4TN9A

Crystal structure of clostridium histolyticum colg collagenase polycystic kidney disease-like domain at 1.4 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
86
structure length
86
Chain Sequence
GSAPIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Metal binding protein
molecule keywords Collagenase
total genus 16
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tn9A00
3RGVD 4BK5A 2ZG2A 2GHWB 1C08A 4G9DB 1JIBA 1LE5A 2DLTA 2Y25A 1T1XA 3VGDA 4DQOH 1ZGLP 1H5BB 3VWKA 4UUJB 1ES0B 3BIKB 4XC1H 4ODUB 4H0IA 7FABH 4LCCC 4MJ4A 3MLVL 1FYTD 3S37L 2E7LA 2LVEA 1A9EA 4WW1B 4NRXB 1FO0A 1QKZL 4HWEH 3F62A 4L1DA 1S9WB 3QDGB 1DQML 4JQXC 1RURH 3FQRB 3WLBB 5HGAB 1OARL 3AFLA 1CCZA 4LSRL 1MCOL 4QF1B 1RK1A 1OAXH 1TDQA 1A1MA 4HKZA 1DLFH 1TZIA 2JK5B 2W92A 1U3JA 3SKOA 4HC1L 5GGRB 3FT3B 5C0BB 4XNZB 3JV6A 1WBXB 1MY5A 4NRZA 1XGRB 1AGEB 5C92A 5F8QC 4S0SD 3STZA 1IQWH 2CIIB 5D7JD 4M93C 5DD1H 3UJTH 4YLQT 5T1LB 4ZQKB 5ILTH 1KJVA 2GAZB 1I8KA 3IDJA 4V1DB 3MRFB 3C08H 5IGXH 3VH8A 5HGBA 1P6FA 5DT1L 3WN5C 4P9MH 2OQJA 4U6HB 3CFIC 1YEJL 4JFXA 3RKDC 2CKBL 2PYFB 4WJ5B 5D9SB 3AU1A 1MAJA 5DR5L 2ITDB 2DM4A 3EYQC 1OAZH 3MCG1 1UCBL 3QUKB 5DJ8B 3V6OC 1KN4H 3KPRD 1IM3B 1ITCA 5IW3A 4N1CA 4URTB 3ARSA 4JPVL 4ZODA 5LJYH 2A9NL 4XAKE 2NW2B 1AO7B 3WUWG 2PTTB 1AQKL 4P2QA 3QA3B 4LGPB 2BDNL 4JG1H 2AP2A 2UZYB 4YO0B 1XAUA 4J1UB 2J6EA 4DCQA 3X13A 1FIEA 5F7YC 2VZTA 1LO0H 4ZG1A 2GSGB 4XVJL 4V2BA 4PJ8D 3MRCA 2NY0B 5F96H 5JW4R 2HMIC 4JKPL 4M93B 1D5MB 5FO9B 4MQTB 1D6EA 4PPTA 5BOZG 2VDLH 4HWBA 4LLMA 4PRNB 1XF3B 4NSKA 3KPLB 2R8SL 4MCZB 1U9KA 1FLRL 2IANB 4Y4HD 2CKNA 3H9ZA 3WD5L 5HHMB 3P4NA 1YNKH 4YIQA 1KENH 4NZUH 1JZ3A 3BYTA 3MRBA 4BELD 2BSSB 5FF6B 4G6KH 3ARWA 3RBGA 1JN6B 2HJLA 1H3PH 1SBBA 2ATKA 3MO1B 4GLRH 4LCCB 1WIOA 2B0SH 3JV6B 4UQ3A 2PN5A 2ZOKA 4RA3A 1X5FA 1LNUA 2WP3O 2YOCA 3CC5A 4KTDH 1V3KA 3QEQE 3OKNA 5IB2A 5EZIL 2NY6C 3RVUC 1IVLA 4YHMH 4YXLL 3PP3H 4KDVA 4Z7OE 1NJ9A 3C2AH 3QG7L 5JIIA 3K0WA 1B6UA 2AJSH 4Y4FC 3Q0HA 3T0EC 3QDJA 2XZZA 3CMOL 4PJDF 1YJDL 4PJXB 1GC1H 4MJID 5KANG 1O5DT 1DQDH 3SKMA 3VJ6A 1WBYA 3PP3K 5JOPD 4MA3B 1DLFL 4U05A 3LQMA 1U36A 5K33A 3P30H 3MLWL 2R0LL 4JZJA 5B38A 5BJTA 2CR6A 4PBWD 1FCGA 1D5IH 1I1YB 4PJ7E 1WIPA 2E7MA 4J4PC 1DDHA 3ZTNH 5GPRA 4K3HA 1MCWM 1MCPL 1BAFL 1BIIA 4WFGD 1BVKB 2BSTB 1G1CA 1ZV5A 2VSDA 5C0DA 1XH3B 1X4ZA 1IM9B 4JAMA 3VXQA 3KAAA 4I13B 4GRLC 3AY4C 4WU7A 5IM7B 4NQXB 1OF2B 3CSYA 2GTWB 4Y2DB 3BWAB 5E8EA 4U2YA 5JHDB 5A1AA 3HZVB 3MCKA 5ACZB 4DK3A 1A6WL 4X6DF 5IFJA 3LQAC 3OZ9H 2I24N 2Z91B 4F7CA 2VDQH 3HMXA 4QHNA 1UVQB 4EDXA 1KPUB 2NY1B 2F53D 3RTQD 4LCCA 2FECL 3V6ZB 4PJIF 2DIAA 4HQQL 4XPAH 4XXCA 3RVWC 1C7SA 2F19L 4F8QA 1QUNA 3MR9B 3C8KB 3HAEH 1NH6A 1D6VH 4KKNA 1UACL 1N59B 3WIIH 3CFKA 1TTFA 2Z0BA 1OTUC 3I85A 4JO4H 4LSVL 3PHOA 3VXTB 1I9JH 1KLGB 4OZGB 4I5BA 4C56A 4TPRH 2WAHA 2E27H 1KUMA 3UJIH 5JDSA 2OTWA 1BAFH 4IM8A 3MRHB 3IU4H 3QXVA 2FEEI 3MLSH 2Z8WC 3ULUC 4MNHA 2JKXA 2YXFA 1FGVH 3TBYB 3QSKB 2W9DH 3AB0B 2WM0A 4K8RH 4YHNB 1T2JA 2OR9H 2VQUA 3PP4H 1M7DA 4YFDB 3MV11 4JEGB 1LEKA 4I8DA 2K7PA 1CGVA 4JY5L 4JQXA 5ISZB 5K9QG 1LE9A 3D0LA 4JREB 2R2CA 1TZHA 2VERN 1GGCL 1NC4D 2IQAA 4C58B 2QQKH 5GZND 4LKCA 3BE1H 2DYPD 5C09A 3PDOA 5M7QA 4IOIA 5DYOB 5BXFB 4K3EL 4ZTPH 1IL1A 4Z7VE 5GGUB 3QRGL 1TFHA 1GC1L 3F7RA 4KI5E 2JELL 4QRRB 3UDWA 4B53A 1OAYH 4PLKC 2PW2B 1P4IH 5DVKA 4PJBA 4NPYB 1JNHB 2G5BA 3MGOB 3QHZH 2H2SC 3BZFB 4R3SB 3X13B 3VRLF 5C2UB 4OZHE 3UPCA 4JHAH 4AENB 5I1EH 2NY3D 1A6UL 3CVHL 2BY1A 3DURB 4GH7B 3RWGB 3D1MC 3IU4L 4NP4H 5F1IB 2EYSB 3IDMA 4U1NB 1KB5H 3E8UH 3FOLA 1IAIH 1OAQH 1A3RL 4Y5YC 3JSSA 4WUUD 5FGBA 3H3PL 2F54E 3X3GH 4PJ5B 4BKLA 1IC4L 3DX9A 1Q9OA 3PXHA 3WIHH 2OL3L 2DKSA 3T1FA 1YNLH 3T0BA 5DJCB 4UI2A 4N0UA 3RWHA 1NKOA 4OM1L 2P8LA 4M5ZL 3FT2A 4HJ0D 1F4AA 5A2JH 2UUDH 4ZSOB 2P4AB 4K7FA 2V7HA 3QXAB 4E41B 3AM8C 1HHJA 4Y4HA 1A1NB 3VDAA 4HPYL 4K7PY 3THMH 4PRIB 1W72B 4MWFB 1TTGA 4XPFL 1PLGH 5IMLB 4Y88A 1NEUA 3O3DB 1S7QA 1JGLL 4G8IB 5K9JL 5EC2A 2Q8BL 2ZCLH 3HMWL 1U3ZA 4X7DC 4G6JL 4ODVL 2AJZB 3GMRA 3P73A 3JWNC 2Y07H 3IFNH 4NP4L 1YEDB 2E27L 3FRPA 4LVOB 3VWKB 5I6XC 3O2WL 1GPOL 4N8PA 5E8NA 1DJSA 5AWNH 4R8WL 5D2NE 1JUFB 3OKKA 3VXSD 1IGYB 1HYSD 1NBVL 1JWUB 3B3IA 1HQRB 5TE4L 3WFHB 4XGZB 3WLBA 1TVHB 4FFVD 3IDYC 3GMLB 4LSUH 3RRQA 1UJTA 3E6FB 2BVEA 4GRLA 3HZMA 1HILA 3SGJA 5E2TH 4EN3A 1MCRA 1OHQA 1YN7B 5DQDL 5K59E 1UYWH 3O6FB 4PG9A 4UIKL 5D7JA 3MMEB 5GGSA 4BQ6A 1OVZA 2D4DA 3D85A 3QHTC 2BNQB 7FABL 3HAEA 2F9BT 4AEIH 5EIIA 3STBA 4DKAA 1QKZH 3WFCH 4GQ9H 2FSEA 4PY7B 4AMKL 1RUAH 2JJTA 3WHE1 1QBLH 4TVSa 1UVQA 1F42A 4EDXB 4KTEL 3VFPA 3DGGB 2AJYH 3WXVL 2NY6B 2V7HB 3QXAA 2DM3A 4E41A 1F90H 1LO3L 4J8RA 2NW2A 1FYTE 3W39A 1QYGL 2JCCE 1CDCA 1R5IB 1DE4B 4PG2A 2O5ZL 35C8H 5A2FA 3BX7C 5F70A 1C5BH 4X6EB 3VFUB 4CJ0A 5F1KC 4Y4FD 3RY6A 3U48A 2QBWA 1EHXA 3ARBB 1FFPB 1YNTA 1QSFE 3N1PC 3QXDA 1AKJD 4MCYA 3L95B 1Z9MA 3VXSA 1MELA 4G5ZH 4PJ5D 4P4RB 1FO0L 1GGIL 4FQHB 5GS1C 4UDUB 4ZOEA 3SO3C 5I1KL 2VDPL 5ETUA 3IJHB 1NDGA 4OKVB 5D1XC 3VFSA 3D69A 4JGMA 1G7HB 3KYKL 5E9DA 2IAND 5SV3A 5DJXB 3SGJC 4HFWB 2P5WB 2BNRB 4KK5C 4YXLH 3ECBA 3D5OF 4U1MB 3PGCA 1KELH 4UV7H 1VGKA 3SQBA 3ULVL 2CRIA 3A6BL 4L3ED 5HYIA 2ADGB 4MD0B 5D7LE 2E5EA 3WLWC 2IPTH 1QBLL 2UWEB 3AMLA 3K4DA 4JHZA 4IRSC 4L3EE 4QO1A 1I7ZA 1ZHNA 2FBJH 2XPGB 2Z93A 3B6SA 5K9KB 2YUWA 5DUMH 5FYLL 2MNUA 4TUJA 5IVXF 2X10A 3WFDH 2ARJA 1G9NH 2VDRH 3Q1SL 1U8KB 5F6IC 2YC1B 4PBXA 3Q48A 4HXAH 5AD0A 3DARA 2P43B 1QLEL 2HT3D 3MGTB 3H3KA 3LKOA 4G6ML 1RIUH 5CILL 4UBDD 3IDXH 1NGPL 1QSEB 1QTYT 2EO9A 4GKNA 5A2LH 3TZVC 3V5HB 3WIHA 4NKIH 3WDJA 3SDAA 2MKLC 4RA0C 3JWDL 3EUUA 2Z92A 1U92A 3ME0A 5LGJB 1Q72L 4KZDH 1RZKH 4XI5C 5FGCB 3RPIB 5L9DH 1MJJB 4UDTB 1Q0YH 3MV01 5GGTH 4HJJL 1J0JA 3OJ2C 1Q9OB 1AKJB 4D0DA 1FC2D 1QFUH 3V95A 3EO9L 3I50H 2XG5A 1WZ1L 2B4CH 1BGXH 1UH3A 3LCYA 1GHFL 4Y4KD 5CSZB 5E2WH 5FB8B 1MFDL 3P0VL 3Q2CA 4OFKA 3TYFB 4N9OB 4PJFF 4L8CB 1HHGA 4Y5YA 1L7IH 3O81A 3L3IB 3HNSL 4DJMA 3IETA 4F37K 1EEZA 4FFZH 2KKQA 2FYYB 2ICES 2DQTH 5GS3A 1GIGH 3BPOC 4I5BB 5FUZL 4C56B 1Q9KA 1R5WB 4MAYA 2WNGA 4R9HA 2OXGA 3VFMA 5E6ID 3GMOA 4Q2ZB 4GSDH 1ZT7A 2CPCA 3C08L 2RIKA 3T0DA 1RIHL 2CD0A 3OHXA 4OCWH 5CS7A 1KIUA 4C4KO 5T5NF 3V4VL 3CNKA 2L0DA 3HMXH 2VL5A 1LD9B 2COQA 5K9OB 3V6OE 4LCWB 3LB6C 2FJHB 1RJZA 4QXWA 1N59A 3CU1A 1RZFH 1CDIA 3LS5L 4G3YL 3BDYH 3T4AB 4L8SC 1BP3B 3DUSB 4PB0L 1G0DA 5DMYA 4ZXBC 1N6VA 2X4SA 1Z9OA 2W60B 5HD8D 4JFQA 4X7TB 5CZXC 3HA0A 5IUSA 4M6OH 5DHYA 3UCRA 5IMMA 5C0IB 3LPGA 5D1ZD 1T66C 3EYVB 5ELIA 1NSNH 1JZ5A 1XFPA 15C8H 3O3BA 4XAWL 1JNNH 1BGXL 1JPTL 3LHPL 5F7MC 3WNLA 3I6GA 1NBQA 4MA3A 4I0PC 3DMMD 1LO2H 4FFYL 2Y72A 2OM5A 3IVKB 4NKMB 4BM7A 1R3LB 5IVZB 2IALB 3MRDB 5K93A 4OUUA 4GXVL 4BFEA 4BH8B 5IB5A 3L5JA 3FAXA 2MOVA 1FNFA 2Q7YB 2Q3AA 4AENA 5MP6H 5BW7A 1MCDA 3O6FD 5IB1B 3NTCH 3NPZB 5E5MB 4OZIA 5D6DA 4FFWC 3QZWA 3VXNA 2ICEA 2VZSA 2Q8AL 2EE2A 3M17B 4JJHA 1XZ0B 1NFDB 4OLXH 2VOTA 3OBAA 1DVFD 4I0PA 4EQ2A 2HJKB 2N56A 1OTSC 2ADIA 1DUYA 5CP3H 1NMBH 3OQ3B 4G9FE 5EN2B 3IRZA 2R0WL 4OSUH 4GG6B 3GSUA 3HTLX 5DSCB 1LQSR 1EAJA 1IEAA 3QDGA 2AGJH 3HUJA 3QQ4B 4X0KB 4PJBB 3RNQA 4XTRC 3BP7B 4M6OL 3RGVA 4NKOA 1PKQE 1XF4B 4Z7NE 3EJJX 1ZGLM 5KN5B 2JJTC 3VXUA 1QLFA 2DD8H 4QNPE 4MCYB 5J4MA 4OZ4A 2I60L 3NIDF 3U0WL 1ED3B 4FQXB 4HULB 3HI5H 4ELKA 1QEWB 1UKTA 5K9QI 2QEJA 5T1LA 3P4MA 3DUUA 2VLJE 3W82A 3V6FA 1MI5B 2MSPA 3D25B 4P3CH 5ICYA 4IOFC 5IB4B 4CVZA 4PRID 3KWWB 4B0MM 1IAII 3QDJD 1BZ9A 4XPFH 1J8HD 5JW4Q 4RNRB 1DUZB 2V2XB 1PD6A 4GG8A 5D96B 3TC9A 4QCIA 4OZFA 3S4SB 5D5MA 1IEBB 1DBBL 4MJ5B 1CE6A 2FDBP 2FIKB 1Q94B 1NFIA 3WO4C 2BY0A 4B50A 1ZAGA 5FYKL 1EVUA 1EHAA 5B4MD 1I75A 2VISB 2OMNA 3KXFB 4NZTH 3VD7A 1HIML 3KS0H 1B90A 12E8H 1TJGL 2VXSH 3MCLH 3RNKB 4JFED 3UTOA 3DVGB 4DVBB 3TZVA 1FZKA 4P3DA 3GMLA 2ZZUT 4DKEH 4IIQC 4LIQH 4MQXD 3UBXA 3RWDB 5A3ID 3KPNB 4LEXH 1S7VB 2XZCL 1I4FA 5EORL 3KLSA 5DRWB 5CLWA 1M6OB 5EC1B 1NCAH 1F2QA 4FNLL 3ZLQC 1NMCC 2NY7H 3PUCA 1UWEH 1JUFA 3OKKB 1IT9H 4IRZL 4JPKH 5I0ZA 5HHXH 1NGXA 3MUGB 4ZFGH 5ESAB 4QRSA 2ZOLA 2VJXA 5DZLA 4NJAL 5D7LD 4UT6H 3U36B 3O2DH 4PJ7A 1RIVH 2J88H 5F21B 1LO4L 4W6XB 1MFEH 3BPCA 2NYYC 1XGTA 5F7NC 3RVXC 2Z31B 2HFEB 5BCAA 1R5IA 5FO8B 5FYKD 3TNMA 3HG1D 1FPTH 4JR9L 5TGBB 3VRJA 1QYGH 4LBEB 3E6HA 4KJWC 3LZFH 3MXVL 2NY1D 1FGVL 3ARED 1A2YA 2Y6SD 5AWNL 1ACYH 1MWAH 2OSLA 1V8HA 3X3FH 3PP4L 1P7QA 3EYUL 1Z9LA 4WHTB 5FYJU 3FCTA 1MCQA 1T4KA 2Q76B 5FV2A 3WDIA 4CN4A 4PRPA 4X5WB 3NFNA 3LKRB 4GBXA 4I3SL 3UYRL 3FFDA 2Q6WA 3H7LA 3QEQA 4PB9H 4EDWL 4RGMC 5C6WH 3B2VL 1CT8A 5C0FA 4HAGA 5A2KH 1B0GA 1KG0A 5EIQA 5EOQH 1NGWA 4R2GB 3V6OA 3BAEH 2ZPKL 1V7ML 2FGWH 1EFXA 1MCOH 5HGHB 1DSFL 1AXSA 3WBDA 5I76A 2P24B 2D31B 2J88L 3QISA 4FXLA 3BJLA 5EDXA 3G6AA 4LPYA 2P48B 4GRWH 1U8IA 3T77B 4O51B 4PRIE 3KPQA 3I6LD 1P9MA 5DD1L 3UJTL 2AJYL 4JRXD 3WXVH 5SWSB 3FRUA 4RMTA 2IGFH 1D5XB 2H8PB 4I1NB 3K8MA 5JHDA 1RU9L 4JG0L 1HOCB 2CJUL 4W81A 2IQ9H 1WISA 3MUGA 3BZ4B 4K94H 1T04B 5IV2A 4NNYB 3B8YA 12E8L 1TJGH 3MCLL 2WBJC 2B0SL 3H3BC 4R0LB 4WFED 4PTUB 3OPZH 2EXYC 4KHTH 1WAAF 1LEGB 3TPUB 5TDPB 2H2PD 5LGJA 4XCCH 2HG5A 1TLKA 1G7LB 4JGJA 3ZDXF 4DGIH 5MENA 3HE7D 5D2NA 1VEOA 1TQCC 3OKOA 1MQ8A 4ISVB 4D2NA 2F54B 4HWUA 5D2LA 1BFSA 3A67L 5GJTL 4LASH 4JFFD 4KK5D 1P2CB 3DX7B 4G7VL 4PJ9D 4R4NC 5IIEA 5HHVH 4IS6A 4D9RD 1CTNA 5FDWB 1FNSL 5HHQB 1VGEL 4D0BB 3DLQR 1HK6A 4TULL 1CXKA 1FC1A 2FEEL 3N85L 4NQDD 5EOTA 5I17B 2CO7B 3DIFB 3QI9D 1P53A 4KROB 1A3LL 1H5BA 5IWLA 4L29B 5JOFB 1NL0L 1U8NA 3D3VA 5I75B 1AHWA 4YXHH 4ZNCD 5C6TH 3FONB 4PJ9A 3SGKC 5BO1H 4XX1E 3V5KA 1TNMA 5GGTA 2Y4SA 3KPSA 5F9AC 2J7LA 4KK6C 5DHVB 5HPOA 4CU6A 4ESKA 1DL7L 1NCUA 1EMTL 1KB9J 4QXUL 3PWPB 1MHEB 4PGCB 4R0LC 3O41A 4PUBH 1HHKB 3RWEA 2FX7L 1I85A 1H9VA 1KNOA 1YY9D 4AEEA 3TFKC 4R8WH 1TZHB 3QPQC 3N9GH 1ZLWK 3AROA 4F7TA 1U58A 4HWBL 4O4YL 1NEZG 5DD5L 2X4PA 2JCCA 4HIEA 1IEBA 1Z0MA 3BXNB 4G6KL 1U8QB 4LMQE 4LOUD 3EFDH 5GRJH 3T0EE 3F6LA 2W91A 3BSZH 4U31A 1BBJB 5IBTL 3DMMA 4NQCD 4QRQA 2YA0A 4ZXBD 4WWKD 3ZYIA 3QUML 3QFJA 4IIQA 1XF2A 5BVPH 3TBSB 1F3JA 1S78D 4GW1A 3T4YA 2R0ZH 5IKCB 2X89A 5EBLA 3C6SA 4UINL 1TCMA 4OF7A 2J8OA 5DJ8A 1PW3A 1CICB 4OZIF 4LCYA 2AAVA 3LIZH 2OJEB 5DMGD 3HC3L 2H32H 5GQBA 1ZLVH 3PV7A 5C0AB 3KHQA 1RI8A 4U1NA 3LD8B 4OF0A 3FO2B 2NZ9C 4AJ0A 1WICA 1K4CB 2SEBA 4GMTL 4JZJB 1FJ1B 2H32A 4HEME 5EC1A 4G8GA 4P2OA 5T3ZL 2NZIA 1MSPA 1KJVB 2JTDA 3L5HA 2X70A 5E2WL 5IEKB 4P23B 3UTSD 4FXKA 4PJAB 1OP5H 5L8JB 1IGIL 4PRPD 4FQIH 3MLRL 3RWHB 4YX2L 3BUYA 3F8UB 5EZLA 2ZSWA 3TVMC 1EEYB 5DK2B 5FYLD 2CJUH 3QUKA 1MFBH 1XZ0A 2C7UB 2HKFL 3QUZD 2VN4A 3IKCB 3VXQB 2XT1B 3JZ7A 2ICWA 5JHDE 5IP4A 3OAZH 2YMXL 4LLWA 1L9NA 1F97A 4EI5B 1FG2B 4QNPF 3MLTB 3JWOL 5F97E 4Q7DA 4Z7VA 4QTHB 4H8WL 1MOEA 5D1XB 3BPLB 4LFHD 2Z91A 4UIMB 4F7CB 4B7LA 1GGCH 4NKOB 2OXHA 2ESVD 5E03A 4K9EH 3K2UL 3QAZB 1H3VA 2OSLB 5IHUH 2CDFA 1KEMH 4PJCA 3SDDD 2R29L 3G5XB 5FB8A 5C8JA 3NZHH 4PP1D 3BD4A 2YBRA 4RGOH 4XPBH 1NUNB 1KXTB 4N5UA 2FB4L 5L7XH 1AR1C 1U8OA 5CIPA 3EOTH 4X80L 4FABL 2FBJL 4F7PA 5DJ2A 5LGHH 4BSVB 2GSIA 5JUEL 2N4IA 3DXAD 4RX4A 5JQ6L 1LE9B 4IRSD 1WCBA 3GRWL 1CE6B 4WI4A 3Q1SH 5KN5A 3BQUD 3HB3D 5D7IF 2FX7H 4QHKJ 5I73C 2PXYA 3K74B 1DN0B 4KK9D 1T7XA 5AAMA 2WWMC 2VH5L 3LRHA 4P2YA 1OTSD 1UM6L 4FTVD 3AREA 3KYMB 4CW1A 4YBLC 3VA6A 2JJWA 2XWJB 4KGJA 4D8PB 2V17H 1UENA 4KWUA 1ITBB 2EXWD 5FM8A 4F58H 2VZ3A 1GVIA 4HMEA 2XZQH 2C4FT 5EIIB 4HZLA 1RZKL 1SEBB 4JQIL 4YHPA 3MV8B 3AAZB 2FD6H 3LQZB 4KKAD 2QQKL 1AQDB 4P23D 2GKIA 3O9WB 5IHUL 1UWEL 1K4DA 4FQ1L 1OAKH 2ADJA 5E9DD 2ID5A 1NCAL 1FVEA 4MLIA 2GCYB 3MOAH 1T0MA 2D7NA 5L88H 1NGXB 1CBVL 2VDNH 5DD0L 5I1AA 2OTUB 4U49A 4ZFFB 2BSRB 5IESH 4R3SA 4X80H 2J1KA 4YDKH 3RU8L 5J6HA 2WV3A 1L7IL 4HUUA 4NCDA 3FMGL 4KRPB 4WCYL 4YAQB 4D0BA 5DVLA 3RWDA 3S96A 4POZD 1XGUB 1XCTB 5CD5D 1BOGB 1RD6A 3KLAA 2P5EA 1P4IL 3QHFH 4P2OC 5ALBH 1FN4A 1HH9B 5ETUB 1I3RA 1MIEH 3J8F7 4QRPD 3SDXB 1XF3A 2XQYK 1YMHB 4WFFD 3UTTB 2FZ3B 3GSOB 2EIZA 2D0GA 4JO3H 2AJ3A 2OCFD 3GSVA 5BW7C 3KYOB 2J8UE 5AYUL 1A6TA 2VLME 1GCFA 2DMKA 1RZKC 2E9BA 2X40A 1CFSB 1I7RA 4UB0L 2OMBA 1MRFH 4NQDA 2D4FA 3KPOA 3O8XB 1QLFB 3FRPG 1E28A 3PGFL 4I3RH 5I9QC 4K07A 1OP3K 4OM1H 4X9GA 2EDHA 1R3IL 1I1FB 4OCLC 1YMMD 5DTFA 5C0EB 1I7UA 5BMFL 3BH8B 3VFVA 3QG7H 2ZPKH 4X9BA 1VFBB 2K3TA 5AD0B 1GGTA 2C3XA 5DRNA 5J8OA 3FJTA 4X99B 3FZUD 5CSBA 1I85C 1ZTXL 5C07D 1VFMA 1S9VB 1JGLH 1M1SA 1WFNA 2DTMH 4XB7A 5C0BE 2YK1H 1MFDH 1MCIA 3P0VH 4OFVA 3NFPB 4LVOC 4FABH 3THML 2VLKD 1JWSB 1Y6MR 4CJ1A 5JO5A 4LQFH 1GAFL 4FZ8H 4X7SH 1A7PH 4P0DA 3QDGE 4DW2H 2DLFH 3CSBA 5I1DB 5ERWB 1NANH 2IQ9L 1D5IL 1P6AB 5TF0A 4OGXL 1BWWA 3LQAH 4S1RL 3IF1B 3SQOH 1ONQB 5IF0A 2IGFL 1YNKL 1B0WA 3HLAB 1ZVYA 4JFYB 3MRRB 5JDJA 5IK3A 4PLNC 3BDXA 4MZ3A 3V4VH 2DJ4A 5L0QC 5JPNB 2DQJH 3GKWL 4QOKA 5I76B 1UT9A 4KQ3L 5IWLC 1V3JA 5GJTH 4TVPL 5ADPH 2FO4A 4WEBH 2HLAA 3VFWA 2D03H 5LCVH 3PWVB 5L6YH 3PWUB 3ROLA 4ODWB 3HB3C 4Z78B 3WSQH 3IDYB 4R4ND 3QXWA 3TO4B 2VZUA 4GLRI 1CLOH 1JF5A 4YWGH 2W0FA 1KELL 5DMJB 2R0KH 1D9KC 5KSVA 4KI5F 1J11A 4XNUH 4EDWH 3WUWB 2DI9A 2FX8H 1FNSH 3DGCR 5IHZA 4QRSB 4Q2ZA 4OCXH 1T83A 1CQYA 2YD4A 1CVSC 4ORGA 4YDKL 5HGDB 2HFFA 5JW4M 2ZG3A 3EJZC 4FHBD 1X6LA 4TNVF 4PLOB 4C59B 3L5IA 3TWCL 3IJHA 1F90L 1KN2L 4Y19A 2R0LH 2D9QB 3Q3GA 3VI4E 5BRZB 1YPZF 2EYRB 1U91B 3G6JE 4QHKI 4PV9B 3MRIB 3GSRA 3GMRB 4XVUC 4OLXL 1BD2B 3UEZA 1GZQA 3IRPX 4WY7H 5HVFB 5T3XL 3DETD 2VN7A 5SWZE 2ZG1A 1JK8A 2KL6A 1CLYH 4GUPB 3U6RB 3UTSA 1DN2A 5DHXB 4PREA 3N1GC 2F5AH 4X4XB 2ADFH 2XG4A 3G6JF 5J11C 2DL9A 1Z0NA 3QCVL 1G84A 1NFDF 4Y2DD 1JWUA 4JFOB 5IG7A 2NR6C 4JDVA 5DK0B 4WW2A 1CXHA 2R0KL 3BGMA 4HWZB 4JRWA 5A2IH 3ARDA 4L8BB 4RMSA 1KXQE 1DANU 4BH7B 4EIGB 1CFQA 2F74B 2XN9B 4LRIC 1AI1H 3FQUB 4GMSH 1E6JL 1NBYB 2GUOB 1IBGH 5HYSB 3TO4C 5IVXB 1DQTA 1ZLUK 5DMIH 3QDMB 4O2EB 3O6FA 5T5FH 4LLMB 3T0EA 2KUTA 3I6KA 3AREC 1IL1B 8CGTA 4AG4H 2JIXA 1RIVL 2EEAA 4R7NB 5FA3A 5EU4A 5FHAL 1FE8L 5JMOC 1D5BA 2EDQA 4DUWA 1MJJA 2EECA 3BP5B 4MNGA 3LB6D 3NAAL 5EZLB 3Q6GH 1KJ3L 4QY8B 1WVZA 3SPVA 5IHBA 2C7UA 1AE6L 3U4BH 1QRNA 3QIBD 1DANT 3H6JA 2Q1EA 3S5LB 3NH7L 2DI7A 2D3VA 3CZFB 3U0PB 1MH5B 1IARB 2RQ8A 3GKWH 4BFIA 1A6VH 1SJXA 2EKJA 1WGOA 1T5WA 2NXZD 2X4UB 4WV1A 4CN1A 4JKMA 2V9QA 3HE6A 2PYEA 1CFVL 5GISH 3GSVB 3HAEB 3MLZL 3RJQB 4BQ9A 1S7XB 5I19L 1BD2E 1GOHA 3L95A 3QDJB 2CO6B 3QNXB 4OBRA 4Q9BA 1KCVL 1F45A 1AFVH 3CSGA 1NANI 1R0AL 1LE5B 3B83A 2XV6B 3RUGB 2EEDA 2H9GB 4WVRA 3ZZ1A 1Q0YL 3CH1B 2RJMA 2GIYA 3ARPA 3NCYP 3DYOA 3GMNB 1UM5L 3VFOB 1XIWA 1ZLSL 1MIMH 4MAYD 4APQA 1HHHB 4Q6IA 4H1LA 2LE9A 3CC5B 2QLVB 1UZ8B 1PLGL 2HWZH 1IJ9A 3LH2L 1RAMA 2ZCHH 5F6HJ 1DE4A 4MA1C 1H0DA 4WWKB 3I2CL 1B9ZA 2ZCLL 2E8YA 4JZOB 5HGAA 3IFPB 3EO0A 3P2TA 5KVEL 2X4SB 2R1WB 4HV8B 2HVKB 3UC0H 1A1MB 3OJMB 4RFOL 3V9FA 4U6TA 3CFJB 2WBJA 3D2UD 3MJ7A 1P7KB 4F33B 4RMWA 3D18B 1AGBA 1U58B 1AE6H 1U95A 4HGMA 3NA4A 3QAZC 3PIQB 4JKWA 2V7NA 7CGTA 2CIKA 1IM3A 4UBDC 2FJHA 3G5ZA 4UAOB 1GZPA 4WU7B 2F15A 1QSZA 1RIHH 4WU5A 2AJUH 4L1HA 5HYJB 5I16B 3O6LL 2QQNH 3H3PH 1OD7A 1U8HB 4UTBH 4QHMA 4ODHH 5KSBF 3PGCB 4JM2B 2XQYG 1BREA 4I3SH 3UYRH 5EH1A 1SMOA 1X5GA 1CIUA 3HS0A 4GRLB 5CJXA 1F3DH 3GM8A 1DN0A 3KPMA 3ZL4L 1XR9A 3UTPD 4MDJA 1L7TH 1EK3A 2WBWB 4OFYA 1IC5H 3IDIB 4XNYH 1E4XH 1OCWH 3W0WE 3TIDB 3DHMA 5J9PB 5CGMA 4ZPTA 4QKXB 5E2JA 1MNUH 4XPBL 1JRHL 3QDMD 3MBXH 3BKCL 3HI1A 3H9SB 1ORQB 3LQZA 5KS9E 2HMID 3L5XL 2LTQB 3MV9A 3CDYA 4ZFZA 2KZ1B 4HG4K 1UWGH 2Z8SA 3K7UA 3BIAX 2VITA 1HXMB 1I8MB 4KXZI 3U9UB 2XRAL 4EBQH 2AV1A 5C2BH 4MQ7A 4LNVA 1DEDA 2ZCKH 3OB0K 3SGEI 5B3JF 5SX4I 4P46C 4ZYKA 4AH2B 1F8TL 1MUJA 5TDNB 3EFDL 2X5PA 1ACZA 3G9AB 1SQ2N 2AXJA 3MROB 4S1QL 4ODBD 4X5XA 3T3PF 4LSDA 3RIAF 3ABZA 3LRGA 5I1LB 4QRPB 1R3JB 2YN5A 4WI2A 2FZ3A 1G7IB 5CZXD 4Z77B 3VH8B 4LNRA 3VXME 2QADC 2L7UA 4Y5XA 4K3EH 5DMGC 3NN8B 4QRTB 1FL6A 4TUKH 2J3SA 4DGYL 2OI9B 5TH2A 4MAYB 3VFMB 4Z76A 1CR9L 3I2CH 1S78C 2NZ9D 1FLRH 3K81A 5M95B 2Z35A 1Q94A 1MFEL 3ARXA 2QHRH 3SKOB 2OTPA 3X12B 5KVDL 3QIWB 1JRHI 1JYVA 4XPHL 5CMAA 1IEHA 5BZDB 4N8CL 1IC7L 3BN9C 1M6OA 4PP2A 2NY2D 1A7OH 4XRCB 43CAB 1IAIL 4GKSB 4YUEL 3QHFL 5ALBL 1TVDA 2YA1A 4APQD 2R2BA 3QPQD 2VE6A 3E3QE 3X3FL 1HSBA 1QNZH 4N1EA 3LY6A 3X3GL 5F7FA 3TA3A 1F8TH 3B2UC 2ICWI 3MRQB 3RZCA 5EBWA 1EHLL 3NFPA 4W4OC 4M6NH 3JTTB 1U8JA 5BS0A 1KPUA 1T89A 3BP6B 4CADB 4HT1H 1N3NA 4LHJB 1BOYA 3BOVA 4EN3D 4LIQL 2DDQH 3JVGA 2NY5H 5FGRA 3TT3H 1Q9LA 1OLZA 1IAKA 5E8DH 5B39G 2CMRL 1LWRA 2F58H 3GIVA 4ONHB 5JQHC 1P4LB 3DI3B 4PGEB 4R96A 1B4RA 2P5ED 1KNOB 2EZ0D 1O7SA 4G6FD 5EU5B 2JJUA 3QRGH 1QD0A 2VLKB 4PIRF 4YC2B 4HUUB 1RY7B 5I1CH 4NJAH 5C9JA 1E6OL 2VDLL 4FQQA 4HD9A 3WNOA 4W6YB 2WQ8A 1ZA3A 1RQ5A 1FVDA 4RFNC 5ID0A 3IU3A 3HNSH 1G7IA 1HYRC 4FFZL 2E9JA 3M8OL 1KLUA 1GAFH 4OM0H 1KOAA 1CDBA 5DSCA 3IDUA 2FYYA 1JHKH 4WW2C 3DVNA 3NA9H 1LDPH 4BYHA 3DROB 1MWAL 1RSFA 1ZEAH 5H35A 5GRYA 2H2PC 4CVWA 1T22B 2RB8A 4NHUA 5ID1B 1YC7A 1X44A 1X6NA 3QIWA 5JR1H 4KAQL 4HMDA 3BH9B 2BNUA 2PKDA 3QR2A 4KY1H 2Q87A 4E0RA 5J0BA 4X6DB 5A16B 4XP6H 3MTRA 1C16A 3OXRA 4KJYA 4UILL 4PJGE 5K9OA 4NRYB 5DYOA 1CI5A 3QEHB 1S7RB 3VRIA 3QUZB 1NCNA 4RMVA 3HG1E 5HYJA 4XNXH 1FNLA 2V2TB 2AXHA 3OB0H 4HS8H 3TYGH 4PJIB 4CKVX 1G6VK 1BIIB 1S9VA 3AY4A 4OCSH 1YEFL 3BUYB 4R2GC 5CINL 2E9IA 1E0OB 4UZGA 4DWHA 4RX4D 4F7EB 1IGJB 1T6WA 4JG1L 3PHQB 4XCYB 5KSAB 2CH8A 1B3JA 4YHZH 4KHXL 1MREL 3WJJA 1PKQB 3I84A 5D2NC 4DGYH 3SKNA 1LO2L 4J3WA 3EHBC 1NFIB 3GBML 5K59F 1YPZA 1OPGH 3TBWA 3GK8H 2AERT 3QPXH 4HUVB 2V6HA 1VERA 1S7UA 2XWBB 5ANMA 5C0AD 5JPMA 4Q9RH 2KDGA 2GJJA 1T66D 4KKCD 4P2CG 3IDGA 3INUL 3K3QA 1JPFA 2EH7L 5AAWA 4YUEH 1NFDE 1GPOH 1H5BC 1JWMB 1RMFL 1D7FA 1CXFA 5I30H 3VXSB 2BVOB 5E6IA 4Y5VC 4C4KT 1JYXA 2HKHH 1ZA3B 4Q6YA 4G5ZL 1M71A 4PRAB 1U0QA 3GJFK 3I6KB 3O8XC 4JJ5B 5IEHA 2DQUH 1A6VL 4OJFL 1RZFL 3LS5H 4EJ1C 4FTVB 3GRWA 3SDCB 4NYLB 3QQ4A 3UYPA 4H1LG 2VSCA 1WSST 1UKQA 5H35B 4U3HA 1A6WH 1W0VB 4Y5VA 2PTUA 2HFTA 4X6FA 5TPWL 1I7TA 1XIWB 2YZ1A 2HTKC 1FL3A 2X7LA 1PX3A 3P73B 4LDOB 4ZO9A 5AUMB 3L3DA 4K3GA 5TE6L 2O61A 4KMTH 3IFOA 4JDTH 5HI3C 3WFCL 1ZT1B 3G5VB 4P2OD 1WITA 3QEHA 4FFYH 1BQLL 3TCLB 4LCWE 3FMGH 4WCYH 2BC4B 5E99H 2F8VA 3D0LB 4DKFL 2CR3A 1K8IA 2AJVL 2OQJB 3WEXB 5DC4B 2A6JA 2FHFA 3C5ZB 3CPLB 2HKFH 3O0RL 3QNXA 3S4SA 3CX2A 3UDWC 3GMQA 1V3LA 4MXQC 4WHTA 3R8BB 1ULVA 3KR3L 1DP0A 3FOMA 1T1WB 3LN5B 2AK1L 1U3HB 2Q76A 5E00A 1NEZA 4NHCH 4HUWA 2BVPA 4I3GA 4NZTL 2QQNL 2QSCL 4J4PD 4R7DA 3OKEA 4XHQA 4YHNA 4NO2A 3WJLC 4M6ML 4G8GB 3MJ9H 2CDGA 1JHLH 4JCMA 5EPMB 4G6AD 4OKDA 4JFDA 3TVMA 3F7QA 1ND0A 5CAYB 1CQKA 4DZ8A 3OGCB 3KYKH 1OGTA 5IBTH 1XEDA 3ARVA 2N7BA 4PLJD 3LS4H 1NAMH 4HIJA 4HJ0C 2JIXD 3HUJF 2ERJB 3MRKA 4XNYL 2CXKA 3B9KD 3JTTA 4N0RA 1URLA 3TF7C 4NSKB 3JV4A 3QWRA 3BZEA 5D96C 1IT9L 1JRHH 5C7XL 4NDMA 1CS6A 1A7NL 4PGBA 1K85A 1GGBH 1Q9LB 2KPNA 1HEZA 4RGMB 2YA2A 2PW2A 3NVQA 1UH4A 5E99L 3TNNB 4DKFH 4AEHH 2MTPA 3VI4F 1ZSDB 3QEUA 1KB5A 4YX2H 1FV1B 3BI9X 3MV9B 3O0RH 4ZS7H 3DGGA 4W4OA 1QSEE 4P57A 4XPTL 3FO9A 4M1GH 3D87B 5I1EL 4L4VA 4ODSH 1OGAD 5CSZA 2GFBA 1KB5L 3E8UL 5GGVH 4I48B 1I8KB 3SDDC 3IAPA 1J87A 3ZDXE 3HE7A 2A9MH 3O3DA 4JHWL 4UNUA 2OS7A 1XGQB 3MA9L 3RDTA 2PYEB 5HDQL 5DQJA 3BDYL 4G3YH 4AT6B 1CF8H 4GAJL 1A7BA 1R24A 2QADB 1MAKA 5DD3L 1Q9KB 3CFCL 4N0YH 3T0XA 1UYWL 4K2UH 2BZDA 4Q74A 1YEKH 1FAKT 4ODHL 2GJZB 1FFOB 3BPOB 4U7SA 1F6LL 3I6GB 4MJIE 2VNCA 4R6UA 3FL7A 4XP5L 4MAUH 1HXMA 5IFAL 1GH7A 2B39A 5EO9A 2HA1A 5J12C 1WZKA 3RTQB 4GQ9L 1A7NH 1GHFH 1W2KT 3NCYS 5GZOC 1H3UA 4JO1L 3ZYJA 2YC1A 2Q7YA 4MA7L 1F4XL 5LGHL 5DFVC 1IZKA 1J1OH 4FQCL 5K9JH 1QSFD 5JA8B 2MPAL 3CH8A 1J8KA 4ZS7L 1SEBA 4DOHB 1PX4A 3E3QC 5IQ7L 3G6JA 2DL2A 5JXEC 1CTOA 2YKLH 5KTEH 2FO4B 3MLPA 3F5WB 3JVGC 1IC7H 4OD1H 5HYSG 2VDKH 1J1PL 4BZ2L 1OTUD 1QRKA 1NMBL 2V9TA 3MGTA 1W72L 3HE6C 3TNNA 3MRBB 1GGIH 5J13C 5JHLH 1QSEA 4GKNB 1QQDA 4NFCA 4LLDA 2IPUG 4JFZL 4KC3B 1UZ6E 5DVOA 1I1CA 4RRPA 5C0JA 3GHBH 1A1OA 5SWQA 4WWKC 3TT3L 3W81A 4OLEA 3D9AH 1G6RA 4OQTH 4QRRD 1U2CA 2GCYA 3KXFE 2RR3A 1J0KA 4EN3B 3FQWA 4EI5A 4G7YL 3BO8B 4UV7L 4MJIB 4A2MA 2C3WA 1OY3B 3MFFB 2WWKO 2DYPB 4EOWL 2F5BL 4LLYA 5DJDB 3PV6B 3WNMA 2QKIB 1ZANL 4LHQB 4XMKL 5D7SL 5HYQB 4AL8L 4K7PX 5DUML 5FYLH 5T5FL 1EO7A 5HYFA 1P7HL 1PZ5B 2VDNL 4HIIA 5DD0H 4ZAKD 1NDGB 5D4QA 5INCA 4M48L 1OAUH 1FFRA 1T21B 1I9JL 3QIUA 1R3KB 5FKAA 3SY0A 4WW1A 1F5WA 2PXYD 4NCC2 2VDKL 2CGRL 4FS0A 1WWCA 1RJCA 2DM7A 1HIMH 5I74C 1HHKA 4NZJA 5LXGL 3CDCA 4JKLA 1VEPA 3ARBA 4HXBL 1M05A 1SHMA 1HXYA 4JHWH 5D9SA 2XWTB 4UT9L 2BSTA 2DQHL 3MQIA 2IF7A 1MVUA 2HTLD 3O3BB 4KJYB 3CFCH 4M1CC 4N0YL 1VSCA 4RRPG 4M6NL 5MEPA 3PDGA 4L4TA 3AVEA 3U1SL 4WFFE 3OKEB 5BV7H 3PJSB 3WHXA 5EWIL 4U1KA 4XWGL 1UEYA 3P4OB 1GGUA 3ZT7A 2EDTA 1J12A 2VLRD 1KJ2H 4DFIA 3CVHB 1NBZA 3KPPA 2DJUA 2HFGL 2C26A 1QOKA 1JGVL 3SDAB 3UROR 1BPVA 5JW5A 1QBBA 4Z8FL 4F80A 3GK8L 3MZGB 5F6HI 3QI9B 2UWEA 2OJZH 3V79C 1NCBH 4XVTH 3P11H 4MSWA 4QXTA 2J8UA 5D7IE 1I7ZB 1KLFA 3GSWB 2WP3T 3MR9A 1UB5B 5GS1B 2OP4H 4NN5B 1XF5A 4EZMA 3QUZA 2NCMA 5FV1L 3SBWA 3ROLB 3HE6B 1F11B 4G6MH 5HSFA 2LTQC 5FYKH 4HGWA 3O6KL 3TP4A 2P5EE 1JNLL 1PSKH 1XGUA 3JWDH 5AG9A 1RMFH 3LQAL 3SQOL 3P0YH 1S9XA 1KB5B 3IDXL 2IH1B 4HJGB 1IGCL 2WUBH 4JRYE 2BVQB 5ESQA 1SJHB 4NO3A 1EFQA 5ITBH 1XGTB 4XVSL 3MXWH 3P4NB 4J3OC 1NKRA 3OR6A 1FG2A 5DI8A 5CJ8A 4I77L 3VWJB 4XZUB 1T1YB 4N0FB 4ZUVA 4I18B 3OJDA 4G7YH 4FQLL 4YWGL 4ENED 2EIBA 2QSTA 2KQNA 4U7MA 3A6OA 1WZ1H 1MJ7H 4JM2C 2WINB 3WN5A 5CBAA 2XWTA 3RIFF 3QWOB 3MRIA 1U95B 2VAAB 1QFUL 3CUPB 3NZHL 4U6VH 5E1AA 4ODXA 1BF8A 2VZ1A 3IFOB 4MXWH 5HGGS 3EYQD 1J8HB 1PGRB 2R4RH 3GB7B 3OL2A 2MCPL 3RIFK 4U1IA 3P30L 5DO2C 2ED9A 2NYYD 3L9RA 1CD9B 1DZBA 2B5IC 3NTCL 4ORZC 1DQQA 2ZNXA 2W60A 3GBMH 3L3IA 2R39A 4MZ2A 5KS9A 3OAYK 4F7MB 4W6WB 3S35H 4EUPG 2DBLL 4OV5A 3U4BL 3L5XH 4BSVA 3EYVA 5C1MB 5F3HA 1U3HC 2AKRB 4QT5B 3I02A 1RZJH 2MQ3A 5JW3L 4O5LL 4GUPA 3DO7A 4UT7H 2PXYB 1B2WH 5TDPA 3ZKNC 3FOLB 3L7EA 3GBLA 4PJAF 1I3UA 2XFXA 3VFTA 3PL6D 3TO4D 4GT7A 1OW0A 3C9NA 3QEQD 4XT1C 4R97B 1I1YA 3BH8A 4ZUUB 4AQOA 1R5VB 4U6XB 5BS0E 5CUSL 4M7LL 3IS0X 3ARDB 3QFDA 5C9KA 4OZHF 2H26B 4ENEC 1QVOB 1FH5H 5F9WB 4YHKL 3T8XB 4PRDB 4I9WD 1NCWL 4KK6D 4PY8I 4BSJA 3S88H 4ZSOA 1EUUA 1JFQH 1YPZB 2XQBH 5DVMA 2ADJB 2EDBA 3BPCB 2DIBA 2R69L 4OLZL 1P1ZB 1FHGA 2UY6A 3BWAA 1G7LA 3WIIL 4C54A 4S1SH 5L2KA 4ZUSA 1TJHH 2P42B 1CR9H 1VADB 4L3EB 4M61B 1OT1A 3DYMA 4EUPH 1W72A 4KMTL 5CHNB 1WF5A 2EIEA 1MCFA 3PNWA 4UV4H 5T33L 1RHHA 1FNEA 2FBOJ 4ZFOA 3H7BB 2XNAB 3LKSB 5FUOH 4X6BA 4DZ8B 3BEVA 3V0WH 2J6EH 1QFHA 4LLVB 4IOFD 4JM2F 4PS4L 5TF1H 5I17A 3QCUH 5FECA 3I3EA 5C07B 1GIGL 5FUZH 3OKLB 2XYCA 3FCTB 1U8QA 1H8OA 4X4ZA 1JGDA 4U1IB 2OR9L 1PJ9A 4M43L 4LBEA 1RHFA 4O2FB 4TTDC 1HHHA 4NHCL 4X4YA 5B8CA 4YIQB 1KLGA 3VG9B 1DUZA 3JWDC 4NYLA 2QSVA 3WL9B 3O4LB 4UOJA 3CZJA 2APXA 4OCMC 4UILH 1MAMH 3AS0A 1DBJH 2AGJL 3UX9B 4Z95H 3QDHA 3MLVH 4PJ8A 5F7LB 1QFWI 4ERSL 3O8XA 3JTSA 5IFAH 3FQNA 3U2SB 2XKNB 3MLZH 5J57B 1FL3B 2ICWJ 4KJQC 2G75A 2NMSA 2HLFC 4ZTPL 1FYTB 4TQEL 1T7VA 3CIQA 4YPGB 2VZVA 3RVTC 5H2BA 5C0EA 4GMTH 5E2UH 2WIMA 1UQSB 3J7HA 4HC1H 1QRNE 4QRUB 4U1KB 1JZ7A 4DVRH 1IGYA 3G6DL 3LKOB 2H26A 1UB6B 3SJVE 3LD8C 4QWWC 2P24A 1CGWA 4OLVH 5F88A 1INQB 2DBLH 3BP6A 4F3FA 4LHUB 3PF2A 1A22B 1LO3H 3MV7B 3SKMB 3VJ6B 2AJXH 4OF5A 4L5FH 5DLML 4QRRA 4G8EA 1HH6A 5E56A 5MENB 1IGFH 2VXQL 3NPSB 3MLTA 1KGCD 1UB5A 5E6YA 3TH3T 2Q3ZA 3ARFB 3HRPA 2NX5D 2A83A 2X4QB 3OXSA 4PJ5A 4BKLB 4ZPTB 4UTBL 3DX6B 4KAQH 2YD8A 5HTSA 4OLYH 1NLDH 3QUMA 3RWGA 4L8BA 3ULUD 4J3SA 1AD0A 3NGBC 1C08B 4U6YB 3K2UH 2WIIB 2VR4A 1QSFA 2D03L 2MQCA 5IMKB 3DIFA 3G5XA 5D2NB 1JGDB 4NJ9L 4JFDE 4NBZB 4YJZL 1H8SA 4R4BA 2Y5TB 1ZHLA 4ONFL 3HC3H 1VACB 4LSQH 5J89A 1CD1A 4IS6B 4U0RC 5ABDE 3PGDA 4K3JH 1OL0A 5TPWH 5HI5C 1MLCB 3LAFA 2WUCL 3DVNB 4P5TB 2O5XH 3MCKB 5ACZA 4NBYB 1E4WL 1OQOA 1KCKA 1PZ5A 5AEAA 3BQUB 5E5RB 4BFBD 3CH1A 1F58H 4XPHH 4FN0A 5IBLC 5SWZD 3ULUH 4LSTL 3WMSA 1EAPB 4GBXD 3O2WH 3C60D 2CIIA 4X5XB 1C16B 1K5NA 5IT2H 6CGTA 1TENA 4X6CE 4PRIA 1VPOH 1K3ZA 3WJLA 4HH9A 5MEND 3T2PA 1OB1B 3L3GA 4KRNA 3EO0B 1DQQB 1RJYB 1DLHA 4HWNA 1CN4A 2ITCA 2YEZA 3PWLB 3T2NH 2QKIA 4YR6A 3RGHA 1WUNT 4HXBH 4P59H 1UGNA 2MQ0A 2OX5A 4OGZA 1IQDA 4FRWA 3K4ZA 1Q72H 3H2WA 3KPRE 3W0WB 2PNDA 4PJXF 2HN7B 3MREA 4L4TD 4FQ1H 1XF2B 1O0VA 4UDTA 4I2XB 3MYZA 4FZEH 4Y19E 1INDL 1TVHA 2EE6A 4TUKL 5T3XD 3QWRD 3RJDA 1DSFH 1RZIB 1Z5LA 1KPVA 4P2RB 4EUPA 3E6FA 4NZRL 4HUNB 3GBNH 3KPMB 1BFTA 4N90E 4U6YA 3PIQA 2H6PA 2YUXA 4HS6A 3V5HA 3ZMRA 4OGAC 5ICZA 2P7TB 3OKOB 2BNQD 3VGBA 3ZKMD 5CIPH 5MEPB 2ADIB 1PZUB 2Y5TA 3GJFB 5MP6L 1UG9A 4F8TA 1JF1A 3T3MF 5IIEB 4ODTH 4B41A 2RCSL 1EH9A 5FM5M 3QBTB 5GRUL 1MCEA 3KPSE 1NC4B 1C5BL 1KJMB 2ED8A 4LAQH 4P4KA 4OCYH 3RVUD 1TITA 2AK4B 4JG0H 3GSXA 4ZFOB 1RK0B 5FUCE 1G9EA 5TFSH 5T3XH 4QEGA 1NUFA 5HI4C 1YEEL 2AQ1A 2FRGP 2BOBA 2W65A 3ARFD 3U0TB 1KGCE 1CLYL 3UTZA 3ZKMC 2I5YH 3HNVL 2EDEA 3TBVB 5EB9A 3UTSE 1Q0XH 4RISH 3CK0H 5E2TL 4HGKC 4WI8A 4O2FA 4NN5C 4FZEL 2ITCB 2YEZB 3MV7D 3O9WC 1YEFH 1BBDL 4KJPD 5CINH 3OAYH 4JRXE 3DX8A 1F2XK 5C0IA 2ITDA 4I9WE 1YEGL 2GYSA 3CUPA 1DQLH 2OL3B 2P8LB 4AM0B 3ILQD 1I7RB 1DQMH 2IH3B 4OAWB 4WTXA 5TE7L 4JY4A 1EGJL 5L8LB 2HFGH 1MFCH 3KPOB 2AV7A 3K8LA 1QHOA 3UBXG 5C0NC 4NFDA 3S36X 3EDEA 5CJOH 3BEWA 2ZSVA 4X7SL 3HI6H 5CD3A 1B0RA 4J7RA 4NO5A 5HDBF 5IMLA 1A7QL 3SOBL 1JHKL 2I07B 1EMTH 4QXUH 3UO1L 3NA9L 3W0WD 4QHLA 4HV8A 1ERNA 2R4SH 4OT1H 4KROD 1SBSL 3TN0C 3HRZB 2EDDA 3QZWB 3SN6N 1J05A 3RDTC 4Y0GA 4Q0XL 1YMME 2W1NA 3MUZ1 5AZEL 4O02L 1NMAH 2E8ZA 3RKDD 3TBTB 2QJDA 1TXKA 3B9AA 5IBLD 1H15B 1AO7A 1HSBB 5I8OH 4KJWD 5HVWA 4M3KB 4CVXB 4WHYG 5IMOA 5GJSL 2YUVA 5FFLA 4ZAKB 3SDYH 3VE0B 5IB5B 3MODL 1K6QL 4PG2C 4LKXA 5IR1A 4IJ3C 3A67H 2X4OB 1XF4A 4OZGF 4E42B 1UFUA 2FX8L 4PJCF 4JHBA 2HH0H 5HHVL 4WDIA 1L7TL 4Y16A 1JVKA 4CVUA 3MRPB 4PJDA 1BOGA 5HHPA 3NCBB 1X5ZA 4JO1H 1D9KB 5FAAA 3TJHD 4GKSA 1ZXQA 1OSPL 5J7CC 4KI5D 3SDAD 4ZUUA 1WLHA 5E94B 4WNQB 1BEYL 2XNAA 3LKSA 1G9NL 4QOKE 5ADOH 2AW2A 3Q5OA 3QCUL 4GW4A 4J6RH 3P9MA 4WFEE 3OF6D 4LLQB 3MLXH 4YDJB 1C12A 3H9SD 4CADA 3MXVH 4H5SB 2X2YA 4M6MH 4NQSB 1W72H 5IEHB 1YNLL 5AUMA 4U3XA 3QEQB 3EJYC 3BKYH 2VL5B 3QIWD 4X9IA 1CWVA 3L5WB 4MGXA 2L4OA 1MJ8H 3GIVB 4ONHA 4XNZC 2DIJA 3JWOH 1VFBA 2B20A 2HT4D 4RISL 4ZDHB 3SDYL 3KG5A 3PWLA 4PJGF 2EYRA 4FA8A 5J6GB 4Y5VB 1Z3GL 1CFQB 2F74A 3RX7A 5CBEB 4LPWA 1AGEA 4PJBF 1NMCB 2VLRA 1YECH 1LD9A 4IBLT 3DECA 3AREB 3DSNA 4YPGA 3F5WA 1LO0L 3T4AA 5ID0B 1NUDA 3U6RA 5DURD 2ENSA 4EXKA 1I1AA 1EGJH 1WTLA 3QUXA 2V2TA 3CXDL 2JE8A 4XMKH 1DCLA 1G9NC 3VW3L 3GM0A 5CWSA 4EXPX 4U1SA 1N6QH 4I2XA 4KDWA 1KT2A 2VLMD 3AS3A 2GSIB 5DUBB 3TWCH 5KSAA 1T89C 4G6JH 1OTTC 1T2QL 4OIIH 2AKRA 1JWSA 4UV4L 4OLVL 5SV4A 5DLMH 3WD5H 4J3TA 3MRCB 5FM4A 4HW6A 2CGRH 5DRZB 4YHIA 1WWAX 2BNUB 2J6EL 5HYSA 3GMMB 5HJ3A 1UWGL 3NMEA 5FK9A 1CLZL 1WK0A 4NRYA 4Y7MA 4DUXA 1V7NL 1NCCH 3HNTL 1N0XL 3KPRB 3VMNA 3HLAA 1KCSL 5EO0A 4XBEH 2XZQL 4MNQD 4PV8A 5D7IA 4U1JA 1HINH 4B5EA 4JFHE 5BV7C 2G5RA 2ESVE 4LSUL 3MNZB 4LASL 3TM6A 3EO1A 2AK4E 3DXAE 4FQLH 4K55A 1AHWB 5INDA 3CLEL 1FGNL 1LP9B 3CAFA 3KPSB 1KTLB 1RURL 3ZHDA 4XC3L 4Z7WA 1VADA 4L3EA 1IBGL 1N8ZA 4G80A 5HHOD 4RFNB 4MWFA 1NC2B 1U6AL 5D93C 4RGOL 4UMGA 4AEHL 2P47B 3EYOB 2VC2L 4ALAL 4CDHA 4LSTH 4JO4L 4H26B 4LSVH 3DX8B 2XXMB 5HGHA 2I25N 3W2DH 3HMWH 2Q8BH 4ETQA 4G8FA 1ZVSB 5KSAC 1I9IH 4ELKB 4K7PL 2AI0H 2D7OA 3UP1A 2Q8AH 4PGDB 2GTZA 1CDYA 3V6FB 1M71B 4PRAA 1NUGA 2CUHA 4L4TB 3SDXE 1AXTL 1KLUB 2BC4A 1QFWM 3NH7H 5IVNA 3OKMB 4MX7A 1REIA 4PV9A 3TO2B 1U3HD 1L0XA 4OCRL 4Q9CA 3MA9H 1G7PA 2O26U 4M62H 3O3EB 3C6SB 4NO0B 5I1KH 4X9FA 4HDIA 1HNGA 2LV4A 4XCCL 5IJKA 1AGDA 3FT3A 3SE4C 2BXYA 2EDKA 4XC1L 4NNPL 5DC9B 2Y9RT 1BX2B 1CK0L 1FQ9C 4ZQKA 2DMBA 3MA7A 3OJVC 3LKNA 3BP4B 1IC5L 3MV7E 5EO0B 3D48R 4X6CB 3K8KA 1QO3A 5I0DA 2VKXA 2GTWA 1ZANH 2EDOA 4R26H 4WUUA 2FJFA 4MQXC 1QFWH 4MVBD 5B39B 2PYFA 4WJ5A 4F9LC 5CEZE 3BP5A 5ECJE 3GSNH 3ULVH 4HIJB 4IEFB 4RAVB 1CGTA 4MNQA 3RY4A 1UWXH 1YN6B 5BV7B 5FIEA 2NXZB 1TZGL 1A1OB 1F4HA 2WLYA 3QPXL 2Z31D 5KTEL 1G6RB 3TV3H 3U46B 4FP8L 1S3KH 2JIXB 1RIUL 5D6CA 3LEVH 4X4MA 4ZTOL 2VYRE 1KJMA 1EX0A 4NBXB 1T1ZA 4L4VD 5JORA 4JFDB 1QQDB 3RX5A 5D2LE 4DCQB 4AH2A 5E94A 3G04A 3RA7L 4HZAA 1C1EH 5DJDA 3EZJB 4KKBD 4XXDA 4FMFA 5B3NA 2LU3A 4H8WH 5DJ0A 3FQWB 4QWWD 5HHOA 4YDIL 2LFGA 2JB6A 4K8RC 1AQKH 3HNVH 3SGEH 3C2AL 4NKDA 1WTGT 2Y06H 2A38A 2VITB 3U7YL 3FFDB 4B7IA 2EXYD 1U93A 1AP2A 2YRLA 1S7XA 4LCWD 3B8SA 2AQ2A 1DQJA 1NC4A 4NM4H 1CT8B 4CU8A 4XCEB 3QQ9D 2WBJD 3GSRB 4P5TA 1XMWA 2FLBT 4JDZA 3V52L 5H37G 3LIZL 4XH2A 3B9KB 5GHWH 4CRPA 2PW1B 1K8DA 5JIKA 1OP3H 5TE7H 2DQFA 5KVFL 3SJVB 2JELH 3HZMB 2DI8A 2F53E 1I7TB 5CMAB 3SKJH 5MHSD 5KVDH 1XIWD 2VLJD 5F1OB 3IAGC 4GFTB 1F6AA 4Z7OF 2VB5A 3QEGL 5GRZA 2AI0L 1PSKL 3OF6A 5CEZL 1UADC 3TN0B 2CK2A 3DVFA 3O6FC 1M05B 3GNML 2VH5H 4ZUTA 1U8HA 1J10A 3ZKQD 5LXGH 3LKPB 4RAVA 1UXSA 2XTJC 3SCMB 1SBSH 1FDLH 4JQVC 4Y16D 3DOSA 5F3BA 1MPAL 2FJGB 4XNMB 1Y0LB 1K4DB 2EH8H 4KTDL 4WI7A 5F1IA 4HG4J 3QUXD 5I16A 4HT1L 4MDIA 2VQTA 3L3OB 4D9QD 5JNYB 1OGAE 4N0CD 5EWIH 4S1QH 4Z95L 3CVHA 2BCKB 4F37F 4ZS6D 5IG7B 4FXKB 4X7CC 5FEBA 3RZWA 3IJYB 1ADQA 3E2HC 3NIDE 1LP9F 3IKKA 3HC0A 4U1HB 3UBXB 5BQ7A 3KGRA 3S5LA 3V7MA 3DNKA 4LIQE 3BGFB 4PJDB 1JTTA 5I1JL 1CBVH 1HCFX 3A0OA 3EGSA 5B38G 1J7VR 2A6DA 1FVDB 3TYFA 1JGUH 4LCIL 4MLSA 5C0RH 4HKXB 3AM8A 3S3SA 3X11B 3B9VA 2VXVH 1LP9A 2BMKA 5A43C 5D1QC 1MJUL 2BJMH 1RUPH 5EBMB 1B4JH 1EJOH 4XCEA 2VO5A 2QQLH 1MFAL 2NXYD 3WKMH 4QTIL 3PWJA 3OJDB 3CJJA 1GOGA 1VGKB 1C12B 1X5JA 3FB6A 1FV1A 1EZVX 2B5IB 3LN4B 5GS0D 3MLXL 5EUOE 2UZIH 2XA3A 3MOBL 4MD5A 3MJ8A 3GEWB 1MCCA 4PJCB 3FN0H 1A5FH 4KK8D 2JF1A 4DAGH 2P5WD 3GB7A 4BFIB 3W9EA 4Y4KC 4JRYB 5JLZA 3VFSB 4JM4L 3O41B 2DWEB 1P69B 4RGNB 4YDIH 4JFFE 4ZDHA 2MWCA 5D8JL 5E9DB 1XGQA 3NCEB 5CIPB 1HHIB 3WUZA 4HLZG 1XF1A 1BFVL 5KSAD 1HDMA 5HHNB 5BMFH 4JY4B 2DQIH 3NCFB 5I1LA 1CICC 4HPOH 1ZHKB 5D5ME 3MOAL 1L9MA 1I1AB 2R1YA 2HWZL 3SDDB 1K2DB 3BKCH 2WUCH 4P4KD 5I1GH 4UTAH 5FKAB 4E0RB 1NQBA 3BKML 1X9QA 4ZS6C 1MIML 3DETC 4I4WA 3RTQA 3OSKA 3FO1A 1AIFB 1JGEB 1DBBH 4J1UA 2XWJA 3HR5A 3F6IA 4N8VG 5EZOL 4Z76B 1RV6X 1MHCA 3UXFA 4LLUB 5BVJA 1BJ1H 1QO3B 1J8HE 1I8IB 2BNQA 1N7MH 4PRHA 5IQ7H 5ICXA 1KCRH 5T3XE 4U7KA 1CXLA 1IAOA 4F7EA 1NDMB 3SE4A 4P5TD 3HZKA 1B2WL 3P77A 2GJ6E 2FLRT 2C3VB 4PG9B 4MCZA 5T1KB 4POUB 2BVTA 3W39B 4U1JB 2YPLE 3HI1B 2Q86B 4LEOB 4KRLB 3IDGB 1FFQA 2G5BB 2DN7A 1UEMA 1WAAE 4K2UL 3WIFA 4D0CA 4YAQA 4YK4B 5HGDA 4YZFF 1KSRA 1CFVH 2X4TA 4Y4FA 4MD5B 4Z7UB 1YQ2A 3HFMH 2P5EB 5DF0A 1IAKB 4LSSL 4KI1A 4OLZH 5KSBA 3D25A 4XBGA 1OB1A 3L3GB 1JGUL 5FCUL 4LRNL 1BF2A 2EO1A 5I74B 1D5ZA 3GGWA 3P9LA 3C5ZA 2FCBA 4TSBH 3QIBA 4Q9QL 1E4JA 4M48H 2BERA 1FL5B 3MUHL 3DBXB 4CUCA 4P4KC 2VLJA 3IT8D 3FO0H 3CVHH 3QIUB 5GSVA 4LPXA 3L3DB 5TF1L 4XMLL 2A0LC 2W59A 4GKZA 2YD2A 3QP3A 1ONQA 2IAMB 3BW9B 1I7UB 1CFNB 1QR1A 2Y7QB 1NC2A 4GW5A 3QO0B 4LLUA 3DUSA 4JLRB 4LFHG 5IK3B 5C2BL 1S8DA 2GK0A 3VD4A 5C09E 3HC4H 1A9BA 2FD6L 3D2UB 4WHCA 2WINA 4KQ3H 3WN5B 2VZOA 1J0ZA 3ZT5A 2X09A 4ONGH 1S7VA 2AABL 1TIUA 1ZT4A 5GGQL 4V2CB 4P5KB 5GGTL 3AGVA 4U1LB 5CEXA 3HPLB 5JO5B 4RFEB 4TQEH 4WUUB 2IMMA 2RFXA 1HWHB 2DKUA 1V05A 4P2QB 3HUJB 1MF2L 4A2LA 5CCKL 3CFEB 5DEFA 4WHDA 1GRWA 1BVLA 1S9YB 1IRAY 4LF3B 2ATKB 5J6HB 5F96L 4LHUA 3K2MC 3BGAA 1I3VA 4MJ6B 3RVVD 4XP9L 3EAKA 1AGDB 4EVNA 3RZCD 3U0PA 3FFCB 1OP9A 1OAUL 2Z31A 3TA3D 5F7HA 3TBVA 4YDLC 3VXMA 5GS1A 3RBSA 3ES6A 3NABL 2DB8A 4Y8DC 1RHHB 3NOIA 3LRSB 3CXHK 5E4EC 1NJ9B 2BRRH 2NNAA 2P8PB 3VXTA 3RHWF 1Z6JT 4O2CB 25C8L 1H3PL 4MS8D 4P46B 3ROOB 4FQJH 1U8MA 3BKYL 4XP1L 5SWSD 2GJ6D 1T0NB 3BP7A 4L9LA 1CFSA 1AY1H 3QEUB 3BVNB 5F9JB 2FIKA 5DDHB 3P3YA 3MZTA 1H3GA 4KMLB 1YMHA 1UM4H 2VQ1B 2XKUA 4XVSH 2EDNA 5ESQB 3MJ8B 4P2QE 3U82B 4J8RB 3UZEA 1LNUB 2L7JA 3NCMA 2Z4QA 4S2SB 1T6VN 1EEZB 4XCFH 5DWUL 1UZ8A 4HF5L 4IRJA 1I1FA 4YGVA 4LSQL 1VKXA 3KJ6L 4KHXH 1N8ZB 4G80B 1T20B 1HSAB 1KG0B 4R2GD 4NJ9H 1RJYA 1ZVHA 3MV9E 4JPIA 4QF1A 3V52H 3ZHKA 3EOAB 1I9EA 4GMSL 3BEVB 3TH2T 3O9WD 4OB5L 3UTQA 1YJDH 4DN4H 5C09B 4G43A 5KVFH 1FG9C 1FYTA 1VENA 3QJHA 3FN3A 3IGAB 5D7KE 5FO7B 3VWKD 5DJZB 3A6CL 3MRFA 3VGEA 4LAQL 1H15A 4CNIB 4HWBH 3S7GA 4IJ3B 1FIGL 4XWOC 2CDGB 3OX8A 1LO5B 1Z9SA 3O4LA 4U1MA 4M9OA 5DK0A 4O5LH 4MD4B 1VPOL 4NZDA 5DR5H 2EDJA 5DUPL 1RZIA 1Z5LB 4M8QA 2A9ML 2QR0A 5ID1A 1PQZA 3U7WL 3ALPA 5L2KD 1RVFL 4OZIB 1QZ1A 4GAJH 3V0VB 4K8RD 2C5DC 5TQ0L 4RMUA 5JA9A 4NIKB 4XTRD 1X5XA 1YEHH 3ARGB 3MRDA 5DFTA 3BSZL 3KYMA 3FB7A 4CW1B 2DQDL 3QO1A 4XWOD 2R2HA 1FP5A 5EO1A 2J5LC 1JZ6A 3N1FC 2Z8VC 2VWEC 3UZVB 2UWEF 2NY7L 3LPFA 1MCWW 4JFHD 3RNQB 1P7QB 5IOPA 4H20H 1WFUA 5MEOB 1UXSB 4OGAD 5FO9A 3AAZA 3AS2A 1YA5A 3GSXB 2X1PA 1CFTB 5INCB 3VFWB 3MLUH 4X5WA 3S36H 4O9HH 1DUYB 2WLZA 2UVEA 4EN3C 2YD1A 5EU3B 4JRYD 4M3JA 1Y18B 4NQVB 2VDRL 3NFSL 1A7QH 3SOBH 1MFBL 4HCRH 2PXYC 5EUOB 1ZHBA 3SDXF 3EJYD 2HJFA 2GJ6B 3RI5K 3FB6B 1UJ3B 3L3JB 1CD0A 1EFXB 5DT1H 1J1XH 3QIBB 1BD2A 2X1OA 2W65B 1YY8B 2X41A 5F1SA 4PJFE 1T1XB 1F4WL 3QJHB 4X5LA 2K1MA 1HE7A 4NNXA 1OAZL 1KCSH 1ZT1A 3G5VA 2ATPA 3GHEH 3LEYH 5HHOB 4I48A 1HZHL 4OD3L 4HKXA 3X11A 2IG2H 4WI6A 5CSGA 5T3ZD 2YZ8A 1YEHL 2IFFH 5GS0C 1BD2D 3QFJE 3D9AL 4WUKH 1BFVH 1T7WA 1A7RL 3TJHC 4YR6B 3VXSE 1G1YA 5HI3D 5D5MB 5D7JC 1INEH 1QFOA 1Q0XL 2AJSL 3IXAB 1FGNH 1KJ2B 1K8DB 1FH5L 3X12A 4NC1C 5E2VL 2WW8A 2R1YB 5KS9F 4K71B 5DQ9B 4YFLI 3I50L 2XZAL 3WS6A 5CD3B 1IAIM 5E9DE 2FB4H 4AEFA 4YQXH 1Y6KR 5JQ6H 4PD4K 1HI6A 4ZXBB 3DVGA 4DVBA 5IFHL 1CU4H 2Z8RA 5FA4A 3T1WA 1MFCL 2ICCA 1CDUA 3OG6B 1U3YA 3O8XD 2DOCA 4WIQA 1GGYA 4R4FH 3O6KH 3D3VE 4UU9B 1C5CL 3ALWA 4PJIE 4NZUL 2ZOLB 3HZKB 1RUQL 1BQUA 5ICZB 3HG1B 1I1AC 3TN0D 3QUXC 1N3NB 3MJ9A 2FL5B 2A6KA 3EIFA 2NY0C 3CMGA 5DUPH 3OV6A 4FTVE 4PGBB 2PTTA 5DURB 3L3OA 4FQ2L 5KW9L 2X44D 4KV5F 1AIFA 3ARFA 4XI5D 1XGPB 3RWEB 4O02H 4RZCA 5SWZA 5DGRA 4BUHA 2ZUXA 3U0WH 1R0AH 2ZJSH 5I71C 4OJFH 1TJIH 2ESVA 4FQPA 3QUYD 4NM4L 1NCDH 2H9GA 1OM3H 2A6DB 2H1PH 1T0PB 4PRNA 1IM9D 2V2WA 5JOFA 1KTDA 5T1DL 1G7HA 5HDOA 3D39B 3ZSTA 3VFRA 3GSUB 2YUZA 4YGVB 3RU8H 4RIRA 3DV4A 2X4RA 1CL7I 2NY4B 2XN9D 3DROA 1JN6A 3IXAA 1T5XA 3DRQA 5F7WC 4X98B 3I75B 5F9OH 2N1KA 4D0CB 5EFIA 4TTDD 5D1QA 1EV2E 3IAQA 4HBCH 4UT7L 4NUJB 1J1XL 4ELMA 4M1GL 4OV6F 1EXUA 5KG9A 4XBEL 3EYSL 5FO7A 4UB0H 1D9KD 3P4MB 1B0GB 3VRIB 3R8QA 1A3QA 4BZYA 1TMCB 3VCLA 5BRZA 2AK1H 4PJGB 2R2BB 4WWID 5GGVL 3BYYA 4Y5XB 1A6ZA 5FDYA 1S8DB 1YEIL 4X7EC 1G7MB 1U91A 3CFJA 5CJBA 5EOCJ 2LU4A 1G6RL 3WNKA 4JZNA 4IRSB 3MV8A 3WFHA 2V7NB 2D31A 5GS0L 2Y06L 3VFPB 5F7EH 2XI9A 2HVJA 3HG1A 4YHKH 2GJZA 5C08E 4HKBA 2BX5A 4JN2A 3QQ3A 3VXRA 2H1PL 1IFHL 4ZD3H 4HUVA 1UM5H 2SEBB 1MCLA 1CDHA 3CX5K 1SYVB 4ISVA 2DLIA 3PQYA 3L3KA 3O11A 5CHNA 5TDOA 5J12B 5FXCH 5I15H 1ZLUH 4DUVA 4UIMA 1BVLB 1S9YA 3CX5J 1BQHB 1F11A 1JPSL 2DTML 2A77L 1ADQL 4D3CH 4NT6A 4YEFA 5SWQB 3ARGD 2GW5A 2ZP0T 1A4KA 1B4JL 1EJOL 3SE9L 2EEBA 4JZJC 1FPTL 3OKDA 4XP9H 2NTFB 5C8JB 3VXMB 1AXTH 1ES0A 3BIKA 3HPLA 4ZOCA 3RVWD 4TNWK 3NIFF 1N0LA 2BVQA 4QRPE 3GSNB 4OCRH 4WI9A 5CILH 3IETB 1J1PH 3HPJB 3LEXB 3I3DA 4NQED 4YDLB 1YYMH 3BN9D 4HIXL 3C60C 4PJEB 2XY1A 4JN1L 4Y1AA 1G6RH 5TFSL 4HIIB 3EDDA 1HQ4A 4M4RA 5CGTA 3LOWA 1JI2A 2ZKHH 4DTGL 1CK0H 4JPVH 4P4RA 3SKUD 5FYJH 1TJIL 1NLBL 4I3RL 2M8XA 4JVPA 4NNXB 1HKLH 4U3CA 4EOWH 5FO8A 2YD5A 3RDTD 3VWJA 1TPXC 4JKKA 3DXAB 1Q1JH 1N26A 3TN0A 1YMMA 5KS9B 3S37H 1U8OB 2LVCA 4GW1B 3GGWB 4ETYA 3V8OA 4MAUL 4S1SL 4OTXL 2MKWA 2X4NA 5CBEA 5HBBA 1ZVSA 2QHRL 4NZRH 4GAGL 3O2DL 1KF9B 2J5LB 3KHOA 1QSED 2HVJB 4NHUB 1NEZB 5T1LD 5IW1A 1OD9A 4N8CH 3ARGC 4DGVL 1Y6NR 5F9OL 3FO2A 4CNIA 3V0WL 4ZPVA 1EEUA 1DFBL 3HAEG 2DLFL 2OZ4L 4PBVC 4L4TE 2YSSB 3FQTB 1QNZL 4BH8A 1ETZA 4JCLA 2DS4A 3BISA 5DVNA 5DZNA 4A6YH 5GIRB 3E1F1 1A02N 4GAYB 1IC4H 4W70A 3TA3B 1XR8A 5I66A 1AGBB 3MBEB 2AJZA 1N5YH 3KLAB 4M03A 1D5MA 3MBED 5BZDA 5F7KC 4UT9H 2NY6D 3EW3B 3ARGA 1BVZA 3NZ8A 1LEIB 4TRPL 3ARFC 1U8IB 4PB9L 5SX4H 3BP4A 3GSOA 4PJAA 5J11B 2MJWA 3NPSC 2OK0L 3MUJA 3CK0L 2E3VA 5ANMB 3T08A 3LS4L 4GRWB 1JYWA 3SDCA 3HPJA 3WSQL 4LSSH 15C8L 4XAWH 1DQDL 4AEIL 4LF3A 3G04B 4KJQD 2ZUVA 4NQDB 3H7BA 3U7AA 5E2UL 4OF6A 3MLWH 1U8PB 3V8CA 5LVEA 5L2JA 3ZDYE 3MRPA 2ESVB 4Y4HC 2YPLA 4FQQB 1FZMA 2IPKA 5D6CB 3UJJL 5B22A 4JO2H 1YN7A 2C3GA 2C1OA 2F54D 4P5TC 4Z0XB 5CEZH 3QQ9C 4JRYA 3PXJA 2Y36H 3HE7B 3PHSA 3QO1B 5GRVK 1T3FA 4PLKD 2KQMA 2A74A 4IHOB 3GJEA 3RUGE 4HK3N 2EC8A 1HHIA 2IBGA 3MRJA 4ODSL 4MA1B 4ETQB 2KBGA 1U8LB 3QDJE 2X4NB 5D7LA 3ZTNL 5E08H 2IFGA 4E5XB 4ZOAA 1T5XB 1IGCH 5EULV 5H94A 3FOMB 2APTA 4KH2A 2B1AH 3CFBB 1CD8A 1MHHA 1C1EL 3CCHA 2APWA 4KVCL 4ZO7A 1K2DA 3BT2H 4PJHE 1EAPA 1QSVA 3VH8G 1F3DJ 1INEL 4HK3J 4LU5L 3L3HB 5HPMB 1P4BH 1RJZB 4JDZB 3GI9L 3PWPA 4XZUA 5EZIH 5CZVL 1CYGA 1LK2B 3SHSA 4GAYA 2DQDH 3KDMA 3WEXA 4GOSA 1K6QH 2ADGA 4MD0A 4BH7A 3T0AA 2W9EL 4QGTA 5MEQB 4HZLB 1IE5A 4NRZB 4XMPH 5ACLA 3WS3B 3MROA 3C5JB 4JANB 4YXHL 2P8MB 2NX5B 1DR9A 3KYAA 2HJKA 4HQQH 4XPAL 1OSZA 3ZE2F 4PGDA 4NQCA 4HKBB 1NGQL 4GXVH 2NLJA 3NN8A 4HS3B 3ECBB 2A1WL 4AG4L 5CLTA 1JZ8A 3PL6C 3T8XA 3WDHA 3L1OH 1KTRL 5KAQG 2O5ZH 4OGYH 3SKNB 3GSQB 5FUCC 1KPVB 4P2RA 4YHLL 5GXBB 1GOFA 4PJ7B 2ARWA 4ORGB 3DO7B 2CLRA 3HN3A 3OGOE 2BVOA 3ARDC 4MDIB 1VESA 1S7SB 5ALCH 4K3DL 1N5YL 4XB8A 2D9CA 2EDRA 4M61A 1KIPB 3M07A 4HLZH 4OQTA 4EEEA 3ZE0F 1R3HB 2X1WL 3QIUD 4K23L 2R2HB 4WEBL 5EO1B 3SO5A 3RGVC 2AJ3B 4Z78A 3ORJA 1JWMA 3SJVD 1MLCA 1KEML 3QFDB 5GISL 4XCFL 1ZS8B 3VD9A 1Z3GH 2WIIA 5GZOD 2APFA 5B8CC 2QL1A 3EDFA 4QYOB 1MWAA 8FABB 1FCCA 4YHZL 3BN3B 4R90H 3NCCB 1E28B 5DFVD 4LPUA 5LAXA 5C0ND 3UTSB 3ZTJH 2X89D 4H1LB 3GUTA 3SDCC 4NRXA 2A2QT 3VXMD 4NC1E 4QHUA 4ZUWB 2OR8A 1MJUH 2YWZA 4Y16C 1DVFA 3ILQC 4QTHA 2J12B 4M7KL 1QHPA 1KTKE 5T5NG 2AEQL 1KN2H 3QDME 1JPST 2NX5E 2AJXL 1X4YA 1PEWA 1UJ3A 4X98A 3VFGL 4WFGE 5KBNC 3W9DB 3M1BA 4OGYL 1EIBA 3BFOA 4JPWH 2XRAH 3ULUF 5C9JB 5CKGA 5I30L 3MLYL 4EQ3A 2UZIL 3OKNB 4JFDD 5IB2B 5E8OA 5IGXL 1T1WA 4XVUD 2B7DT 1OSZB 5D70L 2IANE 2BK8A 1DBKL 1HKFA 1MCJA 1I9RH 3P4OA 5ERWA 3S98A 5DJXA 1ZGLA 5HDBE 4NWUL 1T7ZA 4JB9H 3ULVC 2BVUA 2PCPA 1G7PB 4K9EL 4ZOBA 3T2QA 1HWGB 4P2RE 4NN7C 5F3BB 4E42A 3B43A 3MRGA 4HIHB 3WFEH 3QI9A 4Y89A 2B8OT 5I66B 1EA9C 2BHUA 5I1DA 1RJLB 5C0DB 2YS4A 2B4CC 4M7JL 4E41D 2EKSB 1KFAL 5E95B 2HLAB 5EOQL 1V5JA 3MA7B 3AXLA 1KCLA 3TIDA 3TBTA 4Z8FH 1MHCB 1BQHA 2X42A 5HHXL 1E4XL 1OCWL 4WNQA 5FYKU 1S5IL 1W0WA 3EFFA 5B39A 5BQ7B 1DVFC 3HI6L 5EOTB 5IFJB 4ELMF 2PUQT 5I8KL 2A1WH 5F7UA 1FVCB 2FHBA 4WFHD 5DDHA 4L5FL 2DTSA 2IBBA 4I0PB 4ZFZB 5JUEH 3JUYA 3WXWH 4WDIB 1VFUA 3DTXB 4PJ9B 2EDLA 4RGND 4NQSA 1VA9A 1X5LA 4GRWE 1FZMB 2IPKB 3JXAA 5LBSH 2DMCA 1G7JB 4EI5D 4X8XA 3C09C 3REWB 3QIWC 4CDGC 2DWDB 3U7WH 4L3AA 3DMMC 3PHOB 2YRPA 4U1HA 4Z0BL 3FHQA 4ZAKC 3VU2A 2NXYB 1HKLL 4XHJC 1JMXA 3N06B 4UNVA 3MRHA 3SDXA 4Y19B 1AGCA 3IFLL 2J8UF 5ICYB 1TQBB 2CMRH 5BOPA 2ZUWA 1X5HA 1E6JH 3HFML 1NCTA 3CMOH 3OX8B 5TH2B 3FQRA 4YHYC 3TCXA 3CVIH 3VG0H 3KJ4C 2PTVA 2R23A 4O9HL 4R0LA 1JF6A 2WWKT 3LDBB 3TPUA 4X6FB 4MNGE 4OZ4B 5IT2L 1I8LC 2OBGA 3HHRB 1P7QD 3FQUA 5GSRA 2FO1A 4UAOC 4JFEA 1MCBA 3RWCA 1A6PA 4P5KA 35C8L 4U1GB 3QDMA 4O2EA 5D71H 2I9LA 3IFNL 1ZEAL 3HCVB 3IDJB 1DFBH 3JV0A 4V1DA 4WW2B 3FB5B 2VXSL 4PV8B 2VKWA 5SWSA 2CDEA 2W0PA 4AZ8A 1W8OA 4QCIB 4JZNB 4DKEL 1QVOA 5ITFB 3GMQB 1XH3A 5JR1L 1CFTA 4UQ2A 1QRNB 5EOCL 5C3TA 4XNMA 3CFDA 3U4AA 5J13B 1CXEA 1WBYB 2NY4C 4F2MB 4WO4A 4XCNA 1AD9A 4OLUH 4TRPH 3DRTB 4WTWA 2J8UB 5EU4B 4CVXA 1T03L 2DDQL 5DI8B 2P46B 1N2RA 1WWBX 1NCDL 2XTJD 5FYJL 3UTTE 5DQDH 1MY7A 3LRSA 2F58L 5EUKA 3RWJB 4BQCA 5T1DH 5T1MB 4O58L 5FDWA 2ZUUA 1AHWC 3O4LE 1HN1A 4GW4B 5C09D 4PJ9C 3SGKA 3MGAA 5CJQL 4U1GC 3A6BH 3VRLE 4FQCH 4ZNEE 5CCKH 3FT2B 5HHPB 3EOYG 2HFEA 1PYWA 4OD2A 2YBRB 2IH1A 4HJGA 5DGQA 3O6ML 1WZLA 5HHMD 4YXKH 2A74B 3VGFA 2N7AA 2Y36L 3VD5A 1I8MA 4WW2F 5AG8A 3VFNB 3EYFA 1FL6B 2CLVA 5D6DC 5C08B 3RL1B 1T1YA 1CGYA 4N0FA 2AK4D 4ZUVB 1QG3A 1CICA 4PRBB 2V5MA 2CRZA 2G9HA 2F5AL 4P57B 4YGAB 4RWYH 2E7BA 3UTQB 5EZJB 1BWMA 4FQ2H 3SO3B 4HBQA 3F7VA 4L4VB 5E4IA 1P4BL 3SY0B 5IJVA 4HIEB 5LCVL 3ULVE 4P59L 4H0GA 1YPZE 2X70B 3BT2L 3V7AG 4XWGH 5F6IB 5CUSH 1BQHG 4TVPH 3Q3GB 2DWEA 2BDNH 2ZJSL 3PJSA 3DMMB 4PYHA 4QRQB 4QHLB 3IDNA 4C56D 43C9B 3JBG7 2CLZA 5CZVH 1AI1L 1MEXL 2A9NH 4HFUH 1N64L 1LO5A 1KBGH 3RZCB 4J3VA 1BFOB 5DJ6A 2ZUYA 1KCUH 3PDOB 4OQ1A 2OTWB 3LN9A 5BS0B 2VDOL 4U1LA 5CJQH 5CEXB 3OTTA 4M1DH 4QXGH 1WZMA 1JK8B 4PJAE 2BNRD 1NAKH 4BSWB 3ARUA 2G2RB 4Z6AT 4Y4KB 3LKRA 3EOTL 2UYLB 5C0RL 2FH6A 4ODVH 1I1AD 2ZSVB 2IPTL 1AC0A 3WE6A 2VISA 2WK2A 5CJOL 3D39E 4P5MA 3QRFM 3SE9H 3FB7B 3UJJH 3DSFH 4FQXD 4RBPK 5C0AE 2HYMA 2M2DA 4CL7A 4MXVE 4GW5B 4LKXB 4RZCB 3HZYB 5ISZA 2VE6B 5C07E 5JZ7D 1PQZB 4OI9A 1F4WH 4JVWA 4UNTA 1YZZA 4F9PA 5F7DB 1FNAA 4NO0D 3JUZA 3GMMA 3WNPA 4LQ1A 1U8JB 2HT2C 5D1ZC 1WAAA 2QSCH 2EYTA 2YPKA 4RBPH 1DTUA 4GS7C 2V2WB 3U79A 1KULA 1HHGB 2HP4A 5DJYB 5EOCH 4LSPH 3D39A 5HD8C 1JHLL 5E6ZA 1MRDH 2NNAB 2P8PA 4Y2DA 2VAJA 4APQC 2R9HC 3QIBC 5DEGB 5LQBH 1A6TB 3OG4B 3VXRE 2VDQL