1UCFA 3C5VA 3FSGD 1ZK2A 1NLMA 3IJRA 2V6IA 4LOKA 4NS1A 3UPDA 4MUIA 2VBIA 3WVNA 1NUAA 2X8KA 1MD9A 4FKZA 1G8KA 3ZNQA 2XUDA 4XFJA 4B2IA 3Q85A 1DKOA 2JFHA 3S2GA 2OFOA 2IEDA 2BJHA 5JATA 1SCQA 1VJ1A 1WB4A 2B5VA 2WTBA 3C6QA 3MPOA 3R0IA 2B7BA 4KTTE 3M5WA 4EZBA 3VNBA 1GPDG 3K31A 3KCNA 1ZD4A 4HQFA 4NE2A 2GKSA 3NBUA 4ZK6A 3JSXA 1ML3A 3SSMA 4ACAA 3T34A 3Q8KA 4AJKA 3RAFC 1DI0A 4JBHA 4MHOA 1ACJA 3OCCA 1VGQA 3L0CA 4AFNA 1LBQA 3WWPA 2J08A 1Z4LA 4N8EA 1UK9A 1T1SA 2EXXA 4WKPA 5TQ2A 1V5VA 3Q3HA 2GCEA 1WW8A 1XRSB 3K0KA 3UPUA 4NOJA 3I9FA 3MWGA 4L02A 5I9TA 3R9XA 4XUGB 1B0UA 4O4JF 4OPMA 4ZVMA 1LW6E 1YTLA 1UXIA 3O03A 2ZT7A 1KYXA 3WL6A 1YZ3A 3HABA 5F52A 4RVOA 4RY0A 5ADHA 1O5IA 2WOOA 2O20A 1UZNA 3IUEA 3IVXA 3C1OA 4GI3A 4JKYA 2Q1YA 4I1SA 4W7IA 5H02A 3WYGA 3L07A 1T8TA 2H1LA 3WWYA 2H0AA 1RIIA 4N0QA 3R7DA 5GTDA 2WKPA 4E08A 4G5RA 4X94A 4DV1B 3KPVA 4WNAA 1Q0TA 3QU4A 3CCBA 1MABA 5B3JA 2BCGY 4TT3A 1G8FA 4MRRA 1DAKA 4QUAA 5JNSA 2YOGA 3QUBA 3EFBA 2CZQA 3CG0A 2A58A 2WU1A 1HYGA 3JR3A 1P80A 4GSLA 3LP6A 3G59A 3A1PA 4L4XA 5DGXA 4DFDA 3U16A 5LMUB 3ZDAA 1XQVA 4J6FA 4IDAA 3VR1A 2GQ0A 4X63A 2HXSA 1P3JA 1N0UA 1U8UA 4JB0A 3N87A 3QRWA 1I3CA 5DMXA 5TF0A 1CZNA 2HIHA 2PYIA 2YYAA 3LQRA 2BV3A 4QJ5A 5SYAA 2JA2A 3ZWKA 2AOWA 4E5NA 2WT8A 3UOGA 3PFFA 4BXOB 1R64A 3VQTA 1MN6A 1IOWA 2FYTA 3BJRA 2PAFA 1A2QA 3DQQA 4JL6A 4MWDA 2J67A 3VYVA 4DLAA 2ZE7A 5FUXA 2GJSA 2OV8A 2PMDA 1BMFA 5EXSA 1A1SA 4JMQA 3OM9A 3MRSA 1SOAA 2PMCA 3ZDCA 2IOFA 2J8ZA 3PSHA 1QIEA 3CP8A 2BHNA 3A6FA 5LXTF 1E79D 1AKQA 2O07A 2W48A 1YRBA 2R1TA 3BFVA 1JVNA 4LJKA 2ZTGA 4WBXC 2BM8A 2VQ6A 1Z2CA 4ESHA 3WLPA 3IKTA 3MCWA 2P65A 2O8EB 1UPUA 3EF1A 4DNQA 5CAEA 5M29A 1SUBA 2FUCA 4CMEA 4I6JA 4HH4A 5TJ9A 3I8OA 3WLKX 1SY7A 2C97A 3HFGA 2PL3A 4PSAA 3AMVA 3L5OA 2C2ZA 3O21A 4MPRA 5UKDA 4WTOA 4KWTA 3GEEA 2R1ZA 3RK4A 3ICWA 5F5NA 3GUYA 3E18A 2SICE 4L4SA 5GV8A 1P9OA 4EPRA 4I4CA 2CZCA 3L7YA 3EMKA 1TTHA 4FN5A 1SD2A 4JENA 2H4XA 4I2NA 4US0R 3RANA 3O8CA 2Z08A 4PC1A 4L28A 4BMXA 3KEQA 4P25A 1ILEA 2B2CA 5EWMA 1MXHA