4TNUA

Human brain aspartoacylase mutant y231c complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
b'HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDCPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4tnuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4tnuA01
2PVWA 2ZEEA 2GLJA 3KR5A 1LFWA 8CPAA 1YSJA 1H8LA 4P4BA 3NH5A 5DS0A 1TKHA 4PPZA 4OIWA 3FMCA 2ZEHA 3ISZA 3WC6A 2IQ6A 3D4UA 1LANA 3DGVA 1LAMA 4OC4A 3RBUA 3V7ZA 2BO9A 4OIDA 2IJZA 4P4DA 2CTBA 4P44A 3B2YA 4F8ZA 4DJLA 3WC7A 3S9LA 1ZG8A 2V8GA 4NJRA 3IJ3A 2PIYA 4MHZA 2XEIA 2V8DA 4PXCA 4FAIA 2ABZA 3KQZA 4NGMA 1TXRA 3QNVA 4P4FA 2BCOA 3PB9X 2EK8A 4IHMA 4NGSA 4ZY2A 3RAMA 3N5FA 3VH9A 4ONWA 1Y0YA 1AYEA 1BAVA 5HVFA 5LYLA 2OR4A 3JRUA 3FECA 4TNUA 1YW6A 1EE3P 2ZOGA 3IEHA 2ZEFA 3PB7X 4NGTA 1CPXA 2O4HA 1F57A 3FVLA 2PJ0A 2HB6A 4PQAA 5CPAA 3B3SA 3KHXA 3FEEA 4RUHA 1TF8A 4MHNA 2Q43A 3WT4A 1HEEA 3PB8X 3PBBA 2NSMA 4FWUA 3SI1A 2XEJA 5ELYA 2ZEDA 1XJOA 2Q51A 4FBEA 2PJBA 4IK2A 1Y7EA 3VARA 3IC1A 1IGBA 3B3TA 5D29A 4MHPA 2C6GA 3BHXA 3BI1A 1Z5RA 2ZEOA 5LYDA 3V38A 1M4LA 3K9TA 4EMEA 4KSIA 1Q7LA 3LWUA 1F2OA 2AFUA 3B3VA 1VHEA 3PBEA 3D7DA 3NA6A 1QMUA 4JYWA 3D67A 2JBJA 6CPAA 1NSAA 5JM6A 5HVHA 4OC3A 3D7GA 3B3WA 4NGQA 2HC9A 2ANPA 1PCAA 5LRJA 3WABA 4EFDA 3H8GA 2C6PA 1ZG9A 3TC8A 3IFEA 1CX8A 2AFMA 4UEEA 2PJ3A 2OOTA 4ZX9A 4A94A 3B3CA 3LMSA 4O23A 3TX8A 2CF4A 4IAVA 2C1CA 4X8IA 1ARMA 3CPXA 5HXDA 4P4EA 1GYTA 2QYVA 3SJXA 2PJAA 2QJ8A 4OKOA 2XEFA 3HLPA 4OC1A 1XMBA 4MHYA 2ZOFA 3KR4A 5F09A 2EK9A 1JQGA 4OC2A 3K2KA 1Y0RA 2V8HA 2CTCA 3PB4X 4MCSA 5HVGA 3SJGA 3S9MA 4UF4A 5JGFA 3KGQA 1DE4C 4P4IA 3PRTA 3FH4A 5K8MA 3FJUA 4P6YA 1VIXA 4X2TA 4UIAA 4A38A 3D66A 4DUKA 4ZY1A 4MMOA 2JBKA 4PXDA 3SJEA 3FEDA 2ZEMA 2EWBA 1FT7A 1ARLA 4UEZA 2PJ8A 5JH9A 3SI0A 2RFHA 2PJ5A 3B35A 2QVPA 2RB7A 4BD9A 3PFOA 3KI9A 1YMEA 2PJ7A 4NGNA 4CPAA 5LYFA 2NYQA 5K8NA 3ISXA 1BLLE 2C6CA 3I1UA 1ZLHA 3HUVA 2GREA 3PEIA 7CPAA 4Z65A 4K3NA 3VATA 3SI2A 4AXVA 4EWTA 4X3RA 5LYIA 4OMEA 1F2PA 4G1PA 1TF9A 2AFZA 4OC0A 4Q7AA 1HDQA 3CT9A 4OC5A 4YWYA 3RZAA 3D7HA 3T8WA 3KHZA 1XFOA 2O53A 4W9YA 2GU2A 4ZYQA 1Z8LA 3IO1A 2PJ2A 2GLFA 2AFSA 1RTQA 2PCUA 2PJCA 3IIBA 4H2KA 2IMOA 2PIZA 3GLJA 3NH8A 3MN8A 4JZ0A 2WZNA 2Q4ZA 3CDXA 3GUXA 4MCQA 3KQXA 1CP7A 4MRIA 3NFZA 4MCPA 2CIJA 3SJFA 3KZWA 4TWEA 4ZX8A 2PJ1A 4ZY0A 4R8FA 3B7IA 4NGRA 4P10A 5J1QA 4MXUA 4R76A 1XBUA 4B6ZA 1CG2A 3D7FA 2PRQA 1CBXA 2VL1A 1R3NA 4A37A 5K8PA 1CPSA 1CP6A 2PE3A 2BOAA 2FVGA 4OP4A 2JEWA 3H8FA 2DEAA 5IB9A 2J9AA 4NGPA 1LCPA 4NFRA 1QQ9A 4NJQA 3PB6X 2V8VA 3NH4A 1KWMA 3BXMA 1R43A 1FNOA 5K8OA 1ELMP 4GM5A 1DTDA 1IY7A 4PXBA 2V77A 2ZEPA 3MRUA 1AMPA 3KL9A 4R6TA 3GB0A 4A39A 4UIBA 2ZENA 3L2NA 2AFWA 4F9VA 1UWYA 3DLJA 1PYTB 1LOKA 4FUUA 3CPAA 1HDUA 1XRYA 1ZG7A 2AFOA 4P45A 1YW4A 5LRGA 2F8HA 3BI0A 2PJ4A 1VHOA 4UEFA 5D8NA 4DYOA 5CBMA 2ZELA 3S9NA 2PJ9A 4WWVA 5I4MA 2G9DA 3D68A 3IWWA 4F9UA 1ELLP 2AFXA 4LQGA 5LRKA 4P4JA 3H8EA 1BPNA 5THWA 1YLOA 2POKA 4YU9A 1VGYA 3KASA 1Z2LA 3FF3A 2ZEGA 2WYRA 1ZLIA 1TKFA 3PFEA 1OBRA 2XEGA 4MCRA 1LAPA 2PVVA 4PXEA 1BPMA 4ZI6A 2I3CA 4R7MA 2PJ6A 1TKJA 3FX6A 3WC5A 2F7VA 4WJBA
chains in the Genus database with same CATH superfamily
1I12A 1LFWA 5AG4A 4MHDA 3EEDA 3EERA 4KVXA 2D4OA 2WB1A 3TOAA 1KUXA 1LAMA 4Q38A 1Z9UA 2Z10A 2J6AA 2OTLZ 3MONA 4P44A 3S9LA 4QBJA 4NJRA 1KD12 3H4QA 4NF1A 4A32A 3KKWA 2DE6A 2GE3A 2ZW6A 4RVHA 3PB9X 4ZY2A 4NGSA 3CMEZ 3H3VJ 4ONWA 4U9ZA 2OR4A 1YREA 1Z02A 3FECA 1EE3P 2PSWA 1ZB8A 3IEHA 2VQYA 2Q7BA 2O4HA 1Q7Y1 1F57A 1S7LA 1TWCI 2JS4A 3KHXA 4M85A 1W2BY 3FEEA 4KSFA 4HNWB 2Q43A 3SI1A 2X7BA 3I4NI 4L89A 2JLMA 5D1OA 2PJBA 3VARA 1S7MA 2CY2A 2F4MA 5F49A 2FE7A 3TDHB 4H6UA 1I3QI 5G1ZA 4MHPA 3FQQA 2C6GA 3BHXA 3PZJA 1K8A2 2OTJ1 5LYDA 1WK4A 1M4LA 2DF5A 1IOFA 2PM9A 2QLVB 2J8NA 2E2JI 4NBFA 2G2KA 4BBSI 1YIT1 4C2ZA 2QEXZ 4A3JI 2JA5I 3D67A 3DSBA 3W6SA 4M3SA 1VKCA 5JM6A 3J80b 3TO7A 4OC3A 3D7GA 4NGQA 1PCAA 1RXTA 3FNCA 3WABA 1J4JA 3H8GA 1OZPA 4FD7A 4QTTA 4MFZA 1ZG9A 3TC8A 3CC4Z 2AFMA 4UEEA 2B5GB 4KLWA 5C44I 3DR6A 4AG7A 2JIMA 5DWNA 2JA8I 1RNIA 3HOWI 4MY3A 2OTL1 2B4BA 4Y49C 3S6FA 2Z11A 1RLYA 1SFOI 1ARMA 1YHQZ 1MJ9A 2WUUA 4OKOA 2M48A 4CYQA 5T6BA 2EK9A 4YGOA 2M6NA 3MZLB 1YIJZ 4UWJA 3K2KA 3VMIA 4MCSA 4MFQA 4H6ZA 4Q36A 3SJGA 3S9MA 2JUBA 3D2PA 1M1DA 1XF8A 4S1TA 4P4IA 2Y0MA 3K7AI 4NXYA 2JBKA 3FEDA 3I3GA 3M4OI 3JAMb 3P2FA 1FT7A 2Z3KA 3B35A 4AG9A 4QTUA 4C68A 1VQKZ 4KSAA 3I07A 2PJ7A 2QKDA 2G3AA 4BBRI 5T67A 5LYFA 2NYQA 4R3LA 5K8NA 1YVOA 1BLLE 2YNCC 1I6HI 4CL1A 1K731 4E2AA 2JDDA 2EGTA 3NDIA 1VQM1 3PEIA 7CPAA 1M4DA 2P28A 1KZFA 4R57A 2ODFA 1FDIA 4X5KA 3ZZIA 3S2DI 3SXOA 4OMEA 4G1PA 2V8JA 3S16I 2DXQA 4OC0A 3H5ZA 4YWYA 3CXCY 3T8WA 2O53A 2R98A 4YRHA 4NBCA 3R1KA 2GLFA 1RTQA 2PCUA 2PJCA 3GLJA 4JZ0A 3NH8A 2F4OA 4MCQA 4C7IA 1QSMA 4C2XA 3EXNA 4MCPA 2Q04A 4ZX8A 5IV0A 2PJ1A 4ZY0A 1M4GA 4JXQA 4M6HA 2VPYA 1CG2A 4R87A 2PC1A 1CBXA 2VL1A 1R3NA 3GTOI 5H84A 2R7HA 2PDOA 2WSAA 3IF8A 3CCLZ 4NH1C 1VQNZ 5J8FA 2JEWA 1Q2CA 2NAPA 3H8FA 3W91A 2DEAA 1FY7A 4BBHA 1JWQA 3GTGI 4E2YA 1X10A 3S6GA 4NFRA 4NJQA 3GTMS 1Y9WA 2W03A 4CAVA 5KTDA 4GS4A 2V77A 3MRUA 2KPIA 2NVQI 4UIBA 1RO0A 3GTKI 3L2NA 1UWYA 4UFXA 3J7A4 2AFOA 1YJNZ 1YW4A 2F8HA 2P3YA 1VHSA 4E32A 4KOTA 1Q822 1AUGA 4JXRA 3DDDA 1M44A 3CCVZ 4U5YA 3GTJI 4AVCA 1KQSY 4UA3A 3KASA 3FF3A 2ZEGA 2WPWA 5EMIA 2ATRA 2PVVA 1YJ9Z 1WZNA 1BPMA 3NE8A 3CPWZ 3T4NB 4A3EI 3F3PC 1TKJA 1P9NA 3S1NI 1K83I 3FX6A 4GXHA 3TO9A 3IWGA 2JR6A 1YSJA 4P4BA 2AJ6A 1S7FA 2CXAA 3BJ7A 2KI7B 3WC6A 4QVTA 4OC4A 3HOVI 4R3KA 2B5GA 2R8VA 2R6MA 1TFIA 3B2YA 1BOBA 4QUSA 4F8ZA 2V8GA 3FBUA 4XPDC 5C4JI 2PIYA 3IJ3A 1PU9A 2XEIA 1YLEA 4IF5A 4PXCA 4II9A 1S72Z 3BG0B 4PK2A 2QECA 1Q2YA 4IUSA 4KOUA 1X0TA 2QRCB 2VBQA 3VH9A 2H5MA 1AYEA 2JIQA 2WAQA 1VQ7Z 2WPXA 5A28A 2C27A 3JRUA 3J80f 4ZBGA 2FCKA 4NBEA 2O28A 1ML8A 4NGTA 5ISVA 5BWAB 1Z8TA 2HB6A 1SIWA 3Q87A 5CPAA 2HU9A 3B3SA 1Q861 4XNHC 4E8OA 4NBDA 3TOBA 3WT4A 3PB8X 1Q7Y2 3PGPA 3IGRA 2XEJA 2VPXA 1YJN1 4ONUA 1XJOA 2Q51A 5FLXb 4IK2A 2GFQA 2QIRA 1Y7EA 4EVYA 3IC1A 3G71Z 3GIUA 3CCV1 3V38A 2G0BA 1CJWA 1N2FA 1LQLA 3K9TA 4A31A 3A9LA 4Y52I 1M901 3C26A 1XEBA 3LWUA 1F2OA 2AFUA 3RNZA 1QSNA 2QRDB 1VHEA 3PBEA 4JLYA 1YI2Z 1QMUA 3IFUA 4JJXA 3B3WA 5IP7I 2ARHA 2HC9A 5LRJA 2VEZA 3JAMf 2C6PA 3OW2Y 4XPKA 5IX3A 3VMHA 1MJBA 3IFEA 1CX8A 1X3ZA 3VMGA 4AVAA 4ZX9A 4A94A 3E0KA 3R9GA 1LRZA 4IAVA 3CCJZ 2C1CA 3G4SZ 4NB8A 3CCQZ 4P4EA 2PJAA 2FIWA 2QJ8A 1TWFI 2A4NA 3CC2Z 4MD8A 2XEFA 4OC1A 4BMHA 4B13A 4RVDA 4KOYA 1S721 4AVBA 5F09A 4CGMA 5AGEA 4CGLA 1V0CA 4MY0A 2V8HA 3PB4X 2R92I 4UF4A 4OAEA 5JGFA 4A3LI 1VQ71 3CCMZ 4A95A 4KORA 2EBJA 5K8MA 2B4DB 4X2TA 3D2MA 4CRZB 4DUKA 4MMOA 1JJ2Y 2AYDA 2Q7SA 5H86A 3W6XA 2K5TA 1NJI1 2EWBA 4XPLA 4OLLA 2JA7I 1RO5A 2PJ8A 5JH9A 3D3SA 2RFHA 2PJ5A 3F5BA 1XOVA 3D9XA 4QC6A 4MH4A 1N8R1 3IWEA 4F6AA 4CYNA 4AB7A 1VQ5Z 2OU2A 4PK3A 2C6CA 3NE7A 3I1UA 3ZJ0A 4CAWA 3G711 3HUVA 1VQ6Z 4E0AA 4MFKA 4L8AA 5J8CA 1VQOZ 4K3NA 3VATA 2CNMA 3LACA 1KRLA 1Y1VS 4AXVA 4NOZA 3DNSA 4MJ8A 4B10A 1F2PA 2OZGA 3I56Z 2DPTA 1K732 1TF9A 3R96A 3IU1A 1HDQA 2PK7A 3CT9A 1YI21 2DPSA 3R9EA 3T9YA 4B12A 4ZYQA 1Z8LA 5C88A 4BY1I 2PJ2A 1B6BA 3FQMA 3CD6Z 2IMOA 2PIZA 1USPB 3MN8A 4CGOA 3S15I 3KQXA 3KIHA 1CP7A 3FKII 4TWEA 4RV9A 1SQHA 3CCJ1 4KZTA 3G4S1 3CCQ1 1MJAA 4HNYB 1S7KA 2YNDA 3CC21 1IU8A 3CXCZ 3TE5B 5DWMA 3IX0A 1NUIA 2E9HA 2IL4A 1IICA 3K9UA 1CP6A 1S7NA 1QVFZ 2PE3A 3CXSA 3CME1 3JTKA 1Y1WI 4OP4A 3EY5A 3HOYI 5IB9A 4A3FI 4NGPA 1R9TI 2Z0ZA 3PB6X 1K9M1 3CQZI 3OWCA 1R43A 5K8OA 4GM5A 1DTDA 1IY7A 3GTMI 3EFAA 4PXBA 2E2II 2YU9I 4UFWA 3GB0A 2Z3PA 1Q2DA 3VWEA 1WCMI 2ZENA 2AFWA 4F9VA 3GCFA 2B3UA 1PYTB 1NP6A 1HDUA 3S6KA 4A3II 1XRYA 1ZG7A 4HPSA 5LRGA 3BI0A 4JD6A 4NB9A 5D8NA 4DYOA 2ZELA 3S9NA 1VQ51 2LFUA 5I4MA 4F9UA 1ELLP 5CM2M 2AFXA 1KUVA 4P4JA 2Q0YA 4UCMA 3H8EA 4UCPA 1BPNA 1IYKA 1VQO1 5THWA 1R57A 1N71A 1NE9A 3EC4A 4YU9A 1VGYA 2QEX1 1X3WA 1QF8A 4NSQA 1TKFA 3PFEA 2PR1A 4KLVA 1RO2A 3HOUI 3S2HI 4B14A 4KVOE 3CC41 2FSRA 1ON0A 1UFHA 3R9FA 4WJBA 2FIAA 2I79A 2PVWA 2G3TA 2GLJA 2ZEEA 1Z8XA 3CD61 1H8LA 3NH5A 3PO3S 2ZEHA 3ISZA 2Q4YA 3DGVA 1YQEA 1KQSZ 5FLXf 1YHQ1 4H89A 2NVTI 4A3CI 1Q811 4DJLA 3WC7A 5C4XI 4MONA 4LQ6A 3GTQI 4MHZA 4OADA 4MD7A 1YIJ1 2P6GA 5A27A 4CAXA 4FAIA 2ABZA 3KQZA 1XMTA 3VB9A 4P4FA 3NDJA 4B11A 2V3VA 1L0CA 3V8IA 1Y9KA 2AKLA 3RAMA 3PO2I 4E33A 3KIFA 3QAYA 5HVFA 5LYLA 5IB0A 1CM0A 4TNUA 1YW6A 2VUGA 2ZEFA 3BLNA 3PB7X 2JDCA 1CPXA 2IZ3A 5G20A 2PJ0A 1S60A 2B4DA 4UBRA 1KC82 2RHBA 1S3ZA 1TF8A 1VQK1 3F3FC 1P0HA 3PBBA 2NSMA 4FWUA 1QXFA 5ELYA 2ZEDA 2VZYA 2R1IA 3LD2A 5JQ4A 1QYPA 4RS2A 1JWHC 4PSXA 1Q862 5IT9b 1Q16A 2P6FA 4HGYA 2EUIA 2HV2A 2ZW4A 1IGBA 3B3TA 4HGZA 1IYLA 2VUMI 1ZH1A 5FVJA 2ZEOA 4R9MA 4KVME 3ESWA 5EC4A 2Y0SA 2FT0A 2V8KA 2KCWA 2GTIA 1Q7LA 2Z3MA 1IOIA 3SXNA 3FXTA 2R93I 4ZGYB 4JYWA 3P5JB 2JBJA 1NSAA 5HVHA 1M902 2B58A 3HKZA 2ANPA 4RVFA 4NBBA 4RN7A 3J81b 3DR8A 4NBHA 2OB0A 5FLMI 4PV6A 4K30A 2LEXA 3TT2A 1USPA 3B3CA 4HNXB 4O23A 3TX8A 3GTLI 2OH1A 3CPXA 1GYTA 2IZ4A 4E30A 3HLPA 4A3GI 2ZOFA 3CCL1 5G22A 1VQN1 3B8GA 4DNCA 2DE5A 2JNYA 1YJWZ 1Y0RA 3OW2Z 3I55Z 4F0YA 1ZB9A 5HVGA 2GANA 4FD5A 3T90A 1KC81 3UY5A 3D8PA 3KGQA 4RVGA 2VXKA 4KOWA 5A2Qb 4DK1A 3FH4A 3FJUA 3GKRA 4CS0B 1VIXA 3QWUA 4A2ZA 1IB1E 3D66A 4ZY1A 4PXDA 3SJEA 4C2YA 1ARLA 4QB9A 4UEZA 2GTHA 3SI0A 2BEIA 1TWHI 2JEVA 4BD9A 3PFOA 1M1K1 3JVNA 1NJI2 2BJOA 1L1OC 1YK3A 3CPWY 1RQFA 4X6AI 1QSOA 4CAFA 3FYNA 1ZLHA 4M6IA 3QAHA 3D6WA 1N8R2 4KOXA 2OTJZ 1W2BZ 2JIPA 3SI2A 4EWTA 3RZDI 2Z3NA 1Y1VI 4X3RA 5LYIA 3I9SA 1YX0A 4RI1A 2AFZA 4Q7AA 1YJ91 3SHPA 1QVGY 3D7HA 1X12A 3KHZA 1YITZ 4I49A 2AFSA 2I00A 3IIBA 3MZKB 3F0AA 2Q4ZA 4ORFA 4CAEA 2RIQA 2CIJA 3SJFA 2V45A 1Y8CA 2ZAEB 3B7IA 5J1QA 1VQ4Z 2QREB 2PRQA 4A3BI 2YNEA 1CPSA 1YJW1 2FVGA 4KS9A 3I551 1TIQA 4A33A 4UCNA 3P2HA 3TFYA 3RO0A 2RT9A 1QQ9A 3N7ZA 1KWMA 1DL6A 4M6GA 2D4PA 4CYOA 2H85A 2YGWA 4KOVA 1FNOA 2HUZA 1ELMP 2ZEPA 2EO8A 3KL9A 5HH1A 3CCRZ 2BSWA 3U50C 4F0XA 4AYBA 3CCUZ 4DGLA 1K9M2 3DLJA 1LOKA 2LIYA 4FUUA 2IV2X 4UFVA 4A93I 5AN9F 1VHOA 1Z03A 2PJ9A 4WWVA 2E7ZA 2RPRA 4RS4A 2K3RA 5GCNA 1VQPZ 4LX9A 3S14I 1YLOA 2CNSA 5HMNA 3CCEZ 1VQMZ 2POKA 4C7HA 3IR7A 3VTNA 2ZXVA 1VQ9Z 3PP9A 1B87A 1WJ2A 2OOYB 3CC7Z 4BINA 1OBRA 4MCRA 1WW9A 1LAPA 3GTPI 4PXEA 3BJ8A 2OZUA 4ZI6A 3MGDA 2VZZA 3LODA 3CMAZ 2PJ6A 4J3GA 2J8RA 1KUYA 3KR5A 2JA6I 8CPAA 3TCVA 5DS0A 1TKHA 4PPZA 4E2ZA 4OIWA 3FMCA 1KD11 3PO3I 2NVYI 2REEA 2IQ6A 3D4UA 1LANA 4KUAA 3RBUA 1NMTA 3V7ZA 2BO9A 3CXPA 5IT9f 5KTAA 4OIDA 2IJZA 4P4DA 1K4JA 2CTBA 1Z4EA 1PFTA 1VQ41 1ZG8A 1Z01A 4A3KI 3S1MI 2V8DA 1I21A 3S1QI 1BO4A 4NGMA 1TXRA 3QNVA 1Q812 4Y49B 2BCOA 3LUSA 2EK8A 4IHMA 3N5FA 3CCM1 3EO4A 1Y0YA 5KTCA 1BAVA 4MFPA 2P0WA 2J8MA 2ZOGA 2OZKA 5D1PA 1ZO0A 3FVLA 4LUAA 3J81f 2JIOA 4PQAA 1S5KA 3CCR1 1I1DA 3CCU1 1U6MA 4RUHA 1TWAI 4MHNA 1HEEA 1K8A1 4JWPA 4NCZA 4FBEA 2JIRA 2DE7A 4Y7NI 1VQ8Z 5AG5A 4YFJA 1Z8WA 2W04A 1VQ61 4HKFA 5D29A 4UWIA 3BI1A 3F8KA 2QMLA 3TO6A 1Z5RA 5AG6A 1VQP1 3I561 4CYPA 4EMEA 4NEXA 3CCE1 4KSIA 3GY9A 2JMOA 1VQ91 1QSRA 2R7ZI 1Z4RA 3B3VA 3CC71 5A2Qf 4BY7I 2Q44A 3D7DA 3NA6A 4CGNA 4B5PB 6CPAA 2NMTA 5F48A 2HF1A 3CMA1 3FB3A 4EFDA 4PSWA 2Z3LA 3TE4A 2K5RA 5IP9I 3VWDA 1FDOA 2OOXB 4EWCA 1QVFY 2PJ3A 2OOTA 4CGPA 2ZW5A 3S1RI 2PQ8A 2PRBA 1QSTA 3LMSA 4U9YA 1M4IA 2CF4A 3CCSZ 2QA4Z 3QB8A 4X8IA 2RC4A 5HXDA 2QYVA 3SJXA 2BL1A 3S6HA 2ZPAA 4MFLA 1XMBA 4MHYA 4MD9A 4KOSA 3KR4A 5EBVA 1I50I 1JQGA 5F47A 2BUEA 4OC2A 2CTCA 1PUAA 4XX2A 1TWGI 5F46A 1DE4C 4A3MI 3PRTA 1VLAA 4P6YA 1P4NA 4UIAA 4A38A 2ZEMA 3RYOA 5C3EI 4FD6A 4KUBA 2Q4VA 1Y7RA 3G8WA 2VPWA 5D1OB 1YR0A 2QVPA 4NBGA 2RB7A 2GIVA 4BXXI 3KI9A 1YMEA 2ZW7A 4NGNA 1VQ81 4CPAA 1WWZA 3S17I 2HQYA 1WIIA 3ISXA 5CNPA 3G6EZ 2GREA 1M1K2 4Z65A 1YUKA 4MI4A 4OC5A 4A3DI 3WR7A 5AG7A 3RZAA 1XFOA 4W9YA 3M3YI 2GU2A 3FIXA 3IO1A 3I4MI 1VQLZ 2RBLA 2B63I 2QR1B 4H2KA 3TTHA 2EVNA 2YADA 2WZNA 4A30A 3CDXA 3GUXA 2Z3OA 4MRIA 3NFZA 2PR8A 3FRMA 5T64A 4DQYB 3KZWA 5G21A 1GHEA 4R8FA 4NGRA 4P10A 4MXUA 2E2HI 3CCS1 1IIDA 4R76A 2QA41 1XBUA 1XE4A 4B6ZA 1YGHA 3D7FA 3G3SA 2FL4A 1QVGZ 4E2WA 3HOZI 4A37A 4FD4A 2B3VA 4MFJA 4HH4A 4E2XA 3HOXI 1A2ZA 5K8PA 2BOAA 3R95A 5I0CA 2FXFA 4NBAA 2J9AA 2V8IA 2NVXI 3CZXA 1LCPA 2CNTA 4XPDB 1MK4A 1RO4A 4MBUA 2V8VA 3NH4A 3BXMA 2PMZA 1AMPA 4R6TA 2VPZA 3IU2A 4A39A 3JUWA 3GKQA 5JPHA 3CPAA 1Q821 3RZOI 2VI7A 4P45A 2REFA 1YVKA 3H0GI 2PJ4A 4UEFA 5LL6f 5CBMA 5E96A 2VF1A 2P6EA 4XNHB 3GYAA 3G6E1 4B5OA 2G9DA 3D68A 3IWWA 1AA6A 2FS5A 1JJ2Z 4LQGA 5LRKA 3CXQA 5C82A 1Z2LA 2WYRA 2OZHA 1XIXA 1ZLIA 2F5IA 2XEGA 4E31A 2I3CA 2AE6A 1YUAA 2YNCA 4R7MA 4CRYB 1NSLA 4B5PA 3D2LA 1VQL1 3WC5A 2F7VA 3BG1B
chains in the Genus database with same CATH topology
2PVWA 2ZEEA 2GLJA 3KR5A 2JA6I 1LFWA 8CPAA 3CD61 1H8LA 1YSJA 4P4BA 3RAMA 3NH5A 3EEDA 5DS0A 3EERA 1TKHA 3PO3S 4E2ZA 4PPZA 4OIWA 3FMCA 2ZEHA 1KD11 2WB1A 3PO3I 2KI7B 2NVYI 3ISZA 3WC6A 2IQ6A 3D4UA 1LANA 3DGVA 1LAMA 4OC4A 2JR6A 3RBUA 3HOVI 3V7ZA 2BO9A 5IT9f 2R6MA 2J6AA 1KQSZ 1TFIA 4OIDA 5FLXf 2IJZA 2OTLZ 1YHQ1 4P4DA 2NVTI 3MONA 4A3CI 2CTBA 4P44A 3B2YA 1PFTA 4F8ZA 1Q811 4DJLA 3WC7A 3S9LA 1VQ41 1ZG8A 2V8GA 4NJRA 1KD12 5C4XI 4MONA 5C4JI 3GTQI 2PIYA 3IJ3A 4MHZA 1Z01A 4A3KI 3S1MI 2XEIA 4MD7A 2V8DA 1YIJ1 4PXCA 1S72Z 2DE6A 3S1QI 3BG0B 4FAIA 2ABZA 3KQZA 1X0TA 4NGMA 1TXRA 3VB9A 3QNVA 4RVHA 1Q812 4P4FA 3NDJA 2QRCB 2BCOA 3PB9X 3LUSA 2EK8A 2AKLA 4IHMA 3CMEZ 3PO2I 4NGSA 4ZY2A 4E33A 3H3VJ 3CCM1 3N5FA 4ONWA 3VH9A 1Y0YA 1AYEA 2WAQA 1VQ7Z 3KIFA 1BAVA 5HVFA 5LYLA 2OR4A 3JRUA 3J80f 1Z02A 3FECA 4TNUA 1YW6A 1EE3P 2VUGA 1ZB8A 2OZKA 2ZOGA 4NBEA 2ZEFA 5D1PA 3IEHA 1ML8A 3PB7X 4NGTA 1CPXA 2O4HA 1Q7Y1 1F57A 2IZ3A 3FVLA 3J81f 2HB6A 2PJ0A 3Q87A 4PQAA 1TWCI 5CPAA 3CCR1 2HU9A 3B3SA 1Q861 2JS4A 4NBDA 3KHXA 1W2BY 1KC82 3FEEA 3CCU1 2RHBA 4RUHA 1TWAI 1TF8A 1VQK1 3F3FC 4MHNA 2Q43A 3WT4A 1HEEA 3PB8X 3PBBA 2NSMA 1Q7Y2 4FWUA 3SI1A 1K8A1 2XEJA 3I4NI 5ELYA 2ZEDA 1YJN1 1XJOA 2Q51A 1QYPA 4FBEA 1JWHC 2DE7A 4Y7NI 1Q862 1VQ8Z 5IT9b 5D1OA 2PJBA 5FLXb 4IK2A 1Y7EA 3VARA 1S7MA 4HGYA 2F4MA 3IC1A 2W04A 3TDHB 1VQ61 1IGBA 1I3QI 3B3TA 5D29A 4HGZA 4MHPA 3FQQA 2VUMI 1ZH1A 2C6GA 3BHXA 1K8A2 3BI1A 2OTJ1 3G71Z 1Z5RA 2ZEOA 5LYDA 3CCV1 3V38A 1M4LA 1N2FA 1LQLA 1VQP1 3K9TA 3I561 3ESWA 4EMEA 2Y0SA 2PM9A 2QLVB 3CCE1 4Y52I 4KSIA 1M901 2V8KA 2GTIA 2JMOA 1Q7LA 1VQ91 3LWUA 2R7ZI 1F2OA 2AFUA 3B3VA 2E2JI 2QRDB 1VHEA 3CC71 4NBFA 5A2Qf 3PBEA 4BY7I 2G2KA 4BBSI 2R93I 3D7DA 1YI2Z 3NA6A 1YIT1 2QEXZ 4A3JI 1QMUA 4JYWA 2JA5I 3P5JB 3D67A 2JBJA 3IFUA 6CPAA 1NSAA 5JM6A 3J80b 5HVHA 1M902 4OC3A 3D7GA 2HF1A 3CMA1 3HKZA 3B3WA 4NGQA 5IP7I 2ANPA 1PCAA 2HC9A 5LRJA 3WABA 4EFDA 3H8GA 4RVFA 4QTTA 4NBBA 3JAMf 2C6PA 2K5RA 3OW2Y 5IP9I 3J81b 1ZG9A 3TC8A 3VMHA 4NBHA 2OOXB 3IFEA 3CC4Z 4EWCA 1CX8A 2AFMA 4UEEA 1X3ZA 5FLMI 3VMGA 1QVFY 2PJ3A 5C44I 2OOTA 3S1RI 1USPA 4ZX9A 2JA8I 4A94A 3B3CA 3LMSA 4O23A 1RNIA 3HOWI 3TX8A 2OTL1 2CF4A 3GTLI 4IAVA 3CCSZ 3CCJZ 2QA4Z 1RLYA 1SFOI 2C1CA 3G4SZ 4NB8A 1ARMA 4X8IA 3CCQZ 3CPXA 5HXDA 4P4EA 1YHQZ 1GYTA 2QYVA 3SJXA 2PJAA 2IZ4A 2QJ8A 1TWFI 4E30A 2M48A 4OKOA 3CC2Z 4MD8A 2XEFA 3HLPA 4OC1A 1XMBA 4MHYA 4A3GI 4MD9A 2ZOFA 4RVDA 3CCL1 3KR4A 1S721 5F09A 5T6BA 1VQN1 2EK9A 2DE5A 2JNYA 2M6NA 1I50I 3MZLB 1JQGA 1YIJZ 4OC2A 1YJWZ 3K2KA 1Y0RA 2V8HA 3VMIA 3OW2Z 2CTCA 3I55Z 3PB4X 4MCSA 2R92I 1ZB9A 5HVGA 3SJGA 3S9MA 2JUBA 1KC81 4XX2A 1TWGI 4UF4A 5JGFA 3KGQA 4RVGA 1VQ71 4A3LI 1DE4C 4S1TA 4P4IA 5A2Qb 3CCMZ 4A3MI 4DK1A 3PRTA 3K7AI 3FH4A 1VLAA 5K8MA 3FJUA 4P6YA 1VIXA 3QWUA 4X2TA 4UIAA 4A38A 3D66A 4DUKA 4ZY1A 4MMOA 2JBKA 1JJ2Y 4PXDA 3SJEA 3FEDA 3M4OI 2ZEMA 1NJI1 3JAMb 2EWBA 5C3EI 1FT7A 2JA7I 1ARLA 4UEZA 2GTHA 2PJ8A 5JH9A 3SI0A 2RFHA 2PJ5A 3B35A 5D1OB 4QTUA 1TWHI 2QVPA 4NBGA 1VQKZ 3D9XA 2RB7A 4BD9A 4BXXI 4MH4A 3I07A 3PFOA 3KI9A 1N8R1 1YMEA 2PJ7A 1M1K1 2QKDA 4NGNA 1NJI2 4BBRI 5T67A 1VQ81 4CPAA 5LYFA 2NYQA 2BJOA 5K8NA 1L1OC 3S17I 1WIIA 3CPWY 3ISXA 1VQ5Z 1BLLE 1I6HI 1RQFA 4X6AI 2C6CA 3G6EZ 4CL1A 1K731 3I1UA 1ZLHA 3G711 3HUVA 1VQ6Z 2GREA 3D6WA 2EGTA 1N8R2 3NDIA 1VQM1 1M1K2 3PEIA 7CPAA 2OTJZ 1VQOZ 4Z65A 4K3NA 3VATA 1W2BZ 2P28A 1KRLA 1Y1VS 3SI2A 4AXVA 4EWTA 1YUKA 4NOZA 3RZDI 3S2DI 1Y1VI 4X3RA 5LYIA 4OMEA 1F2PA 4G1PA 2V8JA 3I56Z 3S16I 1K732 1TF9A 2AFZA 4OC0A 1YJ91 4Q7AA 1HDQA 2PK7A 3CT9A 1YI21 4OC5A 4A3DI 4YWYA 3CXCY 1QVGY 3D7HA 3RZAA 3T8WA 3KHZA 1XFOA 1YITZ 2O53A 4W9YA 3M3YI 2GU2A 4ZYQA 4NBCA 1Z8LA 4BY1I 3IO1A 3I4MI 1VQLZ 2RBLA 2B63I 2PJ2A 2QR1B 2AFSA 1RTQA 2GLFA 3FQMA 2PCUA 2PJCA 3IIBA 4H2KA 3CD6Z 3MZKB 2IMOA 2PIZA 3GLJA 1USPB 3NH8A 3MN8A 4JZ0A 2F4OA 2YADA 2WZNA 2Q4ZA 3CDXA 3GUXA 3S15I 4MCQA 3KQXA 3KIHA 1CP7A 4MRIA 3NFZA 3FKII 2RIQA 4MCPA 2CIJA 3SJFA 5T64A 4DQYB 3KZWA 4TWEA 4ZX8A 2PJ1A 4RV9A 4ZY0A 4R8FA 2ZAEB 3B7IA 4NGRA 4P10A 5J1QA 4MXUA 2E2HI 3CCS1 4R76A 3CCJ1 2QA41 3G4S1 1XBUA 3CCQ1 4B6ZA 1VQ4Z 1CG2A 3D7FA 2QREB 2PRQA 1CBXA 2VL1A 3CC21 1R3NA 4A3BI 3CXCZ 3TE5B 1QVGZ 4E2WA 3GTOI 3HOZI 3IX0A 1NUIA 2E9HA 4A37A 4HH4A 4E2XA 3IF8A 3HOXI 5K8PA 3CCLZ 1CPSA 4NH1C 1CP6A 2PE3A 1QVFZ 3CME1 1YJW1 2BOAA 1VQNZ 1Y1WI 2FVGA 3I551 2JEWA 4OP4A 3H8FA 3HOYI 4NBAA 2DEAA 5IB9A 2J9AA 2V8IA 4A3FI 2NVXI 3GTGI 4NGPA 1LCPA 1R9TI 4E2YA 2RT9A 4NFRA 1QQ9A 1RO4A 4NJQA 3PB6X 1K9M1 3CQZI 2V8VA 3NH4A 1KWMA 3BXMA 1DL6A 3GTMS 1R43A 2H85A 2W03A 1FNOA 5K8OA 1ELMP 4GM5A 1DTDA 1IY7A 3GTMI 4PXBA 2E2II 2V77A 2ZEPA 3MRUA 2KPIA 2PMZA 2YU9I 1AMPA 3KL9A 4R6TA 3GB0A 3CCRZ 4A39A 2NVQI 4UIBA 1RO0A 3U50C 3GTKI 4AYBA 1WCMI 2ZENA 3CCUZ 2AFWA 3L2NA 4DGLA 3GCFA 1UWYA 1K9M2 4F9VA 3DLJA 3J7A4 3GKQA 1PYTB 1LOKA 2LIYA 3CPAA 1Q821 4FUUA 1NP6A 3RZOI 1HDUA 4A3II 1XRYA 1ZG7A 2AFOA 4P45A 1YJNZ 4A93I 1YW4A 5LRGA 2F8HA 5AN9F 3H0GI 3BI0A 2PJ4A 1VHOA 1Z03A 4UEFA 2P3YA 4NB9A 5LL6f 5D8NA 4DYOA 5CBMA 2ZELA 3S9NA 4E32A 2VF1A 2PJ9A 1VQ51 4WWVA 1Q822 2LFUA 2RPRA 3G6E1 5I4MA 4RS4A 2G9DA 3D68A 3IWWA 4F9UA 1ELLP 5CM2M 3CCVZ 1JJ2Z 2AFXA 4LQGA 5LRKA 4P4JA 2K3RA 3H8EA 1VQPZ 1BPNA 3S14I 1VQO1 5THWA 1YLOA 3GTJI 3CCEZ 1KQSY 1VQMZ 2POKA 3VTNA 4YU9A 1VQ9Z 1VGYA 2QEX1 1Z2LA 3FF3A 2ZEGA 3KASA 2WYRA 1ZLIA 1X3WA 1QF8A 3CC7Z 2OOYB 1TKFA 3PFEA 1OBRA 2XEGA 4MCRA 1WW9A 1LAPA 2PVVA 3GTPI 4PXEA 4E31A 1YJ9Z 1BPMA 4ZI6A 2I3CA 1RO2A 1YUAA 3HOUI 3CPWZ 3T4NB 3S2HI 4A3EI 3CMAZ 4R7MA 3F3PC 2PJ6A 1TKJA 1P9NA 1VQL1 1K83I 3CC41 3S1NI 3FX6A 2F7VA 3WC5A 4WJBA 3BG1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVW A;  2ZEE A;  2GLJ A;  3KR5 A;  1LFW A;  8CPA A;  1YSJ A;  1H8L A;  4P4B A;  3NH5 A;  5DS0 A;  1TKH A;  4PPZ A;  4OIW A;  3FMC A;  2ZEH A;  3ISZ A;  3WC6 A;  2IQ6 A;  3D4U A;  1LAN A;  3DGV A;  1LAM A;  4OC4 A;  3RBU A;  3V7Z A;  2BO9 A;  4OID A;  2IJZ A;  4P4D A;  2CTB A;  4P44 A;  3B2Y A;  4F8Z A;  4DJL A;  3WC7 A;  3S9L A;  1ZG8 A;  2V8G A;  4NJR A;  3IJ3 A;  2PIY A;  4MHZ A;  2XEI A;  2V8D A;  4PXC A;  4FAI A;  2ABZ A;  3KQZ A;  4NGM A;  1TXR A;  3QNV A;  4P4F A;  2BCO A;  3PB9 X;  2EK8 A;  4IHM A;  4NGS A;  4ZY2 A;  3RAM A;  3N5F A;  3VH9 A;  4ONW A;  1Y0Y A;  1AYE A;  1BAV A;  5HVF A;  5LYL A;  2OR4 A;  3JRU A;  3FEC A;  4TNU A;  1YW6 A;  1EE3 P;  2ZOG A;  3IEH A;  2ZEF A;  3PB7 X;  4NGT A;  1CPX A;  2O4H A;  1F57 A;  3FVL A;  2PJ0 A;  2HB6 A;  4PQA A;  5CPA A;  3B3S A;  3KHX A;  3FEE A;  4RUH A;  1TF8 A;  4MHN A;  2Q43 A;  3WT4 A;  1HEE A;  3PB8 X;  3PBB A;  2NSM A;  4FWU A;  3SI1 A;  2XEJ A;  5ELY A;  2ZED A;  1XJO A;  2Q51 A;  4FBE A;  2PJB A;  4IK2 A;  1Y7E A;  3VAR A;  3IC1 A;  1IGB A;  3B3T A;  5D29 A;  4MHP A;  2C6G A;  3BHX A;  3BI1 A;  1Z5R A;  2ZEO A;  5LYD A;  3V38 A;  1M4L A;  3K9T A;  4EME A;  4KSI A;  1Q7L A;  3LWU A;  1F2O A;  2AFU A;  3B3V A;  1VHE A;  3PBE A;  3D7D A;  3NA6 A;  1QMU A;  4JYW A;  3D67 A;  2JBJ A;  6CPA A;  1NSA A;  5JM6 A;  5HVH A;  4OC3 A;  3D7G A;  3B3W A;  4NGQ A;  2HC9 A;  2ANP A;  1PCA A;  5LRJ A;  3WAB A;  4EFD A;  3H8G A;  2C6P A;  1ZG9 A;  3TC8 A;  3IFE A;  1CX8 A;  2AFM A;  4UEE A;  2PJ3 A;  2OOT A;  4ZX9 A;  4A94 A;  3B3C A;  3LMS A;  4O23 A;  3TX8 A;  2CF4 A;  4IAV A;  2C1C A;  4X8I A;  1ARM A;  3CPX A;  5HXD A;  4P4E A;  1GYT A;  2QYV A;  3SJX A;  2PJA A;  2QJ8 A;  4OKO A;  2XEF A;  3HLP A;  4OC1 A;  1XMB A;  4MHY A;  2ZOF A;  3KR4 A;  5F09 A;  2EK9 A;  1JQG A;  4OC2 A;  3K2K A;  1Y0R A;  2V8H A;  2CTC A;  3PB4 X;  4MCS A;  5HVG A;  3SJG A;  3S9M A;  4UF4 A;  5JGF A;  3KGQ A;  1DE4 C;  4P4I A;  3PRT A;  3FH4 A;  5K8M A;  3FJU A;  4P6Y A;  1VIX A;  4X2T A;  4UIA A;  4A38 A;  3D66 A;  4DUK A;  4ZY1 A;  4MMO A;  2JBK A;  4PXD A;  3SJE A;  3FED A;  2ZEM A;  2EWB A;  1FT7 A;  1ARL A;  4UEZ A;  2PJ8 A;  5JH9 A;  3SI0 A;  2RFH A;  2PJ5 A;  3B35 A;  2QVP A;  2RB7 A;  4BD9 A;  3PFO A;  3KI9 A;  1YME A;  2PJ7 A;  4NGN A;  4CPA A;  5LYF A;  2NYQ A;  5K8N A;  3ISX A;  1BLL E;  2C6C A;  3I1U A;  1ZLH A;  3HUV A;  2GRE A;  3PEI A;  7CPA A;  4Z65 A;  4K3N A;  3VAT A;  3SI2 A;  4AXV A;  4EWT A;  4X3R A;  5LYI A;  4OME A;  1F2P A;  4G1P A;  1TF9 A;  2AFZ A;  4OC0 A;  4Q7A A;  1HDQ A;  3CT9 A;  4OC5 A;  4YWY A;  3RZA A;  3D7H A;  3T8W A;  3KHZ A;  1XFO A;  2O53 A;  4W9Y A;  2GU2 A;  4ZYQ A;  1Z8L A;  3IO1 A;  2PJ2 A;  2GLF A;  2AFS A;  1RTQ A;  2PCU A;  2PJC A;  3IIB A;  4H2K A;  2IMO A;  2PIZ A;  3GLJ A;  3NH8 A;  3MN8 A;  4JZ0 A;  2WZN A;  2Q4Z A;  3CDX A;  3GUX A;  4MCQ A;  3KQX A;  1CP7 A;  4MRI A;  3NFZ A;  4MCP A;  2CIJ A;  3SJF A;  3KZW A;  4TWE A;  4ZX8 A;  2PJ1 A;  4ZY0 A;  4R8F A;  3B7I A;  4NGR A;  4P10 A;  5J1Q A;  4MXU A;  4R76 A;  1XBU A;  4B6Z A;  1CG2 A;  3D7F A;  2PRQ A;  1CBX A;  2VL1 A;  1R3N A;  4A37 A;  5K8P A;  1CPS A;  1CP6 A;  2PE3 A;  2BOA A;  2FVG A;  4OP4 A;  2JEW A;  3H8F A;  2DEA A;  5IB9 A;  2J9A A;  4NGP A;  1LCP A;  4NFR A;  1QQ9 A;  4NJQ A;  3PB6 X;  2V8V A;  3NH4 A;  1KWM A;  3BXM A;  1R43 A;  1FNO A;  5K8O A;  1ELM P;  4GM5 A;  1DTD A;  1IY7 A;  4PXB A;  2V77 A;  2ZEP A;  3MRU A;  1AMP A;  3KL9 A;  4R6T A;  3GB0 A;  4A39 A;  4UIB A;  2ZEN A;  3L2N A;  2AFW A;  4F9V A;  1UWY A;  3DLJ A;  1PYT B;  1LOK A;  4FUU A;  3CPA A;  1HDU A;  1XRY A;  1ZG7 A;  2AFO A;  4P45 A;  1YW4 A;  5LRG A;  2F8H A;  3BI0 A;  2PJ4 A;  1VHO A;  4UEF A;  5D8N A;  4DYO A;  5CBM A;  2ZEL A;  3S9N A;  2PJ9 A;  4WWV A;  5I4M A;  2G9D A;  3D68 A;  3IWW A;  4F9U A;  1ELL P;  2AFX A;  4LQG A;  5LRK A;  4P4J A;  3H8E A;  1BPN A;  5THW A;  1YLO A;  2POK A;  4YU9 A;  1VGY A;  3KAS A;  1Z2L A;  3FF3 A;  2ZEG A;  2WYR A;  1ZLI A;  1TKF A;  3PFE A;  1OBR A;  2XEG A;  4MCR A;  1LAP A;  2PVV A;  4PXE A;  1BPM A;  4ZI6 A;  2I3C A;  4R7M A;  2PJ6 A;  1TKJ A;  3FX6 A;  3WC5 A;  2F7V A;  4WJB A; 
#chains in the Genus database with same CATH topology
 1I12 A;  1LFW A;  5AG4 A;  4MHD A;  3EED A;  3EER A;  4KVX A;  2D4O A;  2WB1 A;  3TOA A;  1KUX A;  1LAM A;  4Q38 A;  1Z9U A;  2Z10 A;  2J6A A;  2OTL Z;  3MON A;  4P44 A;  3S9L A;  4QBJ A;  4NJR A;  1KD1 2;  3H4Q A;  4NF1 A;  4A32 A;  3KKW A;  2DE6 A;  2GE3 A;  2ZW6 A;  4RVH A;  3PB9 X;  4ZY2 A;  4NGS A;  3CME Z;  3H3V J;  4ONW A;  4U9Z A;  2OR4 A;  1YRE A;  1Z02 A;  3FEC A;  1EE3 P;  2PSW A;  1ZB8 A;  3IEH A;  2VQY A;  2Q7B A;  2O4H A;  1Q7Y 1;  1F57 A;  1S7L A;  1TWC I;  2JS4 A;  3KHX A;  4M85 A;  1W2B Y;  3FEE A;  4KSF A;  4HNW B;  2Q43 A;  3SI1 A;  2X7B A;  3I4N I;  4L89 A;  2JLM A;  5D1O A;  2PJB A;  3VAR A;  1S7M A;  2CY2 A;  2F4M A;  5F49 A;  2FE7 A;  3TDH B;  4H6U A;  1I3Q I;  5G1Z A;  4MHP A;  3FQQ A;  2C6G A;  3BHX A;  3PZJ A;  1K8A 2;  2OTJ 1;  5LYD A;  1WK4 A;  1M4L A;  2DF5 A;  1IOF A;  2PM9 A;  2QLV B;  2J8N A;  2E2J I;  4NBF A;  2G2K A;  4BBS I;  1YIT 1;  4C2Z A;  2QEX Z;  4A3J I;  2JA5 I;  3D67 A;  3DSB A;  3W6S A;  4M3S A;  1VKC A;  5JM6 A;  3J80 b;  3TO7 A;  4OC3 A;  3D7G A;  4NGQ A;  1PCA A;  1RXT A;  3FNC A;  3WAB A;  1J4J A;  3H8G A;  1OZP A;  4FD7 A;  4QTT A;  4MFZ A;  1ZG9 A;  3TC8 A;  3CC4 Z;  2AFM A;  4UEE A;  2B5G B;  4KLW A;  5C44 I;  3DR6 A;  4AG7 A;  2JIM A;  5DWN A;  2JA8 I;  1RNI A;  3HOW I;  4MY3 A;  2OTL 1;  2B4B A;  4Y49 C;  3S6F A;  2Z11 A;  1RLY A;  1SFO I;  1ARM A;  1YHQ Z;  1MJ9 A;  2WUU A;  4OKO A;  2M48 A;  4CYQ A;  5T6B A;  2EK9 A;  4YGO A;  2M6N A;  3MZL B;  1YIJ Z;  4UWJ A;  3K2K A;  3VMI A;  4MCS A;  4MFQ A;  4H6Z A;  4Q36 A;  3SJG A;  3S9M A;  2JUB A;  3D2P A;  1M1D A;  1XF8 A;  4S1T A;  4P4I A;  2Y0M A;  3K7A I;  4NXY A;  2JBK A;  3FED A;  3I3G A;  3M4O I;  3JAM b;  3P2F A;  1FT7 A;  2Z3K A;  3B35 A;  4AG9 A;  4QTU A;  4C68 A;  1VQK Z;  4KSA A;  3I07 A;  2PJ7 A;  2QKD A;  2G3A A;  4BBR I;  5T67 A;  5LYF A;  2NYQ A;  4R3L A;  5K8N A;  1YVO A;  1BLL E;  2YNC C;  1I6H I;  4CL1 A;  1K73 1;  4E2A A;  2JDD A;  2EGT A;  3NDI A;  1VQM 1;  3PEI A;  7CPA A;  1M4D A;  2P28 A;  1KZF A;  4R57 A;  2ODF A;  1FDI A;  4X5K A;  3ZZI A;  3S2D I;  3SXO A;  4OME A;  4G1P A;  2V8J A;  3S16 I;  2DXQ A;  4OC0 A;  3H5Z A;  4YWY A;  3CXC Y;  3T8W A;  2O53 A;  2R98 A;  4YRH A;  4NBC A;  3R1K A;  2GLF A;  1RTQ A;  2PCU A;  2PJC A;  3GLJ A;  4JZ0 A;  3NH8 A;  2F4O A;  4MCQ A;  4C7I A;  1QSM A;  4C2X A;  3EXN A;  4MCP A;  2Q04 A;  4ZX8 A;  5IV0 A;  2PJ1 A;  4ZY0 A;  1M4G A;  4JXQ A;  4M6H A;  2VPY A;  1CG2 A;  4R87 A;  2PC1 A;  1CBX A;  2VL1 A;  1R3N A;  3GTO I;  5H84 A;  2R7H A;  2PDO A;  2WSA A;  3IF8 A;  3CCL Z;  4NH1 C;  1VQN Z;  5J8F A;  2JEW A;  1Q2C A;  2NAP A;  3H8F A;  3W91 A;  2DEA A;  1FY7 A;  4BBH A;  1JWQ A;  3GTG I;  4E2Y A;  1X10 A;  3S6G A;  4NFR A;  4NJQ A;  3GTM S;  1Y9W A;  2W03 A;  4CAV A;  5KTD A;  4GS4 A;  2V77 A;  3MRU A;  2KPI A;  2NVQ I;  4UIB A;  1RO0 A;  3GTK I;  3L2N A;  1UWY A;  4UFX A;  3J7A 4;  2AFO A;  1YJN Z;  1YW4 A;  2F8H A;  2P3Y A;  1VHS A;  4E32 A;  4KOT A;  1Q82 2;  1AUG A;  4JXR A;  3DDD A;  1M44 A;  3CCV Z;  4U5Y A;  3GTJ I;  4AVC A;  1KQS Y;  4UA3 A;  3KAS A;  3FF3 A;  2ZEG A;  2WPW A;  5EMI A;  2ATR A;  2PVV A;  1YJ9 Z;  1WZN A;  1BPM A;  3NE8 A;  3CPW Z;  3T4N B;  4A3E I;  3F3P C;  1TKJ A;  1P9N A;  3S1N I;  1K83 I;  3FX6 A;  4GXH A;  3TO9 A;  3IWG A;  2JR6 A;  1YSJ A;  4P4B A;  2AJ6 A;  1S7F A;  2CXA A;  3BJ7 A;  2KI7 B;  3WC6 A;  4QVT A;  4OC4 A;  3HOV I;  4R3K A;  2B5G A;  2R8V A;  2R6M A;  1TFI A;  3B2Y A;  1BOB A;  4QUS A;  4F8Z A;  2V8G A;  3FBU A;  4XPD C;  5C4J I;  2PIY A;  3IJ3 A;  1PU9 A;  2XEI A;  1YLE A;  4IF5 A;  4PXC A;  4II9 A;  1S72 Z;  3BG0 B;  4PK2 A;  2QEC A;  1Q2Y A;  4IUS A;  4KOU A;  1X0T A;  2QRC B;  2VBQ A;  3VH9 A;  2H5M A;  1AYE A;  2JIQ A;  2WAQ A;  1VQ7 Z;  2WPX A;  5A28 A;  2C27 A;  3JRU A;  3J80 f;  4ZBG A;  2FCK A;  4NBE A;  2O28 A;  1ML8 A;  4NGT A;  5ISV A;  5BWA B;  1Z8T A;  2HB6 A;  1SIW A;  3Q87 A;  5CPA A;  2HU9 A;  3B3S A;  1Q86 1;  4XNH C;  4E8O A;  4NBD A;  3TOB A;  3WT4 A;  3PB8 X;  1Q7Y 2;  3PGP A;  3IGR A;  2XEJ A;  2VPX A;  1YJN 1;  4ONU A;  1XJO A;  2Q51 A;  5FLX b;  4IK2 A;  2GFQ A;  2QIR A;  1Y7E A;  4EVY A;  3IC1 A;  3G71 Z;  3GIU A;  3CCV 1;  3V38 A;  2G0B A;  1CJW A;  1N2F A;  1LQL A;  3K9T A;  4A31 A;  3A9L A;  4Y52 I;  1M90 1;  3C26 A;  1XEB A;  3LWU A;  1F2O A;  2AFU A;  3RNZ A;  1QSN A;  2QRD B;  1VHE A;  3PBE A;  4JLY A;  1YI2 Z;  1QMU A;  3IFU A;  4JJX A;  3B3W A;  5IP7 I;  2ARH A;  2HC9 A;  5LRJ A;  2VEZ A;  3JAM f;  2C6P A;  3OW2 Y;  4XPK A;  5IX3 A;  3VMH A;  1MJB A;  3IFE A;  1CX8 A;  1X3Z A;  3VMG A;  4AVA A;  4ZX9 A;  4A94 A;  3E0K A;  3R9G A;  1LRZ A;  4IAV A;  3CCJ Z;  2C1C A;  3G4S Z;  4NB8 A;  3CCQ Z;  4P4E A;  2PJA A;  2FIW A;  2QJ8 A;  1TWF I;  2A4N A;  3CC2 Z;  4MD8 A;  2XEF A;  4OC1 A;  4BMH A;  4B13 A;  4RVD A;  4KOY A;  1S72 1;  4AVB A;  5F09 A;  4CGM A;  5AGE A;  4CGL A;  1V0C A;  4MY0 A;  2V8H A;  3PB4 X;  2R92 I;  4UF4 A;  4OAE A;  5JGF A;  4A3L I;  1VQ7 1;  3CCM Z;  4A95 A;  4KOR A;  2EBJ A;  5K8M A;  2B4D B;  4X2T A;  3D2M A;  4CRZ B;  4DUK A;  4MMO A;  1JJ2 Y;  2AYD A;  2Q7S A;  5H86 A;  3W6X A;  2K5T A;  1NJI 1;  2EWB A;  4XPL A;  4OLL A;  2JA7 I;  1RO5 A;  2PJ8 A;  5JH9 A;  3D3S A;  2RFH A;  2PJ5 A;  3F5B A;  1XOV A;  3D9X A;  4QC6 A;  4MH4 A;  1N8R 1;  3IWE A;  4F6A A;  4CYN A;  4AB7 A;  1VQ5 Z;  2OU2 A;  4PK3 A;  2C6C A;  3NE7 A;  3I1U A;  3ZJ0 A;  4CAW A;  3G71 1;  3HUV A;  1VQ6 Z;  4E0A A;  4MFK A;  4L8A A;  5J8C A;  1VQO Z;  4K3N A;  3VAT A;  2CNM A;  3LAC A;  1KRL A;  1Y1V S;  4AXV A;  4NOZ A;  3DNS A;  4MJ8 A;  4B10 A;  1F2P A;  2OZG A;  3I56 Z;  2DPT A;  1K73 2;  1TF9 A;  3R96 A;  3IU1 A;  1HDQ A;  2PK7 A;  3CT9 A;  1YI2 1;  2DPS A;  3R9E A;  3T9Y A;  4B12 A;  4ZYQ A;  1Z8L A;  5C88 A;  4BY1 I;  2PJ2 A;  1B6B A;  3FQM A;  3CD6 Z;  2IMO A;  2PIZ A;  1USP B;  3MN8 A;  4CGO A;  3S15 I;  3KQX A;  3KIH A;  1CP7 A;  3FKI I;  4TWE A;  4RV9 A;  1SQH A;  3CCJ 1;  4KZT A;  3G4S 1;  3CCQ 1;  1MJA A;  4HNY B;  1S7K A;  2YND A;  3CC2 1;  1IU8 A;  3CXC Z;  3TE5 B;  5DWM A;  3IX0 A;  1NUI A;  2E9H A;  2IL4 A;  1IIC A;  3K9U A;  1CP6 A;  1S7N A;  1QVF Z;  2PE3 A;  3CXS A;  3CME 1;  3JTK A;  1Y1W I;  4OP4 A;  3EY5 A;  3HOY I;  5IB9 A;  4A3F I;  4NGP A;  1R9T I;  2Z0Z A;  3PB6 X;  1K9M 1;  3CQZ I;  3OWC A;  1R43 A;  5K8O A;  4GM5 A;  1DTD A;  1IY7 A;  3GTM I;  3EFA A;  4PXB A;  2E2I I;  2YU9 I;  4UFW A;  3GB0 A;  2Z3P A;  1Q2D A;  3VWE A;  1WCM I;  2ZEN A;  2AFW A;  4F9V A;  3GCF A;  2B3U A;  1PYT B;  1NP6 A;  1HDU A;  3S6K A;  4A3I I;  1XRY A;  1ZG7 A;  4HPS A;  5LRG A;  3BI0 A;  4JD6 A;  4NB9 A;  5D8N A;  4DYO A;  2ZEL A;  3S9N A;  1VQ5 1;  2LFU A;  5I4M A;  4F9U A;  1ELL P;  5CM2 M;  2AFX A;  1KUV A;  4P4J A;  2Q0Y A;  4UCM A;  3H8E A;  4UCP A;  1BPN A;  1IYK A;  1VQO 1;  5THW A;  1R57 A;  1N71 A;  1NE9 A;  3EC4 A;  4YU9 A;  1VGY A;  2QEX 1;  1X3W A;  1QF8 A;  4NSQ A;  1TKF A;  3PFE A;  2PR1 A;  4KLV A;  1RO2 A;  3HOU I;  3S2H I;  4B14 A;  4KVO E;  3CC4 1;  2FSR A;  1ON0 A;  1UFH A;  3R9F A;  4WJB A;  2FIA A;  2I79 A;  2PVW A;  2G3T A;  2GLJ A;  2ZEE A;  1Z8X A;  3CD6 1;  1H8L A;  3NH5 A;  3PO3 S;  2ZEH A;  3ISZ A;  2Q4Y A;  3DGV A;  1YQE A;  1KQS Z;  5FLX f;  1YHQ 1;  4H89 A;  2NVT I;  4A3C I;  1Q81 1;  4DJL A;  3WC7 A;  5C4X I;  4MON A;  4LQ6 A;  3GTQ I;  4MHZ A;  4OAD A;  4MD7 A;  1YIJ 1;  2P6G A;  5A27 A;  4CAX A;  4FAI A;  2ABZ A;  3KQZ A;  1XMT A;  3VB9 A;  4P4F A;  3NDJ A;  4B11 A;  2V3V A;  1L0C A;  3V8I A;  1Y9K A;  2AKL A;  3RAM A;  3PO2 I;  4E33 A;  3KIF A;  3QAY A;  5HVF A;  5LYL A;  5IB0 A;  1CM0 A;  4TNU A;  1YW6 A;  2VUG A;  2ZEF A;  3BLN A;  3PB7 X;  2JDC A;  1CPX A;  2IZ3 A;  5G20 A;  2PJ0 A;  1S60 A;  2B4D A;  4UBR A;  1KC8 2;  2RHB A;  1S3Z A;  1TF8 A;  1VQK 1;  3F3F C;  1P0H A;  3PBB A;  2NSM A;  4FWU A;  1QXF A;  5ELY A;  2ZED A;  2VZY A;  2R1I A;  3LD2 A;  5JQ4 A;  1QYP A;  4RS2 A;  1JWH C;  4PSX A;  1Q86 2;  5IT9 b;  1Q16 A;  2P6F A;  4HGY A;  2EUI A;  2HV2 A;  2ZW4 A;  1IGB A;  3B3T A;  4HGZ A;  1IYL A;  2VUM I;  1ZH1 A;  5FVJ A;  2ZEO A;  4R9M A;  4KVM E;  3ESW A;  5EC4 A;  2Y0S A;  2FT0 A;  2V8K A;  2KCW A;  2GTI A;  1Q7L A;  2Z3M A;  1IOI A;  3SXN A;  3FXT A;  2R93 I;  4ZGY B;  4JYW A;  3P5J B;  2JBJ A;  1NSA A;  5HVH A;  1M90 2;  2B58 A;  3HKZ A;  2ANP A;  4RVF A;  4NBB A;  4RN7 A;  3J81 b;  3DR8 A;  4NBH A;  2OB0 A;  5FLM I;  4PV6 A;  4K30 A;  2LEX A;  3TT2 A;  1USP A;  3B3C A;  4HNX B;  4O23 A;  3TX8 A;  3GTL I;  2OH1 A;  3CPX A;  1GYT A;  2IZ4 A;  4E30 A;  3HLP A;  4A3G I;  2ZOF A;  3CCL 1;  5G22 A;  1VQN 1;  3B8G A;  4DNC A;  2DE5 A;  2JNY A;  1YJW Z;  1Y0R A;  3OW2 Z;  3I55 Z;  4F0Y A;  1ZB9 A;  5HVG A;  2GAN A;  4FD5 A;  3T90 A;  1KC8 1;  3UY5 A;  3D8P A;  3KGQ A;  4RVG A;  2VXK A;  4KOW A;  5A2Q b;  4DK1 A;  3FH4 A;  3FJU A;  3GKR A;  4CS0 B;  1VIX A;  3QWU A;  4A2Z A;  1IB1 E;  3D66 A;  4ZY1 A;  4PXD A;  3SJE A;  4C2Y A;  1ARL A;  4QB9 A;  4UEZ A;  2GTH A;  3SI0 A;  2BEI A;  1TWH I;  2JEV A;  4BD9 A;  3PFO A;  1M1K 1;  3JVN A;  1NJI 2;  2BJO A;  1L1O C;  1YK3 A;  3CPW Y;  1RQF A;  4X6A I;  1QSO A;  4CAF A;  3FYN A;  1ZLH A;  4M6I A;  3QAH A;  3D6W A;  1N8R 2;  4KOX A;  2OTJ Z;  1W2B Z;  2JIP A;  3SI2 A;  4EWT A;  3RZD I;  2Z3N A;  1Y1V I;  4X3R A;  5LYI A;  3I9S A;  1YX0 A;  4RI1 A;  2AFZ A;  4Q7A A;  1YJ9 1;  3SHP A;  1QVG Y;  3D7H A;  1X12 A;  3KHZ A;  1YIT Z;  4I49 A;  2AFS A;  2I00 A;  3IIB A;  3MZK B;  3F0A A;  2Q4Z A;  4ORF A;  4CAE A;  2RIQ A;  2CIJ A;  3SJF A;  2V45 A;  1Y8C A;  2ZAE B;  3B7I A;  5J1Q A;  1VQ4 Z;  2QRE B;  2PRQ A;  4A3B I;  2YNE A;  1CPS A;  1YJW 1;  2FVG A;  4KS9 A;  3I55 1;  1TIQ A;  4A33 A;  4UCN A;  3P2H A;  3TFY A;  3RO0 A;  2RT9 A;  1QQ9 A;  3N7Z A;  1KWM A;  1DL6 A;  4M6G A;  2D4P A;  4CYO A;  2H85 A;  2YGW A;  4KOV A;  1FNO A;  2HUZ A;  1ELM P;  2ZEP A;  2EO8 A;  3KL9 A;  5HH1 A;  3CCR Z;  2BSW A;  3U50 C;  4F0X A;  4AYB A;  3CCU Z;  4DGL A;  1K9M 2;  3DLJ A;  1LOK A;  2LIY A;  4FUU A;  2IV2 X;  4UFV A;  4A93 I;  5AN9 F;  1VHO A;  1Z03 A;  2PJ9 A;  4WWV A;  2E7Z A;  2RPR A;  4RS4 A;  2K3R A;  5GCN A;  1VQP Z;  4LX9 A;  3S14 I;  1YLO A;  2CNS A;  5HMN A;  3CCE Z;  1VQM Z;  2POK A;  4C7H A;  3IR7 A;  3VTN A;  2ZXV A;  1VQ9 Z;  3PP9 A;  1B87 A;  1WJ2 A;  2OOY B;  3CC7 Z;  4BIN A;  1OBR A;  4MCR A;  1WW9 A;  1LAP A;  3GTP I;  4PXE A;  3BJ8 A;  2OZU A;  4ZI6 A;  3MGD A;  2VZZ A;  3LOD A;  3CMA Z;  2PJ6 A;  4J3G A;  2J8R A;  1KUY A;  3KR5 A;  2JA6 I;  8CPA A;  3TCV A;  5DS0 A;  1TKH A;  4PPZ A;  4E2Z A;  4OIW A;  3FMC A;  1KD1 1;  3PO3 I;  2NVY I;  2REE A;  2IQ6 A;  3D4U A;  1LAN A;  4KUA A;  3RBU A;  1NMT A;  3V7Z A;  2BO9 A;  3CXP A;  5IT9 f;  5KTA A;  4OID A;  2IJZ A;  4P4D A;  1K4J A;  2CTB A;  1Z4E A;  1PFT A;  1VQ4 1;  1ZG8 A;  1Z01 A;  4A3K I;  3S1M I;  2V8D A;  1I21 A;  3S1Q I;  1BO4 A;  4NGM A;  1TXR A;  3QNV A;  1Q81 2;  4Y49 B;  2BCO A;  3LUS A;  2EK8 A;  4IHM A;  3N5F A;  3CCM 1;  3EO4 A;  1Y0Y A;  5KTC A;  1BAV A;  4MFP A;  2P0W A;  2J8M A;  2ZOG A;  2OZK A;  5D1P A;  1ZO0 A;  3FVL A;  4LUA A;  3J81 f;  2JIO A;  4PQA A;  1S5K A;  3CCR 1;  1I1D A;  3CCU 1;  1U6M A;  4RUH A;  1TWA I;  4MHN A;  1HEE A;  1K8A 1;  4JWP A;  4NCZ A;  4FBE A;  2JIR A;  2DE7 A;  4Y7N I;  1VQ8 Z;  5AG5 A;  4YFJ A;  1Z8W A;  2W04 A;  1VQ6 1;  4HKF A;  5D29 A;  4UWI A;  3BI1 A;  3F8K A;  2QML A;  3TO6 A;  1Z5R A;  5AG6 A;  1VQP 1;  3I56 1;  4CYP A;  4EME A;  4NEX A;  3CCE 1;  4KSI A;  3GY9 A;  2JMO A;  1VQ9 1;  1QSR A;  2R7Z I;  1Z4R A;  3B3V A;  3CC7 1;  5A2Q f;  4BY7 I;  2Q44 A;  3D7D A;  3NA6 A;  4CGN A;  4B5P B;  6CPA A;  2NMT A;  5F48 A;  2HF1 A;  3CMA 1;  3FB3 A;  4EFD A;  4PSW A;  2Z3L A;  3TE4 A;  2K5R A;  5IP9 I;  3VWD A;  1FDO A;  2OOX B;  4EWC A;  1QVF Y;  2PJ3 A;  2OOT A;  4CGP A;  2ZW5 A;  3S1R I;  2PQ8 A;  2PRB A;  1QST A;  3LMS A;  4U9Y A;  1M4I A;  2CF4 A;  3CCS Z;  2QA4 Z;  3QB8 A;  4X8I A;  2RC4 A;  5HXD A;  2QYV A;  3SJX A;  2BL1 A;  3S6H A;  2ZPA A;  4MFL A;  1XMB A;  4MHY A;  4MD9 A;  4KOS A;  3KR4 A;  5EBV A;  1I50 I;  1JQG A;  5F47 A;  2BUE A;  4OC2 A;  2CTC A;  1PUA A;  4XX2 A;  1TWG I;  5F46 A;  1DE4 C;  4A3M I;  3PRT A;  1VLA A;  4P6Y A;  1P4N A;  4UIA A;  4A38 A;  2ZEM A;  3RYO A;  5C3E I;  4FD6 A;  4KUB A;  2Q4V A;  1Y7R A;  3G8W A;  2VPW A;  5D1O B;  1YR0 A;  2QVP A;  4NBG A;  2RB7 A;  2GIV A;  4BXX I;  3KI9 A;  1YME A;  2ZW7 A;  4NGN A;  1VQ8 1;  4CPA A;  1WWZ A;  3S17 I;  2HQY A;  1WII A;  3ISX A;  5CNP A;  3G6E Z;  2GRE A;  1M1K 2;  4Z65 A;  1YUK A;  4MI4 A;  4OC5 A;  4A3D I;  3WR7 A;  5AG7 A;  3RZA A;  1XFO A;  4W9Y A;  3M3Y I;  2GU2 A;  3FIX A;  3IO1 A;  3I4M I;  1VQL Z;  2RBL A;  2B63 I;  2QR1 B;  4H2K A;  3TTH A;  2EVN A;  2YAD A;  2WZN A;  4A30 A;  3CDX A;  3GUX A;  2Z3O A;  4MRI A;  3NFZ A;  2PR8 A;  3FRM A;  5T64 A;  4DQY B;  3KZW A;  5G21 A;  1GHE A;  4R8F A;  4NGR A;  4P10 A;  4MXU A;  2E2H I;  3CCS 1;  1IID A;  4R76 A;  2QA4 1;  1XBU A;  1XE4 A;  4B6Z A;  1YGH A;  3D7F A;  3G3S A;  2FL4 A;  1QVG Z;  4E2W A;  3HOZ I;  4A37 A;  4FD4 A;  2B3V A;  4MFJ A;  4HH4 A;  4E2X A;  3HOX I;  1A2Z A;  5K8P A;  2BOA A;  3R95 A;  5I0C A;  2FXF A;  4NBA A;  2J9A A;  2V8I A;  2NVX I;  3CZX A;  1LCP A;  2CNT A;  4XPD B;  1MK4 A;  1RO4 A;  4MBU A;  2V8V A;  3NH4 A;  3BXM A;  2PMZ A;  1AMP A;  4R6T A;  2VPZ A;  3IU2 A;  4A39 A;  3JUW A;  3GKQ A;  5JPH A;  3CPA A;  1Q82 1;  3RZO I;  2VI7 A;  4P45 A;  2REF A;  1YVK A;  3H0G I;  2PJ4 A;  4UEF A;  5LL6 f;  5CBM A;  5E96 A;  2VF1 A;  2P6E A;  4XNH B;  3GYA A;  3G6E 1;  4B5O A;  2G9D A;  3D68 A;  3IWW A;  1AA6 A;  2FS5 A;  1JJ2 Z;  4LQG A;  5LRK A;  3CXQ A;  5C82 A;  1Z2L A;  2WYR A;  2OZH A;  1XIX A;  1ZLI A;  2F5I A;  2XEG A;  4E31 A;  2I3C A;  2AE6 A;  1YUA A;  2YNC A;  4R7M A;  4CRY B;  1NSL A;  4B5P A;  3D2L A;  1VQL 1;  3WC5 A;  2F7V A;  3BG1 B; 
#chains in the Genus database with same CATH homology
 2PVW A;  2ZEE A;  2GLJ A;  3KR5 A;  2JA6 I;  1LFW A;  8CPA A;  3CD6 1;  1H8L A;  1YSJ A;  4P4B A;  3RAM A;  3NH5 A;  3EED A;  5DS0 A;  3EER A;  1TKH A;  3PO3 S;  4E2Z A;  4PPZ A;  4OIW A;  3FMC A;  2ZEH A;  1KD1 1;  2WB1 A;  3PO3 I;  2KI7 B;  2NVY I;  3ISZ A;  3WC6 A;  2IQ6 A;  3D4U A;  1LAN A;  3DGV A;  1LAM A;  4OC4 A;  2JR6 A;  3RBU A;  3HOV I;  3V7Z A;  2BO9 A;  5IT9 f;  2R6M A;  2J6A A;  1KQS Z;  1TFI A;  4OID A;  5FLX f;  2IJZ A;  2OTL Z;  1YHQ 1;  4P4D A;  2NVT I;  3MON A;  4A3C I;  2CTB A;  4P44 A;  3B2Y A;  1PFT A;  4F8Z A;  1Q81 1;  4DJL A;  3WC7 A;  3S9L A;  1VQ4 1;  1ZG8 A;  2V8G A;  4NJR A;  1KD1 2;  5C4X I;  4MON A;  5C4J I;  3GTQ I;  2PIY A;  3IJ3 A;  4MHZ A;  1Z01 A;  4A3K I;  3S1M I;  2XEI A;  4MD7 A;  2V8D A;  1YIJ 1;  4PXC A;  1S72 Z;  2DE6 A;  3S1Q I;  3BG0 B;  4FAI A;  2ABZ A;  3KQZ A;  1X0T A;  4NGM A;  1TXR A;  3VB9 A;  3QNV A;  4RVH A;  1Q81 2;  4P4F A;  3NDJ A;  2QRC B;  2BCO A;  3PB9 X;  3LUS A;  2EK8 A;  2AKL A;  4IHM A;  3CME Z;  3PO2 I;  4NGS A;  4ZY2 A;  4E33 A;  3H3V J;  3CCM 1;  3N5F A;  4ONW A;  3VH9 A;  1Y0Y A;  1AYE A;  2WAQ A;  1VQ7 Z;  3KIF A;  1BAV A;  5HVF A;  5LYL A;  2OR4 A;  3JRU A;  3J80 f;  1Z02 A;  3FEC A;  4TNU A;  1YW6 A;  1EE3 P;  2VUG A;  1ZB8 A;  2OZK A;  2ZOG A;  4NBE A;  2ZEF A;  5D1P A;  3IEH A;  1ML8 A;  3PB7 X;  4NGT A;  1CPX A;  2O4H A;  1Q7Y 1;  1F57 A;  2IZ3 A;  3FVL A;  3J81 f;  2HB6 A;  2PJ0 A;  3Q87 A;  4PQA A;  1TWC I;  5CPA A;  3CCR 1;  2HU9 A;  3B3S A;  1Q86 1;  2JS4 A;  4NBD A;  3KHX A;  1W2B Y;  1KC8 2;  3FEE A;  3CCU 1;  2RHB A;  4RUH A;  1TWA I;  1TF8 A;  1VQK 1;  3F3F C;  4MHN A;  2Q43 A;  3WT4 A;  1HEE A;  3PB8 X;  3PBB A;  2NSM A;  1Q7Y 2;  4FWU A;  3SI1 A;  1K8A 1;  2XEJ A;  3I4N I;  5ELY A;  2ZED A;  1YJN 1;  1XJO A;  2Q51 A;  1QYP A;  4FBE A;  1JWH C;  2DE7 A;  4Y7N I;  1Q86 2;  1VQ8 Z;  5IT9 b;  5D1O A;  2PJB A;  5FLX b;  4IK2 A;  1Y7E A;  3VAR A;  1S7M A;  4HGY A;  2F4M A;  3IC1 A;  2W04 A;  3TDH B;  1VQ6 1;  1IGB A;  1I3Q I;  3B3T A;  5D29 A;  4HGZ A;  4MHP A;  3FQQ A;  2VUM I;  1ZH1 A;  2C6G A;  3BHX A;  1K8A 2;  3BI1 A;  2OTJ 1;  3G71 Z;  1Z5R A;  2ZEO A;  5LYD A;  3CCV 1;  3V38 A;  1M4L A;  1N2F A;  1LQL A;  1VQP 1;  3K9T A;  3I56 1;  3ESW A;  4EME A;  2Y0S A;  2PM9 A;  2QLV B;  3CCE 1;  4Y52 I;  4KSI A;  1M90 1;  2V8K A;  2GTI A;  2JMO A;  1Q7L A;  1VQ9 1;  3LWU A;  2R7Z I;  1F2O A;  2AFU A;  3B3V A;  2E2J I;  2QRD B;  1VHE A;  3CC7 1;  4NBF A;  5A2Q f;  3PBE A;  4BY7 I;  2G2K A;  4BBS I;  2R93 I;  3D7D A;  1YI2 Z;  3NA6 A;  1YIT 1;  2QEX Z;  4A3J I;  1QMU A;  4JYW A;  2JA5 I;  3P5J B;  3D67 A;  2JBJ A;  3IFU A;  6CPA A;  1NSA A;  5JM6 A;  3J80 b;  5HVH A;  1M90 2;  4OC3 A;  3D7G A;  2HF1 A;  3CMA 1;  3HKZ A;  3B3W A;  4NGQ A;  5IP7 I;  2ANP A;  1PCA A;  2HC9 A;  5LRJ A;  3WAB A;  4EFD A;  3H8G A;  4RVF A;  4QTT A;  4NBB A;  3JAM f;  2C6P A;  2K5R A;  3OW2 Y;  5IP9 I;  3J81 b;  1ZG9 A;  3TC8 A;  3VMH A;  4NBH A;  2OOX B;  3IFE A;  3CC4 Z;  4EWC A;  1CX8 A;  2AFM A;  4UEE A;  1X3Z A;  5FLM I;  3VMG A;  1QVF Y;  2PJ3 A;  5C44 I;  2OOT A;  3S1R I;  1USP A;  4ZX9 A;  2JA8 I;  4A94 A;  3B3C A;  3LMS A;  4O23 A;  1RNI A;  3HOW I;  3TX8 A;  2OTL 1;  2CF4 A;  3GTL I;  4IAV A;  3CCS Z;  3CCJ Z;  2QA4 Z;  1RLY A;  1SFO I;  2C1C A;  3G4S Z;  4NB8 A;  1ARM A;  4X8I A;  3CCQ Z;  3CPX A;  5HXD A;  4P4E A;  1YHQ Z;  1GYT A;  2QYV A;  3SJX A;  2PJA A;  2IZ4 A;  2QJ8 A;  1TWF I;  4E30 A;  2M48 A;  4OKO A;  3CC2 Z;  4MD8 A;  2XEF A;  3HLP A;  4OC1 A;  1XMB A;  4MHY A;  4A3G I;  4MD9 A;  2ZOF A;  4RVD A;  3CCL 1;  3KR4 A;  1S72 1;  5F09 A;  5T6B A;  1VQN 1;  2EK9 A;  2DE5 A;  2JNY A;  2M6N A;  1I50 I;  3MZL B;  1JQG A;  1YIJ Z;  4OC2 A;  1YJW Z;  3K2K A;  1Y0R A;  2V8H A;  3VMI A;  3OW2 Z;  2CTC A;  3I55 Z;  3PB4 X;  4MCS A;  2R92 I;  1ZB9 A;  5HVG A;  3SJG A;  3S9M A;  2JUB A;  1KC8 1;  4XX2 A;  1TWG I;  4UF4 A;  5JGF A;  3KGQ A;  4RVG A;  1VQ7 1;  4A3L I;  1DE4 C;  4S1T A;  4P4I A;  5A2Q b;  3CCM Z;  4A3M I;  4DK1 A;  3PRT A;  3K7A I;  3FH4 A;  1VLA A;  5K8M A;  3FJU A;  4P6Y A;  1VIX A;  3QWU A;  4X2T A;  4UIA A;  4A38 A;  3D66 A;  4DUK A;  4ZY1 A;  4MMO A;  2JBK A;  1JJ2 Y;  4PXD A;  3SJE A;  3FED A;  3M4O I;  2ZEM A;  1NJI 1;  3JAM b;  2EWB A;  5C3E I;  1FT7 A;  2JA7 I;  1ARL A;  4UEZ A;  2GTH A;  2PJ8 A;  5JH9 A;  3SI0 A;  2RFH A;  2PJ5 A;  3B35 A;  5D1O B;  4QTU A;  1TWH I;  2QVP A;  4NBG A;  1VQK Z;  3D9X A;  2RB7 A;  4BD9 A;  4BXX I;  4MH4 A;  3I07 A;  3PFO A;  3KI9 A;  1N8R 1;  1YME A;  2PJ7 A;  1M1K 1;  2QKD A;  4NGN A;  1NJI 2;  4BBR I;  5T67 A;  1VQ8 1;  4CPA A;  5LYF A;  2NYQ A;  2BJO A;  5K8N A;  1L1O C;  3S17 I;  1WII A;  3CPW Y;  3ISX A;  1VQ5 Z;  1BLL E;  1I6H I;  1RQF A;  4X6A I;  2C6C A;  3G6E Z;  4CL1 A;  1K73 1;  3I1U A;  1ZLH A;  3G71 1;  3HUV A;  1VQ6 Z;  2GRE A;  3D6W A;  2EGT A;  1N8R 2;  3NDI A;  1VQM 1;  1M1K 2;  3PEI A;  7CPA A;  2OTJ Z;  1VQO Z;  4Z65 A;  4K3N A;  3VAT A;  1W2B Z;  2P28 A;  1KRL A;  1Y1V S;  3SI2 A;  4AXV A;  4EWT A;  1YUK A;  4NOZ A;  3RZD I;  3S2D I;  1Y1V I;  4X3R A;  5LYI A;  4OME A;  1F2P A;  4G1P A;  2V8J A;  3I56 Z;  3S16 I;  1K73 2;  1TF9 A;  2AFZ A;  4OC0 A;  1YJ9 1;  4Q7A A;  1HDQ A;  2PK7 A;  3CT9 A;  1YI2 1;  4OC5 A;  4A3D I;  4YWY A;  3CXC Y;  1QVG Y;  3D7H A;  3RZA A;  3T8W A;  3KHZ A;  1XFO A;  1YIT Z;  2O53 A;  4W9Y A;  3M3Y I;  2GU2 A;  4ZYQ A;  4NBC A;  1Z8L A;  4BY1 I;  3IO1 A;  3I4M I;  1VQL Z;  2RBL A;  2B63 I;  2PJ2 A;  2QR1 B;  2AFS A;  1RTQ A;  2GLF A;  3FQM A;  2PCU A;  2PJC A;  3IIB A;  4H2K A;  3CD6 Z;  3MZK B;  2IMO A;  2PIZ A;  3GLJ A;  1USP B;  3NH8 A;  3MN8 A;  4JZ0 A;  2F4O A;  2YAD A;  2WZN A;  2Q4Z A;  3CDX A;  3GUX A;  3S15 I;  4MCQ A;  3KQX A;  3KIH A;  1CP7 A;  4MRI A;  3NFZ A;  3FKI I;  2RIQ A;  4MCP A;  2CIJ A;  3SJF A;  5T64 A;  4DQY B;  3KZW A;  4TWE A;  4ZX8 A;  2PJ1 A;  4RV9 A;  4ZY0 A;  4R8F A;  2ZAE B;  3B7I A;  4NGR A;  4P10 A;  5J1Q A;  4MXU A;  2E2H I;  3CCS 1;  4R76 A;  3CCJ 1;  2QA4 1;  3G4S 1;  1XBU A;  3CCQ 1;  4B6Z A;  1VQ4 Z;  1CG2 A;  3D7F A;  2QRE B;  2PRQ A;  1CBX A;  2VL1 A;  3CC2 1;  1R3N A;  4A3B I;  3CXC Z;  3TE5 B;  1QVG Z;  4E2W A;  3GTO I;  3HOZ I;  3IX0 A;  1NUI A;  2E9H A;  4A37 A;  4HH4 A;  4E2X A;  3IF8 A;  3HOX I;  5K8P A;  3CCL Z;  1CPS A;  4NH1 C;  1CP6 A;  2PE3 A;  1QVF Z;  3CME 1;  1YJW 1;  2BOA A;  1VQN Z;  1Y1W I;  2FVG A;  3I55 1;  2JEW A;  4OP4 A;  3H8F A;  3HOY I;  4NBA A;  2DEA A;  5IB9 A;  2J9A A;  2V8I A;  4A3F I;  2NVX I;  3GTG I;  4NGP A;  1LCP A;  1R9T I;  4E2Y A;  2RT9 A;  4NFR A;  1QQ9 A;  1RO4 A;  4NJQ A;  3PB6 X;  1K9M 1;  3CQZ I;  2V8V A;  3NH4 A;  1KWM A;  3BXM A;  1DL6 A;  3GTM S;  1R43 A;  2H85 A;  2W03 A;  1FNO A;  5K8O A;  1ELM P;  4GM5 A;  1DTD A;  1IY7 A;  3GTM I;  4PXB A;  2E2I I;  2V77 A;  2ZEP A;  3MRU A;  2KPI A;  2PMZ A;  2YU9 I;  1AMP A;  3KL9 A;  4R6T A;  3GB0 A;  3CCR Z;  4A39 A;  2NVQ I;  4UIB A;  1RO0 A;  3U50 C;  3GTK I;  4AYB A;  1WCM I;  2ZEN A;  3CCU Z;  2AFW A;  3L2N A;  4DGL A;  3GCF A;  1UWY A;  1K9M 2;  4F9V A;  3DLJ A;  3J7A 4;  3GKQ A;  1PYT B;  1LOK A;  2LIY A;  3CPA A;  1Q82 1;  4FUU A;  1NP6 A;  3RZO I;  1HDU A;  4A3I I;  1XRY A;  1ZG7 A;  2AFO A;  4P45 A;  1YJN Z;  4A93 I;  1YW4 A;  5LRG A;  2F8H A;  5AN9 F;  3H0G I;  3BI0 A;  2PJ4 A;  1VHO A;  1Z03 A;  4UEF A;  2P3Y A;  4NB9 A;  5LL6 f;  5D8N A;  4DYO A;  5CBM A;  2ZEL A;  3S9N A;  4E32 A;  2VF1 A;  2PJ9 A;  1VQ5 1;  4WWV A;  1Q82 2;  2LFU A;  2RPR A;  3G6E 1;  5I4M A;  4RS4 A;  2G9D A;  3D68 A;  3IWW A;  4F9U A;  1ELL P;  5CM2 M;  3CCV Z;  1JJ2 Z;  2AFX A;  4LQG A;  5LRK A;  4P4J A;  2K3R A;  3H8E A;  1VQP Z;  1BPN A;  3S14 I;  1VQO 1;  5THW A;  1YLO A;  3GTJ I;  3CCE Z;  1KQS Y;  1VQM Z;  2POK A;  3VTN A;  4YU9 A;  1VQ9 Z;  1VGY A;  2QEX 1;  1Z2L A;  3FF3 A;  2ZEG A;  3KAS A;  2WYR A;  1ZLI A;  1X3W A;  1QF8 A;  3CC7 Z;  2OOY B;  1TKF A;  3PFE A;  1OBR A;  2XEG A;  4MCR A;  1WW9 A;  1LAP A;  2PVV A;  3GTP I;  4PXE A;  4E31 A;  1YJ9 Z;  1BPM A;  4ZI6 A;  2I3C A;  1RO2 A;  1YUA A;  3HOU I;  3CPW Z;  3T4N B;  3S2H I;  4A3E I;  3CMA Z;  4R7M A;  3F3P C;  2PJ6 A;  1TKJ A;  1P9N A;  1VQL 1;  1K83 I;  3CC4 1;  3S1N I;  3FX6 A;  2F7V A;  3WC5 A;  4WJB A;  3BG1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...