4TNMA

Crystal structure of arabidopsis importin-alpha3 armadillo repeat domain
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
421
structure length
407
Chain Sequence
PAMVAGIWSQLEATNLLRKLLSIEQNPPINEVVQSGVVPRVVKFLSRDDFPKLQFEAAWALTNIASGTSENTNVIIESGAVPIFIQLLSSASEDVREQAVWALGNVAGDSPKCRDLVLSYGAMTPLLSQFNENTKLSMLRNATWTLSNFCRGKPPPAFEQTQPALPVLERLVQSMDEEVLTDACWALSYLSDNSNDKIQAVIEAGVVPRLIQLLGHSSPSVLIPALRTIGNIVTGDDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWTISNITAQIQAVIDAGIIQSLVWVLQSAEFEVKKEAAWGISNATSGHDQIKFMVSQGCIKPLCDLLTCPDLKVVTVCLEALENILVVGEAEKNLGEDNLYAQMIDEAEGLEKIENLQSHDNNDIYDKAVKILETFWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Importin subunit alpha
publication title Probing formation of cargo/importin-alpha transport complexes in plant cells using a pathogen effector.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 152
structure length 407
sequence length 421
ec nomenclature
pdb deposition date 2014-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
A PF01749 IBB Importin beta binding domain
A PF16186 Arm_3 Atypical Arm repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4tnmA00
4FZFA 3NMZA 1XQSA 2NPPB 3EG5B 5H2WA 3K5QA 5B56A 2Z5OA 5AEIA 3ZIPA 4FZDA 2Z6GA 4I2WA 3NOWA 2JDQA 4R11A 3EA5B 4JLQA 3UKWB 1GCJA 3NMXA 1JDHA 3AU3A 3LTMA 2JKTB 3QHEA 4HM9A 4D4EA 3GVTA 5HUWC 5DN7A 5K6SA 3BWTA 4BQKA 4B8JA 2GL7A 4U5VA 2BKUB 4Y5JA 3O2SA 2DB0A 3FGAA 3Q0NA 1M8YA 5SWFA 4UAEA 4FDDA 1QGKA 1I7XA 3TPOA 3ZIOA 2PKGA 4QMHA 1BK5A 4CT6B 1EE4A 3GRLA 4H3KA 4DVGB 4BPLA 2BNXA 4MFVA 4YJEA 3OUXA 1Q1SC 1IQ1C 4KZGA 3FEXC 2QK2A 4U54A 4TNMA 4CRVB 5BZVA 4U5LA 1IBRB 2BAPA 4O27A 1LUJA 3DADA 4BA3A 2NYLA 4P6ZB 1M8WA 4EVTA 4HTVA 4YGXA 2VGLA 2XA7A 3IBVA 5K9SA 3Q0MA 5KL8A 2QK1A 3ZIRA 4EV9A 4UADA 3FEYC 5D5KC 3TJ3A 4MZ6E 1OYZA 2WTKA 4B8OA 4NZWA 4LACA 4FQ3A 4U5SA 5E6QB 3DW8A 2IWHA 3KNDA 4HNMA 4U5OA 3O4XA 3K5ZA 4NEEA 3UKYB 1LRVA 2IAEB 3ODRA 3W3UA 4OIHA 4U5NA 3GQ2A 1UPKA 2BCTA 3PSPA 1XQRA 2IX3A 3UL1B 2FV2A 3K7VA 5EWPA 4U58A 4PVZA 4DB8A 4YI0C 4GMNA 1W63A 3T7UA 5BZUA 2IW3A 5KLAA 3ZHPA 1HO8A 3TPMA 3LWWA 3WPTA 5HHGE 3Q5UA 4U3JC 1G3JA 3GS3A 1F59A 4CBAA 1QZ7A 4XZRB 4DB9A 3IFQA 3C2GA 4R10A 4ADYA 4DJSA 4QMJA 5BYMA 3BSBA 3GB8A 3QGBA 4QMIA 4WV6A 4FFBC 3FGAB 5J3VA 3L3FX 3Q0OA 3BTRC 3V74A 1M8ZA 1EJLI 2JAKA 4B8PA 4OO6A 4PLSA 3A6PA 3VWAA 3K62A 4ZDUA 4DBAA 4E4VA 4RZPA 4JW2B 4UQIA 1M1EA 3WYFC 1WA5B 4YJLA 2NYLB 4V3QA 1JPWA 3WOZA 2VGLB 2XA7B 4H3HA 3O2TA 3L6YA 4I5LA 5CTTA 1UPLA 5SVZA 1BK6A 3V71A 2JKRA 4D49A 4CT7B 4EVPA 3NMWA 1W9CA 3L3QA 2Z5KA 3BX3A 3Q0PA 1V18A 4YK6A 4RV1A 4U5UA 3K49A 3TJZB 4V3OA 1QBKB 1M5NS 4CRUB 1TH1A 2NYMA 4L7MA 4B18A 3TX7A 2C1TA 3BCTA 3ND2A 1UN0A 1I7WA 4IMIA 5EKGA 4K92A 1W63B 4MFUA 2X1GF 2RU4A 3OPBA 5JJAA 3PSTA 3ZKVA 3K64A 2YNSA 4UWXA 4V3RA 1JPPA 3OUWA 5H2XA 1QGRA 1Q1TC 5KLRB 5FC8E 3Q0RA 2Z5JA 5SW9A 2NPPA 3GAEA 3K7WA 3RZ9A 3C2HA 1Y2AC 3Q0LA 3UKXB 3ODSA 3UL0B 2F31A 3BX2A 3K61A 4IMJA 2C1MA 2QNAA 4PLRA 4CB8A 1EJYI 4P6ZG 3OQSA 2H4MA 3Q0SA 3ZIQA 4EVAA 1O6OA 3TT9A 3GNIA 2JKTA 1IB2A 2X19B 1B3UA 4DB6A 4I5NA 1M8XA 3Q0QA 3C5WA 4HXTA 5BZ5A 4UQIB 3UKZB 3QGCA 2IE3A 3EBBA 2OT8A 3K5YA 5LSWA 1PJMB 3VE6A 2QMRA 3QMLC 1IALA 3LTJA 4G3AA 2P8QA 4UAFB 2YJYA 1U6GC 1WA5C 1O6PA 1PJNB 4MZ5E 4GMOA 4R0ZA 3BSXA 2JKRB 5EKFA 3UVUA 4DZSA 2Z5MA 3RZXA 4RXHB 3K4EA 1Z2CB 5KL1A 3OBVA 5HUYC 4I2ZA 2W3CA 2Z6HA 2OF3A 2YNRA 5KLTB 4CV5B 1UKLA 3O2QA 5BZ1A 2NYMB 2PF4A 1T08A 4A0CA 3GVOA 4FZAA 3WOYA 3QG9A 4CB9A 3L6XA 3H3DX 4EV8A 2RU4B 4K6JA 3V6YA 2IE4A 2Z5NA 1XM9A 4PLQA 2Q5DA 2IAEA 3ZINA 1EE5A
chains in the Genus database with same CATH superfamily
4FZFA 3NMZA 1XQSA 2NPPB 3EG5B 5H2WA 3K5QA 5B56A 1LSHA 2Z5OA 5AEIA 3ZIPA 4FZDA 2Z6GA 4I2WA 3NOWA 2JDQA 4R11A 3EA5B 4JLQA 3UKWB 1GCJA 3JY1A 4I96A 3NMXA 1JDHA 3AU3A 3LTMA 2JKTB 3QHEA 4HM9A 4I3NA 4D4EA 3ZIKA 3GVTA 5HUWC 5DN7A 5K6SA 3BWTA 4BQKA 4B8JA 2GL7A 4U5VA 2BKUB 4Y5JA 3O2SA 2DB0A 3FGAA 3Q0NA 2XOAA 1M8YA 5SWFA 4UAEA 4FDDA 1QGKA 1I7XA 3TPOA 3ZIOA 2PKGA 4QMHA 1BK5A 4CT6B 1EE4A 4I7IA 3GRLA 4H3KA 4DVGB 4BPLA 4A3VA 2BNXA 4MFVA 4YJEA 3OUXA 1Q1SC 1IQ1C 4KZGA 3FEXC 2QK2A 4U54A 4TNMA 4JW2A 4CRVB 5BZVA 4U5LA 1IBRB 5CLEA 2BAPA 4O27A 1LUJA 3DADA 4BA3A 2NYLA 4P6ZB 1M8WA 4EVTA 5CL9A 4HTVA 4YGXA 2VGLA 2XA7A 3IBVA 5K9SA 3Q0MA 5KL8A 2QK1A 3ZIRA 4EV9A 4UADA 3FEYC 3BVSA 5D5KC 3TJ3A 4MZ6E 1OYZA 2WTKA 4B8OA 4NZWA 4LACA 4FQ3A 4U5SA 5E6QB 4I37A 5CL3A 3DW8A 2IWHA 3KNDA 4HNMA 4U5OA 3O4XA 3K5ZA 4NEEA 3UKYB 1LRVA 2IAEB 3ODRA 3W3UA 4OIHA 4U5NA 3GQ2A 3UJ0A 4I8MA 1UPKA 2BCTA 3PSPA 1XQRA 2IX3A 3UL1B 2FV2A 3K7VA 5EWPA 4U58A 4PVZA 4DB8A 4YI0C 4GMNA 1W63A 3T7UA 5BZUA 2IW3A 5KLAA 4I1EA 1HO8A 3ZHPA 3TPMA 3LWWA 3WPTA 5HHGE 3Q5UA 4U3JC 1G3JA 3GS3A 1F59A 4CBAA 1QZ7A 4XZRB 4DB9A 3IFQA 3C2GA 4R10A 4ADYA 4DJSA 5CL4A 4QMJA 5BYMA 3BSBA 3GB8A 3QGBA 4QMIA 4WV6A 4FFBC 3FGAB 5J3VA 3L3FX 3Q0OA 3BTRC 3V74A 1M8ZA 1EJLI 2JAKA 4B8PA 4OO6A 4PLSA 3A6PA 3VWAA 3K62A 4L4HA 4ZDUA 4L4IA 4DBAA 4E4VA 4RZPA 4JW2B 4UQIA 1M1EA 3WYFC 1WA5B 4YJLA 2NYLB 4V3QA 3VLEA 4I6IA 1JPWA 3WOZA 2VGLB 2XA7B 4H3HA 5CL7A 3O2TA 3UJ4A 3L6YA 4I5LA 5CTTA 1UPLA 5SVZA 1BK6A 3V71A 1N4KA 2JKRA 4D49A 4CT7B 4EVPA 3NMWA 1W9CA 3L3QA 2Z5KA 3BX3A 3Q0PA 1V18A 4YK6A 4RV1A 5CL6A 3JXYA 4U5UA 3K49A 3TJZB 4V3OA 1QBKB 1M5NS 4CRUB 1TH1A 2NYMA 4L7MA 5CLAA 4B18A 3TX7A 2C1TA 3BCTA 3ND2A 4I2SA 1UN0A 1I7WA 4IMIA 5EKGA 5CL5A 3ZILA 4K92A 1W63B 4MFUA 3JXZA 2X1GF 2RU4A 3OPBA 3VLDA 5JJAA 3PSTA 3ZKVA 3K64A 2YNSA 4FP7A 4UWXA 4V3RA 1JPPA 3OUWA 5H2XA 1QGRA 1Q1TC 5KLRB 5FC8E 3Q0RA 2Z5JA 5SW9A 2NPPA 3GAEA 3K7WA 3RZ9A 3C2HA 1Y2AC 3Q0LA 3UKXB 3ODSA 3UL0B 2F31A 5CLDA 4A3TA 3VLFA 3BX2A 3K61A 4IMJA 2C1MA 2QNAA 5KUBA 3JX7A 4JW3C 4PLRA 4CB8A 1EJYI 4P6ZG 5CL8A 3OQSA 2H4MA 1TE4A 3Q0SA 3ZIQA 4EVAA 1O6OA 3TT9A 3GNIA 2JKTA 1IB2A 2X19B 1B3UA 3SLAA 4DB6A 4I5NA 1M8XA 3Q0QA 4I0YA 3C5WA 4HXTA 5BZ5A 4UQIB 3UKZB 3QGCA 2IE3A 3EBBA 2OT8A 3K5YA 5LSWA 1PJMB 3VE6A 2QMRA 3QMLC 1IALA 3LTJA 4G3AA 2P8QA 4UAFB 2YJYA 1U6GC 1WA5C 1O6PA 1PJNB 4MZ5E 3SL9A 4GMOA 4R0ZA 3BSXA 2JKRB 4JKQA 5EKFA 3UVUA 4DZSA 2Z5MA 3RZXA 4RXHB 3K4EA 1Z2CB 5KL1A 3OBVA 5HUYC 4I2ZA 4U2XD 2W3CA 2Z6HA 2OF3A 5CLBA 2YNRA 5KLTB 4CV5B 3T8SA 1UKLA 3O2QA 5BZ1A 2NYMB 2PF4A 1T08A 4A0CA 5CLCA 3GVOA 4FZAA 3WOYA 3QG9A 4CB9A 3L6XA 3H3DX 4EV8A 2RU4B 4K6JA 3V6YA 2IE4A 2Z5NA 1XM9A 4PLQA 2Q5DA 2IAEA 3ZINA 1EE5A
chains in the Genus database with same CATH topology
4FZFA 3NMZA 1XQSA 2NPPB 3EG5B 5H2WA 3K5QA 5B56A 2Z5OA 5AEIA 3ZIPA 4FZDA 2Z6GA 4I2WA 3NOWA 2JDQA 4R11A 3EA5B 4JLQA 3UKWB 1GCJA 3JY1A 4I96A 3NMXA 1JDHA 3AU3A 3LTMA 2JKTB 3QHEA 4HM9A 4I3NA 4D4EA 3ZIKA 3GVTA 5HUWC 5DN7A 5K6SA 3BWTA 4BQKA 4B8JA 2GL7A 4U5VA 2BKUB 4Y5JA 3O2SA 2DB0A 3FGAA 3Q0NA 2XOAA 1M8YA 5SWFA 4UAEA 4FDDA 1QGKA 1I7XA 3TPOA 3ZIOA 2PKGA 4QMHA 1BK5A 4CT6B 1EE4A 4I7IA 3GRLA 4H3KA 4DVGB 4BPLA 4A3VA 2BNXA 4MFVA 4YJEA 3OUXA 1Q1SC 1IQ1C 4KZGA 3FEXC 2QK2A 4U54A 4TNMA 4JW2A 4CRVB 5BZVA 4U5LA 1IBRB 5CLEA 2BAPA 4O27A 1LUJA 3DADA 4BA3A 2NYLA 4P6ZB 1M8WA 4EVTA 5CL9A 4HTVA 4YGXA 2VGLA 2XA7A 3IBVA 5K9SA 3Q0MA 5KL8A 2QK1A 3ZIRA 4EV9A 4UADA 3FEYC 3BVSA 5D5KC 3TJ3A 4MZ6E 1OYZA 2WTKA 4B8OA 4NZWA 4LACA 4FQ3A 4U5SA 5E6QB 4I37A 5CL3A 3DW8A 2IWHA 3KNDA 4HNMA 4U5OA 3O4XA 3K5ZA 4NEEA 3UKYB 1LRVA 2IAEB 3ODRA 3W3UA 4OIHA 4U5NA 3GQ2A 4I8MA 1UPKA 2BCTA 3PSPA 1XQRA 2IX3A 3UL1B 2FV2A 3K7VA 5EWPA 4U58A 4PVZA 4DB8A 4YI0C 4GMNA 1W63A 3T7UA 5BZUA 2IW3A 5KLAA 4I1EA 1HO8A 3ZHPA 3TPMA 3LWWA 3WPTA 5HHGE 3Q5UA 4U3JC 1G3JA 3GS3A 1F59A 4CBAA 1QZ7A 4XZRB 4DB9A 3IFQA 3C2GA 4R10A 4ADYA 4DJSA 5CL4A 4QMJA 5BYMA 3BSBA 3GB8A 3QGBA 4QMIA 4WV6A 4FFBC 3FGAB 5J3VA 3L3FX 3Q0OA 3BTRC 3V74A 1M8ZA 1EJLI 2JAKA 4B8PA 4OO6A 4PLSA 3A6PA 3VWAA 3K62A 4L4HA 4ZDUA 4L4IA 4DBAA 4E4VA 4RZPA 4JW2B 4UQIA 1M1EA 3WYFC 1WA5B 4YJLA 2NYLB 4V3QA 3VLEA 4I6IA 1JPWA 3WOZA 2VGLB 2XA7B 4H3HA 5CL7A 3O2TA 3L6YA 4I5LA 5CTTA 1UPLA 5SVZA 1BK6A 3V71A 2JKRA 4D49A 4CT7B 4EVPA 3NMWA 1W9CA 3L3QA 2Z5KA 3BX3A 3Q0PA 1V18A 4YK6A 4RV1A 5CL6A 3JXYA 4U5UA 3K49A 3TJZB 4V3OA 1QBKB 1M5NS 4CRUB 1TH1A 2NYMA 4L7MA 5CLAA 4B18A 3TX7A 2C1TA 3BCTA 3ND2A 4I2SA 1UN0A 1I7WA 4IMIA 5EKGA 5CL5A 3ZILA 4K92A 1W63B 4MFUA 3JXZA 2X1GF 2RU4A 3OPBA 3VLDA 5JJAA 3PSTA 3ZKVA 3K64A 2YNSA 4FP7A 4UWXA 4V3RA 1JPPA 3OUWA 5H2XA 1QGRA 1Q1TC 5KLRB 5FC8E 3Q0RA 2Z5JA 5SW9A 2NPPA 3GAEA 3K7WA 3RZ9A 3C2HA 1Y2AC 3Q0LA 3UKXB 3ODSA 3UL0B 2F31A 5CLDA 4A3TA 3VLFA 3BX2A 3K61A 4IMJA 2C1MA 2QNAA 5KUBA 3JX7A 4JW3C 4PLRA 4CB8A 1EJYI 4P6ZG 5CL8A 3OQSA 2H4MA 1TE4A 3Q0SA 3ZIQA 4EVAA 1O6OA 3TT9A 3GNIA 2JKTA 1IB2A 2X19B 1B3UA 3SLAA 4DB6A 4I5NA 1M8XA 3Q0QA 4I0YA 3C5WA 4HXTA 5BZ5A 4UQIB 3UKZB 3QGCA 2IE3A 3EBBA 2OT8A 3K5YA 5LSWA 1PJMB 3VE6A 2QMRA 3QMLC 1IALA 3LTJA 4G3AA 2P8QA 4UAFB 2YJYA 1U6GC 1WA5C 1O6PA 1PJNB 4MZ5E 3SL9A 4GMOA 4R0ZA 3BSXA 2JKRB 4JKQA 5EKFA 3UVUA 4DZSA 2Z5MA 3RZXA 4RXHB 3K4EA 1Z2CB 5KL1A 3OBVA 5HUYC 4I2ZA 4U2XD 2W3CA 2Z6HA 2OF3A 5CLBA 2YNRA 5KLTB 4CV5B 1UKLA 3O2QA 5BZ1A 2NYMB 2PF4A 1T08A 4A0CA 5CLCA 3GVOA 4FZAA 3WOYA 3QG9A 4CB9A 3L6XA 3H3DX 4EV8A 2RU4B 4K6JA 3V6YA 2IE4A 2Z5NA 1XM9A 4PLQA 2Q5DA 2IAEA 3ZINA 1EE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZF A;  3NMZ A;  1XQS A;  2NPP B;  3EG5 B;  5H2W A;  3K5Q A;  5B56 A;  2Z5O A;  5AEI A;  3ZIP A;  4FZD A;  2Z6G A;  4I2W A;  3NOW A;  2JDQ A;  4R11 A;  3EA5 B;  4JLQ A;  3UKW B;  1GCJ A;  3NMX A;  1JDH A;  3AU3 A;  3LTM A;  2JKT B;  3QHE A;  4HM9 A;  4D4E A;  3GVT A;  5HUW C;  5DN7 A;  5K6S A;  3BWT A;  4BQK A;  4B8J A;  2GL7 A;  4U5V A;  2BKU B;  4Y5J A;  3O2S A;  2DB0 A;  3FGA A;  3Q0N A;  1M8Y A;  5SWF A;  4UAE A;  4FDD A;  1QGK A;  1I7X A;  3TPO A;  3ZIO A;  2PKG A;  4QMH A;  1BK5 A;  4CT6 B;  1EE4 A;  3GRL A;  4H3K A;  4DVG B;  4BPL A;  2BNX A;  4MFV A;  4YJE A;  3OUX A;  1Q1S C;  1IQ1 C;  4KZG A;  3FEX C;  2QK2 A;  4U54 A;  4TNM A;  4CRV B;  5BZV A;  4U5L A;  1IBR B;  2BAP A;  4O27 A;  1LUJ A;  3DAD A;  4BA3 A;  2NYL A;  4P6Z B;  1M8W A;  4EVT A;  4HTV A;  4YGX A;  2VGL A;  2XA7 A;  3IBV A;  5K9S A;  3Q0M A;  5KL8 A;  2QK1 A;  3ZIR A;  4EV9 A;  4UAD A;  3FEY C;  5D5K C;  3TJ3 A;  4MZ6 E;  1OYZ A;  2WTK A;  4B8O A;  4NZW A;  4LAC A;  4FQ3 A;  4U5S A;  5E6Q B;  3DW8 A;  2IWH A;  3KND A;  4HNM A;  4U5O A;  3O4X A;  3K5Z A;  4NEE A;  3UKY B;  1LRV A;  2IAE B;  3ODR A;  3W3U A;  4OIH A;  4U5N A;  3GQ2 A;  1UPK A;  2BCT A;  3PSP A;  1XQR A;  2IX3 A;  3UL1 B;  2FV2 A;  3K7V A;  5EWP A;  4U58 A;  4PVZ A;  4DB8 A;  4YI0 C;  4GMN A;  1W63 A;  3T7U A;  5BZU A;  2IW3 A;  5KLA A;  3ZHP A;  1HO8 A;  3TPM A;  3LWW A;  3WPT A;  5HHG E;  3Q5U A;  4U3J C;  1G3J A;  3GS3 A;  1F59 A;  4CBA A;  1QZ7 A;  4XZR B;  4DB9 A;  3IFQ A;  3C2G A;  4R10 A;  4ADY A;  4DJS A;  4QMJ A;  5BYM A;  3BSB A;  3GB8 A;  3QGB A;  4QMI A;  4WV6 A;  4FFB C;  3FGA B;  5J3V A;  3L3F X;  3Q0O A;  3BTR C;  3V74 A;  1M8Z A;  1EJL I;  2JAK A;  4B8P A;  4OO6 A;  4PLS A;  3A6P A;  3VWA A;  3K62 A;  4ZDU A;  4DBA A;  4E4V A;  4RZP A;  4JW2 B;  4UQI A;  1M1E A;  3WYF C;  1WA5 B;  4YJL A;  2NYL B;  4V3Q A;  1JPW A;  3WOZ A;  2VGL B;  2XA7 B;  4H3H A;  3O2T A;  3L6Y A;  4I5L A;  5CTT A;  1UPL A;  5SVZ A;  1BK6 A;  3V71 A;  2JKR A;  4D49 A;  4CT7 B;  4EVP A;  3NMW A;  1W9C A;  3L3Q A;  2Z5K A;  3BX3 A;  3Q0P A;  1V18 A;  4YK6 A;  4RV1 A;  4U5U A;  3K49 A;  3TJZ B;  4V3O A;  1QBK B;  1M5N S;  4CRU B;  1TH1 A;  2NYM A;  4L7M A;  4B18 A;  3TX7 A;  2C1T A;  3BCT A;  3ND2 A;  1UN0 A;  1I7W A;  4IMI A;  5EKG A;  4K92 A;  1W63 B;  4MFU A;  2X1G F;  2RU4 A;  3OPB A;  5JJA A;  3PST A;  3ZKV A;  3K64 A;  2YNS A;  4UWX A;  4V3R A;  1JPP A;  3OUW A;  5H2X A;  1QGR A;  1Q1T C;  5KLR B;  5FC8 E;  3Q0R A;  2Z5J A;  5SW9 A;  2NPP A;  3GAE A;  3K7W A;  3RZ9 A;  3C2H A;  1Y2A C;  3Q0L A;  3UKX B;  3ODS A;  3UL0 B;  2F31 A;  3BX2 A;  3K61 A;  4IMJ A;  2C1M A;  2QNA A;  4PLR A;  4CB8 A;  1EJY I;  4P6Z G;  3OQS A;  2H4M A;  3Q0S A;  3ZIQ A;  4EVA A;  1O6O A;  3TT9 A;  3GNI A;  2JKT A;  1IB2 A;  2X19 B;  1B3U A;  4DB6 A;  4I5N A;  1M8X A;  3Q0Q A;  3C5W A;  4HXT A;  5BZ5 A;  4UQI B;  3UKZ B;  3QGC A;  2IE3 A;  3EBB A;  2OT8 A;  3K5Y A;  5LSW A;  1PJM B;  3VE6 A;  2QMR A;  3QML C;  1IAL A;  3LTJ A;  4G3A A;  2P8Q A;  4UAF B;  2YJY A;  1U6G C;  1WA5 C;  1O6P A;  1PJN B;  4MZ5 E;  4GMO A;  4R0Z A;  3BSX A;  2JKR B;  5EKF A;  3UVU A;  4DZS A;  2Z5M A;  3RZX A;  4RXH B;  3K4E A;  1Z2C B;  5KL1 A;  3OBV A;  5HUY C;  4I2Z A;  2W3C A;  2Z6H A;  2OF3 A;  2YNR A;  5KLT B;  4CV5 B;  1UKL A;  3O2Q A;  5BZ1 A;  2NYM B;  2PF4 A;  1T08 A;  4A0C A;  3GVO A;  4FZA A;  3WOY A;  3QG9 A;  4CB9 A;  3L6X A;  3H3D X;  4EV8 A;  2RU4 B;  4K6J A;  3V6Y A;  2IE4 A;  2Z5N A;  1XM9 A;  4PLQ A;  2Q5D A;  2IAE A;  3ZIN A;  1EE5 A; 
#chains in the Genus database with same CATH topology
 4FZF A;  3NMZ A;  1XQS A;  2NPP B;  3EG5 B;  5H2W A;  3K5Q A;  5B56 A;  1LSH A;  2Z5O A;  5AEI A;  3ZIP A;  4FZD A;  2Z6G A;  4I2W A;  3NOW A;  2JDQ A;  4R11 A;  3EA5 B;  4JLQ A;  3UKW B;  1GCJ A;  3JY1 A;  4I96 A;  3NMX A;  1JDH A;  3AU3 A;  3LTM A;  2JKT B;  3QHE A;  4HM9 A;  4I3N A;  4D4E A;  3ZIK A;  3GVT A;  5HUW C;  5DN7 A;  5K6S A;  3BWT A;  4BQK A;  4B8J A;  2GL7 A;  4U5V A;  2BKU B;  4Y5J A;  3O2S A;  2DB0 A;  3FGA A;  3Q0N A;  2XOA A;  1M8Y A;  5SWF A;  4UAE A;  4FDD A;  1QGK A;  1I7X A;  3TPO A;  3ZIO A;  2PKG A;  4QMH A;  1BK5 A;  4CT6 B;  1EE4 A;  4I7I A;  3GRL A;  4H3K A;  4DVG B;  4BPL A;  4A3V A;  2BNX A;  4MFV A;  4YJE A;  3OUX A;  1Q1S C;  1IQ1 C;  4KZG A;  3FEX C;  2QK2 A;  4U54 A;  4TNM A;  4JW2 A;  4CRV B;  5BZV A;  4U5L A;  1IBR B;  5CLE A;  2BAP A;  4O27 A;  1LUJ A;  3DAD A;  4BA3 A;  2NYL A;  4P6Z B;  1M8W A;  4EVT A;  5CL9 A;  4HTV A;  4YGX A;  2VGL A;  2XA7 A;  3IBV A;  5K9S A;  3Q0M A;  5KL8 A;  2QK1 A;  3ZIR A;  4EV9 A;  4UAD A;  3FEY C;  3BVS A;  5D5K C;  3TJ3 A;  4MZ6 E;  1OYZ A;  2WTK A;  4B8O A;  4NZW A;  4LAC A;  4FQ3 A;  4U5S A;  5E6Q B;  4I37 A;  5CL3 A;  3DW8 A;  2IWH A;  3KND A;  4HNM A;  4U5O A;  3O4X A;  3K5Z A;  4NEE A;  3UKY B;  1LRV A;  2IAE B;  3ODR A;  3W3U A;  4OIH A;  4U5N A;  3GQ2 A;  3UJ0 A;  4I8M A;  1UPK A;  2BCT A;  3PSP A;  1XQR A;  2IX3 A;  3UL1 B;  2FV2 A;  3K7V A;  5EWP A;  4U58 A;  4PVZ A;  4DB8 A;  4YI0 C;  4GMN A;  1W63 A;  3T7U A;  5BZU A;  2IW3 A;  5KLA A;  4I1E A;  1HO8 A;  3ZHP A;  3TPM A;  3LWW A;  3WPT A;  5HHG E;  3Q5U A;  4U3J C;  1G3J A;  3GS3 A;  1F59 A;  4CBA A;  1QZ7 A;  4XZR B;  4DB9 A;  3IFQ A;  3C2G A;  4R10 A;  4ADY A;  4DJS A;  5CL4 A;  4QMJ A;  5BYM A;  3BSB A;  3GB8 A;  3QGB A;  4QMI A;  4WV6 A;  4FFB C;  3FGA B;  5J3V A;  3L3F X;  3Q0O A;  3BTR C;  3V74 A;  1M8Z A;  1EJL I;  2JAK A;  4B8P A;  4OO6 A;  4PLS A;  3A6P A;  3VWA A;  3K62 A;  4L4H A;  4ZDU A;  4L4I A;  4DBA A;  4E4V A;  4RZP A;  4JW2 B;  4UQI A;  1M1E A;  3WYF C;  1WA5 B;  4YJL A;  2NYL B;  4V3Q A;  3VLE A;  4I6I A;  1JPW A;  3WOZ A;  2VGL B;  2XA7 B;  4H3H A;  5CL7 A;  3O2T A;  3UJ4 A;  3L6Y A;  4I5L A;  5CTT A;  1UPL A;  5SVZ A;  1BK6 A;  3V71 A;  1N4K A;  2JKR A;  4D49 A;  4CT7 B;  4EVP A;  3NMW A;  1W9C A;  3L3Q A;  2Z5K A;  3BX3 A;  3Q0P A;  1V18 A;  4YK6 A;  4RV1 A;  5CL6 A;  3JXY A;  4U5U A;  3K49 A;  3TJZ B;  4V3O A;  1QBK B;  1M5N S;  4CRU B;  1TH1 A;  2NYM A;  4L7M A;  5CLA A;  4B18 A;  3TX7 A;  2C1T A;  3BCT A;  3ND2 A;  4I2S A;  1UN0 A;  1I7W A;  4IMI A;  5EKG A;  5CL5 A;  3ZIL A;  4K92 A;  1W63 B;  4MFU A;  3JXZ A;  2X1G F;  2RU4 A;  3OPB A;  3VLD A;  5JJA A;  3PST A;  3ZKV A;  3K64 A;  2YNS A;  4FP7 A;  4UWX A;  4V3R A;  1JPP A;  3OUW A;  5H2X A;  1QGR A;  1Q1T C;  5KLR B;  5FC8 E;  3Q0R A;  2Z5J A;  5SW9 A;  2NPP A;  3GAE A;  3K7W A;  3RZ9 A;  3C2H A;  1Y2A C;  3Q0L A;  3UKX B;  3ODS A;  3UL0 B;  2F31 A;  5CLD A;  4A3T A;  3VLF A;  3BX2 A;  3K61 A;  4IMJ A;  2C1M A;  2QNA A;  5KUB A;  3JX7 A;  4JW3 C;  4PLR A;  4CB8 A;  1EJY I;  4P6Z G;  5CL8 A;  3OQS A;  2H4M A;  1TE4 A;  3Q0S A;  3ZIQ A;  4EVA A;  1O6O A;  3TT9 A;  3GNI A;  2JKT A;  1IB2 A;  2X19 B;  1B3U A;  3SLA A;  4DB6 A;  4I5N A;  1M8X A;  3Q0Q A;  4I0Y A;  3C5W A;  4HXT A;  5BZ5 A;  4UQI B;  3UKZ B;  3QGC A;  2IE3 A;  3EBB A;  2OT8 A;  3K5Y A;  5LSW A;  1PJM B;  3VE6 A;  2QMR A;  3QML C;  1IAL A;  3LTJ A;  4G3A A;  2P8Q A;  4UAF B;  2YJY A;  1U6G C;  1WA5 C;  1O6P A;  1PJN B;  4MZ5 E;  3SL9 A;  4GMO A;  4R0Z A;  3BSX A;  2JKR B;  4JKQ A;  5EKF A;  3UVU A;  4DZS A;  2Z5M A;  3RZX A;  4RXH B;  3K4E A;  1Z2C B;  5KL1 A;  3OBV A;  5HUY C;  4I2Z A;  4U2X D;  2W3C A;  2Z6H A;  2OF3 A;  5CLB A;  2YNR A;  5KLT B;  4CV5 B;  3T8S A;  1UKL A;  3O2Q A;  5BZ1 A;  2NYM B;  2PF4 A;  1T08 A;  4A0C A;  5CLC A;  3GVO A;  4FZA A;  3WOY A;  3QG9 A;  4CB9 A;  3L6X A;  3H3D X;  4EV8 A;  2RU4 B;  4K6J A;  3V6Y A;  2IE4 A;  2Z5N A;  1XM9 A;  4PLQ A;  2Q5D A;  2IAE A;  3ZIN A;  1EE5 A; 
#chains in the Genus database with same CATH homology
 4FZF A;  3NMZ A;  1XQS A;  2NPP B;  3EG5 B;  5H2W A;  3K5Q A;  5B56 A;  2Z5O A;  5AEI A;  3ZIP A;  4FZD A;  2Z6G A;  4I2W A;  3NOW A;  2JDQ A;  4R11 A;  3EA5 B;  4JLQ A;  3UKW B;  1GCJ A;  3JY1 A;  4I96 A;  3NMX A;  1JDH A;  3AU3 A;  3LTM A;  2JKT B;  3QHE A;  4HM9 A;  4I3N A;  4D4E A;  3ZIK A;  3GVT A;  5HUW C;  5DN7 A;  5K6S A;  3BWT A;  4BQK A;  4B8J A;  2GL7 A;  4U5V A;  2BKU B;  4Y5J A;  3O2S A;  2DB0 A;  3FGA A;  3Q0N A;  2XOA A;  1M8Y A;  5SWF A;  4UAE A;  4FDD A;  1QGK A;  1I7X A;  3TPO A;  3ZIO A;  2PKG A;  4QMH A;  1BK5 A;  4CT6 B;  1EE4 A;  4I7I A;  3GRL A;  4H3K A;  4DVG B;  4BPL A;  4A3V A;  2BNX A;  4MFV A;  4YJE A;  3OUX A;  1Q1S C;  1IQ1 C;  4KZG A;  3FEX C;  2QK2 A;  4U54 A;  4TNM A;  4JW2 A;  4CRV B;  5BZV A;  4U5L A;  1IBR B;  5CLE A;  2BAP A;  4O27 A;  1LUJ A;  3DAD A;  4BA3 A;  2NYL A;  4P6Z B;  1M8W A;  4EVT A;  5CL9 A;  4HTV A;  4YGX A;  2VGL A;  2XA7 A;  3IBV A;  5K9S A;  3Q0M A;  5KL8 A;  2QK1 A;  3ZIR A;  4EV9 A;  4UAD A;  3FEY C;  3BVS A;  5D5K C;  3TJ3 A;  4MZ6 E;  1OYZ A;  2WTK A;  4B8O A;  4NZW A;  4LAC A;  4FQ3 A;  4U5S A;  5E6Q B;  4I37 A;  5CL3 A;  3DW8 A;  2IWH A;  3KND A;  4HNM A;  4U5O A;  3O4X A;  3K5Z A;  4NEE A;  3UKY B;  1LRV A;  2IAE B;  3ODR A;  3W3U A;  4OIH A;  4U5N A;  3GQ2 A;  4I8M A;  1UPK A;  2BCT A;  3PSP A;  1XQR A;  2IX3 A;  3UL1 B;  2FV2 A;  3K7V A;  5EWP A;  4U58 A;  4PVZ A;  4DB8 A;  4YI0 C;  4GMN A;  1W63 A;  3T7U A;  5BZU A;  2IW3 A;  5KLA A;  4I1E A;  1HO8 A;  3ZHP A;  3TPM A;  3LWW A;  3WPT A;  5HHG E;  3Q5U A;  4U3J C;  1G3J A;  3GS3 A;  1F59 A;  4CBA A;  1QZ7 A;  4XZR B;  4DB9 A;  3IFQ A;  3C2G A;  4R10 A;  4ADY A;  4DJS A;  5CL4 A;  4QMJ A;  5BYM A;  3BSB A;  3GB8 A;  3QGB A;  4QMI A;  4WV6 A;  4FFB C;  3FGA B;  5J3V A;  3L3F X;  3Q0O A;  3BTR C;  3V74 A;  1M8Z A;  1EJL I;  2JAK A;  4B8P A;  4OO6 A;  4PLS A;  3A6P A;  3VWA A;  3K62 A;  4L4H A;  4ZDU A;  4L4I A;  4DBA A;  4E4V A;  4RZP A;  4JW2 B;  4UQI A;  1M1E A;  3WYF C;  1WA5 B;  4YJL A;  2NYL B;  4V3Q A;  3VLE A;  4I6I A;  1JPW A;  3WOZ A;  2VGL B;  2XA7 B;  4H3H A;  5CL7 A;  3O2T A;  3L6Y A;  4I5L A;  5CTT A;  1UPL A;  5SVZ A;  1BK6 A;  3V71 A;  2JKR A;  4D49 A;  4CT7 B;  4EVP A;  3NMW A;  1W9C A;  3L3Q A;  2Z5K A;  3BX3 A;  3Q0P A;  1V18 A;  4YK6 A;  4RV1 A;  5CL6 A;  3JXY A;  4U5U A;  3K49 A;  3TJZ B;  4V3O A;  1QBK B;  1M5N S;  4CRU B;  1TH1 A;  2NYM A;  4L7M A;  5CLA A;  4B18 A;  3TX7 A;  2C1T A;  3BCT A;  3ND2 A;  4I2S A;  1UN0 A;  1I7W A;  4IMI A;  5EKG A;  5CL5 A;  3ZIL A;  4K92 A;  1W63 B;  4MFU A;  3JXZ A;  2X1G F;  2RU4 A;  3OPB A;  3VLD A;  5JJA A;  3PST A;  3ZKV A;  3K64 A;  2YNS A;  4FP7 A;  4UWX A;  4V3R A;  1JPP A;  3OUW A;  5H2X A;  1QGR A;  1Q1T C;  5KLR B;  5FC8 E;  3Q0R A;  2Z5J A;  5SW9 A;  2NPP A;  3GAE A;  3K7W A;  3RZ9 A;  3C2H A;  1Y2A C;  3Q0L A;  3UKX B;  3ODS A;  3UL0 B;  2F31 A;  5CLD A;  4A3T A;  3VLF A;  3BX2 A;  3K61 A;  4IMJ A;  2C1M A;  2QNA A;  5KUB A;  3JX7 A;  4JW3 C;  4PLR A;  4CB8 A;  1EJY I;  4P6Z G;  5CL8 A;  3OQS A;  2H4M A;  1TE4 A;  3Q0S A;  3ZIQ A;  4EVA A;  1O6O A;  3TT9 A;  3GNI A;  2JKT A;  1IB2 A;  2X19 B;  1B3U A;  3SLA A;  4DB6 A;  4I5N A;  1M8X A;  3Q0Q A;  4I0Y A;  3C5W A;  4HXT A;  5BZ5 A;  4UQI B;  3UKZ B;  3QGC A;  2IE3 A;  3EBB A;  2OT8 A;  3K5Y A;  5LSW A;  1PJM B;  3VE6 A;  2QMR A;  3QML C;  1IAL A;  3LTJ A;  4G3A A;  2P8Q A;  4UAF B;  2YJY A;  1U6G C;  1WA5 C;  1O6P A;  1PJN B;  4MZ5 E;  3SL9 A;  4GMO A;  4R0Z A;  3BSX A;  2JKR B;  4JKQ A;  5EKF A;  3UVU A;  4DZS A;  2Z5M A;  3RZX A;  4RXH B;  3K4E A;  1Z2C B;  5KL1 A;  3OBV A;  5HUY C;  4I2Z A;  4U2X D;  2W3C A;  2Z6H A;  2OF3 A;  5CLB A;  2YNR A;  5KLT B;  4CV5 B;  1UKL A;  3O2Q A;  5BZ1 A;  2NYM B;  2PF4 A;  1T08 A;  4A0C A;  5CLC A;  3GVO A;  4FZA A;  3WOY A;  3QG9 A;  4CB9 A;  3L6X A;  3H3D X;  4EV8 A;  2RU4 B;  4K6J A;  3V6Y A;  2IE4 A;  2Z5N A;  1XM9 A;  4PLQ A;  2Q5D A;  2IAE A;  3ZIN A;  1EE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...