4TNUA

Human brain aspartoacylase mutant y231c complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDCPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4tnuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4tnuA01
4PXBA 3TX8A 1VIXA 4K3NA 3L2NA 4NGRA 3D7FA 2POKA 2V77A 1TF9A 4PXDA 2AFZA 4DUKA 4FAIA 4O23A 4EFDA 2C1CA 1PYTB 4FBEA 4F9VA 4A94A 3D7GA 3FH4A 3D4UA 3MN8A 3NH4A 2JBJA 2ABZA 3S9LA 3IIBA 2Q4ZA 3PB4X 5HVFA 1YSJA 3D68A 4GM5A 1NSAA 2V8HA 4P4BA 1ZG7A 2CIJA 4NJQA 2QJ8A 1Q7LA 1TXRA 1LFWA 4X8IA 1ELMP 1XRYA 4MXUA 4TNUA 4P10A 5K8OA 1IY7A 3PB8X 3BI1A 3CPXA 3SJFA 3WC6A 2CF4A 2PVWA 5K8PA 1ZLHA 4X2TA 3KHXA 4MCSA 3IJ3A 3GUXA 3B3TA 3FMCA 3WT4A 1BPNA 2XEGA 2PE3A 2ZEHA 1LAMA 4P6YA 3FVLA 4DYOA 4H2KA 1ELLP 2PJ4A 3FECA 3JRUA 1CG2A 1CP7A 5DS0A 2PRQA 4OC3A 3IO1A 2XEJA 5K8MA 3WC5A 4RUHA 2EK9A 1Z8LA 2DEAA 3NFZA 3D66A 3B3SA 2AFWA 4MHPA 2PJ0A 1ZG8A 3ISZA 4WJBA 4KSIA 4OIWA 1EE3P 2ZELA 2PJCA 1TKFA 2ZEDA 2PJ8A 3KZWA 4IHMA 5J1QA 4OMEA 5CPAA 3B3CA 2ZEEA 1YW6A 2BCOA 1VGYA 4OC4A 2ZEGA 3VARA 3KQXA 1LOKA 1BPMA 4LQGA 3H8GA 5JM6A 5LYDA 4UIBA 4NGQA 4OC2A 3N5FA 4OIDA 4PXCA 4PPZA 4MCQA 4P4EA 1XFOA 3GB0A 1DE4C 2IQ6A 3LMSA 3SJEA 1TF8A 4UEZA 2GU2A 1PCAA 4A37A 5JH9A 2Q51A 4JYWA 1ZG9A 3K9TA 4P4DA 1HDUA 3S9NA 1ARLA 2IMOA 4EMEA 2EWBA 3RBUA 4ZY0A 3BXMA 3VATA 3QNVA 5F09A 4A39A 1FT7A 2Q43A 2O4HA 4P4FA 3CDXA 1ARMA 5LYIA 4OP4A 3LWUA 3KHZA 2NYQA 1F2OA 4MHYA 3RAMA 2ZOFA 4ONWA 3SI1A 3PRTA 2C6PA 2ZEPA 1Y7EA 1YLOA 2PJBA 3KQZA 3VH9A 3PB9X 1QQ9A 4NGPA 3WABA 2C6CA 2JBKA 4TWEA 2NSMA 7CPAA 1QMUA 2PJ7A 5LRJA 2ZEFA 3FX6A 3PFEA 3KR5A 5K8NA 4NJRA 4UEEA 1AYEA 4X3RA 1VHOA 4MCRA 1R3NA 4DJLA 2F7VA 1IGBA 1F57A 2AFUA 3BHXA 2V8GA 4NGTA 4JZ0A 3D67A 1Z2LA 4UF4A 4IAVA 3H8EA 1YW4A 4MCPA 2PJ6A 2QYVA 4ZX9A 1CPSA 4R8FA 3T8WA 4P44A 4P45A 4BD9A 2G9DA 2FVGA 5LRKA 1UWYA 2BOAA 3B7IA 3B35A 3SJXA 3DLJA 3B3VA 4IK2A 1H8LA 1HDQA 5JGFA 1CPXA 2CTCA 3HUVA 2ZEMA 3KI9A 2ANPA 4F8ZA 4FWUA 2V8DA 5LYLA 4MHNA 4MMOA 2RFHA 3H8FA 4MRIA 2PJ9A 1Y0YA 2XEFA 2AFSA 3IWWA 3RZAA 3S9MA 6CPAA 3DGVA 1F2PA 4Q7AA 1HEEA 2F8HA 4AXVA 2OR4A 4OC5A 4PXEA 1CX8A 4NGMA 2C6GA 4OKOA 5I4MA 5D29A 4MHZA 4G1PA 2PIYA 4P4JA 4ZI6A 4OC1A 1TKHA 1LAPA 1TKJA 3SI0A 4W9YA 2V8VA 1AMPA 2AFOA 1KWMA 5THWA 3TC8A 3D7DA 2RB7A 4R6TA 3K2KA 5LRGA 2J9AA 4EWTA 2PJ2A 2VL1A 1DTDA 1XMBA 3KL9A 1Y0RA 2WYRA 4ZY2A 2PJAA 4R76A 3ISXA 1R43A 3D7HA 3NA6A 3FJUA 3FF3A 1FNOA 3WC7A 2I3CA 4A38A 4WWVA 4B6ZA 2ZOGA 3KR4A 3PFOA 3FEEA 2CTBA 4ZY1A 2PVVA 3SI2A 3NH5A 8CPAA 3B2YA 3IFEA 3CPAA 3V7ZA 1ZLIA 5IB9A 1CP6A 2PIZA 1Z5RA 3HLPA 1VHEA 3PBBA 3PEIA 5HVGA 4Z65A 3KASA 1GYTA 2BO9A 1M4LA 3IEHA 3MRUA 4UEFA 2GLJA 4PQAA 5D8NA 5CBMA 5ELYA 3SJGA 4UIAA 1LANA 2HC9A 1LCPA 5LYFA 4NFRA 3PB7X 3I1UA 1JQGA 2PCUA 1XJOA 2QVPA 2WZNA 2HB6A 2ZEOA 2IJZA 3FEDA 1YMEA 3CT9A 3PBEA 2PJ3A 5HXDA 2AFMA 2JEWA 3GLJA 2ZENA 4FUUA 3KGQA 4R7MA 4CPAA 4OC0A 3PB6X 1RTQA 4YWYA 1OBRA 4YU9A 3IC1A 3V38A 2GREA 1XBUA 4ZX8A 4NGNA 4ZYQA 2PJ1A 3NH8A 5HVHA 1CBXA 4NGSA 2O53A 3B3WA 1BAVA 2PJ5A 1BLLE 3BI0A 2XEIA 4F9UA 2EK8A 2GLFA 4P4IA 2OOTA 2AFXA
chains in the Genus database with same CATH superfamily
4PXBA 1NJI1 1S3ZA 3UY5A 3L2NA 2Z3PA 1K8A2 2J6AA 2POKA 1YK3A 1RNIA 5A28A 1I50I 2GIVA 2C1CA 3QAHA 3R1KA 1FDIA 3MGDA 4A3BI 3MN8A 3NH4A 2B58A 1S72Z 2Q0YA 3S9LA 3IIBA 2Q4ZA 4MY0A 4NBBA 2QA41 1Y1VS 1ZG7A 4NJQA 1Q7LA 2W04A 5AG6A 5J8CA 5FLXf 5K8OA 1XE4A 1M4IA 1KC81 2CF4A 1A2ZA 3PP9A 1ZLHA 4X2TA 1I1DA 4MCSA 3G4SZ 3CPWZ 3WT4A 1Q2CA 3G4S1 4L89A 1BPNA 4ZBGA 2PDOA 3CMEZ 4H2KA 3CC4Z 5GCNA 3CC41 2EVNA 3GKRA 3LD2A 5LL6f 4AYBA 3S1NI 4NBFA 4BBRI 3WC5A 5BWAB 3DR8A 4RUHA 3DR6A 5C4XI 3R9EA 3EFAA 2AFWA 2LEXA 3N7ZA 3JTKA 5C88A 3J7A4 1YI21 5IT9b 2LFUA 4OIWA 4AG9A 4NBDA 2ZEDA 1NUIA 2K5RA 1XOVA 5J1QA 5CPAA 2ZEEA 3DSBA 5ISVA 2F4MA 3I55Z 3VARA 4NB9A 1Q821 3I551 3KQXA 4LQGA 1KQSY 3RO0A 1MJBA 4A32A 3S2HI 1DL6A 2ZW5A 3N5FA 4PXCA 3GTJI 1TWHI 1RO2A 4P4EA 1JWQA 4BINA 2BEIA 4A3DI 5JQ4A 4UEZA 2BJOA 3D2MA 4NF1A 2JIOA 4JYWA 1ZG9A 1K731 1HDUA 3SXOA 3S9NA 2RBLA 1V0CA 4AVAA 2DE6A 1VQ7Z 4B11A 4A3II 3QNVA 1VQ71 2V45A 1TWCI 4P4FA 5LYIA 4OP4A 3NE8A 2R8VA 2ZOFA 4Y49B 4KUAA 3H0GI 2JMOA 1Y7EA 3VH9A 3PB9X 3CD6Z 3CD61 1L1OC 1B87A 4TWEA 3FX6A 3PFEA 1VQKZ 3KR5A 5K8NA 3RZDI 3FIXA 2FT0A 4UEEA 3GKQA 1R3NA 2F7VA 2PM9A 3S1QI 3BHXA 2Z3OA 4NGTA 5E96A 4NEXA 4X5KA 2C27A 1Z2LA 4IAVA 3KIHA 3S16I 4P44A 4IUSA 2FVGA 5LRKA 1RO0A 1RXTA 3FB3A 2ARHA 4KOSA 2P3YA 4IK2A 5JGFA 1CPXA 3VMGA 4FWUA 4KSFA 4DK1A 2I79A 2J8NA 2Z3KA 5F46A 4KUBA 2B3VA 2IZ4A 3H8FA 4E31A 1AUGA 2Q7SA 4KSAA 1Y0YA 3RZAA 4Q7AA 2F8HA 4AXVA 4CYOA 2Z3LA 1YIJ1 2X7BA 1K8A1 3RZOI 4YGOA 3GTGI 4G1PA 4QB9A 1Z4EA 3F8KA 2ODFA 2I00A 2OTJZ 3SI0A 4ONUA 4FD5A 2OOYB 2RB7A 1YUAA 3QB8A 1ZH1A 2J9AA 2FSRA 2V8JA 3VMIA 4NBHA 4MD9A 3IX0A 1Y8CA 3KL9A 2REFA 1Q862 4FD4A 2R6MA 2KI7B 4KOVA 3ISXA 1R43A 5AG7A 3NE7A 3FJUA 2HF1A 1TWAI 5AN9F 4J3GA 4UCPA 4H6ZA 3S6GA 2Z10A 3CCQZ 5EBVA 4B5OA 1KRLA 4ZY1A 2PVVA 4R9MA 3TDHB 3NH5A 3R9GA 2EUIA 1QVFZ 4X6AI 3CCJ1 3CPAA 4MFJA 1GHEA 3CQZI 4Z65A 2Q4YA 2K3RA 2WUUA 2B4DB 1BOBA 4CGNA 4NCZA 2WSAA 3W6SA 4PQAA 4NBEA 1P9NA 1X3WA 5ELYA 3S14I 1QSNA 4AB7A 5H86A 3P5JB 3F0AA 2REEA 3CXCY 4NFRA 4M85A 2BSWA 3D2PA 1Q2YA 4U9ZA 1XJOA 4F6AA 1WIIA 2WZNA 2HB6A 1ON0A 1YMEA 2RC4A 1Z4RA 3S1RI 2PJ3A 4NH1C 2ZENA 4AG7A 4H6UA 4YWYA 1OBRA 4EVYA 4ZYQA 3TO6A 3D3SA 3NH8A 5HVHA 2GFQA 2ZXVA 3A9LA 5IX3A 2JA8I 3TO7A 3CCRZ 4KOYA 3CCR1 4C68A 1BLLE 3K7AI 3CC2Z 2XEIA 2EK8A 4P4IA 1YX0A 2OOTA 2AFXA 1YGHA 1WK4A 1XEBA 2V77A 1ZB9A 3PZJA 1B6BA 4MD8A 4O23A 2VEZA 4FBEA 4A94A 3JVNA 2B4BA 3D4UA 2YU9I 3MONA 4KZTA 2M48A 2FL4A 5C4JI 2NVQI 4KOWA 1S7LA 4PSWA 5HVFA 1YSJA 3D68A 1Q812 2P6GA 4P4BA 3HKZA 4UA3A 1K9M2 5DWMA 4X8IA 3W6XA 4PK2A 4MXUA 4TNUA 5KTCA 4RVGA 4H89A 2BUEA 5D1PA 1IY7A 5A2Qf 1P0HA 2OTL1 3WC6A 3B8GA 2WB1A 1IIDA 1UFHA 3H4QA 3KHXA 4XPDC 4B14A 3FMCA 4UBRA 2ZEHA 1MJAA 2B63I 3S15I 1CJWA 1KQSZ 3IU1A 4ZGYB 1I6HI 3PO3I 3I9SA 4KVOE 4PSXA 3TCVA 2XEJA 3EERA 2R93I 1M44A 3CCV1 1Z02A 4NOZA 3NFZA 3B3SA 3D66A 4MHPA 2PJ0A 1Z03A 1Q16A 5CM2M 1ZG8A 4A30A 4A3CI 1ZO0A 3PO3S 2Q7BA 3G3SA 3G8WA 4C2YA 3CXSA 2ZW6A 2PJ8A 2QRDB 3U50C 2P28A 3B3CA 3CCU1 1YW6A 1VGYA 1QVGY 4OAEA 2CY2A 1YVOA 5JM6A 3OWCA 4NGQA 4OC2A 2AKLA 5J8FA 1TIQA 4PPZA 4MCQA 3EEDA 2KCWA 3LMSA 2CNMA 3R95A 1TF8A 1Q861 2FCKA 1PCAA 3VB9A 2VZYA 1VKCA 3J81b 2FE7A 3K9TA 2H85A 3R9FA 1FY7A 3QAYA 2IMOA 4EMEA 2V8IA 2EWBA 4CYPA 3RBUA 4ZY0A 3BXMA 4A93I 1M1K2 4A39A 1FT7A 2O4HA 3P2HA 4S1TA 3LWUA 2QA4Z 3KHZA 2NYQA 3S2DI 1Y9WA 3RAMA 4Y52I 3K9UA 2C6PA 3J80b 2VPYA 4EWCA 3IGRA 2PJBA 3BJ8A 3IR7A 1IB1E 2AE6A 2G0BA 5LRJA 1YIT1 3CCL1 4YFJA 1Y9KA 4I49A 4A2ZA 4KOUA 3GYAA 2IV2X 4DJLA 1IGBA 4CAWA 3DDDA 2AFUA 1P4NA 4JZ0A 2BL1A 3KIFA 4MCPA 2QYVA 2JA5I 1M1DA 2QKDA 2VBQA 5FVJA 3FBUA 3D8PA 2PK7A 2G9DA 4IF5A 1UWYA 2BOAA 1Z01A 1AA6A 5IP9I 1YHQ1 3GCFA 1YI2Z 1H8LA 1HDQA 4F0YA 2CTCA 1Z8WA 3HUVA 2E2JI 3Q87A 1WJ2A 4CGLA 4KORA 5T64A 1Y7RA 3KI9A 4F8ZA 2F5IA 4E33A 5A27A 1RO5A 4MHNA 4MMOA 4B10A 1XMTA 3LACA 4BMHA 4MRIA 3IWWA 2WAQA 1Y1WI 1VQ9Z 4A33A 1VQ91 4PXEA 4Y7NI 1S60A 4NGMA 5D1OA 4OKOA 1VQ4Z 1VQ41 2B3UA 4PK3A 4UWJA 4P4JA 2AYDA 4BBSI 1TKHA 4A3EI 1W2BY 3HOZI 1TKJA 2JDDA 5I0CA 2QR1B 3TC8A 2B5GB 3K2KA 1M902 5KTAA 3V8IA 1S7FA 2ATRA 1Q811 2VPZA 1Y0RA 3C26A 4ZY2A 2CNSA 1X10A 1K9M1 2R1IA 1Q7Y2 1S7KA 3WC7A 1VQPZ 3GTOI 3GTPI 2ZW4A 1VQP1 4B6ZA 4B13A 2ZOGA 3CXCZ 1L0CA 2O28A 4NBCA 1QSMA 3SI2A 1SQHA 4NBGA 1PFTA 3B2YA 4AVCA 1ZLIA 2ZAEB 5IB9A 1Z5RA 2E7ZA 3PEIA 1RLYA 2VUMI 2J8RA 1VQL1 3S17I 1USPB 3MRUA 4NB8A 5D8NA 1YJ9Z 1X0TA 2CXAA 2W03A 1VQ81 1YJ91 3SJGA 4L8AA 1LCPA 1S7MA 2VUGA 2DXQA 3D6WA 4A95A 2JIMA 2WPXA 3IU2A 2JA6I 2IJZA 2EO8A 3GIUA 3DNSA 2JEWA 4NBAA 2IZ3A 1RTQA 3ZZIA 4NGNA 4KVME 4HGYA 1YIJZ 4MH4A 2M6NA 4QUSA 4NGSA 3ZJ0A 3D9XA 2NVTI 2O53A 5H84A 3B3WA 1KD12 1BAVA 2QRCB 4MFLA 2Z3NA 2QIRA 3CCM1 1M1K1 2YNDA 5T67A 3EO4A 3HOXI 5IP7I 3TX8A 1VIXA 4JJXA 3HOWI 1IYKA 4K3NA 2PRBA 4NGRA 1VQMZ 4PXDA 1Z8TA 1VQM1 2AFZA 3E0KA 4DUKA 4FAIA 1SIWA 3BLNA 3D7GA 2JBJA 2HU9A 3HOVI 4B12A 4XPDB 5HMNA 4GM5A 4CYQA 1I21A 2V8HA 2GTIA 3IFUA 1RQFA 2CIJA 2G3TA 2QJ8A 4E2WA 1MK4A 3CCJZ 1ELMP 2Q44A 3IF8A 2JNYA 3RYOA 3MZKB 4P10A 1MJ9A 1TWFI 4A3GI 4C7HA 3PB8X 3BI1A 1KUYA 5K8PA 3PO2I 1M4GA 1YVKA 3S6HA 4QBJA 5EC4A 3GUXA 3B3TA 3CMA1 2FXFA 2XEGA 2PE3A 3LODA 3PGPA 2HV2A 1IOIA 3FVLA 4CRYB 4DYOA 1ELLP 1QVGZ 5G20A 4CYNA 2PJ4A 3FECA 1N8R2 1CP7A 4B5PB 5DS0A 3OW2Y 3IO1A 3VMHA 1TFIA 2VXKA 1WW9A 4RS4A 4Q38A 1Q2DA 3ISZA 4CL1A 3T9YA 4KSIA 2ZELA 3FRMA 3GY9A 3KZWA 4IHMA 3VWEA 5KTDA 2K5TA 2ZEGA 2JUBA 2JLMA 1LOKA 1NMTA 2OU2A 4UIBA 3G6EZ 2Z0ZA 1M901 4OIDA 3G6E1 2JIQA 3TOBA 2FS5A 3GB0A 2IQ6A 3SJEA 4HNYB 1PU9A 1YJWZ 2GU2A 2HUZA 1YJW1 2YNEA 4NSQA 3FKII 2YGWA 4P4DA 1VLAA 1ARLA 4UWIA 4XNHB 3VATA 5F09A 2YNCC 2Q43A 3TE5B 2JR6A 4RN7A 4A31A 2EBJA 1F2OA 2DE5A 1KUXA 4MHDA 4ONWA 4E2XA 2ZEPA 3CCEZ 4CAVA 1QF8A 3KQZA 3CCE1 1QQ9A 2OTLZ 3EY5A 2JEVA 2QLVB 2G3AA 2C6CA 1QSOA 4OLLA 3SXNA 7CPAA 1QMUA 2PJ7A 1FDOA 2DPTA 3FYNA 4A3FI 2E2II 4CAEA 4M6HA 3H3VJ 1AYEA 1VHOA 4MCRA 1F57A 2Q04A 3I4NI 2RIQA 1M4DA 3D67A 4UF4A 2B4DA 3H8EA 1YW4A 5AG5A 2OOXB 1QSRA 4ZX9A 2QECA 3CCVZ 4P45A 5JPHA 4E8OA 4RVDA 3GTMI 4C2XA 3B7IA 1IOFA 4B5PA 3SJXA 2NMTA 4YRHA 4M6IA 3B3VA 2OZHA 1W2BZ 2PR8A 2R98A 2E2HI 3TT2A 1IICA 5G1ZA 2ZEMA 2ANPA 2OZGA 3CCUZ 4LX9A 3QWUA 2EGTA 3GTLI 1NP6A 2JA7I 4U5YA 2RFHA 3GTMS 4GS4A 1KD11 4MFPA 2ZPAA 2AFSA 4CGOA 3S9MA 2DE7A 3DGVA 2YADA 1F2PA 1HEEA 4JD6A 1CX8A 5EMIA 4CGPA 5FLXb 4CS0B 4ZI6A 3TTHA 2RHBA 4OC1A 4W9YA 2AFOA 4JXQA 1KWMA 4JXRA 3D7DA 4R6TA 1WCMI 1OZPA 3T4NB 4EWTA 4E2YA 2PJ2A 1XMBA 2WYRA 3MZLB 1Y1VI 1JJ2Y 2PJAA 4R76A 3JAMf 3D7HA 1LQLA 2JS4A 4A38A 2QEXZ 1KUVA 4XNHC 1S721 4C7IA 2QEX1 3KR4A 4QTUA 1YITZ 3CCLZ 4A3KI 8CPAA 4BY1I 3IFEA 1XIXA 4BBHA 1N71A 4KLWA 3J81f 2PR1A 1CP6A 4KVXA 1N8R1 3HLPA 1VHEA 5CNPA 3KASA 2Y0SA 1Z9UA 4XPLA 1M4LA 4UEFA 5CBMA 2R7ZI 3SHPA 3CME1 4HNWB 2VF1A 3J80f 4UIAA 1LANA 1LRZA 1YHQZ 5G21A 3GTQI 3D2LA 1JQGA 1YR0A 2QVPA 2PMZA 3FEDA 4RV9A 3CT9A 3PBEA 1NE9A 3T90A 5HXDA 2AFMA 3GLJA 4CPAA 3JUWA 3PB6X 4UCNA 1VQ6Z 4R3KA 4YU9A 3IC1A 2GREA 4HGZA 1VQ61 1XBUA 2PJ1A 4OADA 4U9YA 5F47A 5C82A 3F5BA 2PJ5A 3M3YI 3BI0A 1X12A 3RNZA 4RVFA 4F9UA 4JWPA 3WR7A 4UFXA 2GLFA 1VQOZ 5IT9f 1VQO1 3D7FA 2PC1A 4MJ8A 4R3LA 1S7NA 1TF9A 4EFDA 1PYTB 4RVHA 4BXXI 2VPWA 4F9VA 3FH4A 1X3ZA 1VHSA 3CC7Z 2ABZA 3CC71 3S1MI 3PB4X 1NSAA 2CNTA 3OW2Z 1ZB8A 5IB0A 1TXRA 4II9A 1LFWA 3EC4A 1XRYA 1YREA 3CZXA 2DPSA 2Z11A 3CPXA 3SJFA 2PVWA 3CXQA 3IJ3A 1VQLZ 1VQK1 4R87A 4CAFA 1LAMA 4KOTA 3FQQA 4P6YA 1VQ8Z 3S6FA 3KKWA 1K83I 3JRUA 1CG2A 2A4NA 1YUKA 2PRQA 4OC3A 2AJ6A 2H5MA 1SFOI 3BG0B 5K8MA 4E30A 2EK9A 3TOAA 3VWDA 3HOUI 1Z8LA 4HKFA 2DEAA 5F49A 3FQMA 3G71Z 1XF8A 2GTHA 3G711 1J4JA 3GTKI 4MONA 3TO9A 1YLEA 2J8MA 5C44I 4WJBA 5C3EI 3CPWY 1EE3P 2PJCA 1TKFA 3NDIA 4OMEA 1VQ5Z 2BCOA 3IWGA 4R57A 4OC4A 1VQ51 4MD7A 4XX2A 1BPMA 3W91A 3H8GA 5LYDA 3P2FA 3HOYI 1N2FA 3CCMZ 1R57A 1XFOA 3CXPA 1DE4C 2KPIA 4A3JI 4A37A 5JH9A 2Q51A 1JWHC 4DGLA 5F48A 1K4JA 2RT9A 1ML8A 4F0XA 2B5GA 2OTJ1 2V8KA 2D4OA 1I12A 4MFKA 2F4OA 3CDXA 1ARMA 2OH1A 1NJI2 4C2ZA 4MHYA 4CGMA 3SI1A 3PRTA 3VTNA 4QC6A 1YLOA 2R92I 4FD7A 3TFYA 2OB0A 2GE3A 4JLYA 4NGPA 4HPSA 3WABA 2JBKA 1Z8XA 3FXTA 2NSMA 3CCQ1 2ZEFA 3CMAZ 4RI1A 4NJRA 4LUAA 4Y49C 4NXYA 4X3RA 4MI4A 3BG1B 2WPWA 2GANA 4HNXB 4K30A 1QSTA 2V8GA 1VQNZ 1VQN1 2NVYI 3TE4A 1KC82 2LIYA 4E32A 2PJ6A 1WWZA 1USPA 1IU8A 1CPSA 4R8FA 3T8WA 1QXFA 2PSWA 4BD9A 4QTTA 3I56Z 3B35A 3I561 3DLJA 4KS9A 2JIPA 4KOXA 4E2ZA 1TWGI 4AVBA 2V3VA 2V8DA 2PQ8A 4UFVA 5LYLA 4KLVA 1PUAA 5FLMI 4MFQA 1JJ2Z 3F3PC 1WZNA 2PJ9A 2XEFA 2ZW7A 2NAPA 4DQYB 6CPAA 2OR4A 4OC5A 5T6BA 4MBUA 3M4OI 2C6GA 4E0AA 5I4MA 5D29A 3H5ZA 4MHZA 2PIYA 1Q7Y1 4LQ6A 2HQYA 4UCMA 1Q822 2Q4VA 4MY3A 4HH4A 5A2Qb 1LAPA 4CAXA 2YNCA 4Q36A 4PV6A 2V8VA 2IL4A 1AMPA 2P0WA 3I07A 5THWA 3CC21 2VZZA 2P6EA 1U6MA 5LRGA 4FD6A 2VI7A 2VL1A 1DTDA 4CRZB 5DWNA 1YQEA 4XPKA 2FIWA 2VPXA 2D4PA 1K732 3S6KA 3NA6A 2G2KA 3FF3A 1FNOA 2P6FA 2I3CA 4WWVA 3R96A 1KZFA 3PFOA 2FIAA 2R7HA 2Y0MA 2CTBA 3FEEA 2OZKA 1CM0A 5AGEA 3I4MI 3ESWA 4GXHA 3F3FC 3V7ZA 3FNCA 1IYLA 2PIZA 3PBBA 4DNCA 5HVGA 4ORFA 4RS2A 2E9HA 1BO4A 3BJ7A 1RO4A 1GYTA 3IWEA 3CCSZ 2BO9A 3CCS1 3IEHA 2GLJA 4A3LI 3EXNA 1I3QI 2JIRA 1NSLA 1R9TI 1S5KA 2HC9A 5LYFA 4E2AA 3PB7X 2Z3MA 3I1UA 3I3GA 4UFWA 2PCUA 2JDCA 3LUSA 4M6GA 5HH1A 1QVFY 4MFZA 2ZEOA 4M3SA 1YJNZ 2RPRA 1YJN1 4FUUA 5AG4A 2DF5A 3KGQA 4R7MA 2NVXI 2QREB 4OC0A 4A3MI 3V38A 4ZX8A 4QVTA 4BY7I 5D1OB 5IV0A 3JAMb 1CBXA 3NDJA 2QMLA 1QYPA 2VQYA 5G22A 2OZUA
chains in the Genus database with same CATH topology
4PXBA 3TX8A 1VQOZ 1VIXA 3HOWI 1NJI1 4K3NA 5IT9f 3L2NA 1K8A2 1VQO1 2J6AA 4NGRA 3D7FA 2POKA 2V77A 1VQMZ 1ZB9A 1TF9A 4PXDA 1RNIA 1VQM1 1I50I 2AFZA 4O23A 4MD8A 4DUKA 2C1CA 1PYTB 4EFDA 4FAIA 4RVHA 4BXXI 4FBEA 4F9VA 4A94A 4A3BI 3D7GA 3FH4A 1X3ZA 3D4UA 2YU9I 3MONA 3MN8A 3NH4A 2JBJA 1S72Z 2HU9A 3CC7Z 2ABZA 3S9LA 2M48A 3IIBA 2Q4ZA 5C4JI 2NVQI 3CC71 3S1MI 3PB4X 3HOVI 5HVFA 1YSJA 3D68A 4GM5A 4NBBA 1NSAA 2V8HA 2QA41 1Q812 1Y1VS 4P4BA 3HKZA 2GTIA 3IFUA 1RQFA 3OW2Z 1ZG7A 1ZB8A 2CIJA 4NJQA 2QJ8A 1Q7LA 2W04A 1K9M2 1TXRA 4E2WA 1LFWA 3CCJZ 4X8IA 1ELMP 3IF8A 1XRYA 4MXUA 5FLXf 4TNUA 2JNYA 3MZKB 4P10A 4RVGA 5K8OA 5D1PA 1TWFI 4A3GI 1IY7A 5A2Qf 3BI1A 3CPXA 3PB8X 2OTL1 3SJFA 3WC6A 1KC81 2WB1A 2CF4A 2PVWA 5K8PA 3PO2I 1ZLHA 4X2TA 3KHXA 4MCSA 3IJ3A 3G4SZ 3CPWZ 3B3TA 3FMCA 3GUXA 3WT4A 3CMA1 1VQLZ 1VQK1 3G4S1 1BPNA 2XEGA 2PE3A 2ZEHA 1LAMA 3FQQA 4P6YA 3FVLA 1VQ8Z 2B63I 3CMEZ 4DYOA 4H2KA 1ELLP 1QVGZ 3S15I 1K83I 2PJ4A 3FECA 3JRUA 3CC4Z 1KQSZ 1CG2A 1N8R2 1CP7A 3CC41 1YUKA 5DS0A 2PRQA 4OC3A 1I6HI 3PO3I 1SFOI 3OW2Y 3BG0B 5LL6f 4AYBA 3S1NI 3VMHA 4NBFA 4BBRI 2XEJA 3IO1A 3WC5A 5K8MA 3EERA 4RUHA 5C4XI 2R93I 4E30A 1TFIA 2EK9A 3HOUI 1Z8LA 3CCV1 1WW9A 4RS4A 1Z02A 2DEAA 4NOZA 3FQMA 3NFZA 3G71Z 3B3SA 3D66A 2AFWA 4MHPA 2PJ0A 1Z03A 2GTHA 3G711 5CM2M 1ZG8A 3GTKI 4MONA 4A3CI 3ISZA 4CL1A 4WJBA 5C44I 3J7A4 3PO3S 5C3EI 1YI21 5IT9b 4KSIA 2LFUA 4OIWA 3CPWY 4NBDA 1EE3P 2PJCA 1TKFA 2ZEDA 2ZELA 2PJ8A 3KZWA 2QRDB 1NUIA 4IHMA 3NDIA 2K5RA 5J1QA 4OMEA 3U50C 5CPAA 2P28A 3B3CA 3CCU1 2ZEEA 2F4MA 1VQ5Z 3I55Z 1YW6A 2BCOA 1VGYA 4OC4A 2ZEGA 4NB9A 3VARA 1Q821 2JUBA 3I551 1VQ51 1QVGY 3KQXA 1LOKA 4MD7A 4XX2A 1BPMA 4LQGA 1KQSY 3H8GA 5JM6A 5LYDA 3HOYI 1N2FA 3CCMZ 4UIBA 3G6EZ 3S2HI 1DL6A 4NGQA 4OC2A 3N5FA 1M901 4OIDA 2AKLA 3G6E1 3GTJI 4PPZA 1TWHI 4MCQA 4PXCA 1RO2A 3EEDA 1XFOA 4P4EA 3GB0A 1DE4C 2KPIA 2IQ6A 4A3DI 3LMSA 3SJEA 1TF8A 1Q861 4UEZA 2BJOA 4A3JI 1YJWZ 2GU2A 1PCAA 4A37A 1YJW1 3VB9A 5JH9A 2Q51A 4JYWA 1JWHC 3FKII 3J81b 1ZG9A 3K9TA 1K731 4P4DA 2H85A 1HDUA 3S9NA 4DGLA 1VLAA 2RBLA 1ARLA 2IMOA 2DE6A 2RT9A 2V8IA 4EMEA 2EWBA 1ML8A 1VQ7Z 2OTJ1 2V8KA 3RBUA 4A3II 3BXMA 3VATA 3QNVA 4ZY0A 5F09A 4A93I 1VQ71 1M1K2 4A39A 1FT7A 1TWCI 2Q43A 2O4HA 2F4OA 4P4FA 3CDXA 1ARMA 5LYIA 4S1TA 3TE5B 2JR6A 4OP4A 3LWUA 2QA4Z 1NJI2 3KHZA 2NYQA 1F2OA 3S2DI 2DE5A 4MHYA 3RAMA 4Y52I 2ZOFA 4ONWA 4E2XA 3SI1A 3PRTA 3VTNA 2C6PA 2ZEPA 3H0GI 3J80b 2JMOA 4EWCA 1Y7EA 3CCEZ 1YLOA 2PJBA 1QF8A 3KQZA 3VH9A 2R92I 3CCE1 1QQ9A 3CD6Z 3PB9X 2OTLZ 4NGPA 3CD61 2QLVB 3WABA 1L1OC 2C6CA 2JBKA 4TWEA 2NSMA 7CPAA 1QMUA 3CCQ1 2PJ7A 2ZEFA 3FX6A 3PFEA 5LRJA 1YIT1 3CCL1 3CMAZ 1VQKZ 3KR5A 5K8NA 3RZDI 4NJRA 4A3FI 2E2II 4UEEA 3H3VJ 1AYEA 4X3RA 3GKQA 1VHOA 4MCRA 3BG1B 1R3NA 4DJLA 2F7VA 1IGBA 1F57A 2PM9A 3S1QI 2AFUA 3BHXA 2V8GA 4NGTA 1VQNZ 3I4NI 2RIQA 4JZ0A 3D67A 1VQN1 2NVYI 1KC82 1Z2LA 3KIFA 4UF4A 4IAVA 3H8EA 3KIHA 1YW4A 2LIYA 4E32A 2OOXB 2PJ6A 4MCPA 2QYVA 4ZX9A 2JA5I 1USPA 2QKDA 1CPSA 4R8FA 3T8WA 3S16I 4P44A 3CCVZ 2PK7A 4P45A 4BD9A 2G9DA 2FVGA 5LRKA 4QTTA 4RVDA 3GTMI 1UWYA 2BOAA 1RO0A 3I56Z 3B7IA 3B35A 3SJXA 3I561 1Z01A 2P3YA 3DLJA 3B3VA 5IP9I 1YHQ1 3GCFA 1YI2Z 1W2BZ 1H8LA 1HDQA 4IK2A 1CPXA 2CTCA 5JGFA 3HUVA 2E2JI 3Q87A 4E2ZA 5T64A 2E2HI 1TWGI 3VMGA 2ZEMA 3KI9A 2ANPA 4F8ZA 4FWUA 2V8DA 4DK1A 3CCUZ 3QWUA 4E33A 5LYLA 2EGTA 3GTLI 1NP6A 2JA7I 4MHNA 4MMOA 2IZ4A 2RFHA 5FLMI 3GTMS 4E31A 3H8FA 1JJ2Z 1KD11 3F3PC 4MRIA 2PJ9A 1Y0YA 2XEFA 2AFSA 3IWWA 4DQYB 3RZAA 2WAQA 3S9MA 2DE7A 6CPAA 1Y1WI 1VQ9Z 3DGVA 2YADA 1F2PA 4Q7AA 1HEEA 2F8HA 4AXVA 1VQ91 2OR4A 5T6BA 4OC5A 4PXEA 4Y7NI 1CX8A 3M4OI 4NGMA 5D1OA 1YIJ1 2C6GA 1K8A1 3RZOI 4OKOA 5I4MA 1VQ4Z 5D29A 3GTGI 1VQ41 4MHZA 4G1PA 2PIYA 1Q7Y1 5FLXb 4P4JA 4BBSI 4ZI6A 1Q822 2RHBA 4OC1A 1TKHA 4A3EI 4HH4A 5A2Qb 1LAPA 1W2BY 3HOZI 2OTJZ 1TKJA 3SI0A 4W9YA 2V8VA 1AMPA 2AFOA 3I07A 1KWMA 5THWA 2QR1B 2OOYB 3CC21 2RB7A 3D7DA 3TC8A 4R6TA 3K2KA 1M902 1WCMI 1YUAA 3T4NB 5LRGA 1ZH1A 2J9AA 2V8JA 4EWTA 3VMIA 4NBHA 4MD9A 3IX0A 4E2YA 1Q811 2PJ2A 2VL1A 1DTDA 1XMBA 3KL9A 1Y0RA 1Q862 2WYRA 4ZY2A 3MZLB 1Y1VI 1K9M1 1JJ2Y 2PJAA 2R6MA 2KI7B 1Q7Y2 4R76A 3ISXA 3JAMf 1R43A 1K732 3D7HA 3NA6A 1LQLA 2HF1A 2G2KA 3FJUA 3FF3A 1TWAI 1FNOA 2JS4A 5AN9F 3WC7A 2I3CA 1VQPZ 3GTOI 3GTPI 4WWVA 2QEXZ 4A38A 1VQP1 1S721 4B6ZA 2QEX1 2ZOGA 3CXCZ 3KR4A 3PFOA 4NBCA 3FEEA 2CTBA 3CCQZ 2OZKA 4QTUA 1YITZ 3CCLZ 1KRLA 4A3KI 4ZY1A 3I4MI 2PVVA 3ESWA 3TDHB 3SI2A 3NH5A 8CPAA 4BY1I 4NBGA 1PFTA 3B2YA 1QVFZ 3IFEA 4X6AI 3CCJ1 3CPAA 3F3FC 3J81f 3V7ZA 3CQZI 1ZLIA 2ZAEB 5IB9A 1CP6A 2PIZA 1N8R1 1Z5RA 3HLPA 1VHEA 3PBBA 3PEIA 5HVGA 4Z65A 2E9HA 3KASA 1RO4A 1RLYA 1GYTA 2K3RA 3CCSZ 2Y0SA 2VUMI 2BO9A 1M4LA 3CCS1 1VQL1 3S17I 3IEHA 1USPB 3MRUA 4UEFA 2GLJA 4A3LI 1I3QI 4NB8A 4PQAA 5D8NA 1YJ9Z 4NBEA 2R7ZI 5CBMA 1X0TA 1P9NA 2W03A 1X3WA 1VQ81 3S14I 1YJ91 5ELYA 3CME1 3SJGA 2VF1A 3J80f 4UIAA 3P5JB 1R9TI 1LANA 3CXCY 2HC9A 1YHQZ 1LCPA 5LYFA 1S7MA 4NFRA 2VUGA 3GTQI 3PB7X 3D6WA 3I1UA 1JQGA 2PCUA 3LUSA 1XJOA 2QVPA 1WIIA 1QVFY 2WZNA 2HB6A 2JA6I 2ZEOA 2PMZA 2IJZA 1YMEA 1YJNZ 3FEDA 2RPRA 4RV9A 3CT9A 3PBEA 3S1RI 1YJN1 2PJ3A 4NH1C 5HXDA 2AFMA 2JEWA 3GLJA 2ZENA 4FUUA 4NBAA 3KGQA 4R7MA 2NVXI 2QREB 4CPAA 4OC0A 2IZ3A 3PB6X 4A3MI 1VQ6Z 1RTQA 4YWYA 1OBRA 4YU9A 3IC1A 3V38A 2GREA 4HGZA 1VQ61 1XBUA 4NGNA 4ZX8A 4ZYQA 2PJ1A 4HGYA 1YIJZ 4MH4A 3NH8A 5HVHA 2M6NA 4BY7I 5D1OB 3JAMb 1CBXA 3NDJA 2JA8I 4NGSA 1QYPA 3CCRZ 3D9XA 2NVTI 2O53A 3CCR1 3B3WA 1KD12 1BAVA 3M3YI 2PJ5A 1BLLE 3BI0A 3K7AI 2QRCB 3CC2Z 2XEIA 3CCM1 1M1K1 4RVFA 4F9UA 2EK8A 5T67A 2GLFA 4P4IA 3HOXI 2OOTA 2AFXA 5IP7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXB A;  3TX8 A;  1VIX A;  4K3N A;  3L2N A;  4NGR A;  3D7F A;  2POK A;  2V77 A;  1TF9 A;  4PXD A;  2AFZ A;  4DUK A;  4FAI A;  4O23 A;  4EFD A;  2C1C A;  1PYT B;  4FBE A;  4F9V A;  4A94 A;  3D7G A;  3FH4 A;  3D4U A;  3MN8 A;  3NH4 A;  2JBJ A;  2ABZ A;  3S9L A;  3IIB A;  2Q4Z A;  3PB4 X;  5HVF A;  1YSJ A;  3D68 A;  4GM5 A;  1NSA A;  2V8H A;  4P4B A;  1ZG7 A;  2CIJ A;  4NJQ A;  2QJ8 A;  1Q7L A;  1TXR A;  1LFW A;  4X8I A;  1ELM P;  1XRY A;  4MXU A;  4TNU A;  4P10 A;  5K8O A;  1IY7 A;  3PB8 X;  3BI1 A;  3CPX A;  3SJF A;  3WC6 A;  2CF4 A;  2PVW A;  5K8P A;  1ZLH A;  4X2T A;  3KHX A;  4MCS A;  3IJ3 A;  3GUX A;  3B3T A;  3FMC A;  3WT4 A;  1BPN A;  2XEG A;  2PE3 A;  2ZEH A;  1LAM A;  4P6Y A;  3FVL A;  4DYO A;  4H2K A;  1ELL P;  2PJ4 A;  3FEC A;  3JRU A;  1CG2 A;  1CP7 A;  5DS0 A;  2PRQ A;  4OC3 A;  3IO1 A;  2XEJ A;  5K8M A;  3WC5 A;  4RUH A;  2EK9 A;  1Z8L A;  2DEA A;  3NFZ A;  3D66 A;  3B3S A;  2AFW A;  4MHP A;  2PJ0 A;  1ZG8 A;  3ISZ A;  4WJB A;  4KSI A;  4OIW A;  1EE3 P;  2ZEL A;  2PJC A;  1TKF A;  2ZED A;  2PJ8 A;  3KZW A;  4IHM A;  5J1Q A;  4OME A;  5CPA A;  3B3C A;  2ZEE A;  1YW6 A;  2BCO A;  1VGY A;  4OC4 A;  2ZEG A;  3VAR A;  3KQX A;  1LOK A;  1BPM A;  4LQG A;  3H8G A;  5JM6 A;  5LYD A;  4UIB A;  4NGQ A;  4OC2 A;  3N5F A;  4OID A;  4PXC A;  4PPZ A;  4MCQ A;  4P4E A;  1XFO A;  3GB0 A;  1DE4 C;  2IQ6 A;  3LMS A;  3SJE A;  1TF8 A;  4UEZ A;  2GU2 A;  1PCA A;  4A37 A;  5JH9 A;  2Q51 A;  4JYW A;  1ZG9 A;  3K9T A;  4P4D A;  1HDU A;  3S9N A;  1ARL A;  2IMO A;  4EME A;  2EWB A;  3RBU A;  4ZY0 A;  3BXM A;  3VAT A;  3QNV A;  5F09 A;  4A39 A;  1FT7 A;  2Q43 A;  2O4H A;  4P4F A;  3CDX A;  1ARM A;  5LYI A;  4OP4 A;  3LWU A;  3KHZ A;  2NYQ A;  1F2O A;  4MHY A;  3RAM A;  2ZOF A;  4ONW A;  3SI1 A;  3PRT A;  2C6P A;  2ZEP A;  1Y7E A;  1YLO A;  2PJB A;  3KQZ A;  3VH9 A;  3PB9 X;  1QQ9 A;  4NGP A;  3WAB A;  2C6C A;  2JBK A;  4TWE A;  2NSM A;  7CPA A;  1QMU A;  2PJ7 A;  5LRJ A;  2ZEF A;  3FX6 A;  3PFE A;  3KR5 A;  5K8N A;  4NJR A;  4UEE A;  1AYE A;  4X3R A;  1VHO A;  4MCR A;  1R3N A;  4DJL A;  2F7V A;  1IGB A;  1F57 A;  2AFU A;  3BHX A;  2V8G A;  4NGT A;  4JZ0 A;  3D67 A;  1Z2L A;  4UF4 A;  4IAV A;  3H8E A;  1YW4 A;  4MCP A;  2PJ6 A;  2QYV A;  4ZX9 A;  1CPS A;  4R8F A;  3T8W A;  4P44 A;  4P45 A;  4BD9 A;  2G9D A;  2FVG A;  5LRK A;  1UWY A;  2BOA A;  3B7I A;  3B35 A;  3SJX A;  3DLJ A;  3B3V A;  4IK2 A;  1H8L A;  1HDQ A;  5JGF A;  1CPX A;  2CTC A;  3HUV A;  2ZEM A;  3KI9 A;  2ANP A;  4F8Z A;  4FWU A;  2V8D A;  5LYL A;  4MHN A;  4MMO A;  2RFH A;  3H8F A;  4MRI A;  2PJ9 A;  1Y0Y A;  2XEF A;  2AFS A;  3IWW A;  3RZA A;  3S9M A;  6CPA A;  3DGV A;  1F2P A;  4Q7A A;  1HEE A;  2F8H A;  4AXV A;  2OR4 A;  4OC5 A;  4PXE A;  1CX8 A;  4NGM A;  2C6G A;  4OKO A;  5I4M A;  5D29 A;  4MHZ A;  4G1P A;  2PIY A;  4P4J A;  4ZI6 A;  4OC1 A;  1TKH A;  1LAP A;  1TKJ A;  3SI0 A;  4W9Y A;  2V8V A;  1AMP A;  2AFO A;  1KWM A;  5THW A;  3TC8 A;  3D7D A;  2RB7 A;  4R6T A;  3K2K A;  5LRG A;  2J9A A;  4EWT A;  2PJ2 A;  2VL1 A;  1DTD A;  1XMB A;  3KL9 A;  1Y0R A;  2WYR A;  4ZY2 A;  2PJA A;  4R76 A;  3ISX A;  1R43 A;  3D7H A;  3NA6 A;  3FJU A;  3FF3 A;  1FNO A;  3WC7 A;  2I3C A;  4A38 A;  4WWV A;  4B6Z A;  2ZOG A;  3KR4 A;  3PFO A;  3FEE A;  2CTB A;  4ZY1 A;  2PVV A;  3SI2 A;  3NH5 A;  8CPA A;  3B2Y A;  3IFE A;  3CPA A;  3V7Z A;  1ZLI A;  5IB9 A;  1CP6 A;  2PIZ A;  1Z5R A;  3HLP A;  1VHE A;  3PBB A;  3PEI A;  5HVG A;  4Z65 A;  3KAS A;  1GYT A;  2BO9 A;  1M4L A;  3IEH A;  3MRU A;  4UEF A;  2GLJ A;  4PQA A;  5D8N A;  5CBM A;  5ELY A;  3SJG A;  4UIA A;  1LAN A;  2HC9 A;  1LCP A;  5LYF A;  4NFR A;  3PB7 X;  3I1U A;  1JQG A;  2PCU A;  1XJO A;  2QVP A;  2WZN A;  2HB6 A;  2ZEO A;  2IJZ A;  3FED A;  1YME A;  3CT9 A;  3PBE A;  2PJ3 A;  5HXD A;  2AFM A;  2JEW A;  3GLJ A;  2ZEN A;  4FUU A;  3KGQ A;  4R7M A;  4CPA A;  4OC0 A;  3PB6 X;  1RTQ A;  4YWY A;  1OBR A;  4YU9 A;  3IC1 A;  3V38 A;  2GRE A;  1XBU A;  4ZX8 A;  4NGN A;  4ZYQ A;  2PJ1 A;  3NH8 A;  5HVH A;  1CBX A;  4NGS A;  2O53 A;  3B3W A;  1BAV A;  2PJ5 A;  1BLL E;  3BI0 A;  2XEI A;  4F9U A;  2EK8 A;  2GLF A;  4P4I A;  2OOT A;  2AFX A; 
#chains in the Genus database with same CATH topology
 4PXB A;  1NJI 1;  1S3Z A;  3UY5 A;  3L2N A;  2Z3P A;  1K8A 2;  2J6A A;  2POK A;  1YK3 A;  1RNI A;  5A28 A;  1I50 I;  2GIV A;  2C1C A;  3QAH A;  3R1K A;  1FDI A;  3MGD A;  4A3B I;  3MN8 A;  3NH4 A;  2B58 A;  1S72 Z;  2Q0Y A;  3S9L A;  3IIB A;  2Q4Z A;  4MY0 A;  4NBB A;  2QA4 1;  1Y1V S;  1ZG7 A;  4NJQ A;  1Q7L A;  2W04 A;  5AG6 A;  5J8C A;  5FLX f;  5K8O A;  1XE4 A;  1M4I A;  1KC8 1;  2CF4 A;  1A2Z A;  3PP9 A;  1ZLH A;  4X2T A;  1I1D A;  4MCS A;  3G4S Z;  3CPW Z;  3WT4 A;  1Q2C A;  3G4S 1;  4L89 A;  1BPN A;  4ZBG A;  2PDO A;  3CME Z;  4H2K A;  3CC4 Z;  5GCN A;  3CC4 1;  2EVN A;  3GKR A;  3LD2 A;  5LL6 f;  4AYB A;  3S1N I;  4NBF A;  4BBR I;  3WC5 A;  5BWA B;  3DR8 A;  4RUH A;  3DR6 A;  5C4X I;  3R9E A;  3EFA A;  2AFW A;  2LEX A;  3N7Z A;  3JTK A;  5C88 A;  3J7A 4;  1YI2 1;  5IT9 b;  2LFU A;  4OIW A;  4AG9 A;  4NBD A;  2ZED A;  1NUI A;  2K5R A;  1XOV A;  5J1Q A;  5CPA A;  2ZEE A;  3DSB A;  5ISV A;  2F4M A;  3I55 Z;  3VAR A;  4NB9 A;  1Q82 1;  3I55 1;  3KQX A;  4LQG A;  1KQS Y;  3RO0 A;  1MJB A;  4A32 A;  3S2H I;  1DL6 A;  2ZW5 A;  3N5F A;  4PXC A;  3GTJ I;  1TWH I;  1RO2 A;  4P4E A;  1JWQ A;  4BIN A;  2BEI A;  4A3D I;  5JQ4 A;  4UEZ A;  2BJO A;  3D2M A;  4NF1 A;  2JIO A;  4JYW A;  1ZG9 A;  1K73 1;  1HDU A;  3SXO A;  3S9N A;  2RBL A;  1V0C A;  4AVA A;  2DE6 A;  1VQ7 Z;  4B11 A;  4A3I I;  3QNV A;  1VQ7 1;  2V45 A;  1TWC I;  4P4F A;  5LYI A;  4OP4 A;  3NE8 A;  2R8V A;  2ZOF A;  4Y49 B;  4KUA A;  3H0G I;  2JMO A;  1Y7E A;  3VH9 A;  3PB9 X;  3CD6 Z;  3CD6 1;  1L1O C;  1B87 A;  4TWE A;  3FX6 A;  3PFE A;  1VQK Z;  3KR5 A;  5K8N A;  3RZD I;  3FIX A;  2FT0 A;  4UEE A;  3GKQ A;  1R3N A;  2F7V A;  2PM9 A;  3S1Q I;  3BHX A;  2Z3O A;  4NGT A;  5E96 A;  4NEX A;  4X5K A;  2C27 A;  1Z2L A;  4IAV A;  3KIH A;  3S16 I;  4P44 A;  4IUS A;  2FVG A;  5LRK A;  1RO0 A;  1RXT A;  3FB3 A;  2ARH A;  4KOS A;  2P3Y A;  4IK2 A;  5JGF A;  1CPX A;  3VMG A;  4FWU A;  4KSF A;  4DK1 A;  2I79 A;  2J8N A;  2Z3K A;  5F46 A;  4KUB A;  2B3V A;  2IZ4 A;  3H8F A;  4E31 A;  1AUG A;  2Q7S A;  4KSA A;  1Y0Y A;  3RZA A;  4Q7A A;  2F8H A;  4AXV A;  4CYO A;  2Z3L A;  1YIJ 1;  2X7B A;  1K8A 1;  3RZO I;  4YGO A;  3GTG I;  4G1P A;  4QB9 A;  1Z4E A;  3F8K A;  2ODF A;  2I00 A;  2OTJ Z;  3SI0 A;  4ONU A;  4FD5 A;  2OOY B;  2RB7 A;  1YUA A;  3QB8 A;  1ZH1 A;  2J9A A;  2FSR A;  2V8J A;  3VMI A;  4NBH A;  4MD9 A;  3IX0 A;  1Y8C A;  3KL9 A;  2REF A;  1Q86 2;  4FD4 A;  2R6M A;  2KI7 B;  4KOV A;  3ISX A;  1R43 A;  5AG7 A;  3NE7 A;  3FJU A;  2HF1 A;  1TWA I;  5AN9 F;  4J3G A;  4UCP A;  4H6Z A;  3S6G A;  2Z10 A;  3CCQ Z;  5EBV A;  4B5O A;  1KRL A;  4ZY1 A;  2PVV A;  4R9M A;  3TDH B;  3NH5 A;  3R9G A;  2EUI A;  1QVF Z;  4X6A I;  3CCJ 1;  3CPA A;  4MFJ A;  1GHE A;  3CQZ I;  4Z65 A;  2Q4Y A;  2K3R A;  2WUU A;  2B4D B;  1BOB A;  4CGN A;  4NCZ A;  2WSA A;  3W6S A;  4PQA A;  4NBE A;  1P9N A;  1X3W A;  5ELY A;  3S14 I;  1QSN A;  4AB7 A;  5H86 A;  3P5J B;  3F0A A;  2REE A;  3CXC Y;  4NFR A;  4M85 A;  2BSW A;  3D2P A;  1Q2Y A;  4U9Z A;  1XJO A;  4F6A A;  1WII A;  2WZN A;  2HB6 A;  1ON0 A;  1YME A;  2RC4 A;  1Z4R A;  3S1R I;  2PJ3 A;  4NH1 C;  2ZEN A;  4AG7 A;  4H6U A;  4YWY A;  1OBR A;  4EVY A;  4ZYQ A;  3TO6 A;  3D3S A;  3NH8 A;  5HVH A;  2GFQ A;  2ZXV A;  3A9L A;  5IX3 A;  2JA8 I;  3TO7 A;  3CCR Z;  4KOY A;  3CCR 1;  4C68 A;  1BLL E;  3K7A I;  3CC2 Z;  2XEI A;  2EK8 A;  4P4I A;  1YX0 A;  2OOT A;  2AFX A;  1YGH A;  1WK4 A;  1XEB A;  2V77 A;  1ZB9 A;  3PZJ A;  1B6B A;  4MD8 A;  4O23 A;  2VEZ A;  4FBE A;  4A94 A;  3JVN A;  2B4B A;  3D4U A;  2YU9 I;  3MON A;  4KZT A;  2M48 A;  2FL4 A;  5C4J I;  2NVQ I;  4KOW A;  1S7L A;  4PSW A;  5HVF A;  1YSJ A;  3D68 A;  1Q81 2;  2P6G A;  4P4B A;  3HKZ A;  4UA3 A;  1K9M 2;  5DWM A;  4X8I A;  3W6X A;  4PK2 A;  4MXU A;  4TNU A;  5KTC A;  4RVG A;  4H89 A;  2BUE A;  5D1P A;  1IY7 A;  5A2Q f;  1P0H A;  2OTL 1;  3WC6 A;  3B8G A;  2WB1 A;  1IID A;  1UFH A;  3H4Q A;  3KHX A;  4XPD C;  4B14 A;  3FMC A;  4UBR A;  2ZEH A;  1MJA A;  2B63 I;  3S15 I;  1CJW A;  1KQS Z;  3IU1 A;  4ZGY B;  1I6H I;  3PO3 I;  3I9S A;  4KVO E;  4PSX A;  3TCV A;  2XEJ A;  3EER A;  2R93 I;  1M44 A;  3CCV 1;  1Z02 A;  4NOZ A;  3NFZ A;  3B3S A;  3D66 A;  4MHP A;  2PJ0 A;  1Z03 A;  1Q16 A;  5CM2 M;  1ZG8 A;  4A30 A;  4A3C I;  1ZO0 A;  3PO3 S;  2Q7B A;  3G3S A;  3G8W A;  4C2Y A;  3CXS A;  2ZW6 A;  2PJ8 A;  2QRD B;  3U50 C;  2P28 A;  3B3C A;  3CCU 1;  1YW6 A;  1VGY A;  1QVG Y;  4OAE A;  2CY2 A;  1YVO A;  5JM6 A;  3OWC A;  4NGQ A;  4OC2 A;  2AKL A;  5J8F A;  1TIQ A;  4PPZ A;  4MCQ A;  3EED A;  2KCW A;  3LMS A;  2CNM A;  3R95 A;  1TF8 A;  1Q86 1;  2FCK A;  1PCA A;  3VB9 A;  2VZY A;  1VKC A;  3J81 b;  2FE7 A;  3K9T A;  2H85 A;  3R9F A;  1FY7 A;  3QAY A;  2IMO A;  4EME A;  2V8I A;  2EWB A;  4CYP A;  3RBU A;  4ZY0 A;  3BXM A;  4A93 I;  1M1K 2;  4A39 A;  1FT7 A;  2O4H A;  3P2H A;  4S1T A;  3LWU A;  2QA4 Z;  3KHZ A;  2NYQ A;  3S2D I;  1Y9W A;  3RAM A;  4Y52 I;  3K9U A;  2C6P A;  3J80 b;  2VPY A;  4EWC A;  3IGR A;  2PJB A;  3BJ8 A;  3IR7 A;  1IB1 E;  2AE6 A;  2G0B A;  5LRJ A;  1YIT 1;  3CCL 1;  4YFJ A;  1Y9K A;  4I49 A;  4A2Z A;  4KOU A;  3GYA A;  2IV2 X;  4DJL A;  1IGB A;  4CAW A;  3DDD A;  2AFU A;  1P4N A;  4JZ0 A;  2BL1 A;  3KIF A;  4MCP A;  2QYV A;  2JA5 I;  1M1D A;  2QKD A;  2VBQ A;  5FVJ A;  3FBU A;  3D8P A;  2PK7 A;  2G9D A;  4IF5 A;  1UWY A;  2BOA A;  1Z01 A;  1AA6 A;  5IP9 I;  1YHQ 1;  3GCF A;  1YI2 Z;  1H8L A;  1HDQ A;  4F0Y A;  2CTC A;  1Z8W A;  3HUV A;  2E2J I;  3Q87 A;  1WJ2 A;  4CGL A;  4KOR A;  5T64 A;  1Y7R A;  3KI9 A;  4F8Z A;  2F5I A;  4E33 A;  5A27 A;  1RO5 A;  4MHN A;  4MMO A;  4B10 A;  1XMT A;  3LAC A;  4BMH A;  4MRI A;  3IWW A;  2WAQ A;  1Y1W I;  1VQ9 Z;  4A33 A;  1VQ9 1;  4PXE A;  4Y7N I;  1S60 A;  4NGM A;  5D1O A;  4OKO A;  1VQ4 Z;  1VQ4 1;  2B3U A;  4PK3 A;  4UWJ A;  4P4J A;  2AYD A;  4BBS I;  1TKH A;  4A3E I;  1W2B Y;  3HOZ I;  1TKJ A;  2JDD A;  5I0C A;  2QR1 B;  3TC8 A;  2B5G B;  3K2K A;  1M90 2;  5KTA A;  3V8I A;  1S7F A;  2ATR A;  1Q81 1;  2VPZ A;  1Y0R A;  3C26 A;  4ZY2 A;  2CNS A;  1X10 A;  1K9M 1;  2R1I A;  1Q7Y 2;  1S7K A;  3WC7 A;  1VQP Z;  3GTO I;  3GTP I;  2ZW4 A;  1VQP 1;  4B6Z A;  4B13 A;  2ZOG A;  3CXC Z;  1L0C A;  2O28 A;  4NBC A;  1QSM A;  3SI2 A;  1SQH A;  4NBG A;  1PFT A;  3B2Y A;  4AVC A;  1ZLI A;  2ZAE B;  5IB9 A;  1Z5R A;  2E7Z A;  3PEI A;  1RLY A;  2VUM I;  2J8R A;  1VQL 1;  3S17 I;  1USP B;  3MRU A;  4NB8 A;  5D8N A;  1YJ9 Z;  1X0T A;  2CXA A;  2W03 A;  1VQ8 1;  1YJ9 1;  3SJG A;  4L8A A;  1LCP A;  1S7M A;  2VUG A;  2DXQ A;  3D6W A;  4A95 A;  2JIM A;  2WPX A;  3IU2 A;  2JA6 I;  2IJZ A;  2EO8 A;  3GIU A;  3DNS A;  2JEW A;  4NBA A;  2IZ3 A;  1RTQ A;  3ZZI A;  4NGN A;  4KVM E;  4HGY A;  1YIJ Z;  4MH4 A;  2M6N A;  4QUS A;  4NGS A;  3ZJ0 A;  3D9X A;  2NVT I;  2O53 A;  5H84 A;  3B3W A;  1KD1 2;  1BAV A;  2QRC B;  4MFL A;  2Z3N A;  2QIR A;  3CCM 1;  1M1K 1;  2YND A;  5T67 A;  3EO4 A;  3HOX I;  5IP7 I;  3TX8 A;  1VIX A;  4JJX A;  3HOW I;  1IYK A;  4K3N A;  2PRB A;  4NGR A;  1VQM Z;  4PXD A;  1Z8T A;  1VQM 1;  2AFZ A;  3E0K A;  4DUK A;  4FAI A;  1SIW A;  3BLN A;  3D7G A;  2JBJ A;  2HU9 A;  3HOV I;  4B12 A;  4XPD B;  5HMN A;  4GM5 A;  4CYQ A;  1I21 A;  2V8H A;  2GTI A;  3IFU A;  1RQF A;  2CIJ A;  2G3T A;  2QJ8 A;  4E2W A;  1MK4 A;  3CCJ Z;  1ELM P;  2Q44 A;  3IF8 A;  2JNY A;  3RYO A;  3MZK B;  4P10 A;  1MJ9 A;  1TWF I;  4A3G I;  4C7H A;  3PB8 X;  3BI1 A;  1KUY A;  5K8P A;  3PO2 I;  1M4G A;  1YVK A;  3S6H A;  4QBJ A;  5EC4 A;  3GUX A;  3B3T A;  3CMA 1;  2FXF A;  2XEG A;  2PE3 A;  3LOD A;  3PGP A;  2HV2 A;  1IOI A;  3FVL A;  4CRY B;  4DYO A;  1ELL P;  1QVG Z;  5G20 A;  4CYN A;  2PJ4 A;  3FEC A;  1N8R 2;  1CP7 A;  4B5P B;  5DS0 A;  3OW2 Y;  3IO1 A;  3VMH A;  1TFI A;  2VXK A;  1WW9 A;  4RS4 A;  4Q38 A;  1Q2D A;  3ISZ A;  4CL1 A;  3T9Y A;  4KSI A;  2ZEL A;  3FRM A;  3GY9 A;  3KZW A;  4IHM A;  3VWE A;  5KTD A;  2K5T A;  2ZEG A;  2JUB A;  2JLM A;  1LOK A;  1NMT A;  2OU2 A;  4UIB A;  3G6E Z;  2Z0Z A;  1M90 1;  4OID A;  3G6E 1;  2JIQ A;  3TOB A;  2FS5 A;  3GB0 A;  2IQ6 A;  3SJE A;  4HNY B;  1PU9 A;  1YJW Z;  2GU2 A;  2HUZ A;  1YJW 1;  2YNE A;  4NSQ A;  3FKI I;  2YGW A;  4P4D A;  1VLA A;  1ARL A;  4UWI A;  4XNH B;  3VAT A;  5F09 A;  2YNC C;  2Q43 A;  3TE5 B;  2JR6 A;  4RN7 A;  4A31 A;  2EBJ A;  1F2O A;  2DE5 A;  1KUX A;  4MHD A;  4ONW A;  4E2X A;  2ZEP A;  3CCE Z;  4CAV A;  1QF8 A;  3KQZ A;  3CCE 1;  1QQ9 A;  2OTL Z;  3EY5 A;  2JEV A;  2QLV B;  2G3A A;  2C6C A;  1QSO A;  4OLL A;  3SXN A;  7CPA A;  1QMU A;  2PJ7 A;  1FDO A;  2DPT A;  3FYN A;  4A3F I;  2E2I I;  4CAE A;  4M6H A;  3H3V J;  1AYE A;  1VHO A;  4MCR A;  1F57 A;  2Q04 A;  3I4N I;  2RIQ A;  1M4D A;  3D67 A;  4UF4 A;  2B4D A;  3H8E A;  1YW4 A;  5AG5 A;  2OOX B;  1QSR A;  4ZX9 A;  2QEC A;  3CCV Z;  4P45 A;  5JPH A;  4E8O A;  4RVD A;  3GTM I;  4C2X A;  3B7I A;  1IOF A;  4B5P A;  3SJX A;  2NMT A;  4YRH A;  4M6I A;  3B3V A;  2OZH A;  1W2B Z;  2PR8 A;  2R98 A;  2E2H I;  3TT2 A;  1IIC A;  5G1Z A;  2ZEM A;  2ANP A;  2OZG A;  3CCU Z;  4LX9 A;  3QWU A;  2EGT A;  3GTL I;  1NP6 A;  2JA7 I;  4U5Y A;  2RFH A;  3GTM S;  4GS4 A;  1KD1 1;  4MFP A;  2ZPA A;  2AFS A;  4CGO A;  3S9M A;  2DE7 A;  3DGV A;  2YAD A;  1F2P A;  1HEE A;  4JD6 A;  1CX8 A;  5EMI A;  4CGP A;  5FLX b;  4CS0 B;  4ZI6 A;  3TTH A;  2RHB A;  4OC1 A;  4W9Y A;  2AFO A;  4JXQ A;  1KWM A;  4JXR A;  3D7D A;  4R6T A;  1WCM I;  1OZP A;  3T4N B;  4EWT A;  4E2Y A;  2PJ2 A;  1XMB A;  2WYR A;  3MZL B;  1Y1V I;  1JJ2 Y;  2PJA A;  4R76 A;  3JAM f;  3D7H A;  1LQL A;  2JS4 A;  4A38 A;  2QEX Z;  1KUV A;  4XNH C;  1S72 1;  4C7I A;  2QEX 1;  3KR4 A;  4QTU A;  1YIT Z;  3CCL Z;  4A3K I;  8CPA A;  4BY1 I;  3IFE A;  1XIX A;  4BBH A;  1N71 A;  4KLW A;  3J81 f;  2PR1 A;  1CP6 A;  4KVX A;  1N8R 1;  3HLP A;  1VHE A;  5CNP A;  3KAS A;  2Y0S A;  1Z9U A;  4XPL A;  1M4L A;  4UEF A;  5CBM A;  2R7Z I;  3SHP A;  3CME 1;  4HNW B;  2VF1 A;  3J80 f;  4UIA A;  1LAN A;  1LRZ A;  1YHQ Z;  5G21 A;  3GTQ I;  3D2L A;  1JQG A;  1YR0 A;  2QVP A;  2PMZ A;  3FED A;  4RV9 A;  3CT9 A;  3PBE A;  1NE9 A;  3T90 A;  5HXD A;  2AFM A;  3GLJ A;  4CPA A;  3JUW A;  3PB6 X;  4UCN A;  1VQ6 Z;  4R3K A;  4YU9 A;  3IC1 A;  2GRE A;  4HGZ A;  1VQ6 1;  1XBU A;  2PJ1 A;  4OAD A;  4U9Y A;  5F47 A;  5C82 A;  3F5B A;  2PJ5 A;  3M3Y I;  3BI0 A;  1X12 A;  3RNZ A;  4RVF A;  4F9U A;  4JWP A;  3WR7 A;  4UFX A;  2GLF A;  1VQO Z;  5IT9 f;  1VQO 1;  3D7F A;  2PC1 A;  4MJ8 A;  4R3L A;  1S7N A;  1TF9 A;  4EFD A;  1PYT B;  4RVH A;  4BXX I;  2VPW A;  4F9V A;  3FH4 A;  1X3Z A;  1VHS A;  3CC7 Z;  2ABZ A;  3CC7 1;  3S1M I;  3PB4 X;  1NSA A;  2CNT A;  3OW2 Z;  1ZB8 A;  5IB0 A;  1TXR A;  4II9 A;  1LFW A;  3EC4 A;  1XRY A;  1YRE A;  3CZX A;  2DPS A;  2Z11 A;  3CPX A;  3SJF A;  2PVW A;  3CXQ A;  3IJ3 A;  1VQL Z;  1VQK 1;  4R87 A;  4CAF A;  1LAM A;  4KOT A;  3FQQ A;  4P6Y A;  1VQ8 Z;  3S6F A;  3KKW A;  1K83 I;  3JRU A;  1CG2 A;  2A4N A;  1YUK A;  2PRQ A;  4OC3 A;  2AJ6 A;  2H5M A;  1SFO I;  3BG0 B;  5K8M A;  4E30 A;  2EK9 A;  3TOA A;  3VWD A;  3HOU I;  1Z8L A;  4HKF A;  2DEA A;  5F49 A;  3FQM A;  3G71 Z;  1XF8 A;  2GTH A;  3G71 1;  1J4J A;  3GTK I;  4MON A;  3TO9 A;  1YLE A;  2J8M A;  5C44 I;  4WJB A;  5C3E I;  3CPW Y;  1EE3 P;  2PJC A;  1TKF A;  3NDI A;  4OME A;  1VQ5 Z;  2BCO A;  3IWG A;  4R57 A;  4OC4 A;  1VQ5 1;  4MD7 A;  4XX2 A;  1BPM A;  3W91 A;  3H8G A;  5LYD A;  3P2F A;  3HOY I;  1N2F A;  3CCM Z;  1R57 A;  1XFO A;  3CXP A;  1DE4 C;  2KPI A;  4A3J I;  4A37 A;  5JH9 A;  2Q51 A;  1JWH C;  4DGL A;  5F48 A;  1K4J A;  2RT9 A;  1ML8 A;  4F0X A;  2B5G A;  2OTJ 1;  2V8K A;  2D4O A;  1I12 A;  4MFK A;  2F4O A;  3CDX A;  1ARM A;  2OH1 A;  1NJI 2;  4C2Z A;  4MHY A;  4CGM A;  3SI1 A;  3PRT A;  3VTN A;  4QC6 A;  1YLO A;  2R92 I;  4FD7 A;  3TFY A;  2OB0 A;  2GE3 A;  4JLY A;  4NGP A;  4HPS A;  3WAB A;  2JBK A;  1Z8X A;  3FXT A;  2NSM A;  3CCQ 1;  2ZEF A;  3CMA Z;  4RI1 A;  4NJR A;  4LUA A;  4Y49 C;  4NXY A;  4X3R A;  4MI4 A;  3BG1 B;  2WPW A;  2GAN A;  4HNX B;  4K30 A;  1QST A;  2V8G A;  1VQN Z;  1VQN 1;  2NVY I;  3TE4 A;  1KC8 2;  2LIY A;  4E32 A;  2PJ6 A;  1WWZ A;  1USP A;  1IU8 A;  1CPS A;  4R8F A;  3T8W A;  1QXF A;  2PSW A;  4BD9 A;  4QTT A;  3I56 Z;  3B35 A;  3I56 1;  3DLJ A;  4KS9 A;  2JIP A;  4KOX A;  4E2Z A;  1TWG I;  4AVB A;  2V3V A;  2V8D A;  2PQ8 A;  4UFV A;  5LYL A;  4KLV A;  1PUA A;  5FLM I;  4MFQ A;  1JJ2 Z;  3F3P C;  1WZN A;  2PJ9 A;  2XEF A;  2ZW7 A;  2NAP A;  4DQY B;  6CPA A;  2OR4 A;  4OC5 A;  5T6B A;  4MBU A;  3M4O I;  2C6G A;  4E0A A;  5I4M A;  5D29 A;  3H5Z A;  4MHZ A;  2PIY A;  1Q7Y 1;  4LQ6 A;  2HQY A;  4UCM A;  1Q82 2;  2Q4V A;  4MY3 A;  4HH4 A;  5A2Q b;  1LAP A;  4CAX A;  2YNC A;  4Q36 A;  4PV6 A;  2V8V A;  2IL4 A;  1AMP A;  2P0W A;  3I07 A;  5THW A;  3CC2 1;  2VZZ A;  2P6E A;  1U6M A;  5LRG A;  4FD6 A;  2VI7 A;  2VL1 A;  1DTD A;  4CRZ B;  5DWN A;  1YQE A;  4XPK A;  2FIW A;  2VPX A;  2D4P A;  1K73 2;  3S6K A;  3NA6 A;  2G2K A;  3FF3 A;  1FNO A;  2P6F A;  2I3C A;  4WWV A;  3R96 A;  1KZF A;  3PFO A;  2FIA A;  2R7H A;  2Y0M A;  2CTB A;  3FEE A;  2OZK A;  1CM0 A;  5AGE A;  3I4M I;  3ESW A;  4GXH A;  3F3F C;  3V7Z A;  3FNC A;  1IYL A;  2PIZ A;  3PBB A;  4DNC A;  5HVG A;  4ORF A;  4RS2 A;  2E9H A;  1BO4 A;  3BJ7 A;  1RO4 A;  1GYT A;  3IWE A;  3CCS Z;  2BO9 A;  3CCS 1;  3IEH A;  2GLJ A;  4A3L I;  3EXN A;  1I3Q I;  2JIR A;  1NSL A;  1R9T I;  1S5K A;  2HC9 A;  5LYF A;  4E2A A;  3PB7 X;  2Z3M A;  3I1U A;  3I3G A;  4UFW A;  2PCU A;  2JDC A;  3LUS A;  4M6G A;  5HH1 A;  1QVF Y;  4MFZ A;  2ZEO A;  4M3S A;  1YJN Z;  2RPR A;  1YJN 1;  4FUU A;  5AG4 A;  2DF5 A;  3KGQ A;  4R7M A;  2NVX I;  2QRE B;  4OC0 A;  4A3M I;  3V38 A;  4ZX8 A;  4QVT A;  4BY7 I;  5D1O B;  5IV0 A;  3JAM b;  1CBX A;  3NDJ A;  2QML A;  1QYP A;  2VQY A;  5G22 A;  2OZU A; 
#chains in the Genus database with same CATH homology
 4PXB A;  3TX8 A;  1VQO Z;  1VIX A;  3HOW I;  1NJI 1;  4K3N A;  5IT9 f;  3L2N A;  1K8A 2;  1VQO 1;  2J6A A;  4NGR A;  3D7F A;  2POK A;  2V77 A;  1VQM Z;  1ZB9 A;  1TF9 A;  4PXD A;  1RNI A;  1VQM 1;  1I50 I;  2AFZ A;  4O23 A;  4MD8 A;  4DUK A;  2C1C A;  1PYT B;  4EFD A;  4FAI A;  4RVH A;  4BXX I;  4FBE A;  4F9V A;  4A94 A;  4A3B I;  3D7G A;  3FH4 A;  1X3Z A;  3D4U A;  2YU9 I;  3MON A;  3MN8 A;  3NH4 A;  2JBJ A;  1S72 Z;  2HU9 A;  3CC7 Z;  2ABZ A;  3S9L A;  2M48 A;  3IIB A;  2Q4Z A;  5C4J I;  2NVQ I;  3CC7 1;  3S1M I;  3PB4 X;  3HOV I;  5HVF A;  1YSJ A;  3D68 A;  4GM5 A;  4NBB A;  1NSA A;  2V8H A;  2QA4 1;  1Q81 2;  1Y1V S;  4P4B A;  3HKZ A;  2GTI A;  3IFU A;  1RQF A;  3OW2 Z;  1ZG7 A;  1ZB8 A;  2CIJ A;  4NJQ A;  2QJ8 A;  1Q7L A;  2W04 A;  1K9M 2;  1TXR A;  4E2W A;  1LFW A;  3CCJ Z;  4X8I A;  1ELM P;  3IF8 A;  1XRY A;  4MXU A;  5FLX f;  4TNU A;  2JNY A;  3MZK B;  4P10 A;  4RVG A;  5K8O A;  5D1P A;  1TWF I;  4A3G I;  1IY7 A;  5A2Q f;  3BI1 A;  3CPX A;  3PB8 X;  2OTL 1;  3SJF A;  3WC6 A;  1KC8 1;  2WB1 A;  2CF4 A;  2PVW A;  5K8P A;  3PO2 I;  1ZLH A;  4X2T A;  3KHX A;  4MCS A;  3IJ3 A;  3G4S Z;  3CPW Z;  3B3T A;  3FMC A;  3GUX A;  3WT4 A;  3CMA 1;  1VQL Z;  1VQK 1;  3G4S 1;  1BPN A;  2XEG A;  2PE3 A;  2ZEH A;  1LAM A;  3FQQ A;  4P6Y A;  3FVL A;  1VQ8 Z;  2B63 I;  3CME Z;  4DYO A;  4H2K A;  1ELL P;  1QVG Z;  3S15 I;  1K83 I;  2PJ4 A;  3FEC A;  3JRU A;  3CC4 Z;  1KQS Z;  1CG2 A;  1N8R 2;  1CP7 A;  3CC4 1;  1YUK A;  5DS0 A;  2PRQ A;  4OC3 A;  1I6H I;  3PO3 I;  1SFO I;  3OW2 Y;  3BG0 B;  5LL6 f;  4AYB A;  3S1N I;  3VMH A;  4NBF A;  4BBR I;  2XEJ A;  3IO1 A;  3WC5 A;  5K8M A;  3EER A;  4RUH A;  5C4X I;  2R93 I;  4E30 A;  1TFI A;  2EK9 A;  3HOU I;  1Z8L A;  3CCV 1;  1WW9 A;  4RS4 A;  1Z02 A;  2DEA A;  4NOZ A;  3FQM A;  3NFZ A;  3G71 Z;  3B3S A;  3D66 A;  2AFW A;  4MHP A;  2PJ0 A;  1Z03 A;  2GTH A;  3G71 1;  5CM2 M;  1ZG8 A;  3GTK I;  4MON A;  4A3C I;  3ISZ A;  4CL1 A;  4WJB A;  5C44 I;  3J7A 4;  3PO3 S;  5C3E I;  1YI2 1;  5IT9 b;  4KSI A;  2LFU A;  4OIW A;  3CPW Y;  4NBD A;  1EE3 P;  2PJC A;  1TKF A;  2ZED A;  2ZEL A;  2PJ8 A;  3KZW A;  2QRD B;  1NUI A;  4IHM A;  3NDI A;  2K5R A;  5J1Q A;  4OME A;  3U50 C;  5CPA A;  2P28 A;  3B3C A;  3CCU 1;  2ZEE A;  2F4M A;  1VQ5 Z;  3I55 Z;  1YW6 A;  2BCO A;  1VGY A;  4OC4 A;  2ZEG A;  4NB9 A;  3VAR A;  1Q82 1;  2JUB A;  3I55 1;  1VQ5 1;  1QVG Y;  3KQX A;  1LOK A;  4MD7 A;  4XX2 A;  1BPM A;  4LQG A;  1KQS Y;  3H8G A;  5JM6 A;  5LYD A;  3HOY I;  1N2F A;  3CCM Z;  4UIB A;  3G6E Z;  3S2H I;  1DL6 A;  4NGQ A;  4OC2 A;  3N5F A;  1M90 1;  4OID A;  2AKL A;  3G6E 1;  3GTJ I;  4PPZ A;  1TWH I;  4MCQ A;  4PXC A;  1RO2 A;  3EED A;  1XFO A;  4P4E A;  3GB0 A;  1DE4 C;  2KPI A;  2IQ6 A;  4A3D I;  3LMS A;  3SJE A;  1TF8 A;  1Q86 1;  4UEZ A;  2BJO A;  4A3J I;  1YJW Z;  2GU2 A;  1PCA A;  4A37 A;  1YJW 1;  3VB9 A;  5JH9 A;  2Q51 A;  4JYW A;  1JWH C;  3FKI I;  3J81 b;  1ZG9 A;  3K9T A;  1K73 1;  4P4D A;  2H85 A;  1HDU A;  3S9N A;  4DGL A;  1VLA A;  2RBL A;  1ARL A;  2IMO A;  2DE6 A;  2RT9 A;  2V8I A;  4EME A;  2EWB A;  1ML8 A;  1VQ7 Z;  2OTJ 1;  2V8K A;  3RBU A;  4A3I I;  3BXM A;  3VAT A;  3QNV A;  4ZY0 A;  5F09 A;  4A93 I;  1VQ7 1;  1M1K 2;  4A39 A;  1FT7 A;  1TWC I;  2Q43 A;  2O4H A;  2F4O A;  4P4F A;  3CDX A;  1ARM A;  5LYI A;  4S1T A;  3TE5 B;  2JR6 A;  4OP4 A;  3LWU A;  2QA4 Z;  1NJI 2;  3KHZ A;  2NYQ A;  1F2O A;  3S2D I;  2DE5 A;  4MHY A;  3RAM A;  4Y52 I;  2ZOF A;  4ONW A;  4E2X A;  3SI1 A;  3PRT A;  3VTN A;  2C6P A;  2ZEP A;  3H0G I;  3J80 b;  2JMO A;  4EWC A;  1Y7E A;  3CCE Z;  1YLO A;  2PJB A;  1QF8 A;  3KQZ A;  3VH9 A;  2R92 I;  3CCE 1;  1QQ9 A;  3CD6 Z;  3PB9 X;  2OTL Z;  4NGP A;  3CD6 1;  2QLV B;  3WAB A;  1L1O C;  2C6C A;  2JBK A;  4TWE A;  2NSM A;  7CPA A;  1QMU A;  3CCQ 1;  2PJ7 A;  2ZEF A;  3FX6 A;  3PFE A;  5LRJ A;  1YIT 1;  3CCL 1;  3CMA Z;  1VQK Z;  3KR5 A;  5K8N A;  3RZD I;  4NJR A;  4A3F I;  2E2I I;  4UEE A;  3H3V J;  1AYE A;  4X3R A;  3GKQ A;  1VHO A;  4MCR A;  3BG1 B;  1R3N A;  4DJL A;  2F7V A;  1IGB A;  1F57 A;  2PM9 A;  3S1Q I;  2AFU A;  3BHX A;  2V8G A;  4NGT A;  1VQN Z;  3I4N I;  2RIQ A;  4JZ0 A;  3D67 A;  1VQN 1;  2NVY I;  1KC8 2;  1Z2L A;  3KIF A;  4UF4 A;  4IAV A;  3H8E A;  3KIH A;  1YW4 A;  2LIY A;  4E32 A;  2OOX B;  2PJ6 A;  4MCP A;  2QYV A;  4ZX9 A;  2JA5 I;  1USP A;  2QKD A;  1CPS A;  4R8F A;  3T8W A;  3S16 I;  4P44 A;  3CCV Z;  2PK7 A;  4P45 A;  4BD9 A;  2G9D A;  2FVG A;  5LRK A;  4QTT A;  4RVD A;  3GTM I;  1UWY A;  2BOA A;  1RO0 A;  3I56 Z;  3B7I A;  3B35 A;  3SJX A;  3I56 1;  1Z01 A;  2P3Y A;  3DLJ A;  3B3V A;  5IP9 I;  1YHQ 1;  3GCF A;  1YI2 Z;  1W2B Z;  1H8L A;  1HDQ A;  4IK2 A;  1CPX A;  2CTC A;  5JGF A;  3HUV A;  2E2J I;  3Q87 A;  4E2Z A;  5T64 A;  2E2H I;  1TWG I;  3VMG A;  2ZEM A;  3KI9 A;  2ANP A;  4F8Z A;  4FWU A;  2V8D A;  4DK1 A;  3CCU Z;  3QWU A;  4E33 A;  5LYL A;  2EGT A;  3GTL I;  1NP6 A;  2JA7 I;  4MHN A;  4MMO A;  2IZ4 A;  2RFH A;  5FLM I;  3GTM S;  4E31 A;  3H8F A;  1JJ2 Z;  1KD1 1;  3F3P C;  4MRI A;  2PJ9 A;  1Y0Y A;  2XEF A;  2AFS A;  3IWW A;  4DQY B;  3RZA A;  2WAQ A;  3S9M A;  2DE7 A;  6CPA A;  1Y1W I;  1VQ9 Z;  3DGV A;  2YAD A;  1F2P A;  4Q7A A;  1HEE A;  2F8H A;  4AXV A;  1VQ9 1;  2OR4 A;  5T6B A;  4OC5 A;  4PXE A;  4Y7N I;  1CX8 A;  3M4O I;  4NGM A;  5D1O A;  1YIJ 1;  2C6G A;  1K8A 1;  3RZO I;  4OKO A;  5I4M A;  1VQ4 Z;  5D29 A;  3GTG I;  1VQ4 1;  4MHZ A;  4G1P A;  2PIY A;  1Q7Y 1;  5FLX b;  4P4J A;  4BBS I;  4ZI6 A;  1Q82 2;  2RHB A;  4OC1 A;  1TKH A;  4A3E I;  4HH4 A;  5A2Q b;  1LAP A;  1W2B Y;  3HOZ I;  2OTJ Z;  1TKJ A;  3SI0 A;  4W9Y A;  2V8V A;  1AMP A;  2AFO A;  3I07 A;  1KWM A;  5THW A;  2QR1 B;  2OOY B;  3CC2 1;  2RB7 A;  3D7D A;  3TC8 A;  4R6T A;  3K2K A;  1M90 2;  1WCM I;  1YUA A;  3T4N B;  5LRG A;  1ZH1 A;  2J9A A;  2V8J A;  4EWT A;  3VMI A;  4NBH A;  4MD9 A;  3IX0 A;  4E2Y A;  1Q81 1;  2PJ2 A;  2VL1 A;  1DTD A;  1XMB A;  3KL9 A;  1Y0R A;  1Q86 2;  2WYR A;  4ZY2 A;  3MZL B;  1Y1V I;  1K9M 1;  1JJ2 Y;  2PJA A;  2R6M A;  2KI7 B;  1Q7Y 2;  4R76 A;  3ISX A;  3JAM f;  1R43 A;  1K73 2;  3D7H A;  3NA6 A;  1LQL A;  2HF1 A;  2G2K A;  3FJU A;  3FF3 A;  1TWA I;  1FNO A;  2JS4 A;  5AN9 F;  3WC7 A;  2I3C A;  1VQP Z;  3GTO I;  3GTP I;  4WWV A;  2QEX Z;  4A38 A;  1VQP 1;  1S72 1;  4B6Z A;  2QEX 1;  2ZOG A;  3CXC Z;  3KR4 A;  3PFO A;  4NBC A;  3FEE A;  2CTB A;  3CCQ Z;  2OZK A;  4QTU A;  1YIT Z;  3CCL Z;  1KRL A;  4A3K I;  4ZY1 A;  3I4M I;  2PVV A;  3ESW A;  3TDH B;  3SI2 A;  3NH5 A;  8CPA A;  4BY1 I;  4NBG A;  1PFT A;  3B2Y A;  1QVF Z;  3IFE A;  4X6A I;  3CCJ 1;  3CPA A;  3F3F C;  3J81 f;  3V7Z A;  3CQZ I;  1ZLI A;  2ZAE B;  5IB9 A;  1CP6 A;  2PIZ A;  1N8R 1;  1Z5R A;  3HLP A;  1VHE A;  3PBB A;  3PEI A;  5HVG A;  4Z65 A;  2E9H A;  3KAS A;  1RO4 A;  1RLY A;  1GYT A;  2K3R A;  3CCS Z;  2Y0S A;  2VUM I;  2BO9 A;  1M4L A;  3CCS 1;  1VQL 1;  3S17 I;  3IEH A;  1USP B;  3MRU A;  4UEF A;  2GLJ A;  4A3L I;  1I3Q I;  4NB8 A;  4PQA A;  5D8N A;  1YJ9 Z;  4NBE A;  2R7Z I;  5CBM A;  1X0T A;  1P9N A;  2W03 A;  1X3W A;  1VQ8 1;  3S14 I;  1YJ9 1;  5ELY A;  3CME 1;  3SJG A;  2VF1 A;  3J80 f;  4UIA A;  3P5J B;  1R9T I;  1LAN A;  3CXC Y;  2HC9 A;  1YHQ Z;  1LCP A;  5LYF A;  1S7M A;  4NFR A;  2VUG A;  3GTQ I;  3PB7 X;  3D6W A;  3I1U A;  1JQG A;  2PCU A;  3LUS A;  1XJO A;  2QVP A;  1WII A;  1QVF Y;  2WZN A;  2HB6 A;  2JA6 I;  2ZEO A;  2PMZ A;  2IJZ A;  1YME A;  1YJN Z;  3FED A;  2RPR A;  4RV9 A;  3CT9 A;  3PBE A;  3S1R I;  1YJN 1;  2PJ3 A;  4NH1 C;  5HXD A;  2AFM A;  2JEW A;  3GLJ A;  2ZEN A;  4FUU A;  4NBA A;  3KGQ A;  4R7M A;  2NVX I;  2QRE B;  4CPA A;  4OC0 A;  2IZ3 A;  3PB6 X;  4A3M I;  1VQ6 Z;  1RTQ A;  4YWY A;  1OBR A;  4YU9 A;  3IC1 A;  3V38 A;  2GRE A;  4HGZ A;  1VQ6 1;  1XBU A;  4NGN A;  4ZX8 A;  4ZYQ A;  2PJ1 A;  4HGY A;  1YIJ Z;  4MH4 A;  3NH8 A;  5HVH A;  2M6N A;  4BY7 I;  5D1O B;  3JAM b;  1CBX A;  3NDJ A;  2JA8 I;  4NGS A;  1QYP A;  3CCR Z;  3D9X A;  2NVT I;  2O53 A;  3CCR 1;  3B3W A;  1KD1 2;  1BAV A;  3M3Y I;  2PJ5 A;  1BLL E;  3BI0 A;  3K7A I;  2QRC B;  3CC2 Z;  2XEI A;  3CCM 1;  1M1K 1;  4RVF A;  4F9U A;  2EK8 A;  5T67 A;  2GLF A;  4P4I A;  3HOX I;  2OOT A;  2AFX A;  5IP7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...