4TN9A

Crystal structure of clostridium histolyticum colg collagenase polycystic kidney disease-like domain at 1.4 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
86
structure length
86
Chain Sequence
b'GSAPIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Metal binding protein
total genus 16
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tn9A00
4NWTH 2P7TA 4XH2B 4OSUH 5E8OB 3RDTC 3G6JF 2Y5TB 2MQ0A 1AFVL 3ZE1F 3TIDB 1Z3GH 3SGEH 4OZIB 3AS1A 2A1WH 4UIKL 3PQYD 3RU8L 3S5LG 4Y4HC 3DBXA 2DI8A 5HVGB 5I1KL 4UDTA 1FP5A 3LS4L 1KN2H 3DSNA 5TH2A 3U79A 1TVBA 5AAMA 3QFDB 2R0LH 3V7AE 4KY1L 4YHLL 3GO1H 5HDQH 3CDGA 4NDMB 4XP4H 4XWGL 1YNTB 4PJCB 1R5IB 2UWEE 5DUBB 2DDQH 1JGLH 3TLRA 1EJOL 5L2KB 3IXTA 3UAJD 2G2RA 1RIUL 4WW1A 1N8ZA 3PWPB 1F11A 2EE6A 3RGVA 4DKFH 1OAZL 4G8GD 5C09B 5ITBL 5B8CA 1XR8B 2F53B 5B3JF 2EYRB 3T0DA 5E24E 3AM8C 3BKJL 1LEGA 3MA9H 2GUOB 4MAYB 3JV6A 1J0ZA 4K7PY 1GYAA 4WI7A 4MJ2A 4PYGA 5D7LB 1XGQB 4N0YL 2BSSB 3OHXA 4LCYA 5D1ZC 2MQCA 5JIPA 4MA8L 5EU4B 3OXSB 4RQQA 1G7LA 2I5YL 2IBZX 4DKAA 4UV7H 1T66C 3K8LA 3IDYC 4PJGF 5F9WB 4Y19B 1ZA3A 3RWHA 2FNBA 3P3YA 3STLB 4HUMB 3P9LA 1XCTB 4EI5C 4IOFD 5K33A 3KNBA 5D7JB 5D2NC 1G9NC 1DFBH 1CLYH 3W0WE 1QVOB 4HIJA 1UVQA 5I8CA 5DJ0A 2IAND 1H5BC 2V7NB 4LHUA 2H1PL 2O5YH 3IDXH 1CICD 4NNPL 4J3TA 5GRJL 3Q1SL 5AZEL 3V6OA 3IAGC 4G9DB 4JO1H 2A83B 2CXGA 3L3JB 2VLKA 3BN3B 2NR6D 4QF1A 2YWYA 5TE4H 1C8PA 4F8QA 1G0YR 4PTUB 4HUXA 3RJDA 1KG0B 1CVRA 5CEXA 2OZ4A 2R0WL 3WUWB 2VLJE 2BVQA 2HG5B 1AJ7H 2H3NA 2CUMA 5FM5O 1A6ZB 1AD0A 1BBJB 3NVQA 4P9MH 1I1CA 3A6CH 3RAJL 2YUZA 4R8WH 4HIHA 5KANG 1MWAH 1VFBB 1VFAA 1G0XA 3OB0K 1C08B 1DCLA 1KSRA 3MLZH 4ZAKD 1WZKA 5GRYA 3KLDA 3E6FB 2XN9E 2C7UA 4LFHG 1ZXQA 4GRLB 2NX5B 2BSTA 2CIIB 5A43C 3MUY1 4ODSL 1YNLL 4WJ5B 4QXTA 3LZFH 1OGAD 1JFQL 4LEOA 1INEH 3ZMRA 1V7NL 4KVNH 4QLRA 1U8NA 3BGFB 1KTLB 5DMYA 2XTJC 2Z93A 5MEND 1ETZB 1A1NB 2OMNA 4D9QD 1TQCC 4P0DA 2X2YA 2F15A 4S11A 1FVCA 2C4XA 1KJ2L 3ARGA 4NJAH 1M6OA 4L9DA 3WLBA 3VI4E 4D0CB 4XCFH 1CN4A 5ICYA 1YPZA 4B0MM 1OT1A 3PWNB 3HNTH 4P9HC 1MNUH 4I18A 3M8OH 1CFNA 3GNMH 3JWDH 4XBPB 3TN0D 4JGJA 4PRDA 1I7ZB 1IFHH 1RIVH 3KPSB 1KCRH 1LK2A 4P2RB 3TO4D 4XPHL 1YN7B 3IGAA 4LDOB 2ARJB 5EOQH 4BQ9A 5MEPB 1JL8A 2ATKA 3DO3A 3PL6D 1JUFB 1KC5L 1A6AB 3SQOL 2ZCLH 5GSVB 5IB1B 3R0NA 1JZ2A 3QUXD 1ZS8B 4MGXA 1N7ML 4KTYA 1WIUA 5D5MB 5TDPA 1KLFA 4OM0L 1ADQH 5F7NC 4GG8A 2CKBL 4LMQI 5JNYA 3KHQA 3TPUA 3SDCB 5T3XE 2R1XB 3U9PL 1VEOA 5DVKA 3UC0H 4OM1L 3E3QE 4CJ0A 4C56A 4LASL 5ANMB 2PXYC 1KTDB 5E5UB 5GJTL 1UACH 1RUKH 3O11B 5JIHA 4LCWA 2GJ6E 4DKEH 4HFWB 1EO7A 2LV4A 4X7SL 3SKJH 5IOPA 4LSSH 4OZGA 3QHFH 4PLOB 4XVSH 5CEYA 3VWKB 3JV0A 1FBIH 4OB5H 5EU5B 4XBEH 2NXZB 1T5WB 2W92A 2YXFA 2A9NH 3QDJA 5HHOB 4ZG1A 1T1WB 1PJ9A 1RZKL 3FO2A 5HI5C 4O02L 3OJVC 3Q6FB 1MVUA 2KH2B 3CNKA 4Q74A 1PG7L 2FX7L 3HE6A 1YMMB 1AP2A 3MV01 3GKWH 5D96C 3B8YA 3TCLA 3VGEA 4XPTH 1VKXB 1XZ0A 3QWRA 5D6DA 4OZHB 1DN0A 3WNNA 3B6SB 2HMIC 4NUGL 4G6AC 2IAMA 5BS0B 5HGAB 4O51A 5FYLH 3U7WL 5I1GH 4J8RB 2VZSA 1QBAA 4GRMA 2QQKH 5DI8A 3T1FA 2GFBB 4PUBH 1FYTD 4F9LA 1U8JB 1U8KA 2DL2A 4UILH 3UTTE 3ZDXF 4CKVX 1KXQE 3HR6A 5HY9B 2YHGA 3GGWA 5JUEL 3RI5F 4XC3H 5FYJU 1G1CA 3KXFA 3VI3F 4TSCH 2F9BT 1FLTX 5BCAA 2Q87A 4O00A 5LWYL 3PGCA 1FO0B 4LVEA 4Z7NE 2F53A 4IRZH 1JNHA 4OIBA 3GM0A 4FN0A 4UV4L 4OCLC 1MHCA 4ODUA 1UENA 2W9LA 3PQYB 5HBBA 1GZQA 5C0CE 1E4XH 3BIKA 4O4YH 3WFHA 3WIHL 2PO6C 4X4ME 4EXPX 5F96L 1U92B 1J8HB 4EQ2A 2OL3A 1YY9D 3CCHA 4NQTA 5L0QB 2VDOL 1T6VN 4YHZL 1H3TA 1WTLA 4HMCA 1JTTA 4X6CF 4RISH 4XTRD 3HC3L 5A16A 2Y1VA 1AIFB 1OPGL 3T09A 1L7TH 4D0BB 4UQ2B 4LHJB 2PR4H 1PX4A 3QUZC 2UV3A 2BHZA 4MNHB 1MFBL 4PJEE 3TBSB 1OSPL 4NO0D 5HYJD 4YBLC 3OJMB 5J9PB 5IJVB 5F7WC 1I8MA 4POZC 2HFEA 5TFSL 3OAZK 3HMWL 2R8SL 4QXUH 5GS0H 3TA3C 2Z92A 4G3YH 2M26A 3C5ZC 5IB2A 3ROOA 1KCUL 1G7MA 1LMKA 3MR9A 4PB9L 3U7YH 2H8PB 3O6MH 4TSBH 1G7PA 4PRAB 4HWBL 3HZYA 4MNGE 3CLEL 1A1MB 1CDHA 2QSCL 4I0PB 1ZLVK 2EIZB 4XNXL 3L5JA 1QR4A 5I1EH 2B8OT 5BJTB 3OGOE 1DR9A 1I1AB 1H3WM 4GMTL 2OI9B 3KLAB 4OBRA 1U3HA 3L5XH 3QZWG 5SWQA 3QIWC 4HJGA 4RGND 3JWDC 4OZIF 1I1FB 1A6WH 2F19H 2ZUQB 3QQ3A 4KWUA 1S7XA 3HZVA 1DBJL 4PJXA 3V6FA 4JDZB 5JW4M 3CH8A 3T0AA 2A6KA 2Y7QB 4QRSB 1NC2B 5DQDH 5SV3A 3JTSA 3VFPB 3BI9X 1OWWA 1IAOB 5FKAA 3C60D 5HGHA 1IGJA 3I02A 4A6YA 1ED3B 4GKSA 2VTFA 5I8OH 2J8UB 1MELA 4NKIH 3HNSL 2YSSB 4Z78B 4IMLA 2X4SA 3WN5A 4PJCF 1OF2B 4WWKC 2FH8A 1DVFD 3LHPH 3TNNA 4TOYL 2Y25A 1U2CA 1WZMA 1J7VR 1Y6KR 2RCSL 3V4PL 1MQ8A 1P84J 3TJEL 3JUZA 1JV5A 4HPOH 1MCLA 2P1YA 5L8LB 1ZLWH 3CVIH 3R06B 4Z7WA 5GRUH 3WNPA 4OUUB 5DJXA 1BP3B 5IG7A 4Q9QL 1HNGA 4Y1AD 2A73B 4PJDA 3D3VA 1ZGLB 1GRWA 4BH7A 2AV1B 4HUVA 2ICEB 1T2QH 5GS1C 4L4VB 4XBPA 1N0XH 5DJDB 1LO5B 2VQ1A 4OCRH 5E95B 3V5KA 4PJFE 3EFDH 5E08H 2W9DH 2ZWLT 4ZO7A 4AM0A 1K2DB 3EO0B 4L9LA 4S1QL 4E42A 1I3GH 2DI7A 3KPTA 4YIQA 5ESQB 2E5EA 2E9JA 3GRWA 3E8UL 1A6VH 1BECA 3DI2B 1FGVL 5GSVA 1JGEB 3RKDC 3R1GH 1H15B 1SY6L 5E56A 3LEXA 2ICWB 3DRQB 4V1DE 4JQIH 4LEXH 5AWNL 5DK0B 3ILQD 4OZ4B 4I77L 3QCUL 1PYWB 4F7MB 4TVPH 4MAUH 5E5RB 5ANMA 3E2HB 2V2XB 2D9CA 2W0FB 3KPRA 3O45B 4G5ZH 1OAUL 1W0YT 3QEQE 1NBYA 3P0YL 4YDKH 1MAJA 3WIIL 3V79C 2R2HA 3TN0B 3WXWL 3KVQA 1F8TH 1WJ3A 2PCPB 4M7KH 4WFHE 4X6FA 1T04B 1IEBB 3SGJA 1GGCH 1S7RB 4XNUL 1FAIL 2FATL 5T3ZL 1JPTH 4KUCD 3RWEB 1HOCA 4NP4H 3WV0A 1MCKA 4D94A 1J1XH 3VXQA 1J87A 1FNFA 4JFXB 3ARFB 3D18B 4WHTA 4XXCA 4GQPH 3QAZC 4MNQB 4U1LB 2FD6H 2X40A 3BE1H 1DQML 4OZHA 4JY5H 2FZ3B 4MCYA 5IV2B 3VG0L 1BMGA 3FN0L 3CAFA 2BVOB 3EDJA 3RGVD 3BPNB 3ABZA 5IFHH 4FXLA 3CFCH 3Q0HA 4G7YH 4J8RA 5BRZB 3E3QC 2V5YA 1RJYB 3IJHB 3IAPA 3ULVD 4Y5XB 1J88A 2FECI 2HTLD 3NIFF 2HTKC 4NUJA 4G42B 1U8JA 3P0VL 4NWTL 3VWJA 3VDAA 4OLZH 3OWEA 3MLUL 1G6VK 4NC0B 4PV9A 4CU8A 3QIBB 1IGYA 2LU4A 5HHMB 1WTGT 5J12B 2ZUXA 1ZVYA 3V5HA 2W60B 2ZSWB 3MQIA 4JO2H 2A9ML 5D7IF 2G9HA 5I1LB 5ECJE 1FO0A 4Y0GA 3QFJA 1KN2L 3OJDB 1TVHB 4YK4B 3DVGA 2JJTC 5SWZB 4YFDB 2R0LL 1C16A 1FLRH 1MRFH 5MI0B 3T4AB 4JVUA 5CP3A 4TRPH 4PLJD 5BZDA 5DA0B 4NHCH 4I13B 3MRGA 1NCBL 1QG3A 4DK6A 4I2XB 3BKCH 2YR3A 2A77H 1T80A 3EBAA 3P11H 2VL5B 2BNRA 3M07A 4K3EL 2VDLL 4OD2A 5K9OA 2Q7YB 1ZVSB 4TPRH 5EUOA 3FB5B 4LMQE 4XWOD 1PDKA 1HH9B 4JKLA 4LHUD 2QBWA 5D5MF 2JLLA 4R6UA 3SDAA 1KIUA 1W0WA 1IC1A 1HDMB 3OAYK 1VPOL 2VLKD 1JN6A 3AXLA 4FS0A 3DX8A 3N85H 4U1JA 4BK4A 3T0XA 3M17A 3FZUC 3MLTA 2Z0BA 2BXZA 1JZ6A 2OXGA 4NM8H 5E2VH 4DZBB 3P2TA 4GAFB 4ODTH 1HWGB 3CLFH 3EDDA 43C9B 5KG9B 1KB5H 1WZLA 3FB6B 5DJYA 2CKNA 4BKLA 5JA9A 3MBEB 1DFBL 3F7YA 5I1AA 1D6EA 3GSUB 4LCCA 4DFHA 4ZPVB 5TPWH 4L29B 1BQHG 4AG4L 5C0AE 5GS2H 3MJ8A 1AGEB 1VSCA 5C0BA 3IDXL 3I3EA 4EN3B 4NC1E 2BXYA 5E94A 3VFPA 7FABH 2BOBB 4J23A 3ULSA 2XWBB 3A67H 1KJVB 3CMOH 1UH2A 3D87B 3GMLB 4F2MB 2FBOJ 3NIDF 3TJHD 4YXLH 1EEZB 2YSSA 4EZMA 1UJ3A 3ZKXB 1JMXA 1AJ7L 5DUMH 5C6TL 4F37F 3ARGD 1KXTB 3QHZH 2YKLH 2OCFD 5IJKA 4KTEH 5E6IB 1J1PL 1XGUB 4R8WL 4JZJC 1QKZH 2X4UA 5D2LF 4HIXL 4KRMB 3RVUD 4NKOB 5JHDE 3GBLA 1A2YB 4MS8D 4L3CB 1C5CH 4OF8A 3TYFA 2X7LA 3OPZH 4EDXA 4KDWA 5IMMB 4I9WE 1F6AA 1XT5A 2DICA 3DXAB 3ARXA 4E41B 3DX7B 4OUUA 1DQLH 3VH8B 3WFEL 3VXMA 2KKQA 5FO7B 2AV1A 1ZHKB 4NQEE 5KAQF 5IB4A 5F3BB 4Y8AA 4PR5B 1YEGH 1FQ9C 3X13B 3L3HB 1CLOL 1LO5A 5EO9B 2VYRE 4HKBB 3GMRB 5KSVA 3EO0A 3N0PB 1P4LA 1RJLA 1AKJD 3HS0A 4N8CL 5EBWA 4XVTH 3QPQD 1QSEB 4Y5VA 5EBGA 1ZANL 1ITCA 3EJZD 5MHSD 4LCWD 4ZS6D 5EIIA 3PHOB 4CN6A 1CXFA 1T22A 3L7EB 4LNVA 1CI5A 2AV7B 3GNML 1PYWA 3GJFB 3B43A 5EU6E 1YQVH 1FORL 1T2XA 1IC4H 4OLWL 5DGQA 1T6WA 4HJ0D 4YO0A 3LCYA 3RNQA 4OD3L 2W0FA 3N9GH 2JKXA 4JM4L 1MAKA 2BSRA 3HE6D 4P46A 4R2GD 3T0EE 4LRNL 5FM5M 4XP9H 3QWRD 4ZTOL 1OAKH 2J6EL 3ULUL 1KIQA 2IAMD 4N9GA 3LPGA 4LRIC 4MJ6A 1DN2A 3LB6C 4JFDD 5K93A 5I74B 4XPGL 1L0XA 2YZ8A 4HLZH 2AS5M 3NCBB 4H26B 5DRNB 2Q6WA 1B4RA 2BC4A 2NXYB 4ORGB 3VXSA 3ARFA 1J0HA 2APWA 2YPLE 1K8DA 1SJEA 1YNKH 3C2SA 3S37L 4Q6YA 2J8UF 5KSBE 1BZ7A 2OR8A 2HWZL 4FOMA 3KXFD 5IMKA 3IDMB 4XBEL 5CJQL 3QSKB 3I75B 4X4ZA 3MV7E 5CEZH 4Z8FH 2O61B 5FHBH 3GI8H 4M6OH 1WV7T 2MHAA 4AMKL 1NCWH 3UBXB 3RHWK 2KL6A 3BGMB 3MCKA 1OT2A 1TPXB 4IMKA 4WW2B 4PG9B 4YZFE 3HG1A 5I1LA 4X0KA 5LGHH 1I7UB 2RFXB 5KS9A 3MACH 3OAUL 3RWFB 1CTNA 3MRLB 2QQKL 1YUHB 4OCXH 1EPFA 3FO0H 1NFDB 4UILL 5EFIB 1X5HA 2DIBA 4JRYE 3C6SA 4R3SA 4KKLC 1LHZA 3I3DA 4JFEE 4OT1H 5DURD 1AR1C 3DVFA 4X9FA 2YEZB 4MQSB 4QWWC 3I6GB 2P44B 2AK1L 4FQQB 4UNTA 4XPBL 4QTHB 2FO4A 2Z8VC 5I73C 3G9VA 1Y0LA 2X4OA 5H8DA 2CMRL 2DOCA 3W39B 2VXSH 3DO7B 3JVGA 3U0PA 4RNRA 2CLVB 1P1ZB 1SYSB 3BH8A 4JY4A 4XRCB 3UYRL 1RPQA 3SKNA 4OQTA 3N1MC 3CVHL 2YPKA 3ZSTA 1GHFH 3ZKND 1QPXA 5E9DB 2HVKB 1JMZA 3DJ9A 4AQOA 4MJ5A 5ADPL 1TTGA 1NGXB 2XNAA 2HVJB 4CADB 5DRZB 2BOCA 2BNUB 3QI9C 4GQ9L 3K4AA 4KDVA 2NW2B 1MIEH 1U3HD 5E1HB 5DJ8A 5JQHC 2E27L 1QBBA 4L5FL 1MJ8H 4S1DD 1HK6A 2VH5L 4M7LT 2BNQB 2OR9L 1HYSC 1G7IA 1KTKE 1WWCA 2YK1L 3GSWB 3QBTB 4Z7VA 3MOBL 4DCQA 1LE5A 2Y07H 3BO8B 4N0CC 1IAKB 2Z8RA 1T0NB 3FT3A 2V17L 3BUYB 1LNUB 1FL6A 4WCYL 3BZ4A 4QXUL 5GS0L 1UXWB 2GW5A 1RJZB 1HHGB 4OCMC 3DVIA 3PV6A 5T3ZE 1MPAH 1T0PB 3DV6A 1KLUB 3ARQA 3WL9A 1CGSH 5BV7H 3O6ML 4IBLT 3MNWA 1YDPA 2Z9TA 1FG2B 2YBRA 3ES6B 1QEWB 4ODWA 4OGAC 4GMSL 35C8H 3KR3H 4M6ML 2H2SD 2EC9U 4GBXC 3BDYL 3BWAB 4Y16B 4KGJA 4ALAL 4YLQT 3EDFA 4AIXA 5SX4H 3L5XL 4WI8A 4M02A 5DVLA 3RDTA 1GGYA 3F7VB 3FO1B 4AL8H 4KVCH 1A6WL 3QQNA 4UBDC 4RSVA 5DK2A 5D96B 5HGBA 3OTTA 4Y4HA 3D3VD 4LVHC 4P2QB 3ECBA 5HYSB 1A4JB 2EICA 5SWSE 2JTDA 3C2AH 4MQTB 1IBGL 4KK9D 4Z7UA 1RZFL 1DBMH 5IMMA 5DQJA 3MJ6A 4WUKL 1R5VB 2QQLL 5I1IL 5K9QG 4XMKH 3KPPB 1Z9OA 2Y4SA 1KN4H 2FLBT 1WBYA 1RZJH 2DKMA 1FVEA 2LFGA 5IMOB 4NC1C 4ZFOB 3QDGB 3TBVA 2AJUL 4PR5A 2APBA 4WEBL 2XQYG 4OKVB 1A9EB 4HQQL 3UJTL 4QOKB 4PJAA 4B50A 1ZLWK 1ZHNB 5IQ9B 3ARRA 3AM8A 4WV1C 1IZKA 4M7LH 4LCUB 1EHLH 12E8L 3VXNB 3VRIB 3KPRD 3QUMH 1BF8A 3U1SH 5D1ZA 5FYKD 1S7WB 1OGTA 1AGDA 1FFOB 2VOTA 4BZYA 4PJ5A 3TGXA 2AV7A 4NN5C 5IEHB 1FAKT 3GSOA 4OCRL 5D1QC 5E08L 3MLWH 3V7MA 5IVXB 2EZ0C 5DTFB 4RA0C 3S96B 1P7QA 3CH1A 1FH5H 4EI5A 1A6VL 2DQDH 3KDMB 4M1CC 3E6HA 4Z0XA 1P2CA 4WUUE 3EOTL 5D2NA 4UZGA 5L8JB 2BFVL 1DZBA 3BZFA 3CDFA 4M48L 5DFVD 4OV6F 1J11A 2H9GA 2E6PA 4JFYA 3O3UN 5J11B 1W72B 2DKUA 5A2FA 5AD0B 1H5BA 3EDKA 5GRXG 3H7BA 4OCYL 2CO7B 5FF6A 4TVPL 4D2NA 1W2KT 2WNGA 4ODHL 4YHKH 4MXQC 1OCWH 3CFDB 2ZUSA 4LKCB 1EEYB 4JN2B 1VFMA 3VWJD 4ZFFB 3OV6A 1A5FH 1NMAL 3CXDL 3VXPB 3MGOA 1HYRC 1ZWIA 3TNMA 3VFTB 4XCYB 2FSEB 1LK3H 2EYTB 3GZKA 2DLIA 4DAGH 1JWSA 4DK3A 4JPIB 1GGCL 1Q0XL 3QFJD 4F57L 5KTEH 5D1XC 3O4OB 5CHNB 4S1SH 3MRJA 3EJYC 5I66A 3IF1A 5EN2B 1C1EH 2PW1A 3SE3C 3BGMA 3D85B 2YMXL 3T0EC 4XVUC 2FD6L 4ZOEA 1WBXA 3RQ3A 3W0WB 3NIGF 1MAMH 1KPRB 1MY5A 1EFXD 2BNRD 2BRRL 4YDLB 4XP6H 3IDNA 4HS3A 4S1RH 3IDGA 4JFOA 3CFCL 3CX2A 1T03L 4NQXB 5I1JL 4QHMA 4GAYA 5EDXA 5IIEA 1WICA 3R4DA 5FCUH 3EYOB 2IMNA 4C83B 3X11A 3HAEA 5J3HC 4K8RH 3QG6B 1IEAA 1QBLL 4U6YB 4XGZA 2JIXB 3SDAD 2EDXA 1WAAE 1GOGA 3L1OH 4R96B 1HHJB 2H2PC 8FABA 2V2TA 5C7XL 3T2PA 2PYEE 2CRYA 2HT4D 1T21A 5IMLA 5BV7C 1YYML 2Q20A 2VLJB 2DQFB 4P4RA 3MRDB 2DWDA 2EDWA 4PS4H 3R8BB 4QRPA 5FGBC 4YX2L 3EYFB 4KROB 4MX7B 3JV4A 2N7AA 2BY0A 5BZWA 4KI5E 1E4KC 3K81A 3BAEH 4RAVA 2XN9B 1MH5B 2HLAB 1JWUB 2K7QA 4FQLL 3UYPA 4D8PB 3IYLW 1AXTL 4LLDA 3CFJA 2BNUA 4RCAA 4ZO8A 3IS0X 1X6LA 1HCVA 5FYJH 2R0KL 3TVMB 1WUNT 3FQUA 2DM7A 1MLBB 5C0EA 5ALBL 4BK5A 4O2EA 5C0BD 3C09B 4LQFL 1AI1H 3TT3H 2HFGL 1CL7L 3HR5A 1RZJC 3WD5H 4RWYH 1YEEL 4FFZH 1JBJA 5HVWA 2ADJA 2Y36H 4DN3L 4GS7C 4LVOB 1OHQA 1KEML 4KRLB 3VFMB 3V6ZB 3FB7A 2PXYA 1K4CA 2GK0A 3ULUE 2AGJL 3H9SE 3CSYA 4NRXA 4PJHB 1U3JA 4EUPB 1U0QA 4AT6A 4LLQB 3UEZA 1KLUA 4K7PX 3MBXL 2LTQB 4YXHL 4CN1A 3AS2A 3LKPA 3SDXE 1H8NA 3CLFL 3DGGA 5F7HA 1OP9A 1AH1A 1XFPA 3K7UA 1DBKH 5DYOA 1AD9A 3I6KA 5CD3B 1QNZL 4AEIL 5ACLA 2R0ZH 5TQ2L 4NZJA 3BWAA 2MNUA 3MJ7B 3KYMB 4MDJA 1XF2A 4M7ZB 3NN8B 3IU3A 4NNYB 3G6AB 5LBSH 2K1MA 4WW2F 3O3EA 3HLAB 3VXMD 3U4BL 1X5LA 1XR9A 3NFPA 1D9KC 5JPMB 4Y4FC 4IDLA 3TCXA 5DRWA 4DKDC 2EKSB 5IHLB 1T7VA 4QHNA 5DHVH 4P3WA 1B0RA 1PZUB 5E2UL 5DSCB 3SY0A 3DMMB 2H41A 1NUGA 2H32H 5J8OA 1NSNH 2AI0L 2ORBH 4Q9RH 1NFDF 3BP5B 3S34H 5DUML 4HIIB 1KEGH 4LSRH 2GJ6B 1MI5A 3HCVB 5B4MD 3DYMA 4XC1L 3F5WA 5IROC 4YE4H 5T1LA 4M93B 5DLMH 3TO2A 2BRQA 4NYLB 1WCBB 1K5NB 5IFAH 3VD4A 1ONQB 5EU7E 1Y18B 3MROB 2BERA 1C5CL 2JJWA 4LNRB 1VGEH 3UPRB 2LVCA 4JFZH 4M1DH 5L7XL 1MJUL 4W68A 5E70A 5JQ6L 4WFFE 1MREL 4XMPH 4OFDA 2E6JA 2FEEI 5E4EC 1OP5H 3W9EA 2FJGB 1FFOA 2PO6A 3OB8A 2P5EE 3RWJA 4HDIB 4CAGA 1KBGH 1U8PB 2NCMA 3FKUS 1MWAA 1FL5A 2ZOKB 4XCCL 1LDSA 3PHQA 4IHOB 5FA3B 1I3VA 4YHMH 1OARH 3BP6B 1VEPA 1ZT7A 5TDNA 1ZLSL 1NCUA 3ZYIA 2UWEA 3QUZA 1D5MB 1FIGL 2NY3C 4Y4KC 4H0GA 1BWMA 1YEKH 3VXSD 1J9CT 2CLRB 4K71B 4CRPA 4O58L 1U95A 1KENH 5HHNB 4LP4A 1S3KH 4JFFE 5ETUB 2UYLA 1B88A 4N90E 4NZRL 2P49B 4WI2A 4W6WB 3D5OF 3RUGA 3TA3A 4KK6C 3C5ZA 1I85C 2B2XH 3KPLB 4L8DA 1DQQB 3MYJB 2VXQL 3AU1B 1CGYA 1JK8B 5T5FH 1Q9KB 4JN2A 5C0CB 3ORJA 4HD9A 3MRIB 1KT2A 1F3RB 1O7VA 4P5MA 1G7HA 1IAMA 5D93C 2QL1A 1ZK9A 3PJSA 5IVZB 3VFTA 3WS6C 4XCYA 1AO7A 3HG1D 4Z76B 4M5YL 2EYTA 4GG6E 1BIIB 3IB4A 1NEZG 3QIWA 2NY5L 4FXGA 2VLRB 5B39G 1F3JB 1GGUA 3FFCE 1VHPA 4HKJB 1MCNA 4JDTL 4Q2ZB 4PJEB 3WO4C 1TJIL 1INQA 1TJHL 3ZE1E 3I9GL 1KPRA 4FQXB 4N0FA 3W9DA 4UB0H 3C08H 1RUAH 3DI3B 3IRZA 4LSVH 5LGJA 1F90H 1ADQA 2MWCA 3K3QA 3BIAX 4NQXA 1Z9MA 1CF8H 4EBQL 4WWKA 1UQSB 3ARDC 1KLGA 2D2OA 5CEZL 1ZHLB 2Z35B 4OF7A 1IGCL 2D7TH 3WNMA 4HK0A 4Z7QF 4X6EB 4MNGB 2Q76B 3QG6A 4KHTH 1HH6B 4U6YA 2JIXA 2GJZB 2R1YB 1ZT4B 2V2WB 1NGWB 2R39A 4M5ZL 5D9SA 1OTSC 5LGHL 2P5WE 5E2TL 3JV5A 2WQRA 1UWGL 5B3JE 5GXBB 4EI6B 3RIAK 1F58H 4HIEB 3FO0L 5BOPA 5GS1A 3QQ9D 2R9HC 1EFXB 2DQEH 4E5XB 1U8QA 1FE8L 1CDBA 1B2WH 1ZTXL 5EC1A 2DWEA 2R2EA 4HMEA 4JDVA 2Z8WC 5IVXF 4YFLI 2GAZA 2BZDA 4XI5D 4HWZA 1ACYL 2W0KA 1EXUA 1RVFL 4J2XA 4LBEB 3HMXH 4R4BA 5FKPA 2C5DC 3GEWB 2DM4A 4QGTA 4J1UA 5EULV 4P2OC 5KSUA 4YDVA 4XCNA 3OSKA 3C9NA 4JREC 4KK8D 3EYQC 5GGQH 4FNLH 3EYVA 3MUZ1 4LSPH 3MRBA 5F6IB 4X80H 2AABL 5T1DL 4U0QB 4X7CC 2NNAA 4P23C 3A6BL 4RBPK 5C2BH 4JFQB 4HH9B 4ZPTA 2WBJC 3T4YB 3I84A 3Q2CA 3O6LH 4PJBB 3RDTD 3S36H 3DX9B 3DX6A 3BEVA 1PG7X 2C26A 5A1AA 5KVGL 4KI5C 1XCQA 4LAJH 4WFED 5CP7A 4ZOAA 2NY6C 3DHJA 1YMHA 2VDKH 1VGKB 2I25N 1X7QA 1T1XA 3KYMA 5GJSL 4RZCA 5I8KL 4HCRL 2KZWA 4KKCC 2R15A 5IT2H 3GSQA 3LRSB 4ZYKA 2MCPH 4W6YB 1CGWA 2Z31C 1NCTA 4A2LA 1MPAL 1TENA 4NM4L 5ICXB 4V1DB 3TBWA 1CU4L 1UKSA 1ZA6A 4LF3B 3QH3A 5JO5B 1MJJB 3NA9L 2C1PB 3P4NB 3MNZB 4HMDA 4U1IA 2HJKB 1W8NA 2AQ3A 1QD0A 1BOYA 3QXAB 5JXAL 5DD1L 3V4UH 3DIFA 3KHOA 3OKNA 3MV9E 5DVOA 1HSBA 1BPVA 3EOBB 1H3UA 3L3GB 5GGUA 4UQ3B 2IQAA 4X6BA 5D1ZD 5CGYC 2AKRA 3IFNL 4CL7A 1XIWC 3LOWA 4HS8L 1CD9B 1T66D 1A9BB 1RZIB 2JJTA 1ZOXA 4ZUTB 2IJ0C 4L4JA 5A3ID 2ITCB 2YD9A 3K1DA 5CILL 3OZ9H 2ZG3A 1JNLH 4PRBA 1P7QD 4EI5D 1DDHB 1JE6A 1U8IB 3V9FA 3IDIA 1FSKC 3U4EB 5C0FA 4OIIL 2FR4B 4IRSB 1U2HA 3QRFM 2BCKA 3S8WA 1QA9A 4ZMAT 1S7VB 3TT1H 2VZTA 4JANA 3MREB 4H25B 4WHYH 3BP6A 3LKNB 4OZFH 5F7KC 1DBAH 2JB5H 4L3EE 4X7TA 4X7DC 3UTTA 1AHWC 5ITFB 4UINH 3N06B 2CLRA 4ONGL 1T89C 3QUML 4M7JL 3B5GA 3NABH 3UJIH 1BEYH 5E4IA 4ZFGH 5ETUA 2WBWB 1CDYA 2VZVA 3RIFK 3S5LB 5HHXL 4S10A 5E8DH 4PJHF 2MTPA 2YUXA 1MUJB 3V5DB 3LQAC 4WFGE 1JK8A 2P8MB 1BLNA 4JG1H 1KJ2B 3OL2A 2RQ8A 1R3IH 1MCDA 3D39E 2DQDL 1AGBB 1AXIB 1DL7H 4X4MA 1YY8B 3G5ZA 5C0DA 5ISZB 5IVZA 3FT2B 2FGWL 2QADD 3T2NH 4NHUB 4LGRB 1GIGH 4YXKL 3CMGA 2M8XA 2HRPH 2OQJB 3ZTJH 2F54A 3RZWA 4LLUB 4G9FE 1CFVH 3HE7B 3NH7H 2ZNWA 5JXEC 3DV4B 2IG2H 4PD4K 2G75B 1QLEL 3UTZA 3F12A 4NZTL 5M95B 2XTJD 1RURH 2CKBB 5ADOL 2XWTB 2APXA 1YQ2A 1FC2D 4H0IA 4UMGA 5I8EB 4DJMA 3LD8B 4U7KA 1HXMB 2ZG1A 1TQBB 3NGBB 3FQWA 4KC3B 1ZHLA 5KTEL 3C8KB 4QRPD 4RIRA 3MRNB 3MRFB 2YA1A 3AS0A 1BX2A 1NGYA 4MNGA 4ODVH 4JZJA 3IFOB 2GIYA 3MRQB 4ZUVA 4YDIL 1D5IL 4XZUB 5HI4C 1AY1H 5GISH 1OWRM 3ZDXE 4WTZA 4Z7WF 1JZ8A 3C6LC 2R4RL 4LVNB 4G6FD 1MAML 3ZYOA 1N6UA 2ESVD 1G0DA 4S1RL 2X1PA 3VI3E 4MQXC 4PJDF 3S9DB 3OF6D 4ONOA 3GMQB 4JVPA 3MO1B 3MRHB 5DC9B 5FCUL 2YRPA 4PJIA 1JNNH 3AREB 1BVKB 3VFGH 3O0RL 4K8RL 5JHLH 1SHMA 1HKFA 1TJGL 2DL9A 1RD6A 1FHGA 2AJ3A 1RUMH 3WFCH 1Q0YH 4FP8L 2YPVH 4P5TD 1QRNE 1OOAA 1N2RA 4YNYB 2IWGA 2VR5A 2V7HB 3G5VB 5ENWB 1ZT1B 4R4FL 4PS4L 1QQDB 2PXYD 1I75A 1UH4A 2P45B 1GGIH 2GK2A 1EHAA 1OP3H 4MDIB 1CFSB 2VDNL 4HFUH 1UJTA 5JHDB 1NAKH 3RTQB 3LKSB 3F6IA 5FGRA 2HKFL 1WFNA 3MA7A 4NN5B 1K6QL 3M45A 3GMPB 1FZOB 2MFNA 4R97C 1ORQB 3G08B 4W4OC 1F4XH 3TBYA 3O41A 5FYJL 4U1GB 2DQCL 4WI3A 1FRGH 2GSIA 1N5AB 2OTWB 1G7JA 3G6DH 3OR6A 1JVKA 1T7XA 1EERB 2FHCA 4KUZL 2C3XA 2HMID 3TT3L 4G6AD 2GSGA 1VGKA 4PJFA 3B9KC 3OKYA 4LRIA 1BVZA 3GK8H 4LOUC 4OJFL 3SCMB 4RWYL 3BXNB 4FFZL 3W82A 2OS7A 3FB8A 4YHIB 4XB7A 4EIZC 1R3LB 1RMFL 5J0BA 1U8MA 4UT9L 1CXKA 3SGKC 3QWOA 3HKFA 2EDHA 5DJAB 1MI5D 1TZGH 2ZP0T 2ZCKH 1QSFE 2APVA 4NO2B 3N50A 4QRUB 1LVEA 2WMPA 4HBCL 5T1LD 2VKXA 3O2VH 3DUSA 5DD0L 4XAWL 4K3JH 1CXIA 5CKGA 1ZV5A 3B2UC 4XP5H 5H94B 2R0ZL 4K2UL 4NSKA 2DLGA 3QXAA 1KJMB 3EIFA 3U30B 1T7ZA 3MRKA 1ZGLM 1SJXA 4NWUH 3QEQA 4XNMA 5FGCE 3W81A 2DM2A 2VL4A 4OLUH 4PJCE 3TZVB 5L2KE 4GRWB 1V3MA 2JK5A 1HIMH 3VXUB 3RVVC 2PO6D 2R1WA 4HW6A 1I7RA 3PWPE 3QEUA 4Y5YC 2FJFB 4IRJC 2DD8H 4X99A 2DBLL 4M1GL 1RU9H 5IB3A 5F3HA 3PGFH 3P73A 1OTTC 3GSVA 4X8JB 2A2QT 3TPKA 2N7BA 3V0AC 4ZQKA 2Y06L 2YPLB 1DDHA 1M7DB 4NO5A 4ACPA 3QNZA 3UPAA 2CGRL 5KSBB 5GGTH 3ARVA 4YE4L 3VW3H 3P30L 2BDNH 5EUOF 5F7LB 3T77A 2VZ1A 4ZD3H 1A21A 4POZD 5DJ6A 4HUKB 4P59H 3MV7B 3SDYL 4UNUA 1F2QA 4M61B 2C3WA 1CZ8L 4M1DL 4GFTB 4Y19E 3TA3D 3C5ZD 1EX0A 3KJ4C 1EMTL 4ELKA 4HJJH 5C0RH 4JPVH 5I9QC 1OP5K 4Z77A 4XAKD 4ISVA 2BY2A 1KCKA 3RX7A 4X9BA 1Y6NR 1YYLL 1A02N 5E7FA 4G8FA 1FV1A 1TTFA 3QEHA 3QI9A 1AO7D 3GBML 4JM2D 4U2YA 4PJBF 3MUGB 4TVSa 5IHZB 3QIWD 5EZLB 4MLIA 5DQ9A 3F65A 3ESVF 5JOPD 2GY5A 3B2VH 3B3IA 5ILTL 1KJ2A 2HN7A 2ICWI 1H3PL 3MV8D 5DVNA 2ZPKL 5F9JB 4JRYB 4YWGL 4QRTB 3KGRA 3VFWB 3SPVB 1NLBH 1DUZA 1P4BH 3CXHJ 4QY8B 3UYOD 4LAQH 3CC5A 2VZOA 3V0WH 1FFPB 4IIQB 1OTUC 4NQCA 4P3CL 1R0AH 1EHXA 2X70A 4U0RB 1JF1A 2YD8A 3KAAA 3NCYS 2OQJA 4PV8A 4WWKD 4HPYH 2VNCA 1CK0H 5T5FL 5I1DB 3K4DA 1A3LL 3RNKB 4IDJL 3KYOB 2HLFC 4J4PC 1SJHB 3VD3A 1J0YA 4QRRA 2LABA 3HC0B 2C3VB 4GBXA 4YHNB 1B6UA 3NCMA 2EE2A 3GM8A 3S4SA 2XKNA 2JJSC 4CVUA 5A2JH 5DWUH 2ATPA 3JSSA 1A6TB 4BH8A 2Z8SA 2FRGP 2NLJB 4KMQA 1X5ZA 5CAYB 1G84A 1A3QA 1QYGL 3T3PF 5IF0A 3MRQA 3NIFE 4OTXH 1J1OL 5FXCH 1BD2E 4PP1C 2FH6A 5L6YH 2QR0B 5DA4A 2DM3A 2QADB 2X89A 3PDDA 4I48B 1NGZA 3C08L 5D6CB 1F90L 4Q97A 5D7IE 1G6RL 4LSTL 2AQ2A 5C0AA 2AK4B 5I16B 4JQVC 3MO1A 3QEGH 2G5BA 1NBZB 5FYLD 3RL2B 3LRGA 4P49A 3RKDD 4RMTA 4CU6A 1TVDA 4Y2DC 3O9WC 2OL3H 5C9JA 4KHTL 4AEFA 2DJ4A 5JORB 1JGDB 3H3PH 1MFEH 4G6JL 4WHYG 2W9EL 4ETQA 2R2BB 4NKQB 4OV5B 1PX3A 3KPSE 5F88A 4P2RE 4WV1A 2X1WL 1LO0H 4MA7L 4Q9BA 1WFUA 1HQ4A 4DGYH 5I75C 5GZNC 3NMEA 4HSQA 2XTLA 4NKMA 3QZWB 1LQSR 1UZ8A 4Q6IB 1D6VL 1F58L 4GUPA 1UM4L 1NL0H 1SBSH 3PDGA 5SWSB 4EOWH 1FDLH 2DQEL 5D1QA 1T5XA 2QJDA 1FZOA 1B2WL 2ESVB 1Q1JL 2FWOA 3SOBH 4HXAH 3VXOB 1OAYL 1RZ7H 2NY2C 4OFVA 4U6XB 2BJMH 2FHFA 5J6GB 3HMXL 3QA3A 1YZZA 3ZHDA 4YDJA 3MXVL 4QT5B 4NQEA 1N5AA 1YECH 1DQDH 1ODAA 1CDIA 3ZKMC 5JLZB 3ZL4H 3AC0A 1P7KA 3F58H 4JLRA 3D2UB 2VJXA 2AERT 2AJVL 1KGCD 3EOAB 4RRPG 3VCLA 2EDDA 2YA2A 1N59B 5HHOE 4PRPA 4U1HA 4MA3A 2Y23A 4BSWA 5DMGC 5HHVH 4LSPL 4HX1B 4D3CL 4X80L 3ZT7A 2DQJH 5C08D 2NZ9C 1JWMB 2HTKD 3BDXA 5C2BL 2CRZA 3WFDH 4OCWH 4IJ3B 3RZCD 4P48A 1YMME 4HUUA 3B9DA 5GS0D 1BBDH 2B1HH 3T65B 3GSXB 2VITA 5FO8B 2EDEA 5JPNA 4GW1B 5HYIA 5JW3H 4NZUH 2YOCA 5CD5C 1H3XA 2XPGA 1KNOA 1NDMB 3NPSC 3O8XC 4I5BB 4MCZB 4TUOB 5EU6A 3GB7B 5BS0E 4QNPF 1EEUA 2WINA 3DSFH 3D69B 5C0GB 1M71B 2WZPD 5D1XA 4KJPC 3IKKA 3VGAC 4DZ8A 3IFPB 3RPIA 3MPCA 3NIDE 4QTIL 1BM3H 1IC7L 4CMHB 1E4WL 1FZMB 4PRIA 3WO4B 3X12B 3SE3A 1DANU 1M1SA 3T0EA 4WUUB 3HRPA 5I76A 3WHE0 1BZ9B 4PGCB 3QG7L 4F80A 4R9HA 5IK3A 3NFNB 3GSNL 4LCIH 5D2LE 4L8CA 5DD6B 3FONA 3KWWB 4QRQA 1L0QA 1DEDA 4XNYH 2BHUA 5JW4Q 3EAKA 1CR9H 5IEKB 2W65A 5JOEA 5JR1H 3MGTA 3MXWL 4GXVL 2YPLA 4NRYB 5E99L 1KCLA 3UTTD 3PQYE 3NAAH 5GGRA 3S97C 5E1AA 3QULB 4J6RL 3H6JA 4O2FB 4PP2A 3SKOB 1IC5H 2MJWA 2XKUA 3SO5A 5ERWA 2ZNXA 4HUWA 5JDSB 5ALCL 5IR1A 3D0LB 3V4VL 1LEIB 2PF6A 1NC4B 5FGBA 4F7TB 3FZUD 4FXKB 4X5LA 4JZOA 3DUUB 4PJ8B 4UT6H 2YD7A 5TDOA 4H8WH 5HYEA 5IB5B 1JNLL 3MLVL 5KVEL 1A7BA 4LIQH 3LN4B 5IW3A 4S0SD 1E4KA 3VFVB 1MLCB 4LHUG 3ZE2E 4G8GE 1JTOA 1JF5A 1CFTB 1U8HB 5C3TA 3O6FB 2RHEA 3MODL 2CQVA 5EZLA 4I3SH 1CLZL 5LCVL 4Z7VF 5CSZA 4MAYC 15C8L 3L5WB 2JELL 2F54D 3QDMD 4PY8I 5F9JA 4Y7MA 5CUSH 3RIAF 1MF2L 2NY1C 4LSUL 4JFEA 2GTWA 2PYEB 5CMAA 4EVNA 1CGTA 1IKNC 5EO0A 2DAVA 3MJ9H 3NZ8A 2X09A 1A6PA 3MLRL 1NAML 2DLFL 5F9WC 4JFHE 3FAWA 5DUPH 4LLMA 3BP4A 1FNSL 1UYWL 3KPQA 2R29L 4TTGA 1Q94B 1I8KA 1Q9OB 4TVPD 4DEPB 4NQVA 5CWSA 2FJHB 1WGOA 5D7JC 2UZIH 5I15H 2R69H 2C3VA 2M2DA 5K9KA 4UT7H 3FOMB 5EORH 2LVEA 1V7ML 1M4KA 4JM2B 1WC7A 2J8UE 3AAZB 4RMUA 1T1ZB 4ZUUB 5FUZH 1IAIM 2NLJA 3P77A 4BSVA 4TNWK 3BEWB 3TFKC 1GIGL 4PY7A 1Q9WB 4GRWF 3LN5B 3EZJB 1O0VA 1ND0A 3SJVD 1D9KA 1FO0H 1SM3L 3BHBB 3VJ6A 4Y4FA 4JHWL 1A47A 1A14L 5EA0H 2PKDA 5D6CA 2Q8AL 4RGOL 2VABA 4HK3J 4UUJB 1U8LB 2XWJB 3UBXI 1FJ1B 1SYVA 3PWJA 4DTGL 1RZ8A 2CSPA 2Q86B 5KSBF 3QNXA 4YUEH 5DHYB 3HZMA 5IROA 2AXJA 3LKOB 4DUXA 2Y6SC 4U1NA 3GMNB 3SKMA 5JORA 5T33L 2WIIB 4CVXB 4WNQB 1AY1L 4L4VE 3ULVL 4ONHA 3VRJA 1DLHA 1RK0B 4DGIH 3O4LD 5ESAA 4NCDA 1T1YB 4QHLB 3U9UB 3Q5OA 4GRLC 3OKDB 2AXGA 2CLZA 3DWTA 5D71H 4HEPG 4YQXL 1A6UL 5HVHB 4ELMB 5DD3L 1D7FA 2Y72A 5FCSH 4XPAH 2ADIB 1BQHB 3NZHL 1WWAX 4EQ3A 1IM9A 5MENE 1LD9A 4TYUA 1Y6MR 3BGFC 3WS3B 1S7SA 5E5MA 4D9QE 1RUML 1DE4B 2Z4QA 3LB6D 3BYYA 3QCVH 4NNXB 1C5DB 1YC8A 5J6GA 4K3DL 2NY4C 5E00A 2FIRT 1Q38A 4JFPA 5J13B 4Y4KA 5JOFA 1UB6B 5I19H 5IW1B 1GGIL 4PRHB 3NACH 1I3RB 5F1IB 2J1KA 3EO9L 3OKKA 2ITDB 1I85A 4K94H 1R6VA 4HWUA 2B0SH 3WO3B 3QEQD 5EUKA 5IGXH 2VZ3A 3MRPB 1FRGL 3T65A 5E8NA 3IKCA 4MNQE 4OCSH 3UTQA 3DTXA 2P5EB 1REIA 4H88H 4TTDC 2OZ4L 1AXSA 3WS6A 1NDMA 2FBJH 5EZJA 4H8WC 3SDCC 2PUQT 4TUOA 3CVHB 4TULL 2J2ZA 2BY1A 3REWB 4ZFZB 3QUKB 1M05B 5M94B 1NBVH 5IM7A 4BZ1L 5BRZE 5JW4N 1NCNA 1OD9A 3IT8D 1S7UB 4NBYB 1QR1B 2QHRL 1RULL 3X12A 4JQXC 4P4KB 2HT3C 2YD2A 1BZ9A 3GHEH 4JFFB 5EU3B 5GS2D 5DO2D 3VWKC 4KKLD 5CCKL 2NXZC 5IP4A 3S3JA 5HD8C 1AR1D 2P8PA 5CBEA 4QWWD 5CGTA 5C08B 1AQKH 3ARDA 1HINH 1GZPA 2K9UA 4GW4B 3RZCB 5EH1A 5F7DA 1R3HA 3RY5A 3PP3K 3STZB 4MB5A 3QISA 2VKWA 3OB0H 3ALXA 1KIRA 3OR7B 4HK3N 4OLUL 4G8IA 3RI5K 4I2XE 1K4DB 1IGTA 2L4OA 3BSZH 1CDJA 1FC1A 2I9TA 4NJ9L 5B22A 3BRDA 4XPFH 1D3CA 1UB5B 4GG6B 3L9RB 3MFFB 4R0LB 2X4NB 2VXVH 1F4HA 3QI9D 4LKXA 5AAWA 3HC4H 4U3XA 3FFCB 5BMFH 2IH3B 1B0GA 3PGFL 1LDPH 5T5NG 1P69B 1XGRA 3PDOB 4NQDB 4MMZC 1HYSD 4X6DB 4YC2C 1XF1A 1HHHB 3VFVA 1OSZB 5J56B 3IJSA 2IQ9H 5C07A 4N0CD 3MMEA 5E8EB 3RWGB 3VGBA 2AEPH 3IDJA 3RA7H 4NQCD 3ARBD 3U2SA 5FM8A 5DHVA 5FO9A 2FX9L 1OAQH 4JO4H 1HSAB 2HH0H 5D7KE 5T1KA 4L8SC 4UAOB 1IGML 2OJZH 3LRHA 3WE6B 2H32A 1CT8B 4P2OA 3BT2H 5C0RL 1X5YA 1TCRA 4PTTA 2P24A 2H6PA 4GSDH 5KW9H 4MQ7B 5DT1L 1CFQB 4QRRD 5M7QA 3SE8H 2FX8H 3GIZL 4HBQA 2OK0H 3FHQA 5L0QC 4YPGA 4P23A 5D7SL 5DDHB 2WBJA 4MYWB 4EDWL 4MJIB 4O2CA 1WF5A 3CX5K 4JHBA 4NCC2 5E7BA 2BSED 3DECA 3QIUB 2CR3A 5F9OL 5HYJE 5DJ2B 2VDPL 2DYPA 3EO1A 1U3ZA 5TE7L 4FFYL 2NTFA 1JRHL 4U1SB 3N1GC 2X89D 1F00I 4ODXB 4QCIA 5IKCA 4GW5A 5MERA 2Z31A 1B90A 1IKFL 2DQHL 4HPYL 5FB8B 5L2JA 1LEKA 5GIRB 1S9VA 4WU5B 4I0PC 4OI7A 4LLVB 3JTTA 1S5IL 2IH1A 3CFBB 5DK3A 1XH3B 1DQJA 1I1AC 2CK0L 1YN6B 3HTLX 3NIGE 3QO1A 1DSFL 3H9SA 4JRXD 2OI9C 4RGNE 2QQQA 5F93C 5KJRL 4E41E 1HHIA 2ZUQC 3TIEB 3U46B 5CLWA 5EZOH 1KXVC 4NO3B 5F7EH 4A2MA 3SDXA 5CEZD 3HI6L 2IFFH 1JYWA 2A6DA 3FOLB 5HXMA 1HILB 1XIWA 2WANA 5HJ3A 4Y5YB 3MRMA 2BVPB 1R3JA 3JUYA 4RMRA 5D1QD 4I9WD 1T1YA 1S9XA 3VDBA 4UIMA 2ZKHL 4HT1L 4PGDB 5JZ7C 3MZGB 2IPTH 2ZSVA 1QFUL 2DQTH 2EZ0D 3FTGB 4APQB 1XF5B 4U6HA 3RFZC 4OQTH 3SJVB 1QFWH 4NQED 2NR6C 1B0WA 2OL3L 2ADFH 2P48B 3SE9L 2UY6A 2WWKO 4WU7A 5T1MA 1DE4A 1TITA 4OAWA 3WJJC 2J88H 3LVEA 2XYCA 4PRPD 4Z0BH 1P7HL 4PGBA 3LY6A 3MV9B 5F89B 1AHWA 4EKXA 4Y1AE 1WAAF 5IW1A 1T89A 2VISB 1IQWH 1JPGB 3FQXA 4NFDA 4MSWA 5JIIA 1SBSL 3FQTB 4EOWL 2CDFB 3M1BB 5F21B 1N6VA 3H9HB 3H2WA 3HRZB 4KV5E 5FA4A 4OCNC 5EU6D 3UTOA 4F7EB 3SOBL 1J05B 4HXAL 1RZ7L 3LKQB 5GHWH 5D1XD 4ZDHB 2HJFB 3U83A 2AJYH 2JE8A 5KSAB 1ZHBA 3ZT5A 1UM6L 3EJYD 4P57A 5MEQB 3HZKB 3BQUB 4PRID 4DVBA 4E9LA 3J8F7 4I8DA 3QCTL 3T0ED 4XVUD 3O3BB 3KLSA 1MCPH 3ZL4L 4DUVA 4JM2F 1NCAH 1NANH 1IL1A 1Z5LA 3CZJA 3UCRA 4M62H 1KV3A 4FHBD 3QUKA 3OAZH 2H26A 3P4LA 5KVDH 3EUUA 1NFKA 4U1MA 5E8PB 2IPKB 2Q3ZA 4L3EB 3E2HC 2FB4H 4ZUWB 3VGDA 2DQJL 5DRXA 3U36A 4ZNCD 1S9WB 5HYFA 5JXEA 5AUMA 4NT6A 4PGEA 3WFDL 5J3HD 2CK2A 3GDBA 3THMH 4A6YL 2J12B 1E27B 2DQUL 2H2PD 1R24A 4QGYA 3TN0C 2PYFB 1AQDB 3LQZB 4NKDA 4KZDH 1CCZA 5CS7A 2CPCA 3DSFL 5EZIH 2XRAH 3TH2T 1YJDC 4KHXL 1UA6H 2R4SL 3HFMH 3KPNA 2Q8BH 1VESA 2IGFH 3STZA 1BM3L 3CZFA 5JW5A 3D39B 4QHKI 1QO3B 3OR7A 3VG9B 2UZYB 2NY0B 2Y5EA 3L3KB 2DBJA 4XNQB 1J5OL 4QXWA 2X4RA 3C6LA 4PJ9B 4DVRH 3D0VB 1UB5A 3VFOA 3OKEB 4X5XB 2VC2H 3BW9B 3NFSH 3JXAA 3BISA 3BPNC 3PWVB 3MX0A 2BMKB 3WKMH 4F33A 2I9LB 4ELMF 1OQOA 2A74B 4H1LB 2CDEB 4PG2C 4Y5XC 2IH3A 4RFOH 5TE6L 2WUBH 4JEGB 1XF3A 4G9FB 5DGRA 1DP0A 1U6AL 2FYYA 3LKRB 3QIBC 3G6JA 3NAAL 3GJFH 4ZOBA 2E3VA 5J12C 1JHKH 2F5AL 3KPOB 4PB0H 4X7FC 5HDLA 1N5YL 3WHE1 2XFXB 4JFED 3ET9F 5BO1L 3GMOA 1VACB 3HI5L 1BGXH 3VMNA 1R5WA 3OXRA 2DTML 3GRWL 1U36A 3RP1A 1FL3B 1IGIH 1S7TA 2X42A 4YK4C 2P8LB 1ES0B 3QUYB 3T2OA 4Z18A 1HZHH 5I75B 5MI0C 3U0TB 4UTAH 4NOBA 2XQBH 2ZJSH 4UT6L 3CFIC 2BNQE 1MRDL 4DQOH 1IRAY 2UUDK 2RBLA 3UTSA 4NQSB 2E9WA 2NMSA 2ZUWA 5D72H 1G9MH 4HF5H 3CFKB 1INDH 1PSKH 2P5WA 1J0JA 1GGBL 4W4OA 4HWEL 4HHAA 1MFAL 2B4CL 5FYKL 3CD4A 3RL1A 1WWBX 4CU7A 2WBKA 2XZAH 3DLQR 1OVZA 4ZXBB 2DMKA 3K2UH 4PJ7B 4RAUB 3SDDB 4G43A 4F7CA 3B5TA 4U7SA 5HGDB 4YHOH 4YFEA 1D9KD 3B9KA 4XP1L 1MFDL 1RZGA 3PP4H 3BFOA 4RGMB 4OLXH 1QRNB 2C1OB 1X5JA 1YEDB 1ZKAA 3ROLB 1T83C 5L9DH 3LIZL 4OGXH 5GRZA 4F3FB 4PJGA 5TQ0L 3SGKA 1PKQA 3CU7A 4OZFA 3FRUA 1PVHA 1UM5H 3BYTA 4ERSL 4L4TA 4P2QE 1YEFL 3W2DL 2R69L 2X4TA 1HN1A 5DEGB 4UDUA 4WVRA 1XH3A 3MBEC 2OTPA 4PBVC 3EKCA 4WY7L 2F74B 1IAIH 1MEXL 1KCSH 5TGBA 4FQHA 3G5XB 5FOBA 4F37K 4MB4A 3TV3H 5SX5K 3DROA 2OTUA 3G5YA 4EN3C 3O6KL 2MPAH 3QDGE 5H2BB 4Z7QE 1EO8H 3L95A 1CE6A 3LEVL 4Y5YA 4FQIH 4IRJA 1IM9D 3IXAA 2P46B 1H9VA 1M7IA 3K8KA 3VFSB 4CVZB 4K7PL 3ZKXC 5I0ZA 4HC1H 5ACZA 4R4NC 3AMLA 4X6DF 3HNVL 4P9HH 4MD4A 2OJEA 5A2KH 2NY3D 4Y4KD 1YPZE 5E6IC 3WKNA 4YUEL 4KK5C 1QSFB 3T08A 4FRWA 2QV2A 2XI9A 5DMIL 1FNGA 3WCYA 1WIOA 4KZEH 2COQA 1K8IA 4JJHA 2O5XH 4K8RD 1RI8A 1C12B 1MCBA 1HKLL 2VDML 1QZ1A 2A0LC 1ZAGA 4X5WB 1BVLB 5EPMB 4KK6D 4HZLB 4FZ8L 5IVXE 5FGCB 4KPHH 2AJXH 1YA5A 1MCHA 2CDGA 3PABB 5LQBH 2RIKA 3ARWA 1JP5A 1ULVA 4JR9H 1BQLL 4BQBA 3M1BA 1EAPA 4GLRI 3UTPE 1T3FB 1R3KB 1X4YA 3LMJL 1DANT 1P5UA 3V0VA 4HKZA 1BAFH 3HUJB 4YHPB 5AYUH 3P9WB 2GITB 5D8JH 1I9JH 1CGVA 3HPJA 1PD6A 3DVNA 2JB6B 1L4IA 3MLSL 1T0MB 5KVMC 1LE9B 5B3NA 5FYJD 4I3RL 4K23L 2NY1B 3OAYH 3NACL 4G6ML 2VIRA 4TQEL 3UZQA 5MEOA 1N4XH 4I0CC 2FO1A 1TZHB 3NCCB 4PGJA 4DOHE 4CNIA 3OKOA 2IADA 4Z95H 2GI7A 4IS6B 3PIQB 3RWIB 3P4OB 1F4YH 1OL0A 4NPYB 4J3XA 1A7PL 4LARL 1MCOL 3W5MA 4K94L 4X4YA 2F58H 3CSGA 3ARDD 1TNNA 2R56L 4KRPD 4UOW0 1UGNA 2VSCA 4RFEB 4O9HH 3X3GH 4J4PA 4QHUB 4H20L 2A6IA 1FGNH 1NMBL 3I2CL 2ENYA 5KVFL 2DN7A 4X4XB 4HV8B 1V8HA 3QJHB 1AQDA 1F97A 1LO4H 2JJSA 4JFDE 4ZUSA 5IFJA 3G04B 3ZYZA 1CXEA 2VAAA 1OTSD 4RMQA 5I74C 2VE6A 4H5SB 3GBNH 4GKZB 3MRCA 1G9MC 2B5IC 3FT4B 3LV3B 3D39A 2NXYC 4N8VA 3QRGL 5HI3C 3CFEA 3KYNB 2I07B 2HFFA 1JGVH 1J86A 4WI4A 3WSQH 5C07D 3WLWC 1XGTA 4XVJL 4C57C 3VXRA 3PWVA 3QNYB 2DMBA 4K3HA 4H1LA 4WI9A 2CDEA 4PJIF 2Z91A 1FFNA 3L3IB 4JQVA 4TNWF 1TTUA 1OLZA 2XZQH 4GAGH 5INDA 1S78C 4N0UB 5I6XB 1HI6A 3TESA 5BQ7A 4Y2DA 5T1KD 5IHUH 3O9WA 2E9IA 1MHPL 4P2OD 1TPXC 5DS8B 4WW2C 4P5KA 1EVTC 1QBMH 4WIQA 3D25A 3WIFA 2EXYC 5FHAL 4XPFL 1B3JA 2RB8A 3NCJL 4AIZA 3L3DA 4M43L 4P23D 1E6JL 1S8DB 3HC4L 5I2IB 2WBJD 2ZOLA 1NEZB 4HS6B 3REVA 1I1YA 4BQCA 3BKYL 4M8QA 4AIOA 1BD2B 1W72H 1SEBB 5B39B 1QHPA 2CJUH 4KI5D 4Z6AT 1KFAH 2NY6D 2IQ9L 4X98A 2DYPD 4KJQC 5J1AB 4AJ0A 3H0TB 2AEPL 1BFOB 3B9AA 5D7IB 1I8IA 1GC1H 2NY4B 4KKCD 1H8SA 4U7MA 5CBAA 5KZCB 3EGSA 4N1EA 3RA7L 4P2YA 3QXWA 3EFFA 4PJHE 1BFVL 4J3WA 4JO4L 2GYSA 2HH0L 2PW2B 3C5JA 3WFBH 2OJZL 4PFEA 4R90L 3I85A 4M3KB 4GOSA 5FECA 5FDWA 2HKHL 2G60H 5EOTA 3NBNA 1YEDA 3SE8L 5GGTA 2J4WL 3LH2H 4GAJH 2J8HA 4KMLB 5F7UA 3H9SD 5D70H 4G7VL 4X6CA 3T04D 1FNAA 4P3DA 4N5UA 3VFUB 4Z5RB 3Q6GH 5DC0A 1UXSB 4KQ4L 1ZEAH 4OFYA 5MP6L 5CGYD 1TETL 3QUMB 5DJZB 3O8XA 4FMFA 3KJ6H 5CZVL 3CPLA 3BH9A 1A4KA 5ID1A 4FFWD 3LDBB 4XWOC 1EBAA 1WBZB 4FQJL 2B20A 1MCRA 1RUPH 3SGDI 2EDNA 5ICZB 4HKXB 4WDIA 1BHGA 3PWLB 4JAMA 3GIVB 3MNVB 4X9HA 1NGPH 5F71A 3TWCL 4M6NL 2CIKB 4K9EH 5GGVH 4Y16C 3MSPA 4BFIB 2FIKB 2Q1EA 4Z7WE 2DLHA 1FNEB 4POUB 4CMMA 2EDQA 4XH2A 5E8OA 2Y5TA 3TIDA 4OZIA 3RVWC 2VLMD 2YN5A 4PJDE 3D3VE 4ZO9A 3OBAA 2QQNH 2FL5B 2NY7H 5EIQA 4OLVL 4FTVB 1A1OB 4HGWB 1Q9LB 2CD0A 2MQ3A 4KH2A 4F7PB 5DMKB 3QFDA 4WO4B 2VXTH 1J0KA 5HPOA 1GOHA 1G9EA 3MLYH 2IPTL 4NDMA 4XXDB 4WFFD 2DQTL 2F5BH 3GJEB 1FNLA 5CJOL 3EHBD 1YNTA 3IFLL 1R5IA 4PJCA 5BVJB 4OQTL 4YC2B 5DUBA 3ZDZF 5F9AC 5L2KA 3CIQA 1QFWL 1WZ1H 3PWPA 1B4JH 4GXUN 4R7DB 5F1NB 5D2LB 5C09A 4JY6B 1XR8A 5FUCE 2DB8A 4EUPH 2I60H 2EYRA 1AE6H 5ABDE 5DZNA 5GGSB 3JWOH 2BHYA 2ZUTA 4PJ7F 2GUOA 4MAYA 4OLYL 2HAZA 2MMXA 4L8SB 3VE0B 3KPRE 5D7LA 1XGQA 2BSSA 5FYKE 5JXED 3O3DB 4YBQD 1CXHA 1LO2H 2EDJA 5EU4A 5KANI 1IQWL 2MOVA 3OXSA 5K59F 1IKNA 1UCBH 2EH7H 2ZCHH 4N90D 4LU5H 1VERA 3U0WH 5FV2A 4Y19A 4L3AA 5L88H 4I4WB 2PNDA 4JJ5B 1XMWA 4O5LL 2VLRE 4OF0A 3STLA 4LPVA 4TUKH 4N9OB 1XCTA 5T3XH 2AJYL 5EC2B 1KELH 5FK9B 4QHUA 3FMGL 5D7JA 1KYOJ 1XGYL 1QHOA 5HI4D 4X4XA 4G8GB 3C6LD 1QVOA 1RUQL 3LS5L 5J11C 4OD1L 3HAEG 3BMWA 1I9IH 2X05A 2V7NA 4H0HB 1JTPA 1U91B 5DJCB 4MQXD 4FABL 4JKPH 1IGFH 1L7IH 2XG5A 4G9DA 4AK1A 3L7FB 4ZS6C 2D7MA 1T20B 2A83A 4NRZB 5H35B 3EYUH 3L3JA 3KYNA 1GC1C 3AFLA 3THML 3INUL 4PTUA 2DS4A 1KG0A 5AZ2L 2WWMD 3WUWA 3GMMB 4UU9B 5L8KB 1N6QL 2HG5A 5CIPB 3QFJE 5FEBA 4MZ2A 4G6KH 1MQKL 1A6ZA 4KRPB 2PTVA 1BBJA 1OM3H 4TSAL 2WUCH 2BVEA 3O4OC 2VQUA 1UA6L 1I7TB 2B1AH 1VFBA 1A3RH 1WITA 1C08A 4GKNB 1KB9K 1NDGB 3ILPB 5EIVA 2BNRE 3UTSD 1AGCB 2YRZA 5I1CL 3E6FA 4YDLC 1WFOA 2IANB 4QXGH 5EUOE 1A7OH 3HN3A 4U6VL 4EIGB 4GRLA 2P5WD 2NX5A 1CICB 1FZJB 2CIIA 1KCVH 4RFOL 2FDBP 3IVKB 4WJ5A 3X3FL 4XX1G 3GHBH 1VDGA 4XMLL 4YAQB 4JO3H 1SEBA 1WEJL 3GJFK 5F8QC 5DD5H 2ARJQ 4NFCA 1K3IA 2K7PA 3IRPX 2KQMA 2MSPA 4NC2B 1KTLA 3B9KD 1ETZA 1A1NA 4LOUD 1AC0A 3HUJF 1EAJA 2XT1B 1BGXL 3JBG7 3TBTB 1RIHH 3VMOA 1P4IL 2EDLA 4IOIB 5B38B 4Y8DC 4BYHA 4D0CA 3HI1B 1IQDB 4K9EC 3CK0L 1FNHA 4PJBE 1G9NL 3OX8B 2VZUA 1GAFL 3I50H 25C8L 4KROC 3MLXH 3PWNA 1SEQH 4ZAKB 4L4TD 3HB3C 5C0ND 3S36X 3LEYL 5E6YA 3BX7C 1I7ZA 3KPSA 6CGTA 5IESH 3B2UD 3MRRB 4P2RA 1JPSL 1YN7A 2EIBA 1L6XA 5IQ7L 2ARJA 3TVMC 1LO3L 5MEPA 3VFUA 1PEZA 1JUFA 5HGGS 1A6AA 2M1KA 1TZIB 1OGAB 1CG9B 1RK1B 2XZAL 5IB1A 5C0BE 4CGTA 2GCYB 1ZS8A 4ZS7L 3C09C 5D5MA 1S7QB 3WNOA 1MIMH 5DJZA 3RVVD 4MXWH 1XGPB 3SDCA 1YEIH 5MENB 5CINH 5J6HB 2R1XA 2R23B 4IRJD 5LXGH 3O2WL 3H3BC 4LVOC 4NIKB 3IJYB 1KTDA 3WXVL 1UKQA 3NTCH 3O11A 1OTTD 3PGDB 4K3GA 1SJVA 4MA1B 3GSRB 1PQZB 4JQXA 1EVUA 4HFWA 2LTQC 4BUGA 3JWOC 1CE1H 3VWKA 5EU5A 2VXUL 3T3PE 1T5WA 4M00A 5HHOA 3QPXH 1NCCH 4DGVL 3TO4B 1C5BH 1T1WA 4BFIA 1NLDH 4M7ZC 5HYQB 1F45A 1IAIL 3Q6FA 3MJ9A 1KCSL 1AFVH 3PL6B 1NBQA 1PLGL 1YMMA 4UIKH 3QUXB 3RU8H 3OGCB 1KPUB 3L5HA 4F58L 5GSRB 1Q72L 3VXME 4AEHL 3ZHLA 1ORSB 5F1SA 1VKXA 2FGZA 3V7AG 5I1KH 2DJUA 3B6SA 1QLFB 5I30L 3BP7B 1HEZB 1RJCA 4GLRH 5BS0A 5HGAA 5KN5B 4FQIL 4LPUA 1GPOL 4YHLH 1A64A 3DMMC 4S0TD 1T7WA 2GFBA 4FQ1L 4PREB 2E8ZA 4XWGH 4XXDA 3BGAA 4OSUL 1RHHB 4P9HL 1Z3GL 1RIUH 5HY9A 4F9PC 2A1WL 4DWHA 4XCEB 3F7QA 4M93C 1OAZH 1CD8A 5ITBH 2F8OA 5I18H 1PFCA 3BZEB 3BKJH 3SO3B 3DRTB 1X5GA 3EW3B 1NKRA 4YGVB 5LG1A 4L8SA 3VE0A 3GO1L 5HDQL 1G6RB 3PQYA 1MCQA 4KPHL 1ACZA 2GTZB 2AJXL 5C71A 3SGEI 4XP4L 1X6NA 3FRPA 1ITBB 1F2XK 2KPNA 5J1SC 2DDQL 1JGLL 1A7QH 2I5YH 3FCTB 4KK9C 4J12A 1U92A 1J8HA 5ISZE 1F42A 4JR9L 3VFRB 4DKFL 1HE7A 5EBLB 5CZXD 2HJLB 4I4WA 1AIFA 3ARYA 1FYTB 5ESVB 4HGMA 4D0BA 4UQ2A 1MFCH 4WFGD 3MA9L 1VEMA 4MNHA 1UC6A 2A38A 2J7LA 3TBSA 4K71C 3WBDA 3Q5TA 3ZTNH 2QKIB 5CJXC 5J9PA 1PZ5B 5IJVA 4PP1D 4E0RB 4K7FB 1CD1B 4KFZC 1N4XL 5FUCC 2EC8A 3QXDB 2UVFA 4UV7L 3VXRD 2H1PH 4Z95L 1U91A 1KPVB 1F4YL 5GRJH 3Q1SH 3LSOB 4QNPE 5AZEH 5J89A 1D5ZB 2H8PA 2XACC 3H7LA 4PRAA 4QYOB 3BVNB 2DRUA 1A1MA 4I0PA 4O9HL 3X3GL 1FFRA 4BSJA 2EIZA 3O9WD 3QB7C 5BJTA 1JPFB 1IARB 2R0WH 3HG1E 3CUPB 1CLYL 1I1AA 1WK0A 5IBLC 3D6GA 3KLAA 4KJWC 5KS9E 2OBGA 1I1FA 3ME0A 2O5YL 4JDZA 5GZND 2Y7QA 4UOW1 4QRSA 3U6RB 1NC2A 1ZSDB 2VN4A 4NO0B 5HYJB 1HHKB 4JO1L 1IAOA 1HNFA 2XA3A 3H8NA 2YC1B 4IEFB 5TE4L 1ED3A 1QOKA 3O3AB 4FQXC 1X5KA 2J8UA 8CGTA 5F6HI 1HQRB 2C4FT 4Z78A 5JMOC 1BJ8A 2NY2D 4WEUD 1OF2A 4ODSH 1YNLH 5C0JB 4P9ML 3A6CL 5C70A 1JFQH 4HGKC 3ZKMD 1V7NH 1MWAL 3HA0A 2VRAA 6FABH 5C86A 4QO1A 2J8OA 1XF4B 3L6FB 3C87A 4EUPG 1QBML 2VLLB 3OKLB 3WJJA 3MLZL 4WTWA 3R06A 1KJ2H 5EB9A 4MLSA 4RGNB 3GSNB 5DMGD 5B38A 1RV6X 2NZ9D 5LGKA 2UZXB 5B21A 2A73A 3PF2A 1ZGLA 4G8EB 4Z7VE 1H3VA 3C60B 2ICEA 3LZFL 3H9YA 3ZKSD 1INEL 1C7TA 4L4VA 3GUTB 2NW3B 5CD5D 5DJDA 1D5XB 4L8BB 2X4QB 4KVNL 4XPHH 1K2DA 3SGDH 5ESQA 3LAFA 1DVFB 4C56D 1KC5H 2L0DA 1T4KB 3SQOH 5BXFB 3VXTB 4NJAL 1JGEA 1MJ7H 1N7MH 1H15A 4PLKD 3ZE2F 4M4RA 4XCFL 5CFHA 4OM0H 2ICWA 3DRQA 2CKBH 5DK0A 2AEWA 2AJZB 3MYZA 1MHHB 4OZ4A 3HNTL 1MNUL 4OM1H 3M8OL 3JWDL 3QDJD 4F7MA 3MCG1 1IFHL 1RIVL 5F6IC 5GJTH 3DUHA 1KCRL 1P9MC 2V2XA 4FMKA 2IALB 5D70L 4Y1AB 2AEIT 3O45A 1S9YB 3GSRA 3MJGX 5EOQL 4YPJA 4X7SH 5IW6B 2ZCLL 1NCDH 2NTSP 2P43B 3TN0A 4GRWE 3VXUE 2PCPA 4DN4H 1ADQL 3F7RA 1LP9B 1T04A 1T7YA 1IEBA 4CDHA 1FVDB 4JVWA 1BFTA 1S7RA 1BOGB 3UC0L 2EDFA 3RWEA 2FX7H 1U8OB 5EG6C 1NAMB 2EYSB 1JF6A 5FGSA 2B5IB 5I1HH 4JFXA 1UACL 3D18A 3HPLB 1RUKL 4ZOCA 4U1LA 5E0QA 1ORSA 4MNQA 3ETBF 4F15B 4DKEL 2PTTB 2ICWJ 2FZ3A 5IV2A 2DJSA 4CBPA 3SKJL 1IM3B 4LSSL 3QHFL 4XVSL 5CSBA 3PWPD 1DQTA 1FBIL 2BVOA 3MOAH 4OB5L 3U7WH 1KIPB 2A9NL 5C09D 1NMCB 5BRZA 5F7MC 1RJYA 3IJHA 4U2ZA 2F53D 5C8JB 4PG2A 4Y5XA 5DRWB 1I9RH 2P7TB 4G42A 3DURB 4OFIA 4M4PA 1UZ6F 3QIBA 4OFPA 5D7LD 5JUEH 3GKWL 3DBXB 4XPTL 2ERJB 2W60A 2ZSWA 5LWYH 1E6OH 4UDTB 5TH2B 3OJDA 1TVHA 1TVBB 1CWVA 5C0IB 5FYLL 5I1GL 5SWZA 1ZMYA 4Y19D 3T4AA 1EEQA 4CJ1A 3CDGB 4PGZA 2C3GA 1WT5C 2WWKT 4J3OC 4PUBL 2LQRA 3IXTB 4I2XA 3WIHH 5F96H 5D2NE 4WW1B 5D7JD 1N8ZB 2VL5A 1CFBA 1F11B 3RGVB 3ZZ1A 4XC3L 2VDOH 4IRSC 4YHZH 1ZLUK 4YHYB 4TSCL 1II4E 1ZVSA 2Q7YA 5B8CB 5EBLA 3FB5A 3HC3H 4F8TA 1OPGH 2HJLA 4IRZL 3SQBA 2UVEA 1LEGB 1HH9A 3JV6B 5GGVY 3TFKD 4MHHG 1P84K 1OSPH 1L9MA 3OHXB 3QO0B 1HDMA 1PZ5A 1E4XL 2AJSH 4E0RA 4O4YL 4C4KT 4RQQB 1G7LB 5TFSH 3HMWH 2R8SH 4ORZC 3V6BR 3X14B 1T83A 1ZA3B 1KCUH 4RBPH 5FIEA 4PB9H 4RISL 3RWHB 4DZBA 4FZEH 4GRWH 3U4AA 1L7TL 4WTZG 3P9LB 4HWBH 4B7LA 2QSCH 2PR4L 4XNXH 5T3XL 4C59B 3S6CA 43C9A 5KG9A 1EH9A 2YD3A 3KNBB 3FB6A 2SEBB 5J1TC 4BM7A 4GMTH 3MBEA 4AYFA 1MCWW 3R8QA 2PTUA 3T1WA 3PHSA 1UVQB 3GSUA 5I8CB 4ZPVA 5DJ0B 2EECA 4L29A 4N5EC 4LHUB 3SN6N 1DBJH 4XHQA 4GRLD 2NX5D 4G3YL 1AGEA 2AK4E 4M3JA 4EN3A 4NO0A 3U7YL 3HE7C 1F3DH 2BOBA 4TSBL 2VLKB 4QF1B 2XWBA 2VDQH 1KJVA 5I1EL 2W91A 3GMLA 4HUXB 4F2MA 2EEDA 3HNSH 1EEZA 1H0DB 2BVQB 2H3NB 1AD0B 3LD8C 1TQBC 3NGBC 4QRPE 4TOYH 2F19L 4XBGB 5E6IA 4HIHB 1XGUA 2RCSH 3V4PH 1VFAB 1A3RL 5DQDL 4NKOA 1QSVA 1A2YA 2ED7A 4L3CA 4JPKH 1NGQH 1TMCB 4LVNC 3Q5YA 2ESVE 2C7UB 5I8OL 3QQ4B 3KPSD 3DXAA 4NKIL 4E41A 3DX7A 4Q9QH 3RVTC 2DIJA 2BSTB 3VH8A 3TEUA 1RZKC 3LHPL 1KULA 5FO7A 1ZHKA 4G8EA 4LEOB 2FEDD 3AREC 5F3BA 3GHBL 3X13A 3E0GA 3L3HA 4TTDD 1U8NB 5EO9A 2Z93B 3SDCD 4S1QH 4HKBA 4URTB 3GMRA 4HPOL 1FVCB 3E8UH 3CVIL 5GRUL 3ARGB 1M6OB 1FGVH 1QSEA 2D4DA 3NA4A 2D7OA 3WLBB 5ICYB 1SY6H 1YPZB 4JCLA 5AWNH 5F9DC 2HT3D 3PHOA 2WP3T 3L7EA 3RTQC 1T2QL 4I77H 4I18B 3VWKD 1CFNB 5DR5H 5E2JA 2NXZD 4PRDB 4W4NA 1N0XL 3GJFA 5HHOD 3EFDL 2W9DL 3IGAB 1CDUA 4BZ2H 1I3GL 1OAUH 4Y1AA 2ATKB 3P0YH 4U1GC 1MCJA 1YMMD 3WIIH 1A7NH 3R1GL 3WXWH 4NFBA 2DI9A 5TDPB 1IT9H 5DC4B 4GG8B 4JQIL 4LEXL 5JNYB 3TPUB 1QLRB 4XNUH 1FAIH 2FATH 1AKJB 2HA1A 5T3ZH 3SCMC 1E0OB 5BS0D 1BOGA 1KJ3H 3RRQA 1EK3A 4DW2H 4Z9KB 1A8JH 4MAUL 4H26A 5DRNA 3SE4C 2UY7A 1PKOA 4ORGA 4LCWB 1OQXA 1DQMH 4G5ZL 3W5NA 3VG0H 4YDKL 5IOPB 2LU7A 4OZGB 5CEYB 3FN0H 5DHXB 4KK8C 1IM3A 4DOHB 1ZE3C 3IDMA 1F8TL 4M7KL 4Y88A 3I75A 4LGPB 3LN9A 5GRVL 3TP4A 5C8JA 3FO2B 3U30C 1VB9A 3P0VH 1JPTL 1MVUB 1NLDL 3MLUH 2O61A 3DURA 3HE6B 4KQ3H 4NP4L 5HTSA 3UBXA 1AP2B 4R2GB 1J1XL 4BFGA 3TCLB 4MD0B 3TZVC 1XZ0B 4WW2A 1DN0B 1OD7A 2A9MH 4OI9A 4PG9A 3BE1L 4JY5L 2IAMB 1P5VA 4JFDB 1J8HD 4O51B 5INCB 1I7UA 5C0IA 2RFXA 5IFHL 4G7YL 4GRMB 2XICA 3RWFA 5DI8B 3MRLA 3QXUA 1NCBH 3T1FB 1YUHA 1P6FA 1J0IA 1U8KB 1NFDA 1NKOA 4OLZL 5EFIA 4U49A 4K3EH 3GGWB 2VDLH 4M8VA 3KXFB 1L0YA 4ENEC 4JO2L 2X41A 5I18L 3PGCB 2YEZA 1G7QB 3I6GA 4FQQA 3RUGE 4QTHA 1JNHB 3QR2A 5HVFB 2ILLA 1CTOA 3W39A 3DO7A 1MHCB 4ODUB 3I6LD 1FLRL 1MRFL 2CLVA 1P1ZA 1GZQB 1SYSA 4TRPL 4XRCA 3QO0A 4NHCL 4HC1A 4XAKE 3S4SG 1VPOH 3BIKB 3WFHB 4I0PD 2OMBA 4DFIA 3BKCL 2A77L 1A7QL 3PWUB 5E9DA 2HVKA 3P11L 2OL3B 3CCHB 1NGXA 1AO7E 2HVJA 3X14A 4CADA 5DRZA 3S35H 1I1AD 5A3IC 4TPRL 2NW2A 1NH6A 4X9IA 5A16B 5JOPE 4JFHD 5K9QI 3MV8E 1MFCL 2BNQA 3GSWA 1NC2D 3BUTA 2JCCF 1LP9F 3BO8A 4KV5F 3ZO0A 2SEBA 1IAKA 1BJMA 1T0NA 3ZTNL 3ALPA 5DURB 1I8MB 3BUYA 4JG0H 1LNUA 2HFEB 2YWZA 3N85L 4HLZG 4IIQC 4AG4H 1UXWA 2Z92B 5JZ7D 2FLRT 1RJZA 1HHGA 5IB2B 2J5LB 1WVZA 4U0RC 4ZO6A 4MMXC 3ROOB 1G7MB 3MR9B 4NM8L 5E2VL 1G7PB 3HZYB 4ODTL 3BKMH 3NCFB 1CL7I 1FG2A 2AAVA 1QEWA 3ES6A 3L5IA 1KB5L 3SEPA 4Y16A 1H0DA 2VDRH 3JZ7A 5A40E 1U3HB 5C6TH 5SWQB 4HJGB 5TPWL 3F7VA 3FO1A 1EIBA 3QQ3B 1J1PH 1S7XB 3HZVB 4XBGA 4PJXB 3V6FB 2A6KB 4ELME 3NCEB 4HIXH 3JTSB 4P2QA 5FM4A 5IHBA 5HYSA 2DLTA 5FKAB 4BFEA 7FABL 1A4JA 5HGHB 1MCIA 2DF3A 1IGJB 3I02B 4A6YB 4UNVA 3S98A 4KUCF 4L4VD 4GKSB 3A67L 3UXFA 3BPOB 3CMOL 2QADC 3RVXC 3QQ4A 1R5VA 4IMLB 3BOVA 2X4SB 3WN5B 4YXLL 3KPPA 5CJBA 3WFEH 2EDOA 1CS6A 3AMKA 5FYLE 3TNNB 4RAHA 5FUOH 3PNWB 5IMOA 3QHZL 2YKLL 4ZFOA 4KTEL 3QDGA 1A22B 1DEEB 4PRHE 1CLOH 4OKVA 1QKZL 1A9EA 6FABL 3ULVF 1JV5B 3CSPA 4QOKA 4N8CH 4MVBC 1ZHNA 5IQ9A 4Z7WB 3OPZL 4OF3A 4GO6B 1KTRL 1BWWA 1ZANH 1Z9LA 4LCUA 3B9EA 5DJXB 1A7RH 3VXNA 5IG7B 1G1YA 3VRIA 4PJDB 1DQLL 3D3VB 4BH7B 1S7WA 4HUVB 4Q6IC 4P46D 4MWFB 1RHFA 5IBUG 3O2DA 4EJ1C 1YEGL 5IEHA 2VQ1B 3V5KB 1FORH 4YJZL 4OLWH 4AM0B 1BZQK 4L9LB 4E42B 4YIQB 4OD3H 5IVXA 4JM4H 5DTFA 3S96A 4XVTL 4MB3A 5IUSA 3P9MB 3KDMA 1MJ7L 4LRNH 3ARFD 3LEXB 4MNQD 1MCFA 5EWIH 4ZTOH 2J6EH 1FG9C 3ULUH 1KGCE 2CO6B 1QLRA 4P5TC 1AKJA 4XPGH 1W72A 5AD0A 3F7PC 3QP3A 5BRZD 3RPKA 1YQVL 1IC4L 5C08E 4KAQH 3KPRB 3K0WA 3CFDA 4UOJA 3N9GL 1NBYB 4LKCA 1EEYA 4IJ3C 3S37H 4ZFFA 3QIBD 2HT2C 1NCDL 5HHMD 2HWZH 2R2HB 3UX9B 5CJQH 3VXPA 4I0KA 4XP9L 1CQKA 4X6FB 2FSEA 4DN4L 1OAKL 4KXZI 1MCSA 4JPIA 4HUNB 3BN9D 1HOCB 4AMKH 5SWZD 5CHNA 3VXQB 4CMHC 4NN6B 5I1HL 5EN2A 4WHTB 4MD0A 4NQDE 3D85A 4X6DE 1QACA 4MCYB 3W0WA 1YNKL 5HDBF 3IU4H 2WV3A 4JFDA 4AZ8A 5I71B 3MOAL 1Q8MA 5INCA 3OAUH 1I3UA 1DTUA 4Z8FL 3EYOA 4NUJB 4C83A 3VWJB 4PV9B 1I9RL 5FHBL 3GI8L 4M6OL 4U6TA 1H3GA 1IGYB 1NCWL 2V9QA 3ARUA 2ZUUA 2KZ1B 4IM8A 4R96A 1HHJA 3V5HB 2YD5A 3GI9H 2G9HB 3LQAH 2AK1H 4XPBH 1E6OL 2VLJA 1G7QA 2DQFA 3MRDA 3QFJB 2CMRH 3WJLC 3DVGB 1YPZF 4LDLB 4NBZB 1C16B 3MACL 4MJIE 4PJ8C 5BZDB 5D7KD 3UYRH 3MRGB 4OCXL 3EYFA 3CVHH 4MX7A 3WFZA 2XV6B 3NPZB 2BNRB 5ADPH 3PWUA 4OD2B 5K9OB 4WEMB 2XN9A 1MH5A 2HLAA 1JWUA 4GQ9H 4D8PA 3MBED 4OT1L 4YEFA 5EUOB 3I3BA 3BPLB 3T2QA 2E27H 3O6FC 2I24N 4L5FH 3TVMA 4LGSB 2VH5H 1MLBA 2E7HA 2NZIA 2OR9H 2YK1H 2F54E 2VXSL 3MOBH 3QDME 5CLTA 3SDAB 1W0WB 4EN3D 2W07A 3BJLA 1JN6B 2V17H 4OI8A 2AJSL 3AXLB 3DX8B 4WCYH 1GHFL 4U1JB 3VFMA 3V6ZA 3M17B 4I3GA 3MLTB 1MY7A 5HHPB 2AP2A 1QFOA 1MIEL 4PJHA 4R4ND 4EUPA 4W81A 2Y9RT 2CH8A 4LLQA 2CRMA 1MJ8L 4FZEL 4OZGF 4TVPE 5E6ID 4DEPC 4KRNA 4KK5D 4GMSH 3FAXA 1EGJA 4Y4HD 2Y07L 4KMTH 4M6MH 5DJYB 3BDYH 4BKLB 5CD3A 3F7YB 4ALAH 2FHBA 5AG8A 5I1AB 2AEQH 3MJ7A 5CKAA 1D6EB 1FYHB 4JM2C 5IBTH 3C8HA 3CJJA 4LCCB 4D9RD 2A0LD 3NN8A 3DXAD 4NNYA 4E41D 3MJ8B 3G6AA 1WISA 5C0BB 3HLAA 3SJVE 5E94B 4PJIE 1CGSL 4NN7B 3ULSB 5BV7L 1IBGH 1RZFH 5JPMA 1F6LL 4Q7DA 2VDQL 2EKSA 35C8L 3KR3L 4WHDA 2ZUVA 4WUKH 2QQLH 3CGTA 5DSCA 5EOCH 5I1IH 3DMMA 1CIUA 1T2JA 1UJ3B 3ULUC 1KOAA 3STBA 4FQPA 3BP5A 3GKZA 4HIIA 1EHNA 1QSED 2GJ6A 3HCVA 4AL8L 2RAMA 3PNWA 4KVCL 1MHEB 2AJUH 4F9PA 4WEBH 3QDHA 1DEEA 2IBGA 2X4UB 4HQQH 3UJTH 4CVWA 4NYLA 1WCBA 1DLFH