4TMZA

Translation initiation factor eif5b (517-858) from c. thermophilum, bound to gtpgammas and potassium
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
HMNKDNLRSPICCILGHVDTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
molecule keywords eIF5B
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tmzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tmzA01
4B3FX 4DC9A 4JS0A 1M34E 2FPKA 2EIXA 2WIAA 3C16C 5E7IA 3FKSA 1ZU4A 2J1LA 4M9SA 1G8FA 1YHQB 2DFTA 3A4LA 1GDDA 4HAUA 3QPUA 4BFZA 1K9MD 4KBFA 3WBKA 1E2PA 3AP2A 1DS6A 1E1RD 1QVRA 4OI1A 3W8RA 2GJKA 1E96A 1GKYA 5CB6A 2PL3A 2ZVQX 3ECCA 4LWZA 4AYXA 4HB2A 3DKPA 4OHVA 4OK6A 3ASYA 1KI7A 3AKYA 2FFAA 2RB4A 1TLLA 3AVOA 4EFLA 3HDTA 1T8TA 3MWKA 2WAXA 3LXXA 3CC4B 2AKYA 2C98A 3TSZA 5IK2D 1G16A 4TQUS 2DPXA 3CCQB 4B33A 1Y63A 3NEYA 1E0KA 2JLQA 4NYJQ 4HSEA 1KI3A 3KKNA 1FTSA 4C0SA 2UVQA 4X8LA 3CCEB 3ZVLA 2YOFA 3THYA 3HPRA 3OHMA 2OZEA 4AIIA 1ZNZA 1AMOA 1TAGA 4QG7A 2VNHA 4BE7B 1QF9A 4E5UA 4FK8A 1E2DA 1P2UA 1I4DD 1IHUA 2BGJA 4QL3A 4PX9A 1GKIA 1W87A 1Z0JA 3K09A 4TMXA 2CLCX 2OCYC 2XGJA 2IEZA 1EFCA 4G0NA 3V4FA 2D2EA 5JEEA 3VFDA 1JR3D 2FA9A 2PJZA 1NVXQ 1E1QA 1AKEA 4KI0A 1KO5A 4RZUA 4CVNA 1HV8A 2GK7A 2ZSBA 1N0UA 3PUZA 4QM6A 4Q18A 1E4YA 4LBWA 3C14C 4HUQB 2XTNA 4Q4LA 5FI0B 4EH1A 2H5EA 1W4CA 1KD1D 1A7JA 2R6FA 4B35A 2ZE8A 3U2QA 1KI6A 4QRHA 4WW0A 4FMDB 1W47A 5FOVA 4F38A 2AHOA 2QTZA 3KQNA 2XTMA 1Q86D 4KYUA 1EXMA 5GV7A 4F4JA 1IQPA 4I1OA 3R9WA 4D4LA 2OTJB 1NN0A 5LD2C 1U8YA 3U7FB 3BERA 2BDTA 1XPRA 5G3ZA 4DLXA 1DAMA 1WBBA 4DVGA 4BPBA 1TF5A 1T9HA 3OE7D 4LDJA 4MGKR 2F3TA 5FUWA 3ZS9A 4F91B 1ZD8A 2G1JA 2ZR7A 1ZD1A 3K70C 1PV4A 1ODFA 1NMXA 2JLZA 2IC5A 2REBA 2V4ZA 5JS7A 2H92A 5H5JA 1AQUA 1YR8A 1D9ZA 2VP2A 4OK5A 1XMIA 3VNVA 2CCKA 2R6AA 1WCV1 3KKMA 4BASA 1DAKA 4ZDJA 2QTLA 2IYQA 1AS0A 4WVFA 4QFMA 5KPDA 1II8A 4LV8B 3QE0A 3KKOA 2YOGA 2KSQA 3OF5A 1KQSB 2CDNA 3DOEA 4ESVA 4OKSA 3U44B 1AJEA 1ZNXA 2CRVA 1IN6A 2CLSA 2FF7A 4K8OA 1ZAKA 4ERNA 4MYHA 2F7SA 4ZDWA 1Z6GA 1TU3A 1P72A 4QHTA 5JRJA 3T5DA 3VAAA 4DUGD 3FVQA 2D7CA 4R71A 1NJGA 1SHKA 1NIJA 3AVTA 1P2TA 1WA5A 1YZQA 4RVCA 3QKRA 2EVWX 3SZRA 4CYMA 1N25A 5TMPA 4P31A 1N6NA 3W6PA 4Q1AA 1OXSC 3CPWB 4KJZA 4LUCA 4IHQA 2QMHA 5FPKA 3IBYA 2QDXA 4D6PA 2AXNA 2OCPA 2V1XA 3W5UA 1Z0DA 5E7MA 4CDGA 1ZMXA 4UNSA 1YJWB 3PFIA 4NHOA 1K8RA 2ZU6A 4DLRA 2R6HA 2XJ4A 4TMKA 1AGPA 1YU9A 3LX8A 3EAQA 4M22A 4BRWA 1E64A 2H18A 1I4TD 5FA6A 4DCNA 4YAWA 2P5SA 2IF0A 1W2HA 2REOA 4MA4A 2RGXA 4PPFA 5DI3B 1J8YF 1GILA 3TJZA 5AJZA 1TUEA 4GPTA 1HYQA 1Z47A 3CXCB 1US8B 2DWQA 2R65A 2ZI7A 4DLVA 2NO6A 6Q21A 3U60B 1XPOA 1VTKA 2FN4A 1P5ZB 3VR4A 3NKVA 1M90D 1XTQA 4PHGA 3S1AA 5CK4A 3ZS8A 1XB2A 2QTFA 4JYBA 2RHDA 4BPRA 3B78A 2Q3FA 1F60A 1FMLA 3C8UA 3TUZC 3X1ZA 1E3MA 3P32A 1GZSA 1RFLA 4ZDIA 1YZKA 2GCNA 2FFQA 3HP1A 4QXAA 2XNDA 1VQ9B 1MT0A 1RJ9B 2BIFA 4Z51A 1NN1A 3K09C 1UJ2A 4B2PA 2NMVA 3KJIA 2QUZA 2P2LA 1JA0A 3OFNA 4HLQB 3SBEA 4BGDA 2OBNA 4JLPA 3MMPA 1KK2A 3BXZA 4Q03A 3EASA 2YWFA 5BXQC 2XXAB 3I73A 1VQ6B 1CR0A 1DTSA 1JI0A 1OFIA 4URYR 5EXPA 1ZBDA 3G5UA 3Q5DA 4LOAA 4H1VA 1F2TA 3B8HA 1NBMA 2AX4A 2GF0A 2WTUA 2OO7A 2AFIE 2CJWB 2VYFA 3DO6A 5FI1B 1KMHA 2QT1A 2YWHA 2ZSAA 3ZD7A 4FINA 1XTSA 4XTRA 4NCJA 1E2KA 3ICEA 3UKDA 4GP6A 5B64A 1KDRA 3B85A 1TMKA 2GEUA 3SS8A 2XOKA 5IT5A 3W2FA 3P1JA 4JVNA 2F55A 1CULC 3AQ4A 2ZJZA 2BMDA 1U0LA 2WMNB 1AZSC 1EWQA 4F7DA 1EX6A 2XB4A 1RRCA 2W2TA 2Z0MA 4LYHA 1MO4A 2WKQA 2ZSDA 3JVVA 5DLQC 4A92A 4B2LA 2B5OA 2CBZA 2MMGA 1EFRA 3EPLA 3KZ1E 5BW8A 8OHMA 4TLDA 1UEIA 4U5XA 2OK8A 4DQKA 2QM7A 4HYYA 1HUQA 1LVGA 2CJWA 3MFYA 4OHWA 1MRSA 1I7PA 1BQEA 2X8AA 4BFTA 4N0DA 4C4PA 4XJXA 1R2QA 2VP5A 5FL7A 4MGYR 1JECA 2G88A 1OH8A 4TLAA 3N2EA 3DL0A 5EQTA 3THOA 3VHXA 1VMAA 4AYWA 3K9HA 2OAP1 3PITA 4TT3A 4M8NE 1VQPB 3WXMA 1ELOA 1JR3E 2PZEA 3TGPA 2AXPA 3IEUA 1Z2CA 1XTRA 1RJ9A 3CNNA 1C4OA 2FE4A 2MSEB 2NO9A 5DISB 5KSOA 4ZI2A 2A5JA 3WHLA 4P3YA 1G20E 2ZRMA 1KI2A 4EJSB 3U61B 1XCPA 3RDPA 1XU4A 3Q5EA 3CWQA 3RC8A 1YJ5A 4XVUA 1XD2B 1KY2A 4NYMR 4Q7MB 4PZYA 2FDCA 3VR5A 3KL4A 4MKGA 4RD1A 2NO0A 1CRQA 3M0EA 3MWJA 3OFND 3W8NA 4RD2A 4EFNA 3GLFB 4IDNA 3ZZTA 3GPLA 5J5CA 4A0FA 1DAFA 2J0SA 1JQLB 5KSZA 2QQEA 5HZKA 1KO7A 2FU5C 1IY1A 3G6EB 2YNMA 1ZW6A 2YV5A 3QF4A 4D0GA 3H4MA 4PHHA 2QRZA 1SKQA 2QBYA 1FL9A 3AF1A 5BYJA 1IXRC 3U4QB 2XTZA 2GETA 4D26A 1S2MA 2VPPA 3ADBA 4XOIA 3AGQA 1YKSA 3QKTA 5ELXA 1RPZA 3B13B 1KZ7B 1A82A 1OHHA 3RRZA 3CW2A 2QP3A 3BD9A 4NCKA 1IOZA 3BJIC 1XEFA 1CLUA 1HA3A 1QHGA 2JGNA 3LH5A 4XD7A 3HU3A 3TSOA 4B6FA 3LW7A 4DSOA 4YAFA 4B71A 2WBLC 2IYWA 4BECA 4B43A 3K9LA 2ZYTX 1KTVA 1EK0A 1UM8A 4Q5IA 1E2HA 3C41J 1DG3A 2NTYC 2W58A 5F2EA 3ZDQA 2ZROA 2IT1A 3NBXX 2C2HA 1XP8A 3PEUA 2WWHA 4PAQA 4TTQA 5E3HA 5BWMA 4A1FA 3QF4B 1S0UA 3B7GA 5BN3A 3I8XA 4KHZA 4M0LA 5CIQA 3AUXA 4B3CA 4YMSA 1PVOA 5GVRA 3AF2A 4RD6A 4M1OA 3K0EA 4DT1A 2IYYA 1G18A 1XFAA 4YXWD 4R7ZA 1F5NA 1DAGA 1R0YA 3N5CA 4PHTA 4GMXA 4V0OA 2IWHA 3GMTA 3NHBA 2ZI5A 2VSOA 1Z2AA 1S72B 2ZJ8A 1P2SA 5G41A 5H8WA 4DWJA 1AS3A 2QSZA 4V02A 2CHQA 1AM4D 3GEHA 4FWTA 3NBYC 1J90A 4PXAA 3HYTA 3JZAA 4WXPA 1JR6A 3NG1A 2AR7A 4MRSA 4P32A 1VCMA 1KNXA 3G71B 2NG1A 1D5CA 1E9FA 2ZS8A 2PEYA 4BLQA 2ZRNA 1COWD 2RC5A 5IK2A 4M1MA 1S9HA 4DCSA 1E2GA 3NDPA 1VQNB 4GFDA 1Q3HA 3X1YA 3GQBA 4BUJA 3A1TA 2HXYA 3EZ9A 1CQXA 4URUR 4A0HA 4B32A 2QM8A 1N5IA 1VQLB 1GRRA 3K9GA 4GMDA 2GZDA 4B34A 4FMCF 2F9LA 2DHRA 1QGYA 1WBDA 3BBPA 4WA7A 3OIUA 1XDBA 4MKHA 4W5JA 4QOSA 2QAGC 3OW2B 2O8DB 3PXGA 4IVPA 4XSGA 2F43A 4HLUA 1JJ7A 4YHBA 5HR5A 4UXIA 2GBLA 1T0HB 4Q01A 1J9ZA 4DLTA 1KMQA 1MR3F 3SYNA 2JJ1A 2I1QA 3VMFA 2W83A 4PQFA 2QE7D 2QPOA 4TLBA 3GLHE 1U0HC 4JKIA 1FRNA 3E1YE 3K8YA 1N5KA 4QGGA 1ZNWA 4TTRA 3BIFA 1PLJA 2QMOA 3TUJC 3LW8A 2G83A 2MSDB 1E2FA 4ZCMA 2GK6A 4V03A 3IPXA 3CMAB 1N6KA 4ZPXA 3SFVA 3KB1A 3CM0A 3M1IA 5L3SA 1CKEA 4LJAA 1NL3A 1JJ2B 2OT3B 1UBCA 4YDSA 2QAGA 1D6JA 3KB2A 2IX3A 2IA5A 2QTHA 3EARA 5A5GA 2CVHA 3RABA 2JJ8A 1KI8A 4DCUA 2A5DA 1DO0A 1VCIA 3A8TA 4HLUC 1OFHA 3TAUA 2AK2A 4LJYA 1L8QA 5TV2A 4LHXA 4L5BA 5FBVB 3TNFA 3OAAD 4JYCA 2PCLA 2D4HA 1IY0A 1F2TB 4C0JA 1R8QA 1QHIA 1GNQA 3R7WA 1G17A 1S9DA 2ZANA 2ZRPA 2G9NA 1F2UA 2ZR9A 4F7WA 1HTWA 2R44A 5JHHB 1HQCA 4PC6A 3FFAA 1UBEA 4G5SA 4H1UA 4MKFA 3VTKA 5C2JB 1E0AA 2BBSA 3E5HA 5L8VA 3LWNA 2PT5A 2J7KA 3CCJB 2XNSA 2LKCA 1E9AA 4L4UA 1KI1A 1ZM4A 2BSAA 2ZAMA 3EXAA 4P4SB 4C30A 3ZIAA 1WB9A 1GM5A 4YMVA 2ZS9A 4V0ME 3T34A 1E32A 1EWRA 2JLWA 2GF9A 2DERA 2JLRA 3LXRA 4M1WA 3RYTC 1XXHE 1DPFA 2GAOA 4KFUA 4PO9A 4XVRA 4M1YA 5EP1A 1DAHA 2FEMA 2IYVA 3K1JA 4OL0A 4DB4A 3CCVB 1GKUB 1Z0FA 2KBFA 2FWRA 5KDLA 4B4DA 3Q72A 1DO2A 4C7OA 3TBKA 2WJVA 2V54A 3GFOA 1QG0A 5E4FA 1VQ8B 4XIGS 3CIOA 5M04A 2AWOA 2WKPA 3FMIA 1QHNA 4Q4AB 1XCMA 4HAWA 4AKEA 3QSYA 4MDEA 3P20A 4EPYA 3PUYA 2PIAA 5G53C 1J2JA 2AD5A 3R9XA 4PC3A 4C43A 3FTQA 4RFSB 4QM7A 3LDAA 4A2PA 2RGDA 4GT1A 1XD9A 3NVAA 3TE6A 1SZPA 3KXIA 1N3BA 2XNJA 4Q1BA 1Z6TA 2BPOA 3BH7A 4NCNA 4WZAE 5THXA 5EP3A 4EFMA 1AA9A 3ZVMA 1QFYA 1KKMA 3I72A 4JBXA 2AL7A 1BIFA 5K8TA 2ZI9A 4K1XA 3NEJA 1OKKD 3HR7A 2BBOA 1W5SA 2AWNA 4GOXA 3U3RA 1W7AA 1I2MA 1Q1BA 3SOPA 1DDGA 4QNMA 3RS0A 1QUFA 3AEZA 1NI3A 3UIEA 3THXB 1XNJA 2TMKA 4DUGA 1Z29A 4YC7A 3CMEB 1IBRA 3CR7A 2P5TB 4KSBA 2VRWA 2GJ8A 4HUQA 1R5OA 4JVMA 1MKYA 2UKDA 4HATA 1KK0A 3IIMA 5GJBA 4BLOA 4B74A 1L4UA 1XD2A 3LAWA 4B47A 1XMVA 5HKKD 2W6IA 4YLGA 5J4KA 1LF0A 1VCOA 2B6HA 2GTPA 1RRGA 4Q1FA 3TVTA 3CPEA 2FZLA 2BEJA 2C03A 1VQOB 2GRJA 2ZE7A 1DOAA 2WHXA 5CM8B 3RS5A 3B60A 3NWJA 1FUUA 1QBKC 5JCZA 2VYQA 2NO7A 4Q4AA 4FIDA 3FDIA 3T61A 2Q3HA 5KOYA 3AVXA 4ASUA 2ATXA 2PZFA 2ORIA 4F92B 2EFDB 3KXLA 3MAAC 1OB5A 1P61B 1LB1B 4HB4A 3CRVA 4JLBA 2I3BA 4OHZA 3U6KA 4A36A 1N5LA 1XXHB 3DKVA 4MRVA 4OQXA 2IXFA 4B44A 1YJ9B 1T8UA 1GO2A 3C5HA 3AVQA 1LW7A 2H16A 4MKIA 1W2BB 4HLDA 3W6NA 3QEOA 2GDJA 4CEJA 2BBWA 1X8JA 1RKBA 4TYPA 3GP8A 2VO1A 4TMTA 3FKSD 3IKJA 4TZ6A 2K5UA 3N70A 1KO4A 2P3SA 1W4AA 2C9OA 2QA5A 2QG6A 4XWOA 4Q00A 1XTIA 3KTAB 1XMJA 4GZLA 1ZU5A 3RNLA 1G6HA 1G21E 4RJLA 4BLTA 4YMTA 4F4CA 2O8BB 4Q9KA 4DDVA 4LPSA 1ZM2A 1ZUHA 2J46A 2J0UA 1LY1A 1E9SA 1TL7C 3UWKA 5JFGA 1GL7A 4AKGA 2WWGA 2IYTA 3HU1A 1CJVC 4HZIA 3BB1A 5H59A 2D74A 4US1R 2CL6X 3GD7A 4X8HA 1IM2A 2GQFA 1T5LA 4RZ3A 3K9NA 2IXEA 2ZI6A 5JJLA 2J9RA 4URXR 5EP2A 5L3RA 2FFHA 3F5FA 1T6NA 3THXA 3CCUB 4TWZA 2P6NA 1Q12A 1QHHB 2FV8A 1QFJA 1NVWQ 2RGAA 4V0KA 3ZH9B 4JBWA 2FX3A 3D3QA 3AKDA 1FNDA 4IDOA 4GBMA 4LI0A 2ORWA 2PCJA 3TUIC 4Q7KA 1M1YE 2HXSA 2F6RA 1IXZA 3U44A 1VYUA 3H2YA 1QG2A 3CWZA 4JKYA 3EC2A 1KAOA 1XTKA 2ATVA 2FSIA 4BFUA 3IILA 4L8GA 4IOKA 1SVKA 3BC1A 4RY2A 4JZKA 1ZJ6A 3PQCA 3BWDD 4G1VA 3NDBB 2G6BA 2DFNA 4DRZA 2JJ2A 2J7PA 4A2WA 1XEXA 4MITA 3DM5A 2RGNA 3LQQA 4PANA 5JSZA 4M9XA 3B1XA 4Q1CA 1F48A 1JXOA 4MRNA 2IWRA 4IVQA 3C5CA 4BZQA 5FBQB 4B48A 3EZFA 5G3YA 4JJZA 1E9DA 2ZEJA 4ILEA 4MYUA 3PJRA 2A7QA 4MRRA 3W5JA 1H85A 5LPNA 4FMBB 2EW1A 2WV9A 3IUYA 3X1XA 3QKSA 4PQYA 3CNLA 4E09A 4CF7A 3U4QA 1HURA 1P60A 2J7PD 3QFTA 2DYKA 4ZKEA 5B2ZA 1HT1E 2VA8A 2RGBA 2WJJA 4Z8YA 2J3EA 1QHXA 2ZXUA 1A1VA 5DN6A 2BMWA 4F93B 3TW8B 3UK6A 5KSPA 5EXTA 2QGZA 1II9A 3I62A 1G5RA 1NVVR 4QNRA 1OXVA 2A78A 4GP7A 2RGNC 3RRNA 1HE8B 3K0AB 2BMFA 3E1SA 3UG7A 1N5JA 2FOLA 3K53A 2OUKA 121PA 2IL1A 4D4MA 3OESA 1KO8A 4OQMA 4Q66C 2O8FB 3WY9A 4KCGA 1S96A 1ZINA 1W0KA 2QRNA 4FCTA 4DZZA 3GJ5A 4AC9A 5AUNB 1N2CE 1U8ZA 4Q4JB 5FPYA 5AK0A 1KK1A 2ZRDA 2G77B 2JAQA 4AY2A 2IYXA 2ASEA 1G4UR 4K81B 5FOXA 1Z6AA 5SZKB 5CLLA 2N1BA 4Q48A 4OK3A 1V5WA 3QXSA 4Q47A 5JI2E 3GLHA 3IIKA 4Q1EA 1COWA 5K8UA 1SHZA 1YZNA 4ARZB 4PPGA 1EP1B 1IN4A 2KWIA 3W2IA 2R9VA 3HJNA 2ZE6A 4W7SA 2YVUA 3AH8A 2VH5R 4DHEA 2YINC 5GADl 2J59A 2YJTD 4LHVA 1G3UA 3MGCA 4BFYA 5KPJA 3SR0A 2OHFA 1PJRA 5EUMA 3W3ZB 3GJXC 1SVWA 4NCIA 1D9XA 1P9RA 1U99A 2IS2A 1CXZA 2R6CA 3F3YA 1ZNYA 3AVVA 2FPLA 3FHOA 4FMCB 5GVSA 4HE5A 1QG4A 2H1LA 1FP6A 1XJCA 3SU8A 3H86A 1Q1QA 2YOHA 3DOFA 2AFHE 1G5PA 5HCIA 3W34A 1E98A 1NY5A 1G8PA 3U7EB 4V0MA 2WWIA 1J7KA 4Z1MD 3B1WA 2BJVA 1CJKC 3PENA 3OJXA 2VIIA 4AKHA 4LC1A 3NXSA 1SVIA 4HB0A 1UBFA 4UNQA 4URWR 5L3SB 2VLIA 1AK2A 3GLGE 1JA1A 2CXXA 4HAVA 5C18A 2OAQ1 1G3RA 3EC1A 4A82A 3NC1C 1DADA 4B3GA 2J0VA 3UPUA 1P75A 2WJIA 3TQCA 4ZI3A 1BYUA 5ANRB 2YHSA 2ODWA 4BFSA 1GNPA 1MO3A 2F43B 1C1YA 3LLMA 2FFBA 4Q19A 4ACAA 1TQ6A 4WBSA 3SHWA 1G291 3T1QA 2ZETA 4DSNA 3RSLA 4LHWA 4P33A 4DDUA 4TL9A 1SVMA 2IHYA 2CK3A 4ZCLA 2UZ3A 2VP9A 1QHSA 4P6VF 2GEVA 2QAGB 4LJ4A 4S35A 3IEVA 2FH5B 3MCAA 3LY5A 2HUPA 4Q21A 2QQ0A 1ZIPA 2UZIR 3QVVA 2PH1A 1NG9A 4Q9IA 2FG5A 1MV5A 4ON9A 4IEIA 2EFCB 1GIAA 2P65A 4GI7A 4LHZA 1Q21A 3MWYW 1RZ3A 3ZD6A 3THWB 5FUXA 5DHFA 3RC3A 4IOLA 3JQQA 1KSGA 5F9HA 4KVAA 1KAGA 3KUCA 4ITRC 2BMEA 3TR0A 4JT2A 4AKIA 3ZGXA 3KFXA 4A6XA 3C4JA 4L15A 2C96A 4TLCA 1G5TA 1UADA 3UWOA 2DETA 1FQJA 5TB5A 4QJ4A 2DBYA 2FSHA 4TTPA 4EDHA 1YJNB 1YZGA 5FTJA 4JLJA 2QMEA 2REXB 2EWWA 1KO1A 2DWPA 4M9ZA 2FEOA 2VL7A 3QFSA 4G1BA 2OFOA 2CNWA 1US8A 3TSWA 5AN9A 1KMHB 4JIMA 3GLFE 4DLSA 2BBTA 3VU9B 1FNCA 3A37A 4OYHA 2W2XA 1CNFA 1VHTA 1X8LA 3FHCB 3LV8A 2ZREA 5JJKA 2YWGA 2CMKA 3NH6A 4DT1B 4I4LA 1CR2A 2ZRGA 1JJVA 2PT7A 3B6EA 1ZCBA 3CCLB 1EGAA 5CB8A 4C0HA 4PZZA 1NJFA 4CRWB 3IHWA 1T91A 3ZZ0A 5TY0A 3A58B 1FW6A 1OYWA 1JR3A 1WRBA 2HDNB 3ZZUA 2CHVA 3S1AB 1R5NA 2D62A 5J4VA 1FTNA 4PSVA 1IJFA 1OJLA 3BOSA 4TQ9A 4LYFA 1N6IA 1U81A 4LCBA 4RFSA 4M2LA 3I8SA 2OEPA 4MYTA 2AD1A 3SC3A 4MDFA 4QKQA 1KJWA 1X86B 3DZ8A 3IIJA 5C4GB 4ZKDA 3GJ8A 3EZ7A 3DMDA 1A4RA 2IF2A 2QY9A 1SVSA 3QXJA 1MH1A 3E70C 1UDWA 4QHSA 4UQOA 5FR1A 3SJCA 3AP3A 1IN5A 3G4SB 1ZM7A 4UKDA 1VQ7B 3QKSB 3RWOA 4PPNA 3ND9A 4U7DA 2OILA 3QQ5A 3MG9A 3BB4A 1OF1A 2CK3D 1HY3A 1E9EA 2WWXA 4QGHA 5J40A 3AKEA 4TL8A 3AF4A 1E2MA 3DVLA 5FUVA 3A1UA 1E0JA 2IBMA 4EQ6B 3U3KA 1OH5A 2V3CC 1XZPA 3GJ0A 3OE7A 5EXXA 4F4IA 1OW3B 2J87A 5L3QA 2WAYA 2ZRJA 1OV4A 3Q85A 3GLIE 2X2EA 5J47A 1N6LA 1NLFA 1VCNA 2XAUA 3ZC3A 1TPZA 3B1YA 3H84A 2GBLC 3SNHA 5JCPA 3B9QA 1ZP6A 2YZ2A 4UNRA 3OEEA 3BGWA 1CIPA 3CRW1 3GCGA 3P4YA 5HCNA 5KDOA 4UNPA 1VIAA 3UMRA 4NDZA 2XSZA 1CS4C 1O87A 1KZGB 3NHAA 3PEVA 2KBEA 3QG5A 1YZLA 3CX6A 4KVGA 1UKYA 3LRPA 4OI4A 5FFMA 4CT4B 2C9CA 5DH9A 1FUKA 3PV0A 2NPFA 5KO2A 4XSHA 4OJKA 1GJRA 1BMFA 2O8DA 3CRQA 4NCHA 5EP4A 3FKQA 4TYWA 2HEIA 4GSYA 1ETUA 3C15C 3TW4A 3UMSA 2JASA 4O0MA 1IAQA 3I92A 4KXFB 2CEAA 1FP7A 5FPSA 5L3VA 1I2DA 3L82B 3T1OA 5JI3E 3T06B 4M9QA 1FX0B 4KFRA 3UATA 1W1WA 1W0JA 2HJGA 2GXSA 2OLJA 2C77A 2J0UB 2JLSA 2VSXA 2XJ9A 2XNDD 2VNKA 2ZJ2A 3AUYA 1ZVQA 4G1UC 4KBGA 3SYKA 1NN5A 5EZ5A 3X1DA 2MMCA 3VHLB 2GNOA 4A8JB 4PGOA 4POAA 1H65A 3FOZA 1N6OA 3REFA 3RS3A 1TTTA 4HDCA 1VQMB 1T5IA 2F1RA 1VDZA 4QBIA 1A8PA 2Y8EA 3WHKA 3WMFA 2WWWA 3ZBUA 4C2TA 3QBTA 2QROA 4JL6A 3BFVA 1XZQA 2VEDA 1OFUX 4PSKA 1OKKA 2WVJA 3GLIB 4KU4A 1W0KD 3BH0A 4DJTA 2HT6A 1AS2A 1KDOA 2O5VA 2ANCA 4WIAA 4DKXA 4OQLA 4U9UA 4M4SA 1HH4A 5TDHA 4E07A 2IYZA 4LBZA 3TVDA 5A0FA 1OPXA 4D4KA 4FW9A 2ORVA 4LYAA 1TQ4A 3WMEA 1OE0A 1KIMA 1E2IA 4K46A 1YRBA 2JJ2D 3BH6A 2G0TA 3UMFA 1NG1A 5HE8A 4LGMA 2O8EB 3W2EA 4TYYA 1GRNA 1WE2A 3KQUA 1TUIA 4FCVA 1OGJA 1IB0A 4PZLA 3WYFA 3O8CA 3WNBA 1K73D 1CR1A 3H1TA 1TF7A 2PEZA 3B2EA 1VG0B 3EZ2A 3FMFA 2GXUA 1P73A 1Z3IX 2PX3A 1YVDA 3M6AA 4CEIA 1GITA 2F1JA 4DB2A 3I61A 2QENA 3KQKA 2SHKA 2OCAA 4QBFA 1XEXB 3P4XA 1FFHA 2QEQA 1NBME 3A1VA 5EE9A 1J99A 4BQSA 3TIFA 1NF3A 5JWOA 3ZYCA 2Z43A 3GJ6A 1GP2A 2O52A 2ZRHA 4QBHA 3VR3A 1QRAA 2CVFA 2BKEA 1Q7YD 1ESMA 2WWFA 2B21A 3GFTA 2CLDX 3KUDA 1SXJA 4CZ2A 3WNCA 3LX5A 5DYIA 3VU9A 3V76A 4EUNA 4G5OA 1JAIA 1VG9B 1A2KC 3QJYA 2ZRFA 2G0NA 1NN3A 3PG5A 1II8B 1G7RA 2BC9A 2WZQA 4D0LB 2ZJOA 3CX7A 4JT4A 4LBVA 1M7GA 3G82C 1OT3A 2ZJAA 1EESA 3KJHA 4US0R 1A2BA 1G8HA 2JA1A 5FTKA 1BYIA 4HDQB 2RGEA 2V6IA 1HEIA 5IHPA 2ZTSA 5AUOB 1AZTA 4Q4HA 4EJSC 1FDRA 1Z6XA 3Q7PA 5KNCA 5FTMA 3EIEA 2IS4A 1CRPA 4XTCS 2XB2A 1SVLA 3D6TB 2LCFA 2WSSD 3FPAA 3NC0C 2OTLB 1D2EA 2GJSA 4KFTA 5KSWB 3PR1A 3RHFA 1OIVA 3CF0A 2NGRA 1M7BA 2NZJA 2WOOA 3Q8XB 3CRMA 5HE9A 1Z08A 4IEEA 3ZQJA 3EPKA 2XZPA 1E2LA 1G1MA 5KDDA 1T4GA 3U3JA 1E69A 3SQWA 4HUTA 2QP4A 4LHYA 1JPJA 5A4JA 821PA 1N0WA 3WBJA 4U00A 2WPDD 3K70B 2QN6A 4YONB 5FTNA 3U5ZB 2YKGA 1XJ0A 4B3XA 3H0KA 3NTUA 3QKRB 5FBWB 5CJPA 3VX4A 3KXKA 2O0KA 1RRFA 3A1WA 4X8MA 1QGAA 1NY6A 3W90A 1X8KA 4JLAA 4M1KA 4TSFD 3W2GA 2W0SA 5FR2A 2ZUDA 4IRUB 4N3GA 2ZVPX 5CJ2A 3B82A 3TRFA 1K8AD 1G9XA 4AI6A 1E2JA 621PA 1KSHA 1E1QD 2OM2A 3OIVA 4A6PA 5L3QB 3I5YA 1UEJA 5EXSA 5GJWC 2D3WA 3OIWA 3ASZA 5EE0A 3WYGA 5LDDC 2BCGY 4KITB 3F8TA 1YHNA 5DE3A 2Z6VA 4D81A 3CCMB 3A36A 4HB3A 4XH9B 3W3AA 3U7GA 4BRUA 2C78A 4I1VA 5HKKA 1FZQA 1Q1EA 1EP2B 5TXGA 3BFXA 3ZLJA 2O0HA 4GZMA 1QVGB 5H70A 3QVUA 4AYTA 4II7A 4UNNA 1DVRA 1H8HA 1N6RA 1P6XA 4BLPA 1BS1A 1P2VA 1VG1A 1KYIA 1MABA 3TAHA 4URVR 3L0PA 2DB3A 4GNKA 5GJCA 4RSGA 1OB2A 1UPTA 5GJVC 3RS4A 1E63A 5FUYA 2CNDA 4LJ8A 3Q7QA 2ERYA 5CYOA 3AM1A 5F98A 1FRQA 2D7DA 3E2IA 1FNMA 2B8WA 1Q22A 3LLUA 4DCVA 2J5XA 4PTLA 3W5HA 2EU8A 4LX0A 1ZC3A 4OQFA 1UAAA 1FMJA 1NSTA 2WJYA 3THYB 3QY0A 4FN5A 3EWAA 2J41A 1NVUQ 2V7QD 4YDHB 5EUQB 2YC2C 4P4UA 2IUTA 3LVRE 4IXMA 2JDID 3V00A 2X2FA 4BFVA 3GLIA 4BWYA 1KGDA 2QP9X 5FPTA 4GOKA 4Q7LA 3MSXA 4US2R 2OFWA 2ZRBA 2IYRA 4EPTA 1F3OA 3PVSA 3R8CA 2LWIA 2OXRA 4CGZA 4Y9UA 2F1HA 2BMJA 4FI3C 1OXTA 4JLOA 2PJRA 3AVPA 5JWHA 4A8JC 1QVFB 1G8YA 1L4YA 2QA4B 3I55B 2OE2A 1G6OA 4RKFA 5J4LA 4D82A 1NKSA 2GJ9A 4S2EA 2D06A 4JSTA 3FYHA 3E20A 3DHWC 3LD9A 4JLVA 2KI5A 3U3MA 1U9IA 3QENA 4UJ5A 3O8RA 4I81A 1W35A 2X77A 4PFSA 4Y0AA 4PSAA 2IUUA 1NSFA 4Q9LA 4E22A 2HLDD 3HYRA 5D3MA 1HQYE 3AB3A 2NPIA 2VP0A 4GDFA 1P3JA 1G7SA 5CITA 4LJ7A 2W6ID 3SHFA 2ZI3A 4EJSA 3GJ7A 1CJUC 5FPHA 1QFZA 2B7CA 2WWYA 2ZIAA 1WMSA 3I5XA 2IS1A 4DXAA 4XWAA 1GAWA 2JATA 3MRSA 3SBDA 4DQLA 2D2FA 2XEXA 3VKHA 2WICA 1AQYA 1JBKA 3SJBA 4ZDKA 2RKOA 1I4LD 2ZJBA 2O0JA 3MLEA 3DEFA 1ONBA 1KDPA 3NIBA 1Q81D 4UXJA 4PAOA 1NJID 1YR6A 2OBLA 3PUWA 2RGCA 1AN0A 4WOPA 1RVDA 1G19A 5H1YA 2JLUA 2ZRIA 4GL2A 2A5YB 2BV3A 2Q6TA 4HAZA 2BM0A 1H8HD 4IDQA 3SQXA 3OEHD 3PEYA 1NMZA 1OXXK 1P9WA 2P6RA 4DSUA 1DAEA 1DELA 2CNWD 4JBYA 3SJZA 2O8BA 4OHYA 4B6EA 2C5LA 3QF7A 3R20A 4O2RA 1SGWA 4PQRA 5KSYA 2WPDA 1EP3B 1MO5A 2RH5A 3C7KA 4IFEA 5HPYB 1W48A 5LD2B 3RS7A 4PHFA 3EIQA 2BOVA 4Q9JA 1G3IA 3W9YA 1W44A 2OCBA 2IW3A 2X3UA 1UKZA 4MGIR 5HZHA 2F9MA 4L9WA 2L0XA 4C0KA 3ND8A 4H9GA 4N1AA 2HCJB 2WM9B 1JXMA 2F3RA 2QAJA 3D7MA 4LYJA 4TMZA 4EPVA 4FWIB 2CCJA 3VR6A 2J0QA 4YAUA 3W2HA 3P26A 1LNZA 1EG7A 1QHHA 1XBTA 2A2ZA 1VYTA 4IFBA 4TMVA 3QPWA 1XEWY 1U90A 1EWYA 2EFHB 4HAXA 4ESHA 3VKGA 1E4VA 1IONA 4QBGB 3TKLA 4IJMA 3FJOA 4M21A 5B30A 4X8OA 4M53A 2C8VA 2A9KA 5DIFA 4NYIR 1XX6A 3BFKA 3GLGA 3P27A 2CE2X 2EYUA 4P4SA 1ZD9A 4I1SA 4QC2A 1M8PA 1VIYA 3K70D 2R6DA 3CZPA 3L8ZA 5EZ6B 4B73A 2DFKB 4TL6A 1JPNA 2GILA 2GZAA 1Z0AA 2VHUA 4MH0R 5FOSA 3K0SA 3B1VA 1U98A 4HAYA 4DLUA 4HZUB 4DLZA 3W6OA 4D80A 4ZIRA 3LO5A 1II0A 1Z28A 4DDWA 3A4MA 1M6NA 3SFZA 3LO8A 1D2MA 3L0IB 4EPXA 5CDFE 1LTQA 1U2RA 1D2NA 421PA 4D2IA 1U8AA 2ZYVX 2CCGA 3FE2A 2V9PA 4TZ0A 2ZU0C 3FB4A 4Q7JB 5JMTA 2VP6A 1E2EA 1TEXA 3X1WA 3VR1A 2GCPA 5FOUA 2B7BA 2Q21A 3QBVA 2XXAA 3KKQA 2JDIA 4A8JA 2EWVA 3EA5A 4C7OB 4RCYA 1L7VC 1Q44A 5C46F 1Z63A 5KYKA 2IS6A 2ONJA 3CCSB 3KQHA 1JEDA 2RGGA 1TX4B 2EYQA 3TMKA 3T1TA 2V55B 4A9AA 1GNRA 2BEKA 1GL6A 3NBZC 1CR4A 4HI0E 4HLCA 3QKUA 4ASUD 5FBLB 4A2QA 1ESNA 3BORA 1VG8A 2GCOA 3LBHA 3BB3A 4QJ5A 2GA8A 1G41A 1QDEA 3O8DA 3G0HA 3CC7B 1K5GA 3GLHB 3AKCA 3DMNA 4KFSA 3U3OA 2YC4C 3F0TA 1XXHA 3U6BA 3VNUA 4LV5B 1CJMA 3QPVA 2ZAOA 4IW3B 2GXQA 3OIYA 1OIXA 4RCZA 1SKYE 2FSGA 2VNIA 1W49A 3LQRA 1MABB 3HWSA 2BM1A 4NU0A 5E7JA 3RVBA 1OIWA 3AP1A 4N0EA 3V4RA 4MGZR 4BFWA 5JWRA 1SXJC 1TVCA 1EFHA 5AJWA 1YE8A 3SI7A 3PEWA 1W34A 2ZRCA 4CEHB 1VQKB 5DN6D 1Z0KA 2O8FA 2IUSA 3WRXC 1NBMD 1OHHD 3VO2A 4JJKA 1CTQA 2ONKA 2A5FA 3R8FA 1SQ5A 1GVHA 3ES9A 3SN6A 4NE2A 3WRYC 3CO5A 3CR8A 5IF9A 3LNCA 3QE2A 2VHTA 3HR8A 4FXPA 1GSIA 4FD2A 4FCWA 3ZJYA 1R6BX 3VO1A 1N6PA 2VHCA 1TEVA 4RFVA 1E1RA 2R8RA 2GCOB 4NKRA 1CU1A 4LJ9A 1PZNA 4IKEA 5IDVA 1KSJA 2ZUCA 3KX2A 3N2IA 2JJ1D 1Z5ZA 2BKUA 2G1KA 4EQ6A 1H42A 1OXUA 3MHPA 2PMKA 5DHAA 1OYYA 3REGA 3FPKA 3L0SA 1GL9B 3R7WB 4OI0A 1TNDA 4PAMA 3AF3A 3HPQA 2OSBA 1C9KA 4CEJB 3VKWA 4IDHA 5AUQA 1QGZA 5IRCD 4XVQA 2DWOA 2ZRLA 4QHYA 4PPQA 3T35A 4ACBA 1U9IC 5LB2A 2B8TA 2X1VA 2WSSA 2ZJYA 4G01B 1UMKA 3VR2A 2J45A 3LFUA 3RAPR 4Y9RA 2Z4SA 3D31A 1TADA 1MRNA 2BHRA 3ADCA 1W4RA 3K0FB 3I1FA 1ZCAA 3OZXA 2JCSA 2BVNA 1DAIA 3LVQE 3PCRB 4AD8A 1VYVA 3DDCA 1AIPA 4ZGNB 1XMSA 1OGIA 1Z07A 4URZR 3WP0A 2CL0X 4GRAA 4B76A 1KKLA 1JB1A 3Q3JB 4G5GA 4TYQA 4Y0VA 5DGXA 2VHQA 1RRPA 3A4NA 1FNBA 2GPJA 1W5TA 2LKDA 2ZQ5A 3AVUA 3PUVA 1BMFD 5LB4A 5HXBA 2W00A 1R4AA 1Z22A 5AWFC 2ZYWX 4JL8A 1S8FA 1T0JB 3KDSE 3QNUA 4RZ2A 1Z83A 2W6JA 4AG6A 1GR1A 3CCRB 1S4QA 1E2NA 2AKAB 2IYUA 2B92A 2QPAA 2ODBA 5FTLA 3ZVRA 1W36C 3CB4A 3OZWA 2DFLA 2Q0HA 1BOFA 1VHLA 4LV6A 5KUTA 2NOAA 1ZUIA 4P0TA 1CP2A 5AR1A 4C3ZA 2NQ2C 4TQAA 1ZRHA 1GG2A 5AJYA 1D8TA 1FOEB 1PLLA 1R0WA 3CBQA 5FL7D 3BE4A 3SDZA 1S1MA 3CONA 2OLKA 3DM9B 1UFQA 1Y3AA 1W36D 2R6GA 3RSOA 4PC7A 3CX8A 1GTVA 1R7RA 2Z83A 4MQBA 1UKEA 1YR7A 4I1UA 2O8EA 3VX3A 3AF0A 521PA 1V43A 2V1UA 1RE0A 2KE5A 2R2AA 4JLMA 3IGFA 3GLGB 4LSGA 4NP6A 3SYLA 2FGKA 5KNBA 3ZIAD 2AN9A 1JQJC 1DDIA 1P4SA 1S1CA 2GJAA 4BLSA 4AG5A 1N6HA 4KO8A 3JZMA 1NRJB 1RC8A 1XD8A 2WJGA 3QXXA 4UXHA 2OESA 1NMYA 3AV0B 5AJXA 5DI9A 4BLRA 3LA6A 2O8CA 2DCUA 1ZYUA 5TR9A 2QMUA 3EG5A 3WMGA 3CRRA 4ZIRB 2OFXA 1E79D 2ZS7A 4OQNA 221PA 4A0RA 4Y7CA 1KOFA 4QJ3A 3CC2B 3IPYA 4KLNA 1UBGA 1KY3A 1X3SA 2A5GA 1T3LA 3M4YA 1LF5A 3CNOA 1L2TA 1KJYA 3AVWA 4O2LA 5DYGA 3D8BA 3K0CC 5CIWA 4LPKA 1KSFX 2BN4A 5KHOC 1K6MA 3B5JA 3MUFA 2ZE5A 1JNYA 4LBYA 1ZIOA 1RW4A 2ZI4A 4ZO4A 3J81k 3TQFA 4B2IA 1LS1A 2H7VA 3JQRA 4RD4A 1R5BA 3WNDA 2ODEA 2FSFA 3CPJB 2VHJA 1G8GA 4QGAA 3IO5A 2GHIA 4ZGQB 1IN7A 1N0VC 2FZ4A 1KNQA 2G3YA 1H8ED 3IDQA 2RCNA 1TU4A 4EPWA 4HZUA 1YZUA 1TF2A 2XX3A 1G64A 1G7CA 3FGNA 1M7HA 3NBFA 5CLQA 1Q0UA 3UXMA 4WQMA 1E94E 3EA0A 3T12A 1HT2E 3L43A 3QOFA 3CF2A 4UAJA 3CKLA 3OEHA 2HF9A 2HJVA 1FQKA 1PLKA 4OI2A 5GV8A 2VF8A 4LRWA 2RMKA 4DCTA 4BZXA 5F9FA 3BAFA 4NYJR 2Z4RA 4B3DA 4MRPA 3IQWA 4UJ3A 3X2SA 2Z5FA 3L2OB 5CYPA 1IN8A 1DBSA 4OHXA 1Z06A 4MYCA 1EFRD 5JZVA 2PLRA 4V0NA 2FGJA 2N46A 4WXRA 2ZR0A 1RYFA 4A0GA 1JEEA 1SXJD 4TSFA 4KV9A 2F1IA 4IXNA 2C04A 2WKRA 2EFEB 1WDTA 3FMPB 4HE6A 1E0SA 1M74A 2W0MA 1GWNA 1GAQA 1CBUA 3SE0A 4C0QC 4D25A 2OK7A 2NZ8A 1F2UB 4PO1A 4W5WA 3I56B 1B23P 4AF6A 1P7CA 2BCJQ 3L0OA 3UANA 4U02A 4Q02A 1XF9A 2IK8A 5E95A 4D0NA 3L8YA 2C9YA 2W6JD 3MD0A 4RD0A 1GUAA 4MUBA 5FBRB 2H8KA 3MJRA 4CEHA 1SM4A 1WXQA 3O47A 4B75A 2PMDA 3TR5A 1U0JA 2IYSA 1GAJA 1E9RA 3V9PA 4DIEA 1Q57A 3THWA 1BO6A 1WQ1R 3QFRA 2A30A 1JALA 1OSNA 5KU1A 2N42A 4KODA 2HMAA 2FJUA 2GVZC 2Q3MA 3RLFA 1E99A 2OG2A 2QT0A 1BX1A 1DEKA 1PUIA 5B58C 1UKVY 4QGFA 5BQ5A 1E2QA 1Z0IA 2XSZD 3CZQA 2ZITA 2GKSA 2QNRA 2QEXB 3B1ZA 4IOMA 5JRZA 4FMDF 3IBGA 1W46A 2GAAA 2ZRAA 2H17A 4C0BA 1Q1ZA 2A3RA 1OH6A 3GJ3A 3RANA 3BK7A 3TLXA 2QSYA 3LBIA 2BWJA 1KI6B 5DSZA 4J0QA 3CD6B 4DSTA 1ZM3A 2RHMA 4IDPA 1RYHA 3CUEF 3KKPA 5C1BA 4PO8A 4TN1A 2OXCA 1W36B 1NLYA 5HTKA 4WZ6A 1LV7A 1IY2A 2QORA 2BGIA 4ZCIA 5EE5B 1YIJB 2P67A 1QHYA 3QEJA 5EMNA 4CW7A 4OJQA 2QU8A 4XWKA 1N8RD 1MOZA 4ABYA 1QH0A 4YAOA 3KTAA 1IXSB 1T3SA 1QUEA 4TMWA 1NVVQ 1J8MF 3GEIA 5KTYA 1H8EA 2Q9CA 3CF6R 3OZVA 4EIWA 3T5GA 2H57A 1HE1C 1F6BA 1LFDB 1KK3A 3DPUA 4NPHA 1E9CA 3JQPA 4NBSA 1NIPA 5C4MA 4EKDA 5H68A 4P4TA 4YMUA 3K0AA 4NYIQ 4RZXA 1R0XA 2HCBA 4C2UA 5JEDA 1VECA 1XWIA 4Z54A 5K8LA 3FFBA 3EIHA 1TQDA 4NL4H 2XOKD 4A15A 3A6PC 2GEDA 1WP9A 2HYIC 1D1NA 2ZPTX 3QXCA 4AWXA 4GOJA 1QZXA 1BJKA 1SULA 3O8BA 1UDXA 3OAAA 3LVBA 1TQ2A 1JAHA 1W0JD 1DE0A 2HLDA 3ONWA 5JLJA 3CRZA 1MO6A 2I4IA 1CEEA 3T1VA 1Q20A 4V0LA 1FNNA 2GXAA 4TL7A 1UF9A 2XITA 2ZRKA 4E03A 1KI4A 4DDTA 2JIZD 4G5QA 4PC1A 2IEYA 2P6UA 3BS4A 2WJHA 4IOJA 1E9BA 4BZPA 2QL6A 1BX0A 4DEYA 2E1RA 1BKDR 1EFUA 4TYNA 2QBYB 2EFGA 1XEWX 1X1RA 4G3XA 5D3MB 5UKDA 2C99A 2HT1A 4Q4HB 4JLKA 1XRJA 4I99A 3TK1A 2GZHA 3EZ6A 5FOTA 4NH0A 3QUSA 4R2HA 2O8CB 4RKEA 1NKTA 2DEUA 2WMOB 4N3NA 1RIFA 4A4DA 3B9PA 2P0EA 4IVRA 1Q82D 2E9SA 4LJ5A 1SXJE 3GLFA 2NIPA 3MJHA 5DI3A 3ADDA 2PZGA 2VSFA 4MUAA 3CH4B 1G3QA 2GWHA 3MWLA 4Z1MA 4O3MA 1DG1G 4EAQA 3FMOB 3OEED 2JLYA 5D3QA 4AURA 5P21A 1SXJB 3ZVNA 4Q9HA 1NLZA 5BN4A 1ZM9A 4LY6A 5J4HA 1S3GA 3IQXA 3W5IA 3LBNA 2VF7A 2IYLD 4M1SA 5J4YA 5CK5A 3EW9A 1EX7A 4HEJA 4YXWA 1Z6YA 2CE7A 2QPTA 2JLVA 2CL7X 1F20A 3IO3A 4LZZA 2JLXA 4B3BA 5JHGB 2XNCA 2ZUBA 1J70A 3VQTA 3IHLA 2NO1A 1OLOA 2W2VA 4AK9A 4LJ6A 4JVLA 3RRYA 4C0LA 5KNDA 4R98A 2QE7A 3GFPA 5BYKA 5JSZB 2I1VB 1K5DA 1CNEA 2CHGA 2QTVB 1QVAA 1YQTA 2R62A 3T15A 5AUPB 5LBIA 1E62A 4EPRA 3EPJA 1NP6A 2Q9BA 1OH7A 1AKYA 3ZBTA 3Q9LA 2Q9AA 1ANKA 4Q4JA 4NTZA 4XD7D 3KFVA 3SEAA 1XPUA 4RD3A 1YR9A 2HV8A 4OBEA 2PBRA 4CIDA 3KJGA 1NNEA 3K0FA 1GRQA 2ZSFA 4NZYA 1B2RA 2PX0A 1E6CA 4YQFA 3I4LA 3GJ4A 2HF8A 1Z8FA 3EWSA 4KAXA 1XJQA 1DARA 5G40A 3OJWA 3AGPA 2V8OA 2OV2A 1P62B 1G4AE 3RWMB 1S3SA 2XZOA 2V6JA 1EFTA 2FMXA 2JEOA 1OFTA 1BH2A 3TH5A 1CF4A 4BFXA 1O3YA 3U7HB 2VQSA 2YYZA 1FPMA 3KJEA 4WAUA 3FHTA 4TLEA 2ANBA 4CT5A 5BN5A 5FOWA 1YZTA 3A1SA 4DLYA 1W2GA 1GOTA 3ICQB 1XCGB 1GFIA 1QX4A 4KYIB 2ZM5A 1X6VA 1Q3TA 1KI9A 2IXGA 3R9IA 4NYMQ 3WP1B 1E79A 5DO9A 4C0AC 1JB9A 3WYAA 4O25A 2EQBA 5F3WB 2E87A 3PUXA 1G7TA 5FH9A 4JLDA 4HDOB 2HYDA 1KRHA 3GEEA 3HU2A 4ARZA 2ZYUX 721PA 3QI2A 2X19A 5AJVB 5FL3A 4DBLC 5K8IA 1XTJA 1ZUNB 4DIDA 1XE1A 4Q1DA 1U94A 3SJAA 2WSMA 4TT3D 2FNAA 3ADKA 5CDFA 4M1TA 2VP4A 2QI9C 2OBMA 3JVUA 1M1KD 5SZHB 4YMWA 2KB0A 2YWEA 1A5TA 2ERXA 2IHBA 2QGNA 2WIBA 4Z8XA 4JL5A 2DY1A 4NONA 1VPLA 3QXHA 3RS2A 3RRMA 4C9BA 1KHTA 4DLWA 4L16A 2VZLA 5JS8A 4CEIB 4D4JA 5DNYB 2FPMA 5TARA 3ETLA 3BRWD 4YALA 2ZSEA 3QFCA 2GVDC 5B57C 3OZUA 3I3SR 4JMPA 3CPHA 1T3HA 3K0CA 3NH9A 5CM9C 4PC2A 1VQ4B 1R8SA 1VKJA 2VTKA 5JECA 1SVOA 1YITB 1SKYB 4WZBE 3CLVA 1B0UA 5SZJA 3EPHA 5EE1A 4AF7A 3QIAA 1R0ZA 2VNJA 2JIZA 4W9MC 2RC6A 2ODNA 1YRAA 1W4BA 5EE3A 5SZIA 4JVSB 2WOJA 1IJEA 4G5RA 3QG1A 1YI2B 3UG6A 4R2IA 1KDTA 2C95A 1P9NA 1PUJA 4W5HA 4JSYA 4NMMA 4DEXA 5JBQA 3I32A 2GESA 4KSCA 2PLFA 2V7QA 2BJWA 1WF3A 4LC0A 2VBCA 1G3MA 1AGRA 3PIRA 4JLNA 1KJZA 3AVYA 2BF4A 1VQ5B 2MSCB 4LK2A 1CJTC 3ZQ6A 2QZ4A 4L9SA 5EJEA 1X1SA 3FWYA 4KLZA 3KQLA 4BEJA 3W5VA 2KJQA 3EX7C 4PR0A 2RAPA 2DR3A 2ECKA 2ZJ5A 1M2OB 1GVNB 4ZV4A 1R10A 1LS6A 2AK3A 5JJIA 4R9UC 4BEBA 1NDHA 1FX0A 2XZLA 3CH5A 3DZDA 1KC8D 1ZC4A 5TVKA
chains in the Genus database with same CATH superfamily
1D1SA 1E5TA 4X1YA 4DC9A 5CH8A 1XYYA 4QPCA 4MUMA 3FNGA 1NXXA 2FPKA 2EIXA 3WJ1A 4CIBA 1VB3A 1GGEA 2DPHA 2VPXA 3G2IA 3Q41A 1UANA 4LQCA 1HNZB 2RKBA 4Y2SA 4Q3DA 3K72B 5KTPA 5ESWA 2LGJA 4G4GA 2GO1A 1NRXA 1ZCZA 3QPUA 4HAUA 4BFZA 2Q5OA 3WBKA 1L5MA 3AP2A 2VG8A 4DDHA 3R1IA 4KMMA 5KTNA 3HDYA 2PL3A 2FXVA 1E2UA 2CKMA 3ENZA 1WHSB 4LWZA 4AYXA 3DKPA 2HA0A 3COSA 4YROA 2BFFB 4YP5A 2G9VA 2RB4A 4U6QA 2JCBA 2OBXA 3AVOA 3JD0A 1BFUA 1ATIA 1Y6QA 1U0RA 3UGTA 3OQHA 2NZUG 5HFJA 3O2NA 5BSGA 1KS2A 4P34A 4OXQA 3W8DA 4FGJA 2WNHA 2XRZA 3DT9A 2FPPA 3BILA 2Q6LA 2O5RA 3D59A 2DPXA 2CVOA 2X3FA 1MB0A 1PS8A 2YN4A 2QN7A 3E9QA 4NYJQ 4HSEA 4Q24A 1NXOA 3KKNA 3MQ4A 3U7JA 1U3DA 3DHNA 3G59A 3L7JA 5AIBA 4LJRA 3THYA 4LZWA 4AZVA 2PLWA 3JYLA 1PVVA 2GUWA 5ECDA 1ZNZA 3O8LA 5EWJA 5E6UB 3EMVA 4D9GA 2HA5A 3HKCA 4BVLA 2GBIA 3PEEA 5TPWA 1K86A 3ICOA 1RLOA 3OJLA 5E3JA 1RC1A 2P9ZA 4TMXA 3IQGX 3E5MA 2OCYC 4TGLA 5DNDA 1EFCA 3KPJA 1UINA 4FYWA 3MOIA 5JDCA 4TXMA 3BZUA 1PTJA 1JR3D 1C4WA 4OUDA 1NVXQ 3LRXA 2XDYA 1OCEA 2ZUFA 1N0UA 3A6KA 5CAEA 3KE9A 4PBSA 4L5AA 3MCTA 5D01A 5K3FA 3R7NA 4XGKA 3C14C 3GNLA 2FDRA 1QVVA 4JU9A 3SK0A 2AV6A 3ZQ4A 1NW7A 1DCTA 4Q12A 1ONNA 1U0SY 1JA9A 4U7FA 2GN0A 4JWKA 3U2QA 5CU7A 4YAEA 1IULA 2FPPB 1T29A 3MAJA 4NSNA 5CD1A 1W47A 5KTSA 2ESRA 5FOVA 3D26A 5K6RA 2ZT7A 2AG0A 2I6TA 3KQNA 2Z58A 4KYUA 3GUVA 4I1OA 2QZPA 4PX2A 1NN0A 1DP4A 3U7FB 4KVFA 5JCOA 3I42A 2ZK7A 1GARA 2KLBA 2BDTA 1MMFB 3LCUA 2V6FA 2D0PB 2FE1A 4FNAA 1UPBA 2FWNA 1V0EA 4DVGA 5EJFA 1WBBA 4RIGA 3GXBA 1T9HA 3CLRC 4LDJA 4MGKR 2I3ZA 2QUJA 2ZR7A 1ZD1A 2I65A 1ODFA 1NMXA 4UFPA 2JLZA 3R3WA 2REBA 1R37A 2RH8A 3Q0EA 2SICE 4MUXA 4G8CA 1VLQA 3I9MA 5KC9A 3NBMA 2LTAA 1L9XA 3CZ9A 2AYYA 3RFVA 4K28A 1ZAYA 3UUEA 2F8SA 3E9DA 2QTLA 3NV9A 3VNSA 1AS0A 3S29A 1LTHR 4E14A 4MR7A 2YOGA 1CQPA 3OF5A 4FKZA 4BZWA 1XDGA 1ZKDA 2CDNA 3FDZB 4OKSA 4Q4DA 1HOXA 3Q9UA 1ZNXA 1ZVMA 2C29D 3E27A 3QWIA 4UEOA 3WYCA 1X7GA 2N3ZA 2D0DA 2CLSA 2J6HA 1ZAKA 2E37A 1KVSA 2QD1A 3USES 3ZDXB 4CIWA 4KR2A 2XBMA 4QHTA 3SJUA 3KCQA 1BS2A 4LWPA 5JAOA 3IUQA 1DHRA 3Q3IA 5LFAA 1NIJA 1YZQA 1XJ5A 2XUIA 3O1LA 3MQFA 1XZKA 1ICEA 3DGFC 4EAAA 1REQA 1MO2A 4CYMA 1N25A 2ISQA 4I4TF 4LHSA 4AU1A 1ECPA 2H1SA 1CB7A 5TMPA 2RE8A 2DULA 1I0LA 5DBGA 2TECE 5DTMA 1M67A 1ZD3A 2HSEA 2MSWA 3PUHA 2QMHA 4CTKA 1ODIA 2QDXA 1PBTA 2AG1A 2IXDA 2J08A 2OCPA 2QHXA 2V1XA 3L7DA 3P9SA 4LQ4A 5J2UB 1P1FA 2W7TA 3R5TA 5IAAA 1ZMXA 1KQGA 1IH8A 2DUNA 1ZWLA 4O4JA 4CUKA 1OBCA 4CMAA 2SBTA 1YB5A 2JD1A 5AVZA 2R8EA 4KDCA 2R6HA 1MENA 4Z7NB 1OYOA 1W36C 3WGLA 3LX8A 4E5NA 4UUBA 3VYRB 3ZVKA 1EJ2A 4M22A 1RJFA 1QIHA 4B4WA 2GF2A 2R4UA 2Y66A 1I4TD 4MLZA 5FA6A 3O1JC 3VOSA 3LWZA 3ER6A 2Q3LA 2GLUA 4PPFA 1PQYA 2ZQZA 4C08A 1J8YF 1GILA 2YYAA 1KVTA 3G5MA 1L9KA 1TUEA 2C2GA 3PGMA 5D2CA 5AJZA 2H9YA 2WHPB 3EULA 3Q6MA 5JAZA 2R65A 2DWQA 3INTA 3ZN2A 3GAMA 5ICEA 4Y3UA 3HXOA 1A9QA 5CK4A 2XD9A 3SSMA 1ACJA 4I55B 4JYBA 5DK4A 1K9SA 2QJWA 3C8UA 3S68A 3X1ZA 3OKXA 2XE7A 1GZSA 2Z3ZA 1Q14A 3GOHA 3I2GA 2GCNA 3P32A 2P2GA 2EERA 3HP1A 1TMGE 3H5RA 3JATB 3K94A 4QXAA 2I9PA 1C9YA 4FYIA 3GEGA 4HDAA 2HJRA 4B2PA 1UJ2A 4ZEXA 4XN3A 2P0YA 1P1CA 3L7KA 3O0DA 2NMVA 4XX1A 4DV2B 4RPDA 1D1QA 2C1XA 3KYIB 3L4BC 3NIDB 2OBNA 4MLPA 3CWCA 3SNKA 1YQGA 3UCXA 4B3TB 1XWWA 2EJVA 5ITWA 2ECPA 1BFKA 3QVMA 3EASA 5DYWA 1UD8A 1KAEA 2ABWA 4EYQA 2XXAB 3OJOA 4UTXA 3NNSA 1GAEO 4RU1A 3NEAA 1ZBDA 1QGOA 3WK5A 4HR7A 1N1DA 3SM9A 4U8GA 4LOAA 4H1VA 4ENRA 2PQ6A 5KQRA 3B8HA 2GF0A 2HPHA 3KEFA 4IMJB 2WTUA 2A0YA 2AFIE 3RM3A 3LUKA 4RIEA 4ZQIA 4GW3A 4UVGA 2JVJA 3GEMA 1VB5A 2A1IA 3PNKA 5LYJB 2QYOA 2WM8A 1O89A 1KMHA 1LK5A 3JWEA 5ARDA 1UC9A 2YWHA 1XRNA 4J9UE 3RFUA 3SC2B 3ZD7A 4C7KA 4XTRA 2Y9MB 1EZZA 2YVAA 3HLTA 3M81A 4I55A 3G2QA 4GYYA 4LJKA 2AZMA 2ZIVB 4L0QA 1BWSA 1AHNA 4NMXB 5I8WA 4G24A 3E84A 4AVZA 5HZBA 1KDRA 2C1ZA 3B85A 2CF6A 4ZI7A 3GLTA 4P25A 1WTHD 4ZU3A 4IAOA 2ECFA 5KMGA 3P1JA 4Q3OA 2B1RA 2C61A 3ADPA 3BFPA 1Z2PX 1U0LA 1H6CA 2B25A 4Y1FA 4EB8A 2X5OA 4F7DA 4I3FA 4RDKA 4QTTB 3A2KA 2RG1A 1R4NB 4O4JF 1RRCA 4ZICA 2FUEA 4B2LA 3A7EA 3TTTA 3B9BA 4WACA 4EUSA 1C4XA 1PF7E 3NALA 1P2BA 1CEYA 1VQ1A 1PJ2A 1UJBA 2ZSJA 4H2DA 3KZ1E 4MUIA 3O8QB 4QDKA 3MWEB 4ZVOA 3ZJUA 4BU0A 1UEIA 1XTTA 3HJBA 4U5XA 4BUZA 4XLFA 1C41A 2QM7A 3CX4A 4DV1B 1HUQA 3GRFA 1JHQA 2WU1A 2X8AA 2OZLA 3OM8A 4HNAA 2ONZA 4HG2A 4N0DA 5EJ5A 1ESZA 2VP5A 2R7MA 5HIIA 1LJ8A 2AQ8A 3G49A 1FFSA 4F97A 2YYSA 2ADOA 4HJRA 2NU7A 4RELA 2AMVA 1OH8A 3N2EA 3SEJA 1IY8A 4KQEA 4ROSA 4CPDA 2YICA 4TT3A 1QVZA 4M8NE 1VQPB 3U4CA 4BO9A 2PUTA 1ELOA 4WH0A 2QVLA 3TGPA 2OCLA 2X3YA 2I2XB 2W70A 4W8HA 1XQWA 4K0RA 2EV9A 2FE4A 2MSEB 2NO9A 2ZZMA 3JWJA 1CY4A 2A5JA 3DXYA 5EMHA 4LRQA 2UXBB 3GROA 3X2EA 1NU8A 1ZGHA 4HS4A 3DAFA 1QYVA 1YJ5A 3U7IA 1KY2A 4Q7MB 2WD7A 4N01A 4KP7A 3CZ5A 3RRXA 4DDKA 2NO0A 1F51E 3E3NA 4NBWA 5BOSA 3B52X 3GRVA 1QOPB 3GLFB 2UUOA 3AW8A 1F0NA 1VE1A 1HFKA 1LWNA 5TQJA 3C5WP 4DRYA 3I0MA 3LCCA 2R97A 9MHTA 4FZJA 1N3YA 1XVUA 2AEMA 4PHHA 3AFHA 2DG2A 5AKJA 5MDHA 1RXVA 2PGAA 2QRZA 4HDSB 3GVHA 1LTKA 3KRTA 4N5HX 1R0BA 4FYVA 2W2PA 4GM0A 4P83A 5EIFA 4EQZA 2FEPA 1CK4A 4CFYA 3M6WA 5BYAA 3QVOA 5DS0A 1S2MA 2VPPA 4BIIA 4XOIA 4BNKA 5ELXA 3WSVA 5JPCA 3D8SA 1OHHA 1A82A 4CM4A 4AMBA 4NCKA 3DMGA 4BX0A 4N8DA 2CXHA 4WLOA 1CLUA 2JGNA 3URKA 3HNPA 5JCZA 5EEGA 3WGGA 3BC9A 3LW7A 3G0IA 4B6FA 4Z4CA 3EEIA 3NETA 4B71A 1PD1A 3FZGA 4RKQA 1V16A 3B8EA 4BECA 1AA6A 1H1LA 3L4KA 5D8DA 4U7PB 3FRHA 4B43A 1T36B 3GVXA 3K9LA 3RUDA 3AERB 4KZKA 4IWXA 3C41J 1Y4UA 4KH0A 4ZAZA 2JAPA 3COYA 1X1EA 2VH2A 3DL2A 4GXRA 2WI8A 3ZDQA 4YIHA 5J3OA 3N39C 4HFNA 2BY4A 1RTTA 1GGMA 1LDEA 1JDBC 2JGJA 3DZGA 3UMYA 2WJ6A 4ZEWA 3B7GA 4LMBA 2PIDA 5KX5A 4MV4A 4GNRA 5BN3A 1XZAA 5LOVF 3VM6A 3EVCA 5JT1A 4YMSA 4NBUA 4YP1A 1NNI1 1CT9A 3LYLA 4RD6A 3U4AA 5I9NA 3KG2A 3HK2A 5GZ3A 4DPKA 4YIKA 4R7ZA 4CVNA 3ENVA 4CTJA 3E9YA 4ZTZB 3CEMA 3F1KA 4V0OA 1A8IA 1TYAE 5JOQA 3FDFA 3PIIA 4OYYA 1IPHA 1P2SA 1BA3A 2GS9A 4ZFNA 4D41A 1KZ6A 2WEKA 3GEHA 4LOHA 5DCUA 3NJ4A 2XKKA 5DB4A 1HRDA 4PXAA 3HYTA 1QHEA 4WXPA 2F4VB 4UBKA 5KKAA 3HTXA 3F3KA 1I4OA 1QCCA 4EO9A 3I0ZA 3SYMA 4G9GA 1YRLA 4FGWA 1L4BA 3G71B 4KJXA 1D5CA 4P32A 1QO0D 1D6SA 4YCLA 4GQIA 5ALWA 5SY6A 4UE2A 4BLQA 2BKAA 1Y1RA 4LXTA 4RQTA 3M3DA 1JT2A 2A14A 5F7XA 4RULA 2HBZA 1A1SA 1Q3HA 2WYOA 4D8WA 2P6OA 1ISMA 5TGZA 3A1TA 3E3AA 1CQXA 3HVHA 4A0HA 3TO5A 2ZL5A 1VQLB 3IQZA 4IJKA 3OP1A 2O4UX 3NS7A 4D74A 2GZDA 3NT2A 1E3LA 4FMCF 5AM0A 2DHRA 1WBDA 4KR7A 1JQEA 4GSYA 1C1XA 4WA7A 1C7FA 3AM3A 2RHRA 5ERGB 1XDBA 3VSCA 1Z7YA 3WLJA 4IJQA 3OW2B 4O4HF 4X54A 1RQ7A 4N7JA 4CLDA 2O8DB 3DS8A 1HSZA 4RPKA 3PSAA 1O97D 4IVPA 3SR4A 4HLUA 1NW6A 2IU3A 2B36A 4EG5A 1UZMA 4RGBA 3BMCB 3F9RA 3SYNA 2ADFA 4CV0A 4XDGA 4WZKA 2G5GX 2I1QA 3HB1A 2OZPA 4FWBA 4OG2A 5JXGA 3T5PA 4OXXA 3HCEA 2QPOA 3N9IA 3ND5A 1L5RA 1U0HC 4L85A 4CE6A 4JKIA 5TNXA 1FRNA 3E1YE 3ZXYA 4J1SA 3SLKA 2M6SA 3I04M 1FP1D 2QMOA 1G8AA 3QQPA 3TUJC 3EPRA 2HA7A 3WYNA 4ZCMA 1PL0A 1TCBA 4MS1A 5BQPA 1CZLA 4WY5A 2JIRA 4V03A 4Y2VA 4AJKA 3AJDA 3KB1A 1WVIA 5L3SA 4RSMA 1UXKA 5JG7A 3HB5X 1DWOA 4UPVA 1GA4A 4CF3A 4XKWA 4GDMA 3Q3EA 5AM4A 4LDAA 5IUNC 2IA5A 1EE1A 3EARA 3PEFA 3D6VA 3CVVA 2CVHA 3RABA 2E6KA 1VHWA 3AL2A 2I87A 2A5DA 3GN1A 1NVEA 1VSQA 3A8TA 3NHJA 4HLUC 1OFHA 4FYMA 5TIIA 1RXCA 1BC5A 5HRAA 1OI7A 4L5BA 2AFHA 4JYCA 5EFOA 3AF6A 1WO8A 4BRZA 4C0JA 1R8QA 2CLHB 2J4FA 5AW4A 4ZALA 3F4LA 2Z8XA 4C7VA 1FJXA 3MTAA 3U37A 4F7WA 4PC6A 4J3FA 1UBEA 2JGKA 2ZT8A 3QBJA 4MKFA 2W5UA 3FGZA 4L2IA 2AR9A 1ECGA 2CVQA 2WC1A 1TVMA 3FIUA 1EBBA 3ICPA 1OILA 3JZIA 2XNSA 3FNRA 4PAWA 1EUCB 2BEUB 2LKCA 4RKYA 1E9AA 1COZA 4JI5B 2FMTA 5AXDA 3ZIAA 2ZKIA 3UMJA 4YMHA 2ZS9A 3D6JA 3QI7A 3T34A 1E32A 1QH8A 1EWRA 1QFSA 3MN1A 1OBOA 2DERA 3O1HB 4EZEA 4GQNA 2ON6A 4GLLA 3RYTC 2QXTA 4Y2GA 4GPAA 4G1CA 3TIGA 4E31A 4MRMB 4XVRA 3VDNB 5K09A 5KQPA 5JO0A 1DAHA 5K6AC 1D1PA 1USIA 3RREA 1GA6A 1C7IA 4IHJB 2ZIXB 4C04A 4F06A 2FLVA 4DB4A 3CCVB 1GKUB 5KDLA 1XVAA 3KAKA 4EL5A 3UMVA 4KRGA 2V54A 4EM6A 1WCIB 1RM3A 3K32A 3IDZA 4PWYA 2GCGA 3PQEA 2AZTA 3CIOA 1V9LA 5M04A 1LUAA 2QMZA 3RUPA 1U0OC 2AR0A 1MIHA 1J06A 2B4YA 1QHNA 2VRBA 4CMEA 1JBQA 3OWXA 2YTZA 1GQRA 1IEWA 4D8UA 3RHTA 2AI1A 2UZ1B 3S99A 3PFBA 4AKEA 1KHHA 1GPJA 3PUYA 1J2JA 3CN7A 1AZLA 4C43A 4RFSB 4CM5A 4RHYA 3WFZA 2H07A 2GD1O 3EFHA 3LDAA 4ENUA 2XTJA 4TTPA 3CU5A 3QEKA 1XD9A 3NVAA 1QPGA 2J09A 5CG2A 1EZ1A 1ZHFA 1FTQA 1LCIA 2B8EA 4CL3A 4M1OA 2BPOA 3DTVD 4NCNA 4J43A 5K6AA 1M33A 1UXIA 3H87A 4YGXB 4EFMA 2BL4A 1QFYA 3I72A 4CLOA 2VHWA 4JBXA 5IBPA 2B2CA 1HFEL 1BIFA 1UOQA 4WPGA 4IUCS 5DHQA 3HG7A 5C1DA 4K1XA 3NEJA 5L4NA 1OKKD 2J4CA 4L02A 2BBOA 2DR2A 3S1SA 3N8GA 4QE3A 3HVIA 4QNMA 1TK3A 4S0ZA 3RS0A 3SKVA 3AEZA 4RNDB 3LZCA 1R9GA 3CLKA 2NVUB 3NYQA 5EKXA 2CHFA 4QAJA 5DBOA 3JQ8A 3OJFA 1M34A 2ISCA 4K9MA 2XVYA 4YC7A 3H4IA 3CMEB 3MCWA 5MN6A 2P5TB 1LSJA 4EI8A 4HUQA 1UK7A 4CNBA 3AOEA 2ZJ6A 2X8JA 2UKDA 1BMDA 4XYBA 4G0VA 1O0BA 3IIMA 3ZK7A 4YREA 2I3DA 4BLOA 4K9PA 1W6RA 1L4UA 3LAWA 5ADHA 2FPSA 1T4CB 1MQ9A 2PQMA 4BQNA 4PZ0A 1VCOA 4QUGA 5HW0A 1RRGA 5A2GA 3OCXA 3P9PA 1HE5A 3ONUA 1VQOB 1IL0A 4PIMA 4JBIA 4RY8A 3L8CA 4UEWA 5L4SA 1NPTO 5CM8B 3RS5A 1SC1A 1QBKC 2VYQA 1U3GA 1XELA 4Q4AA 4UCFA 4B3MB 5H9WA 1M0TA 3EGIA 2ATXA 5HA5A 5HJ2A 3PQ6A 4HLNA 4Q4CA 3KXLA 5EGSA 5BW4A 3DCNA 1XA4A 2BGUA 3UUFA 3KT3A 4JLBA 1GYPA 1I51A 4V3CA 5B3JA 1AX9A 1TAQA 3DZBA 1N5LA 4MRVA 4O2AA 1N3IA 3NYIA 3OG9A 1K08A 1YJ9B 1D1TA 3HDHA 5CH5A 4XR9A 3T5CA 4DYDA 3AVQA 4RKWA 3WLFA 3REOA 4YV1A 3FHLA 1F38A 1W2BB 2HSGA 2VOEA 3K71B 1V8OA 4M88A 3W6NA 4YMGA 3T94A 1DO8A 3HXQA 4LXIA 1X8JA 1RKBA 3CLTC 1AUVA 3CUWA 3FUUA 3IPRA 4AX4A 2WM3A 1KL7A 3QEBZ 3FKSD 2HPVA 3IKJA 3JRXA 4UW9A 4BNIA 4TZ6A 2UYQA 2ZGVA 1KO4A 2P3SA 3CSUA 5LJIA 5A3JA 1NRIA 3H6KA 4PZEA 4XJSA 3ZPXA 4KWHA 2QG6A 3UJ9A 3LTEA 2CFCA 2Z3VA 2OQVA 3IA7A 1ZU5A 3RNLA 4UBLA 2O8BB 1G42A 3TQQA 2CXSA 1DHTA 3QHQA 2NUAA 5BW5A 2G80A 4CWAA 2A5LA 3UWKA 1F9AA 3H9CA 4AKGA 3IOCA 1Y37A 1U2PA 1NT4A 1IM5A 1CJVC 2HREA 1V2HE 2XLCA 5MFPA 4ZOAA 3TBFA 4GGPA 2PWAA 1RMYA 1IM2A 2GQFA 2AZDA 2LXNA 3JD2A 4PU0A 1SCIA 2ZCJA 5JJLA 2R6ZA 2J9RA 4URXR 3DOCA 4FFWA 3DDZX 3P45A 5FRDA 3CCUB 3ORRA 2P6NA 4REMA 2AOWA 2FVYA 1XALA 1DEOA 1VMEA 3GPBA 2FX3A 5K0CA 1EDZA 1FNDA 1HKHA 1N0IA 1TK2A 1Z82A 3A6GA 4LI0A 3EUWA 5G1OA 1NF9A 1YZVA 1ENPA 1YB2A 4HKTA 4P84A 3VHXB 2F6RA 1IXZA 3I45A 1RCFA 4Z4YA 2W2KA 3NIWA 4KGDA 4NBRA 3DLHA 2GWRA 2QX4A 3TPCA 2HSWA 1K75A 4JKYA 1U5BA 3KQYA 3EC2A 1QF6A 5JCJD 2CLOB 4J6EA 2JZCA 1XTKA 4KC0A 4BFUA 3UH1A 4L8GA 1LDYA 2WIKA 5JMOA 3IFSA 4G1VA 1JHVA 1LRJA 4XCXA 2VKQA 4YCAA 4MITA 4HMPA 1VE6A 5AYVA 4YCDA 1U1GA 3K5IA 3O92A 4Q1CA 2F90A 1F9EA 1JXOA 2Y4OA 4DJAA 2IWRA 1L7OA 1AKQA 2X76A 3EK2A 2V5VA 4IVQA 4R0VA 4Y1RB 4BZQA 3L7BA 4B48A 5FBQB 3RFCA 1M1NB 5ICMA 5G3YA 3PYLA 2DIEA 1E9DA 1GT6A 3IAM1 4F45A 1QU3A 1H85A 1OXMA 3GJQA 2EW1A 2WV9A 3QKSA 1SUFA 2I34A 1HURA 2J7PD 1FYFA 5F76A 3DC7A 3QFTA 1D7AA 1P18A 1VI6A 1T3TA 1BXZA 1MUUA 5B2ZA 3KAPA 4KO2S 1YD7A 5HRUA 1GTG1 2WKWA 1WKCA 4ZAWA 3WGYA 1ZXBA 2RKWA 1NUSA 4Z4TA 1D6MA 2BMWA 1A7KA 1W2WB 3UK6A 3T9EA 4XPIB 1II9A 1VYHA 3L05A 1YL5A 5ALOA 3ZWVA 5IDXA 4H4CA 3AWIA 4ER7A 1OXVA 1PFUA 1KEUA 4LXQA 3RRNA 3LUHA 5ES3A 1NQOA 3H2IA 5DXAA 1N2CB 5AT1A 4ZVQA 4U2FA 4JJGA 5DW0A 2DQKA 3ESDA 3OX3A 3DMHA 3Q1LA 4KCGA 1YB4A 4EFDA 5ADVA 4KQGA 4ML3A 5K0NA 5C37A 5KOJA 1G21A 2JFUA 1W0KA 1Q0QA 1CE8A 3VPBA 1NB0A 1H2AS 4NULA 5AUNB 4L5CA 1ILWA 3USZA 3HO8A 4NK4A 2WTBA 1G0NA 3M6XA 5IT9A 1AG9A 2YJZA 1NDQA 4HWRA 3U7RA 3SKYA 1FB5A 3IP3A 3JYHA 4B3JA 2WR8A 1Z6AA 5SZKB 3JYPA 1IE3A 2Y0PA 3ZCSA 1VKZA 4Q47A 3IIKA 1SG6A 3ESBA 2H5IA 3MTEA 4N7RA 1SHZA 4XPIA 1KH3A 1YZNA 4JB3A 4OHCA 5LMZA 4ZTBA 1EP1B 5A88A 1MG5A 3W2IA 2HPZA 2QLLA 3NHRA 3WZ2A 1FQOA 2I99A 3C3XA 5K3FB 5GADl 5BRNA 5FWXB 1KZ4A 1B93A 4LHVA 2WLSA 2MYUA 5KPJA 3G8CA 3MWDA 3I8OA 5ALLA 4G1MB 3JAWA 3F5SA 1ZCJA 3W3ZB 2JJMA 1MNAA 1SVWA 1U6IA 1P9RA 2JFNA 1PEKE 1U99A 4ZMRA 3D0KA 2IS2A 1CXZA 1X7YA 2R6CA 1ZNYA 1MAAA 2FPLA 2E21A 1F0YA 3K1AA 1DRVA 1X9IA 4FLMA 1ECLA 2WAMA 3JQBC 1FP6A 2J3LA 3SU8A 1WV0A 4GS5A 2CMDA 2YOHA 1G98A 4IS2A 5ICGA 4IIXA 5K45A 2Z8YA 1K06A 3PK0A 5DLYA 1Y4SA 5EHXA 2X8JB 3I6YA 4G26A 3I3OA 4CI0B 1LPAB 1T1IA 5GOZA 2YCLA 1V11B 2V65A 1U6KA 5H4GA 5K8JB 3P9ZA 5AH0A 3N0XA 1JFLA 3U62A 4HXEB 3AEUB 1C9EA 5A06A 1Q0TA 4ZAFA 2RBGA 3JASB 2IGBA 4LSWA 4MWTA 1F06A 3GRKA 2XVMA 3MVEA 3V1KA 2VK1A 4RX1A 4GUAA 5I9TA 1ORIA 1E43A 3ZHSA 2PAAA 4NZNA 3ABIA 3TB6A 2CC2A 5TMDA 3EC1A 4B3GA 4A82A 3B1KA 2Q4OA 1PFKA 2BTQA 3TQCA 3ESAA 3P2EA 4EA7A 4RTPA 2HMUA 1SVUA 2WWTA 1WLSA 4ZXPA 1LBSA 2VBIA 1P39A 3L02A 5ANRB 4L4ZA 3TTSA 4BFSA 4B8WA 3OZSA 5C8YF 1MGPA 2YJNA 1T2FA 3NVKI 4YBRA 1TQ6A 4WBSA 2AMLA 3JQBA 1U0TA 4HX2A 2HMTA 1BJRE 2YY6A 4NMLA 2KMLA 2CT8A 2QX7A 1SVMA 4OH1A 4XGNA 8ATCA 3PT5A 4GMHA 3IV7A 4NE9A 1ZH2A 2DLCX 3ABQB 3P0FA 3BGOS 3R3XA 5CFMA 1PG0A 4S35A 5EMMA 3R7LA 5DNUA 2FH5B 3MCAA 4X7EA 1SD2A 3FCXA 2P91A 3LY5A 3KPUA 3BK2A 4XKJA 3INYA 4D9BA 1Y1QA 4JODA 2GAJA 4DV0B 3YASA 4ON9A 1V35A 5EJIA 2IOQA 2EFCB 1GIAA 2P65A 2ZYGA 3JV7A 1P29A 4GHWA 2HWWA 4LHZA 1Y33E 3REQB 3ZD9A 5DM70 1S8OA 2IXBA 3DOJA 4L07A 5EUBA 3ROFA 3SIRA 4IOLA 3JQQA 2YX1A 1KSGA 5DU2A 5A4IS 1JTEA 3QH4A 4N03A 1N36B 4XUDA 3R3JA 2G36A 4JT2A 3IT2A 3W7BA 1QIKA 3PHCA 5GTDA 3WYDA 1E5LA 2B6NA 3D7NA 2IH4A 5EKSA 3HM9A 3C4JA 3ND6A 3X2FA 5BORA 3THSA 1ZJJA 2MDTA 2Q6VA 2XIQA 1U2DC 4Z4QA 3J7AC 3WLHA 5KVAA 1Q2XA 1PVDA 1ZX1A 4QJ4A 4TRMA 4Z4SA 1YZGA 2RARA 2P4EA 3EFBA 4JLJA 5TJHA 4YAKA 2EWWA 3T4PA 1KO1A 2D5AA 3PC7A 1H4TA 1MOSA 1Y1LA 4M9ZA 3EDYA 3KSUA 4MS3A 1MQSA 3FCOA 1JU9A 1XRSB 2PGXA 1RXUA 4O6VA 3QU2A 1IHMA 3N0RA 3NHPA 5LP6F 3SZMA 2Y0EA 2BBTA 1Z4NA 2VDLB 3NQ41 1FNCA 4PAGA 4DR6B 2RJOA 1GFSA 2W4QA 4OYHA 4WWHA 1CNFA 1DXQA 1SHTX 4JU8A 4L8YA 4E13A 3OTOB 3DEJA 4J7CA 4DT1B 4OGLA 4WBNB 2IVZA 2ZRGA 4I4LA 4CKXA 1RXYA 1V4VA 5JBNA 3R3ZA 1DQPA 1P3Y1 2G71A 3CCLB 2GSDA 4RMIA 4Y2RA 1EGAA 1Z12A 5CB8A 2RAUA 3IV6A 3M7IA 4S05A 2QLMA 4UPEA 1P0CA 1BHO1 3A6DA 3C6ZA 3KLOA 2CDCA 2H63A 3QUAA 4GZ6A 1T91A 4HDKB 4MWEA 4KNWA 2GFIA 3LPLA 2XQFA 5EHGA 3R8XA 1SA0A 4YJ2F 4CMKA 1AQNA 1XN4A 4I2NA 5L51A 3DMFA 2HDNB 3ZZUA 2CHVA 2D59A 2W6ZA 3H11A 1B7GO 2QTGA 3IUNA 2C5EA 3L7IA 2JFYA 4NICA 4PIVA 5TS3A 4H1WA 1FTNA 1EJ0A 1OJLA 3BOSA 2PK3A 1UOEA 3HVRA 4IXDA 2H85A 4FNMA 1DZ3A 1TA9A 3VR3D 1JFSA 4BVKA 1GZ7A 2DJIA 2F00A 1OGYA 2W6MA 4YPFA 5A4MS 1UXOA 1A5ZA 5FLYA 5AM3A 1KJWA 4IIJF 5HBRA 2CXNA 4E1BA 3GJ8A 3EZ7A 1ZICA 2HMVA 4ZGBA 2IF2A 4P22A 1Z0UA 1NJ8A 2IIBA 1BE6A 2F3PA 1T6ZA 5FI5A 3SJCA 4CIAA 2JH9A 1ZM7A 1M0EA 2PXXA 3QKSB 4UKDA 3LC1O 4ER3A 2G08A 2HL6A 4WZAB 2E49A 1R0RE 3ND9A 4OSPA 3LT2A 2NX2A 1TVKA 2IY8A 4RGVA 5DEOA 3UTCA 4GRDA 5IABA 3AXSA 1OF1A 1MX9A 4ZU1X 3F47A 1W94A 4FGUA 3EJ6A 1XMPA 3AKEA 4DQUA 5EJ6A 3AF4A 3DVLA 3COWA 5FUVA 4L50A 3CO0S 3U9SA 2V3CC 4OBBA 2JAOA 4DA8A 2CZQA 4B6RA 4KAJA 5ELLA 2PSEA 3QU9A 2VJLA 4J0DA 5EJ8A 3HKEA 4F4IA 1MPTA 2C7PA 1RPZA 1KFBB 1OW3B 4HMQA 4M0PA 5L3QA 1YB1A 3VHQA 1OV4A 3N8IA 4M7PA 4KWEA 1N6LA 1VCNA 2XAUA 3PF8A 3CP8A 3DOUA 3SNHA 4OJNA 1JEQB 3JZFA 2YZ2A 3P4YA 3LPMA 3HDGA 3ETNA 4IS3A 3UMRA 3F2VA 1KZGB 2BZSA 3W1EA 3T7KA 1CDZA 1QK3A 2EJTA 1IZ9A 3ETHA 3KT6A 2ZUEA 2RHHA 2Y0CA 3OQ1A 4U2BA 4Y2JA 3A8JA 4RPHA 4BS9A 4YX9A 5JNWA 2G04A 5AM2A 5AVVA 1THZA 2B8JA 2O4CA 4ZVKA 3GCWA 2JB9A 5FFMA 3WIUA 1WXGA 5FAKA 1XI2A 5IC6A 4K6FA 1T3GA 4OJKA 1GJRA 1CY8A 4XSHA 5CFPA 3CRQA 3A4TA 1RQXA 1YB6A 1TRHA 3IVAA 1DT3A 1N5RA 3TW4A 3EVDA 1EU1A 2ZXHA 2BFCA 4UTVA 1T4MA 2JASA 3FI9A 4KXFB 5IYZB 1FP7A 2QK4A 2IKSA 5FPSA 1JXAA 1U7HA 3PTLA 4PGGA 3TZ6A 3L49A 1JAXA 7REQB 1WOYA 1KGSA 1FX0B 4KFRA 1NI4B 1W1WA 3TM4A 2OLJA 2VSXA 2JLSA 1GCGA 2JFPA 2ZJ2A 3D8UA 3SIWA 3AUTA 1PKEA 1ZVQA 2I6SA 3HI4A 1CIJA 1NN5A 3BJMA 5JYDA 3TIVA 3NIFB 2JPDA 1D4OA 1E89A 3LGSA 4E11A 1SCJA 1J21A 5FWYA 6ABPA 3WKEA 3FOZA 1AUXA 3TX2A 1SB8A 2ZFUA 1VQMB 3ILVA 1VJ0A 4CJXA 4OQDA 2XQKA 3DE5X 1CJBA 3ESZA 3M1AA 2CNLA 1QO9A 3SHTA 3SYRA 1URPA 1U02A 2F1RA 2VI5A 3JQEA 1V9CA 4QBIA 1G63A 3DAPA 1QH1B 3K16A 4WZBA 2AI2A 4C2TA 5F9MA 5HF9A 3Q9SA 1ONOA 4JL6A 4D02A 2Z57A 3TEJA 1R0CA 1Y8QA 1I6MA 3KYDA 2X86A 2XRMA 2GM4A 1ZRSA 2PKYX 4PSKA 3WWCA 1OKKA 1UDAA 4ITVA 2CWDA 1X7DA 2C2WA 1PT8A 2TRSB 4OHOA 2O9JA 3BH0A 4D4HA 4QTYA 1GPBA 2NXEA 2HNBA 5AXBA 1HZJA 4OUDB 1HH4A 2IU4A 2YY7A 3H2SA 4E07A 3HXPA 2P4HX 2F1KA 2E5WA 1K3FA 4Z0TA 5CVJA 1OPXA 4UZSA 5CIYA 1KY5A 4UAVA 1RQGA 1RWKA 2UZ1A 4EJ2A 4GG1A 3QMVA 3O94A 4DUYB 1OE0A 2F8TA 3ILSA 4HDNB 2R6JA 4R7TA 3NEPX 3UMFA 5BVHA 1E3XA