4TNUA

Human brain aspartoacylase mutant y231c complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDCPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4tnuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4tnuA01
4JYWA 3K9TA 1HDQA 3ISXA 5LRJA 1GYTA 3WABA 2ZEGA 1H8LA 2PJ5A 5K8MA 3KI9A 1M4LA 2Q4ZA 1LOKA 4ZY0A 5LRKA 1LAPA 2BO9A 4OC0A 4A38A 1HEEA 1DTDA 4EMEA 4ZI6A 4DYOA 4YU9A 1IY7A 1YW6A 4OC4A 1KWMA 4F9UA 3WC5A 1F57A 3VATA 1BPNA 2PVWA 4MHPA 4A39A 2JBJA 3SJEA 1LCPA 3GUXA 2PIYA 4UEZA 4TWEA 3KL9A 3S9MA 5LYLA 4FUUA 4OC5A 2NYQA 1CP7A 4P6YA 5JH9A 3SJXA 2J9AA 1ZG9A 3IWWA 4UF4A 3IIBA 1R3NA 2WYRA 1ARLA 4WWVA 1ZLHA 3NH8A 3KGQA 3SI0A 2XEFA 1BLLE 3BI1A 2HB6A 3FH4A 1Y0YA 2PVVA 2CF4A 2JEWA 2PJ8A 5K8NA 1AYEA 4ZX8A 3D7GA 2FVGA 1PCAA 3KR4A 2RB7A 1QMUA 1CP6A 3BHXA 3TX8A 2O53A 3PB6X 1ELLP 5HVFA 4K3NA 3B35A 4P4DA 1YLOA 4NGSA 4W9YA 4R76A 2PCUA 2PJ0A 4Z65A 2AFXA 4MCSA 2JBKA 3N5FA 3PBEA 2O4HA 3B7IA 5D29A 2DEAA 3KZWA 4DJLA 2CIJA 4O23A 4FBEA 4A37A 2HC9A 2PJ1A 1ZG7A 3VH9A 5CBMA 2PE3A 3FMCA 4NFRA 3PRTA 1XMBA 1AMPA 2GU2A 4PPZA 3MRUA 4NGRA 4ZYQA 3JRUA 1Z2LA 4OC2A 1LFWA 5HXDA 2PJAA 4UEFA 2IMOA 3BI0A 4R7MA 2AFZA 2AFMA 3D4UA 4MHZA 3PBBA 2AFSA 1Y7EA 2QVPA 4UIAA 4JZ0A 4X3RA 1Q7LA 3NH5A 5LRGA 4OC1A 5JGFA 3IJ3A 2GLFA 4NGNA 4P45A 2ANPA 2PJ9A 4IK2A 1RTQA 4OKOA 1BPMA 2PJ4A 2WZNA 1XJOA 4X2TA 5LYFA 2V8DA 1VHEA 3WC6A 2ZEFA 3SJGA 2IJZA 4AXVA 3PFEA 4R8FA 4Q7AA 3GLJA 4NGTA 2PJ3A 1YSJA 3L2NA 2OOTA 4BD9A 2POKA 3VARA 3WC7A 4CPAA 1CPXA 4UIBA 3FEDA 2PJCA 2ZOFA 2AFOA 3NFZA 5I4MA 3WT4A 4P4IA 1LAMA 2QJ8A 3SJFA 4MRIA 1Z5RA 2BOAA 4ZX9A 1CBXA 4MXUA 2EK9A 4OIWA 3ISZA 1FT7A 4EFDA 3D68A 3PB7X 5HVGA 2G9DA 4MMOA 4NGPA 4F9VA 3CDXA 3KASA 2AFWA 1EE3P 2CTCA 4R6TA 3FECA 5LYDA 3RZAA 2BCOA 3LWUA 3FX6A 3KHZA 4OP4A 2Q43A 3KQZA 3SI2A 5HVHA 2PRQA 4IHMA 2NSMA 2V8HA 3FEEA 1R43A 4PQAA 1XFOA 1F2PA 2ZELA 4NJRA 1Z8LA 5THWA 3DLJA 3CT9A 3B3SA 1TKHA 5DS0A 3KHXA 3B3TA 2ZENA 1TF8A 1ZLIA 2QYVA 1UWYA 2C6CA 3KQXA 2PJBA 4MCRA 3IO1A 1YW4A 5F09A 4A94A 2PJ7A 3PB9X 3D7FA 4PXEA 3PB4X 2OR4A 4MCQA 3IFEA 3I1UA 3H8EA 3PB8X 3V38A 2AFUA 1Y0RA 3PEIA 2ZEEA 4NGMA 3D7HA 1IGBA 3IC1A 3CPXA 4P4EA 1VGYA 4ZY2A 5IB9A 2XEIA 4YWYA 2GREA 3MN8A 4P4JA 1DE4C 8CPAA 2IQ6A 4F8ZA 4EWTA 4MCPA 4P44A 3CPAA 4DUKA 2C6PA 2PIZA 1ARMA 3FVLA 4P4FA 3TC8A 2I3CA 4X8IA 2PJ6A 3NA6A 4FAIA 2F7VA 4GM5A 3B2YA 4G1PA 2Q51A 3RAMA 2VL1A 3GB0A 4OC3A 3FF3A 1OBRA 2ZEHA 3H8GA 3K2KA 4P10A 1YMEA 2C1CA 3S9NA 3PFOA 3RBUA 3B3WA 1NSAA 5D8NA 3D66A 4PXDA 5K8PA 1F2OA 1VIXA 4UEEA 1LANA 3HLPA 2ZEPA 5J1QA 3NH4A 4TNUA 1TKJA 3HUVA 4IAVA 5CPAA 4OIDA 2CTBA 1CG2A 2ZEDA 3SI1A 1VHOA 3B3VA 4PXCA 1XBUA 5LYIA 1CX8A 4RUHA 6CPAA 4ONWA 2V77A 3S9LA 4WJBA 1TF9A 3BXMA 4FWUA 5JM6A 2GLJA 1FNOA 4NJQA 1QQ9A 4P4BA 1BAVA 4MHNA 3D67A 3B3CA 7CPAA 3IEHA 2ZEMA 1CPSA 1PYTB 1TKFA 2PJ2A 2ABZA 2ZEOA 1ELMP 3H8FA 4H2KA 3V7ZA 3FJUA 2XEGA 3QNVA 3D7DA 2RFHA 2EWBA 5K8OA 4OMEA 2XEJA 3DGVA 4B6ZA 2ZOGA 5ELYA 3T8WA 1XRYA 1JQGA 1ZG8A 4PXBA 2C6GA 3KR5A 2V8VA 2V8GA 2EK8A 1HDUA 2F8HA 4NGQA 4ZY1A 4LQGA 4MHYA 4KSIA 1TXRA 3LMSA
chains in the Genus database with same CATH superfamily
4RVFA 3G4SZ 1YJNZ 1Q2DA 3Q87A 5LRJA 3EEDA 1GYTA 1Y9KA 5K8MA 1ON0A 4OC0A 3TOBA 3I07A 4UCNA 4A38A 4EMEA 4UA3A 2REFA 4DYOA 4YU9A 4OC4A 3S6GA 1S60A 2FSRA 1F57A 3CXQA 3FXTA 4II9A 3GUXA 1VKCA 3VMHA 4FUUA 1CP7A 2YGWA 5EMIA 2J9AA 3TO7A 2ZW4A 1K4JA 4NSQA 3F0AA 1Q16A 2QIRA 4QUSA 3NH8A 2RIQA 2HB6A 4A3FI 5A28A 1X3WA 3RO0A 4UCMA 3ZJ0A 4E30A 3S2HI 2JEWA 5AGEA 2W04A 2GE3A 1SIWA 2FVGA 3F3FC 1PCAA 2G3AA 1ELLP 1CM0A 3GIUA 1Q2YA 4K3NA 1KC81 4W9YA 4R76A 2PJ0A 4PK3A 4CGOA 3VTNA 4S1TA 3N5FA 1MJAA 2Q7SA 2YNEA 1Z9UA 2DEAA 1YJN1 2R1IA 3KZWA 2CIJA 3C26A 5CM2M 1K8A1 4KOSA 4Y7NI 4FBEA 4NBFA 2PJ1A 1TIQA 2PE3A 3FMCA 4NCZA 2B4DB 4NFRA 3PRTA 1XMBA 1AMPA 3HOXI 2Y0MA 2NVTI 3MRUA 4NGRA 3JRUA 2VZZA 4OC2A 1P9NA 2PR8A 3S2DI 2PK7A 3G6EZ 4KORA 2G2KA 2PJAA 4UEFA 2P6FA 2AFZA 3D4UA 1FY7A 2JA8I 2QVPA 3R9EA 4UIAA 3CC71 4JLYA 3S15I 4X3RA 5C4XI 5C88A 4CGLA 5LRGA 1Z8XA 2QA4Z 2ANPA 1WZNA 2PJ9A 4OKOA 1BPMA 2PJ4A 2WUUA 2P6GA 4CRZB 3MONA 2V8DA 1VHEA 3WC6A 2K3RA 1VQO1 5FVJA 4Q7AA 2F4MA 3F5BA 3FB3A 3GLJA 3CD6Z 4QTTA 1YSJA 2POKA 2OU2A 4A31A 2JDDA 2OH1A 3FEDA 1Q861 2VUGA 2AFOA 3PO3I 5I4MA 2HF1A 2Z11A 1LAMA 2VPWA 4UFXA 2BOAA 2QLVB 4A3MI 1VQ61 3D2MA 4OIWA 3FBUA 3G711 4QC6A 3I4NI 1GHEA 4EFDA 1S7FA 1I3QI 4QB9A 1Q862 5CNPA 3QB8A 2G9DA 4MMOA 4UWIA 5EBVA 2AFWA 4YFJA 1VQOZ 4RS4A 3J81b 1EE3P 3JTKA 5G1ZA 4Q38A 4E2WA 2DE7A 3FECA 4BMHA 2BCOA 2QRCB 3K9UA 3FX6A 1P4NA 4U9YA 2Y0SA 4BINA 2RHBA 2BEIA 4PQAA 1YLEA 1IU8A 1Q822 1Q821 4MY0A 4NJRA 1Z8LA 3WR7A 1ZB8A 5THWA 1RLYA 3CT9A 4NXYA 1TF8A 1UWYA 5ISVA 3KQXA 4R57A 2IV2X 1J4JA 4UCPA 1XOVA 2Z3NA 2PMZA 4A30A 3PB4X 3CCEZ 5FLXb 1Z8WA 3KKWA 3V38A 3D7HA 3J81f 4C68A 3SHPA 1QVFY 1VQ6Z 1S3ZA 1JWHC 1DE4C 1V0CA 2IQ6A 1ZH1A 4F8ZA 5JPHA 2E2HI 2QKDA 3CPAA 3ZZIA 1ARMA 4P4FA 1VQNZ 2B58A 4E2XA 2I3CA 4X8IA 3HOWI 3GKRA 3QWUA 4E31A 5G20A 2R7HA 5BWAB 2F7VA 1KD11 2YU9I 5D1OA 2BJOA 3FF3A 4P10A 2GANA 4CAXA 1Y9WA 2OOYB 4H6ZA 1Q7Y1 1PU9A 2GTHA 1KUYA 3PFOA 1NSAA 4C2XA 5D8NA 4PXDA 2J8RA 3G6E1 3CCR1 4UEEA 1RQFA 1LANA 3HLPA 5J1QA 3CCSZ 3BJ8A 1TKJA 3FQQA 2VXKA 2OZUA 2QMLA 4IF5A 3RZOI 1RXTA 1RO2A 2VI7A 2JS4A 2CTBA 2Z3PA 3SI1A 3B3VA 2KI7B 2F5IA 6CPAA 3T9YA 5JM6A 4CAWA 4MFPA 3V8IA 3PO2I 3D6WA 7CPAA 5KTAA 4QVTA 1PYTB 4AB7A 2PJ2A 3S6FA 1ELMP 3GTOI 1VHSA 3H8FA 2BL1A 4B14A 3V7ZA 2FT0A 4MFQA 4L8AA 2FE7A 1JJ2Z 4E2AA 2Z3KA 5ELYA 1QXFA 4RVGA 1JQGA 1ZG8A 3CPWZ 4PXBA 1S7NA 1Q812 2V8VA 4ONUA 4MBUA 2H85A 4FD7A 5J8FA 3CQZI 1OZPA 4E2YA 1Y1VI 3VWEA 5IP7I 4UWJA 2FXFA 1XE4A 3LMSA 1R9TI 3JAMb 3J80b 4KVXA 3QAHA 2D4OA 2JR6A 1S7LA 1M4DA 1TWCI 2ZEGA 4KLVA 1P0HA 2VPXA 4A95A 3NDJA 3KI9A 2VPZA 4CAEA 4CYOA 2Q4ZA 5LRKA 4OADA 2H5MA 1VQM1 1DTDA 4ZI6A 1YW6A 1KWMA 2V3VA 4F9UA 3WC5A 3TE5B 3VATA 2JDCA 3CXCY 2ODFA 4A39A 2JBJA 1LCPA 1KC82 2PIYA 3IR7A 5AG4A 2M6NA 4C2YA 4UFWA 3IWWA 3T4NB 2WYRA 2Z10A 1WW9A 1RO0A 4WWVA 1XMTA 1Y0YA 2QA41 4E8OA 4ORFA 1AYEA 4ZX8A 4KUAA 5I0CA 2RB7A 2O53A 5T6BA 4NBEA 1VQK1 3CC41 4RN7A 1Y7RA 2JBKA 2GTIA 2JLMA 1Z01A 3I55Z 3PBEA 3S6KA 2FS5A 1K731 2R6MA 4PSXA 4JXRA 2QEXZ 4NBGA 1M44A 4ZBGA 2YNCC 1ZG7A 3VH9A 5AG6A 4KVOE 1IICA 4KOYA 2GU2A 4PPZA 2PQ8A 4ZYQA 3A9LA 1LFWA 4CGMA 4DGLA 3BLNA 4NB9A 3BI0A 4R7MA 1M1K1 2JUBA 2AFSA 3CC2Z 3EERA 5IX3A 4M6HA 2VBQA 3TOAA 3IJ3A 4IUSA 3F3PC 2Q44A 4NGNA 1Q811 4P45A 2LIYA 1XJOA 5LYFA 2PR1A 4CL1A 5F47A 4U9ZA 2BUEA 4E0AA 3LACA 2JMOA 2B4DA 1QSTA 3PFEA 1M4IA 4KOTA 2Z0ZA 4KSFA 4NGTA 3S1RI 1YR0A 2OOTA 3GTGI 3VARA 4UIBA 2VQYA 2PJCA 3IWGA 1TWAI 3WT4A 3CCUZ 4C7IA 3SJFA 4MRIA 4CGNA 1CBXA 4E33A 2Q04A 1VQ8Z 1VQMZ 2EK9A 2PM9A 4NBBA 2RBLA 4CYQA 2J8MA 4MD9A 4FD4A 1XIXA 2CNSA 5HVGA 4JXQA 4PV6A 3R9FA 4NGPA 2HUZA 3TO9A 2K5TA 1KZFA 1FDOA 3CCE1 2DF5A 4R6TA 3RZAA 3LWUA 2LFUA 3SXOA 3SI2A 3RZDI 2Q0YA 4FD6A 2OTJZ 2PRQA 4JJXA 1NUIA 4IHMA 2NSMA 4HPSA 2QR1B 5D1PA 4KSAA 1XFOA 2HV2A 3DLJA 5DS0A 2QREB 2QYVA 1DL6A 1YI21 4MCRA 1VQ9Z 1L0CA 2DXQA 3EO4A 4B5PB 4A94A 3PB9X 5T67A 4MD8A 1Z4RA 4PXEA 4XPLA 4LX9A 2QEX1 2ZW7A 1IYLA 3KIFA 4RVHA 2VUMI 3F8KA 3I1UA 4NGMA 4BBSI 3IC1A 3CCS1 1N71A 4ZY2A 5IB9A 2AJ6A 2XEIA 2AE6A 5A2Qb 2K5RA 2GREA 4DNCA 4P4JA 3OW2Y 5IT9b 1QSMA 4EWTA 3FYNA 4DUKA 4CS0B 2C6PA 1YUKA 1WIIA 3FVLA 4EWCA 1N8R1 5LL6f 3CD61 4GXHA 1NJI2 2FIAA 4FAIA 4B13A 3CCQ1 3CCM1 4G1PA 2X7BA 1SFOI 3GB0A 3H4QA 2JNYA 1ZO0A 2RPRA 2PSWA 4KS9A 4QTUA 2HQYA 3S9NA 3CCV1 3S1NI 4J3GA 4QBJA 1S721 5K8PA 2JEVA 4F6AA 3VB9A 3D9XA 1YVKA 4MFZA 1K9M1 2ZEDA 4HGYA 3GTMS 1B87A 1CX8A 4RUHA 3D2LA 3S9LA 4WJBA 3BXMA 4CAFA 1QQ9A 2F4OA 3B3CA 1ZB9A 1CPSA 1S5KA 1TWGI 3RYOA 4HNXB 4YRHA 2XEGA 2EUIA 1K8A2 4BY7I 5HH1A 3DR8A 3M4OI 2WAQA 3S17I 3MGDA 2XEJA 1X0TA 2ZOGA 2JA7I 1L1OC 3T8WA 4PK2A 3B8GA 3KR5A 3TFYA 2V8GA 1M901 2P6EA 1YREA 4C2ZA 5DWMA 4MD7A 4ZY1A 2V45A 3LODA 2E2JI 1TXRA 1Y1VS 4KOWA 2R98A 2WPXA 3CMA1 4JYWA 2M48A 2B3VA 5IT9f 3TE4A 4MFLA 4XPDC 2JA5I 4R9MA 3WABA 5KTDA 2PJ5A 1XF8A 4I49A 3I9SA 3TO6A 1YIT1 5T64A 1LOKA 4ZY0A 4NBDA 3CC4Z 3IGRA 2BO9A 1KD12 5KTCA 3GTQI 1HEEA 2V8IA 3CCVZ 1VQ81 3W6XA 4BBRI 3PZJA 4MY3A 3CXPA 3OWCA 2Q4VA 4DQYB 2R92I 4MHPA 4UEZA 5LYLA 2NYQA 1QVFZ 3GTKI 4AG9A 1IIDA 4UF4A 3IIBA 1R3NA 2RT9A 1ARLA 1VQN1 3D2PA 3KGQA 3SI0A 1BLLE 2V8KA 3BI1A 3DSBA 3FH4A 2ZPAA 2PJ8A 2BSWA 3S14I 2Z3OA 3D7GA 3PB6X 1YIJ1 4A3JI 1TWHI 1YK3A 4MONA 4AYBA 1VQPZ 4Z65A 4MCSA 1Y8CA 1QVGY 4UBRA 3B7IA 2YNDA 4MFKA 1IOIA 1FDIA 4DJLA 2VF1A 2I00A 4RI1A 3GTLI 1B6BA 4F0YA 1VQ51 4A37A 2HC9A 4NBHA 4CYPA 5CBMA 2PC1A 5C4JI 1QVGZ 3FNCA 3PBBA 3K7AI 3TTHA 1IOFA 2RC4A 3R1KA 2I79A 4KVME 1Q7LA 3NH5A 4E32A 3TT2A 2JA6I 4A3GI 4NBAA 2KCWA 4IK2A 1RTQA 1I6HI 2ZEFA 5C3EI 3M3YI 3SXNA 3P2HA 1QSRA 3CCQZ 2DE6A 2PJ3A 3L2NA 1K9M2 4BD9A 3WC7A 2AKLA 2ZOFA 4B12A 3FQMA 3NFZA 2ATRA 3G71Z 2OOXB 2JIPA 4MXUA 1Z8TA 1S72Z 1KUXA 3ISZA 1FT7A 3CCU1 1M1K2 4A3KI 3JVNA 3D68A 3CXCZ 4HKFA 4M3SA 5HMNA 4F9VA 1Z4EA 2ZAEB 4A3CI 1R57A 4B5PA 3KASA 1QSOA 2VEZA 5F48A 2B5GA 2CTCA 5G22A 5LYDA 3NDIA 3KHZA 3DNSA 1WJ2A 3R95A 1YI2Z 2QRDB 4AVCA 1QYPA 2P0WA 3NE7A 3E0KA 4C7HA 4R87A 2JIQA 4U5YA 4CAVA 2ZELA 4A3BI 2E9HA 4HGZA 4KLWA 3KHXA 3P2FA 4GS4A 2ZENA 3PO3S 2CY2A 1WCMI 2PJBA 3IO1A 1YW4A 4MFJA 2IZ4A 1X10A 4BBHA 2OR4A 3IFEA 2OZGA 4XNHB 5C82A 2D4PA 2VZYA 3H8EA 3PB8X 2REEA 4XX2A 3EC4A 1YJWZ 1LRZA 3PEIA 4MH4A 3MZKB 2ZEEA 5C44I 1IGBA 3H0GI 4E2ZA 2CNMA 3PGPA 4P4EA 1PFTA 3EY5A 1YIJZ 1Z02A 3CCLZ 1X12A 1MJ9A 3D3SA 2Z3LA 3MN8A 8CPAA 4A3DI 4P44A 2R7ZI 4Y49C 1VQ7Z 3NE8A 4A93I 3W91A 4XPKA 3CZXA 3EFAA 3TC8A 3NA6A 4A3II 4GM5A 3QAYA 4L89A 3B2YA 4NOZA 2Q51A 4B5OA 5DWNA 2E2II 4MI4A 4DK1A 4NB8A 1YMEA 2WB1A 5IB0A 4KOVA 3CC21 1PUAA 2O28A 1IYKA 3UY5A 4UFVA 1IB1E 2DPTA 2EO8A 3CCJZ 2EGTA 4B10A 1I1DA 3G3SA 3IU1A 3NH4A 4TNUA 3HUVA 4IAVA 3P5JB 4A2ZA 5CPAA 3LD2A 1CG2A 1VHOA 2PDOA 4NBCA 4PXCA 5LYIA 3JAMf 3J80f 1YHQ1 2R93I 2J6AA 4ONWA 1JWQA 3W6SA 3H3VJ 1TFIA 2J8NA 2V77A 1TF9A 1ML8A 1NJI1 2GLJA 1FNOA 1K83I 1N8R2 4NF1A 1BAVA 3LUSA 4MHNA 3D67A 3IEHA 1W2BZ 3BG1B 2ZEMA 4A32A 1TKFA 5H84A 4ZGYB 2ABZA 2ZEOA 1VQ91 1QSNA 3VMGA 4H2KA 3FJUA 3QNVA 3D7DA 4A3EI 3KIHA 5K8OA 2B5GB 4OMEA 4M6GA 1I21A 1NSLA 5AG5A 3I3GA 2OTJ1 2IZ3A 2EK8A 2AYDA 2F8HA 4M6IA 1YX0A 4A33A 1MJBA 4LQGA 4M85A 4KSIA 4RVDA 2CXAA 2GFQA 1YUAA 1S7MA 3K9TA 3HKZA 1HDQA 5D1OB 3U50C 2PRBA 2VPYA 3ISXA 1Z03A 1H8LA 3GTPI 2GIVA 1M4LA 1LAPA 1VQ4Z 1VQKZ 1YVOA 1VQ41 1YQEA 1YITZ 1IY7A 4AG7A 1CJWA 3I4MI 5IV0A 1BPNA 2P28A 3HOZI 4K30A 3EXNA 4XNHC 2PVWA 3RNZA 3SJEA 3CMAZ 4YGOA 4TWEA 3KL9A 3S9MA 2W03A 4OC5A 3ESWA 4P6YA 5JH9A 3SJXA 4H89A 3CCMZ 1ZG9A 1YJ91 1NE9A 5E96A 1M902 4X5KA 1ZLHA 2XEFA 3CXSA 2PVVA 2CF4A 4AVBA 4NEXA 2A4NA 3H5ZA 5K8NA 4Y49B 3FKII 4NH1C 3KR4A 1QMUA 1CP6A 3BHXA 3TX8A 5HVFA 3S16I 4CYNA 3B35A 2EBJA 4P4DA 1YLOA 4NGSA 5GCNA 2PCUA 1USPA 2AFXA 2JIRA 1USPB 2O4HA 5D29A 1KRLA 3IX0A 1U6MA 1YHQZ 3G4S1 4O23A 1RO5A 3D8PA 4OAEA 2C27A 4AVAA 2OTL1 3GY9A 2ZXVA 3I551 2P3YA 1Z2LA 1KQSY 4MJ8A 5F49A 5HXDA 3IFUA 2IMOA 2AFMA 1LQLA 4MHZA 1I50I 3N7ZA 1Y7EA 1K732 4JZ0A 2JIOA 1VQLZ 4R3LA 1M1DA 4OC1A 1RO4A 2EVNA 5JGFA 4KOUA 2GLFA 4JWPA 1MK4A 2WZNA 4X2TA 3S1QI 4CGPA 2FL4A 5EC4A 4Q36A 3SJGA 2IJZA 2YNCA 2DPSA 3TCVA 1TWFI 4AXVA 2ZW5A 4R8FA 3FRMA 4LUAA 3DDDA 4XPDB 3CPWY 3MZLB 2G3TA 2OZHA 4CPAA 1CPXA 2NAPA 3HOVI 1VQ71 4P4IA 4PSWA 4BY1I 3CCJ1 2QJ8A 1KQSZ 5FLXf 1Z5RA 1S7KA 4LQ6A 4ZX9A 1QF8A 1XEBA 4R3KA 3GCFA 4RS2A 3CCL1 3CME1 3BG0B 3VWDA 3PB7X 2OZKA 2Q7BA 3CDXA 2NMTA 4BXXI 3PP9A 2R8VA 2V8JA 1YGHA 3I561 4OP4A 5J8CA 3GKQA 2Q43A 1BO4A 2NVXI 3KQZA 2NVQI 5HVHA 2V8HA 3HOYI 1VQL1 2Q4YA 3FEEA 3TDHB 1R43A 1F2PA 2JIMA 1JJ2Y 2E7ZA 2ARHA 3B3SA 1TKHA 2DE5A 3B3TA 1WWZA 2FCKA 1ZLIA 3S6HA 2C6CA 5F09A 4MHDA 4JD6A 2PJ7A 2B63I 3DR6A 3D7FA 3GTJI 1I12A 1YJW1 2WSAA 3IWEA 1X3ZA 4MCQA 4KOXA 3GTMI 4FD5A 5AN9F 2FIWA 2AFUA 1Y0RA 2G0BA 5A2Qf 3CPXA 5F46A 1VGYA 3IF8A 4B11A 2HU9A 1Q2CA 3CCRZ 4YWYA 2KPIA 4MCPA 2IL4A 2PIZA 3S1MI 3OW2Z 2QECA 2B3UA 1NMTA 2PJ6A 4RV9A 3RAMA 4OLLA 5IP9I 2VL1A 3HOUI 3T90A 4OC3A 2NVYI 1OBRA 2ZEHA 3H8GA 2B4BA 3K2KA 2LEXA 2C1CA 2WPWA 3CMEZ 5G21A 2CNTA 1W2BY 3IU2A 3RBUA 5JQ4A 3B3WA 4Y52I 3D66A 1M4GA 1F2OA 1VIXA 1KUVA 3R9GA 2ZEPA 1A2ZA 2OTLZ 4OIDA 1AUGA 1XBUA 4F0XA 1VLAA 4KUBA 1WK4A 4HNYB 1UFHA 5AG7A 4FWUA 2YADA 4NJQA 4P4BA 3R96A 3GYAA 3JUWA 4A3LI 1VQP1 1BOBA 3G8WA 3BJ7A 4X6AI 4HH4A 2OB0A 1RNIA 3CC7Z 1AA6A 2RFHA 2EWBA 3FIXA 2ZW6A 1Q7Y2 3DGVA 4B6ZA 1XRYA 5FLMI 1N2FA 2C6GA 5H86A 4KZTA 4H6UA 1NP6A 1HDUA 1SQHA 4HNWB 3I56Z 4CRYB 1YJ9Z 4EVYA 3J7A4 4NGQA 2Z3MA 4MHYA 1Y1WI 5A27A 1VQ5Z 3VMIA
chains in the Genus database with same CATH topology
3CMA1 4RVFA 3G4SZ 1R9TI 3JAMb 1S7MA 3J80b 4JYWA 2M48A 3K9TA 5IT9f 2JR6A 1YJNZ 3HKZA 1HDQA 5D1OB 3U50C 2JA5I 1TWCI 3Q87A 3ISXA 1Z03A 3EEDA 1GYTA 5LRJA 2ZEGA 3WABA 1H8LA 2PJ5A 3GTPI 5K8MA 3NDJA 3KI9A 1M4LA 1YIT1 5T64A 2Q4ZA 1LOKA 4ZY0A 4NBDA 5LRKA 3CC4Z 1LAPA 1VQ4Z 1KD12 2BO9A 1VQKZ 4OC0A 3GTQI 3I07A 1VQ41 4A38A 1VQM1 1HEEA 1DTDA 2V8IA 3CCVZ 4EMEA 1VQ81 4ZI6A 4DYOA 4YU9A 1YITZ 4BBRI 1IY7A 1YW6A 4OC4A 1KWMA 4F9UA 3WC5A 1F57A 3TE5B 3VATA 3I4MI 1BPNA 2P28A 4DQYB 3CXCY 2R92I 3HOZI 2PVWA 4MHPA 4A39A 2JBJA 3SJEA 1LCPA 3GUXA 1KC82 2PIYA 4UEZA 3CMAZ 4TWEA 3KL9A 3S9MA 5LYLA 2W03A 3VMHA 4FUUA 2NYQA 2M6NA 1CP7A 4OC5A 3ESWA 4P6YA 5JH9A 3SJXA 2J9AA 3CCMZ 1ZG9A 1QVFZ 3GTKI 1YJ91 3IWWA 3T4NB 4UF4A 3IIBA 1R3NA 2WYRA 2RT9A 1WW9A 1RO0A 1M902 1ARLA 4WWVA 1VQN1 1ZLHA 3NH8A 3KGQA 2RIQA 3SI0A 2XEFA 1BLLE 2V8KA 3BI1A 2HB6A 3FH4A 4A3FI 1Y0YA 1X3WA 2PVVA 2CF4A 4E30A 3S2HI 2JEWA 2PJ8A 2W04A 2QA41 3S14I 5K8NA 1AYEA 3FKII 4ZX8A 3D7GA 2FVGA 4NH1C 3F3FC 1PCAA 3KR4A 2RB7A 1QMUA 1CP6A 3BHXA 3TX8A 2O53A 3PB6X 1ELLP 5HVFA 3S16I 5T6BA 4NBEA 1VQK1 4K3NA 3B35A 1YIJ1 3CC41 1TWHI 4A3JI 1KC81 4P4DA 1YLOA 4MONA 4NGSA 4AYBA 4W9YA 4R76A 2PCUA 1VQPZ 2PJ0A 4Z65A 1USPA 2AFXA 4MCSA 3VTNA 2JBKA 4S1TA 1QVGY 2GTIA 3N5FA 1Z01A 1USPB 3I55Z 2O4HA 3PBEA 3B7IA 5D29A 1KRLA 3IX0A 1YJN1 2DEAA 3KZWA 4DJLA 1K731 1YHQZ 3G4S1 2CIJA 2R6MA 4O23A 2VF1A 3GTLI 5CM2M 1K8A1 2QEXZ 4NBGA 4Y7NI 1VQ51 4FBEA 4A37A 2HC9A 4NBFA 2PJ1A 4NBHA 1ZG7A 3VH9A 5CBMA 2PE3A 3FMCA 2OTL1 4NFRA 3PRTA 3I551 1AMPA 1XMBA 3HOXI 2GU2A 4PPZA 2NVTI 3MRUA 4NGRA 2P3YA 5C4JI 1QVGZ 3JRUA 1Z2LA 4ZYQA 4OC2A 1P9NA 3S2DI 2PK7A 1LFWA 3G6EZ 1KQSY 4DGLA 2G2KA 2PJAA 5HXDA 4UEFA 3IFUA 2IMOA 4NB9A 3BI0A 4R7MA 1M1K1 2JUBA 2AFMA 1LQLA 2AFZA 3D4UA 4MHZA 1I50I 3K7AI 3PBBA 2AFSA 3CC2Z 3EERA 2JA8I 1Y7EA 1K732 2QVPA 4UIAA 3CC71 4JZ0A 3S15I 4X3RA 5C4XI 1VQLZ 1Q7LA 3NH5A 4E32A 2JA6I 4A3GI 5LRGA 4OC1A 1RO4A 2QA4Z 5JGFA 3IJ3A 4NBAA 2GLFA 3F3PC 4NGNA 1Q811 4P45A 2ANPA 2PJ9A 4IK2A 1RTQA 4OKOA 1BPMA 2PJ4A 2WZNA 2LIYA 1XJOA 4X2TA 5LYFA 4CL1A 3MONA 3S1QI 2V8DA 1I6HI 1VHEA 3WC6A 2ZEFA 5C3EI 3M3YI 3SJGA 2IJZA 2JMOA 2K3RA 1TWFI 4AXVA 1VQO1 3CCQZ 3PFEA 4R8FA 4Q7AA 2F4MA 3GLJA 4NGTA 3CD6Z 4QTTA 3S1RI 2DE6A 2PJ3A 1YSJA 3L2NA 3CPWY 1K9M2 2OOTA 4BD9A 3MZLB 2POKA 3GTGI 3VARA 3WC7A 4CPAA 1CPXA 2AKLA 3FEDA 4UIBA 1Q861 2PJCA 2VUGA 2ZOFA 2AFOA 3HOVI 3PO3I 1TWAI 3FQMA 2HF1A 3NFZA 1VQ71 4P4IA 3CCUZ 1LAMA 3G71Z 3WT4A 4BY1I 3CCJ1 2QJ8A 1KQSZ 2OOXB 4MRIA 5FLXf 3SJFA 5I4MA 1Z5RA 2BOAA 4ZX9A 2QLVB 1CBXA 4E33A 1QF8A 4A3MI 1VQ61 1VQ8Z 1VQMZ 4MXUA 2EK9A 2PM9A 4OIWA 4NBBA 3GCFA 1S72Z 3CCL1 3G711 1FT7A 2RBLA 3CCU1 1M1K2 3ISZA 4A3KI 4MD9A 3CME1 3BG0B 3I4NI 4EFDA 1I3QI 3D68A 1Q862 3PB7X 5HVGA 2OZKA 2G9DA 3CXCZ 4MMOA 4NGPA 4F9VA 2ZAEB 4A3CI 3CDXA 3KASA 2AFWA 1VQOZ 4RS4A 3J81b 4BXXI 1EE3P 3CCE1 2CTCA 4E2WA 2DE7A 4R6TA 3FECA 5LYDA 3RZAA 2V8JA 2BCOA 3LWUA 2QRCB 2LFUA 3NDIA 3FX6A 3KHZA 3I561 4OP4A 3GKQA 2Q43A 2NVXI 3KQZA 3SI2A 2NVQI 3RZDI 5HVHA 2OTJZ 2PRQA 2Y0SA 1YI2Z 2QRDB 1QYPA 1NUIA 4IHMA 2NSMA 3HOYI 2RHBA 2V8HA 2QR1B 5D1PA 1VQL1 3FEEA 3TDHB 1R43A 4PQAA 1XFOA 1F2PA 1Q822 1Q821 1JJ2Y 2ZELA 4NJRA 1Z8LA 4A3BI 1ZB8A 5THWA 1RLYA 2E9HA 3DLJA 4HGZA 3CT9A 2QREB 1TKHA 3B3SA 2DE5A 5DS0A 3KHXA 3B3TA 2ZENA 3PO3S 1TF8A 1ZLIA 2QYVA 1UWYA 1DL6A 2C6CA 1YI21 1WCMI 3KQXA 2PJBA 1VQ9Z 3IO1A 4MCRA 1YW4A 5F09A 2IZ4A 4A94A 2PJ7A 2B63I 3PB9X 3D7FA 5T67A 2PMZA 4MD8A 3GTJI 4PXEA 1YJW1 3PB4X 1X3ZA 2OR4A 4MCQA 3CCEZ 5FLXb 2QEX1 3IFEA 3KIFA 3GTMI 4RVHA 2VUMI 3I1UA 3H8EA 3PB8X 3V38A 4XX2A 5AN9F 1YJWZ 2AFUA 1Y0RA 3PEIA 4MH4A 3MZKB 2ZEEA 4NGMA 3D7HA 5C44I 4BBSI 1IGBA 3H0GI 4E2ZA 5A2Qf 3IC1A 3CPXA 3CCS1 4P4EA 1VGYA 1PFTA 4ZY2A 3J81f 5IB9A 1YIJZ 1Z02A 2XEIA 3CCLZ 3IF8A 2HU9A 4YWYA 5A2Qb 2K5RA 3CCRZ 1QVFY 1VQ6Z 2GREA 3MN8A 1JWHC 2KPIA 3OW2Y 1DE4C 4P4JA 5IT9b 8CPAA 2IQ6A 1ZH1A 4F8ZA 4A3DI 4EWTA 2E2HI 4MCPA 4P44A 2R7ZI 1VQ7Z 2QKDA 3CPAA 4DUKA 2C6PA 2PIZA 4A93I 1ARMA 1YUKA 3S1MI 1WIIA 3OW2Z 3FVLA 4P4FA 4EWCA 1VQNZ 3TC8A 1N8R1 4E2XA 2I3CA 5LL6f 3CD61 4X8IA 2PJ6A 1NJI2 3HOWI 3NA6A 4A3II 4FAIA 3CCQ1 3QWUA 4E31A 2F7VA 3CCM1 4GM5A 1KD11 3B2YA 4RV9A 4NOZA 4G1PA 2Q51A 3RAMA 5IP9I 2YU9I 1SFOI 2VL1A 5D1OA 3GB0A 3HOUI 4OC3A 2E2II 2BJOA 2NVYI 2JNYA 1OBRA 2ZEHA 3FF3A 3H8GA 3K2KA 4P10A 2RPRA 4DK1A 4NB8A 1YMEA 2WB1A 4QTUA 2C1CA 3CMEZ 3S9NA 2OOYB 1Q7Y1 3CCV1 3S1NI 2GTHA 1S721 1W2BY 3CC21 3PFOA 3RBUA 3B3WA 4Y52I 1NSAA 5D8NA 3D66A 4PXDA 5K8PA 1F2OA 1VIXA 3G6E1 3CCR1 4UEEA 1RQFA 1LANA 3CCJZ 3HLPA 2ZEPA 2EGTA 3VB9A 5J1QA 3D9XA 3NH4A 4TNUA 3CCSZ 1TKJA 3FQQA 3HUVA 2OTLZ 4IAVA 3P5JB 5CPAA 3RZOI 4OIDA 1RO2A 1K9M1 2JS4A 2CTBA 1CG2A 2ZEDA 3SI1A 4HGYA 3GTMS 1VHOA 3B3VA 4NBCA 4PXCA 1XBUA 5LYIA 3JAMf 3J80f 2KI7B 1YHQ1 2R93I 1CX8A 4RUHA 2J6AA 4ONWA 1VLAA 2V77A 3H3VJ 1TFIA 6CPAA 3S9LA 4WJBA 1TF9A 1ML8A 1NJI1 3BXMA 4FWUA 5JM6A 2YADA 2GLJA 1FNOA 4NJQA 1QQ9A 1K83I 1N8R2 4P4BA 3PO2I 1BAVA 3LUSA 3D6WA 2F4OA 4A3LI 3B3CA 3D67A 4MHNA 7CPAA 3IEHA 1W2BZ 3BG1B 1ZB9A 1VQP1 1CPSA 2ZEMA 1PYTB 1TKFA 2PJ2A 2ABZA 4X6AI 2ZEOA 1ELMP 3GTOI 1VQ91 3H8FA 1TWGI 3VMGA 4H2KA 3V7ZA 4HH4A 3FJUA 2XEGA 3QNVA 3D7DA 1K8A2 4BY7I 4A3EI 1RNIA 3KIHA 3M4OI 3CC7Z 2RFHA 2EWBA 5K8OA 1JJ2Z 2WAQA 4OMEA 3S17I 2XEJA 1Q7Y2 1X0TA 2ZOGA 3DGVA 5ELYA 4B6ZA 2JA7I 1L1OC 4RVGA 1XRYA 3T8WA 1JQGA 1ZG8A 3CPWZ 5FLMI 1N2FA 4PXBA 2C6GA 3KR5A 1Q812 2V8VA 2V8GA 1M901 2OTJ1 2IZ3A 2EK8A 1NP6A 1HDUA 2F8HA 2H85A 3CQZI 3I56Z 1YJ9Z 4E2YA 3J7A4 4NGQA 4MD7A 4ZY1A 4LQGA 1Y1VI 4MHYA 4KSIA 2E2JI 4RVDA 5IP7I 1Y1WI 1TXRA 1VQ5Z 1Y1VS 3VMIA 1YUAA 3LMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYW A;  3K9T A;  1HDQ A;  3ISX A;  5LRJ A;  1GYT A;  3WAB A;  2ZEG A;  1H8L A;  2PJ5 A;  5K8M A;  3KI9 A;  1M4L A;  2Q4Z A;  1LOK A;  4ZY0 A;  5LRK A;  1LAP A;  2BO9 A;  4OC0 A;  4A38 A;  1HEE A;  1DTD A;  4EME A;  4ZI6 A;  4DYO A;  4YU9 A;  1IY7 A;  1YW6 A;  4OC4 A;  1KWM A;  4F9U A;  3WC5 A;  1F57 A;  3VAT A;  1BPN A;  2PVW A;  4MHP A;  4A39 A;  2JBJ A;  3SJE A;  1LCP A;  3GUX A;  2PIY A;  4UEZ A;  4TWE A;  3KL9 A;  3S9M A;  5LYL A;  4FUU A;  4OC5 A;  2NYQ A;  1CP7 A;  4P6Y A;  5JH9 A;  3SJX A;  2J9A A;  1ZG9 A;  3IWW A;  4UF4 A;  3IIB A;  1R3N A;  2WYR A;  1ARL A;  4WWV A;  1ZLH A;  3NH8 A;  3KGQ A;  3SI0 A;  2XEF A;  1BLL E;  3BI1 A;  2HB6 A;  3FH4 A;  1Y0Y A;  2PVV A;  2CF4 A;  2JEW A;  2PJ8 A;  5K8N A;  1AYE A;  4ZX8 A;  3D7G A;  2FVG A;  1PCA A;  3KR4 A;  2RB7 A;  1QMU A;  1CP6 A;  3BHX A;  3TX8 A;  2O53 A;  3PB6 X;  1ELL P;  5HVF A;  4K3N A;  3B35 A;  4P4D A;  1YLO A;  4NGS A;  4W9Y A;  4R76 A;  2PCU A;  2PJ0 A;  4Z65 A;  2AFX A;  4MCS A;  2JBK A;  3N5F A;  3PBE A;  2O4H A;  3B7I A;  5D29 A;  2DEA A;  3KZW A;  4DJL A;  2CIJ A;  4O23 A;  4FBE A;  4A37 A;  2HC9 A;  2PJ1 A;  1ZG7 A;  3VH9 A;  5CBM A;  2PE3 A;  3FMC A;  4NFR A;  3PRT A;  1XMB A;  1AMP A;  2GU2 A;  4PPZ A;  3MRU A;  4NGR A;  4ZYQ A;  3JRU A;  1Z2L A;  4OC2 A;  1LFW A;  5HXD A;  2PJA A;  4UEF A;  2IMO A;  3BI0 A;  4R7M A;  2AFZ A;  2AFM A;  3D4U A;  4MHZ A;  3PBB A;  2AFS A;  1Y7E A;  2QVP A;  4UIA A;  4JZ0 A;  4X3R A;  1Q7L A;  3NH5 A;  5LRG A;  4OC1 A;  5JGF A;  3IJ3 A;  2GLF A;  4NGN A;  4P45 A;  2ANP A;  2PJ9 A;  4IK2 A;  1RTQ A;  4OKO A;  1BPM A;  2PJ4 A;  2WZN A;  1XJO A;  4X2T A;  5LYF A;  2V8D A;  1VHE A;  3WC6 A;  2ZEF A;  3SJG A;  2IJZ A;  4AXV A;  3PFE A;  4R8F A;  4Q7A A;  3GLJ A;  4NGT A;  2PJ3 A;  1YSJ A;  3L2N A;  2OOT A;  4BD9 A;  2POK A;  3VAR A;  3WC7 A;  4CPA A;  1CPX A;  4UIB A;  3FED A;  2PJC A;  2ZOF A;  2AFO A;  3NFZ A;  5I4M A;  3WT4 A;  4P4I A;  1LAM A;  2QJ8 A;  3SJF A;  4MRI A;  1Z5R A;  2BOA A;  4ZX9 A;  1CBX A;  4MXU A;  2EK9 A;  4OIW A;  3ISZ A;  1FT7 A;  4EFD A;  3D68 A;  3PB7 X;  5HVG A;  2G9D A;  4MMO A;  4NGP A;  4F9V A;  3CDX A;  3KAS A;  2AFW A;  1EE3 P;  2CTC A;  4R6T A;  3FEC A;  5LYD A;  3RZA A;  2BCO A;  3LWU A;  3FX6 A;  3KHZ A;  4OP4 A;  2Q43 A;  3KQZ A;  3SI2 A;  5HVH A;  2PRQ A;  4IHM A;  2NSM A;  2V8H A;  3FEE A;  1R43 A;  4PQA A;  1XFO A;  1F2P A;  2ZEL A;  4NJR A;  1Z8L A;  5THW A;  3DLJ A;  3CT9 A;  3B3S A;  1TKH A;  5DS0 A;  3KHX A;  3B3T A;  2ZEN A;  1TF8 A;  1ZLI A;  2QYV A;  1UWY A;  2C6C A;  3KQX A;  2PJB A;  4MCR A;  3IO1 A;  1YW4 A;  5F09 A;  4A94 A;  2PJ7 A;  3PB9 X;  3D7F A;  4PXE A;  3PB4 X;  2OR4 A;  4MCQ A;  3IFE A;  3I1U A;  3H8E A;  3PB8 X;  3V38 A;  2AFU A;  1Y0R A;  3PEI A;  2ZEE A;  4NGM A;  3D7H A;  1IGB A;  3IC1 A;  3CPX A;  4P4E A;  1VGY A;  4ZY2 A;  5IB9 A;  2XEI A;  4YWY A;  2GRE A;  3MN8 A;  4P4J A;  1DE4 C;  8CPA A;  2IQ6 A;  4F8Z A;  4EWT A;  4MCP A;  4P44 A;  3CPA A;  4DUK A;  2C6P A;  2PIZ A;  1ARM A;  3FVL A;  4P4F A;  3TC8 A;  2I3C A;  4X8I A;  2PJ6 A;  3NA6 A;  4FAI A;  2F7V A;  4GM5 A;  3B2Y A;  4G1P A;  2Q51 A;  3RAM A;  2VL1 A;  3GB0 A;  4OC3 A;  3FF3 A;  1OBR A;  2ZEH A;  3H8G A;  3K2K A;  4P10 A;  1YME A;  2C1C A;  3S9N A;  3PFO A;  3RBU A;  3B3W A;  1NSA A;  5D8N A;  3D66 A;  4PXD A;  5K8P A;  1F2O A;  1VIX A;  4UEE A;  1LAN A;  3HLP A;  2ZEP A;  5J1Q A;  3NH4 A;  4TNU A;  1TKJ A;  3HUV A;  4IAV A;  5CPA A;  4OID A;  2CTB A;  1CG2 A;  2ZED A;  3SI1 A;  1VHO A;  3B3V A;  4PXC A;  1XBU A;  5LYI A;  1CX8 A;  4RUH A;  6CPA A;  4ONW A;  2V77 A;  3S9L A;  4WJB A;  1TF9 A;  3BXM A;  4FWU A;  5JM6 A;  2GLJ A;  1FNO A;  4NJQ A;  1QQ9 A;  4P4B A;  1BAV A;  4MHN A;  3D67 A;  3B3C A;  7CPA A;  3IEH A;  2ZEM A;  1CPS A;  1PYT B;  1TKF A;  2PJ2 A;  2ABZ A;  2ZEO A;  1ELM P;  3H8F A;  4H2K A;  3V7Z A;  3FJU A;  2XEG A;  3QNV A;  3D7D A;  2RFH A;  2EWB A;  5K8O A;  4OME A;  2XEJ A;  3DGV A;  4B6Z A;  2ZOG A;  5ELY A;  3T8W A;  1XRY A;  1JQG A;  1ZG8 A;  4PXB A;  2C6G A;  3KR5 A;  2V8V A;  2V8G A;  2EK8 A;  1HDU A;  2F8H A;  4NGQ A;  4ZY1 A;  4LQG A;  4MHY A;  4KSI A;  1TXR A;  3LMS A; 
#chains in the Genus database with same CATH topology
 4RVF A;  3G4S Z;  1YJN Z;  1Q2D A;  3Q87 A;  5LRJ A;  3EED A;  1GYT A;  1Y9K A;  5K8M A;  1ON0 A;  4OC0 A;  3TOB A;  3I07 A;  4UCN A;  4A38 A;  4EME A;  4UA3 A;  2REF A;  4DYO A;  4YU9 A;  4OC4 A;  3S6G A;  1S60 A;  2FSR A;  1F57 A;  3CXQ A;  3FXT A;  4II9 A;  3GUX A;  1VKC A;  3VMH A;  4FUU A;  1CP7 A;  2YGW A;  5EMI A;  2J9A A;  3TO7 A;  2ZW4 A;  1K4J A;  4NSQ A;  3F0A A;  1Q16 A;  2QIR A;  4QUS A;  3NH8 A;  2RIQ A;  2HB6 A;  4A3F I;  5A28 A;  1X3W A;  3RO0 A;  4UCM A;  3ZJ0 A;  4E30 A;  3S2H I;  2JEW A;  5AGE A;  2W04 A;  2GE3 A;  1SIW A;  2FVG A;  3F3F C;  1PCA A;  2G3A A;  1ELL P;  1CM0 A;  3GIU A;  1Q2Y A;  4K3N A;  1KC8 1;  4W9Y A;  4R76 A;  2PJ0 A;  4PK3 A;  4CGO A;  3VTN A;  4S1T A;  3N5F A;  1MJA A;  2Q7S A;  2YNE A;  1Z9U A;  2DEA A;  1YJN 1;  2R1I A;  3KZW A;  2CIJ A;  3C26 A;  5CM2 M;  1K8A 1;  4KOS A;  4Y7N I;  4FBE A;  4NBF A;  2PJ1 A;  1TIQ A;  2PE3 A;  3FMC A;  4NCZ A;  2B4D B;  4NFR A;  3PRT A;  1XMB A;  1AMP A;  3HOX I;  2Y0M A;  2NVT I;  3MRU A;  4NGR A;  3JRU A;  2VZZ A;  4OC2 A;  1P9N A;  2PR8 A;  3S2D I;  2PK7 A;  3G6E Z;  4KOR A;  2G2K A;  2PJA A;  4UEF A;  2P6F A;  2AFZ A;  3D4U A;  1FY7 A;  2JA8 I;  2QVP A;  3R9E A;  4UIA A;  3CC7 1;  4JLY A;  3S15 I;  4X3R A;  5C4X I;  5C88 A;  4CGL A;  5LRG A;  1Z8X A;  2QA4 Z;  2ANP A;  1WZN A;  2PJ9 A;  4OKO A;  1BPM A;  2PJ4 A;  2WUU A;  2P6G A;  4CRZ B;  3MON A;  2V8D A;  1VHE A;  3WC6 A;  2K3R A;  1VQO 1;  5FVJ A;  4Q7A A;  2F4M A;  3F5B A;  3FB3 A;  3GLJ A;  3CD6 Z;  4QTT A;  1YSJ A;  2POK A;  2OU2 A;  4A31 A;  2JDD A;  2OH1 A;  3FED A;  1Q86 1;  2VUG A;  2AFO A;  3PO3 I;  5I4M A;  2HF1 A;  2Z11 A;  1LAM A;  2VPW A;  4UFX A;  2BOA A;  2QLV B;  4A3M I;  1VQ6 1;  3D2M A;  4OIW A;  3FBU A;  3G71 1;  4QC6 A;  3I4N I;  1GHE A;  4EFD A;  1S7F A;  1I3Q I;  4QB9 A;  1Q86 2;  5CNP A;  3QB8 A;  2G9D A;  4MMO A;  4UWI A;  5EBV A;  2AFW A;  4YFJ A;  1VQO Z;  4RS4 A;  3J81 b;  1EE3 P;  3JTK A;  5G1Z A;  4Q38 A;  4E2W A;  2DE7 A;  3FEC A;  4BMH A;  2BCO A;  2QRC B;  3K9U A;  3FX6 A;  1P4N A;  4U9Y A;  2Y0S A;  4BIN A;  2RHB A;  2BEI A;  4PQA A;  1YLE A;  1IU8 A;  1Q82 2;  1Q82 1;  4MY0 A;  4NJR A;  1Z8L A;  3WR7 A;  1ZB8 A;  5THW A;  1RLY A;  3CT9 A;  4NXY A;  1TF8 A;  1UWY A;  5ISV A;  3KQX A;  4R57 A;  2IV2 X;  1J4J A;  4UCP A;  1XOV A;  2Z3N A;  2PMZ A;  4A30 A;  3PB4 X;  3CCE Z;  5FLX b;  1Z8W A;  3KKW A;  3V38 A;  3D7H A;  3J81 f;  4C68 A;  3SHP A;  1QVF Y;  1VQ6 Z;  1S3Z A;  1JWH C;  1DE4 C;  1V0C A;  2IQ6 A;  1ZH1 A;  4F8Z A;  5JPH A;  2E2H I;  2QKD A;  3CPA A;  3ZZI A;  1ARM A;  4P4F A;  1VQN Z;  2B58 A;  4E2X A;  2I3C A;  4X8I A;  3HOW I;  3GKR A;  3QWU A;  4E31 A;  5G20 A;  2R7H A;  5BWA B;  2F7V A;  1KD1 1;  2YU9 I;  5D1O A;  2BJO A;  3FF3 A;  4P10 A;  2GAN A;  4CAX A;  1Y9W A;  2OOY B;  4H6Z A;  1Q7Y 1;  1PU9 A;  2GTH A;  1KUY A;  3PFO A;  1NSA A;  4C2X A;  5D8N A;  4PXD A;  2J8R A;  3G6E 1;  3CCR 1;  4UEE A;  1RQF A;  1LAN A;  3HLP A;  5J1Q A;  3CCS Z;  3BJ8 A;  1TKJ A;  3FQQ A;  2VXK A;  2OZU A;  2QML A;  4IF5 A;  3RZO I;  1RXT A;  1RO2 A;  2VI7 A;  2JS4 A;  2CTB A;  2Z3P A;  3SI1 A;  3B3V A;  2KI7 B;  2F5I A;  6CPA A;  3T9Y A;  5JM6 A;  4CAW A;  4MFP A;  3V8I A;  3PO2 I;  3D6W A;  7CPA A;  5KTA A;  4QVT A;  1PYT B;  4AB7 A;  2PJ2 A;  3S6F A;  1ELM P;  3GTO I;  1VHS A;  3H8F A;  2BL1 A;  4B14 A;  3V7Z A;  2FT0 A;  4MFQ A;  4L8A A;  2FE7 A;  1JJ2 Z;  4E2A A;  2Z3K A;  5ELY A;  1QXF A;  4RVG A;  1JQG A;  1ZG8 A;  3CPW Z;  4PXB A;  1S7N A;  1Q81 2;  2V8V A;  4ONU A;  4MBU A;  2H85 A;  4FD7 A;  5J8F A;  3CQZ I;  1OZP A;  4E2Y A;  1Y1V I;  3VWE A;  5IP7 I;  4UWJ A;  2FXF A;  1XE4 A;  3LMS A;  1R9T I;  3JAM b;  3J80 b;  4KVX A;  3QAH A;  2D4O A;  2JR6 A;  1S7L A;  1M4D A;  1TWC I;  2ZEG A;  4KLV A;  1P0H A;  2VPX A;  4A95 A;  3NDJ A;  3KI9 A;  2VPZ A;  4CAE A;  4CYO A;  2Q4Z A;  5LRK A;  4OAD A;  2H5M A;  1VQM 1;  1DTD A;  4ZI6 A;  1YW6 A;  1KWM A;  2V3V A;  4F9U A;  3WC5 A;  3TE5 B;  3VAT A;  2JDC A;  3CXC Y;  2ODF A;  4A39 A;  2JBJ A;  1LCP A;  1KC8 2;  2PIY A;  3IR7 A;  5AG4 A;  2M6N A;  4C2Y A;  4UFW A;  3IWW A;  3T4N B;  2WYR A;  2Z10 A;  1WW9 A;  1RO0 A;  4WWV A;  1XMT A;  1Y0Y A;  2QA4 1;  4E8O A;  4ORF A;  1AYE A;  4ZX8 A;  4KUA A;  5I0C A;  2RB7 A;  2O53 A;  5T6B A;  4NBE A;  1VQK 1;  3CC4 1;  4RN7 A;  1Y7R A;  2JBK A;  2GTI A;  2JLM A;  1Z01 A;  3I55 Z;  3PBE A;  3S6K A;  2FS5 A;  1K73 1;  2R6M A;  4PSX A;  4JXR A;  2QEX Z;  4NBG A;  1M44 A;  4ZBG A;  2YNC C;  1ZG7 A;  3VH9 A;  5AG6 A;  4KVO E;  1IIC A;  4KOY A;  2GU2 A;  4PPZ A;  2PQ8 A;  4ZYQ A;  3A9L A;  1LFW A;  4CGM A;  4DGL A;  3BLN A;  4NB9 A;  3BI0 A;  4R7M A;  1M1K 1;  2JUB A;  2AFS A;  3CC2 Z;  3EER A;  5IX3 A;  4M6H A;  2VBQ A;  3TOA A;  3IJ3 A;  4IUS A;  3F3P C;  2Q44 A;  4NGN A;  1Q81 1;  4P45 A;  2LIY A;  1XJO A;  5LYF A;  2PR1 A;  4CL1 A;  5F47 A;  4U9Z A;  2BUE A;  4E0A A;  3LAC A;  2JMO A;  2B4D A;  1QST A;  3PFE A;  1M4I A;  4KOT A;  2Z0Z A;  4KSF A;  4NGT A;  3S1R I;  1YR0 A;  2OOT A;  3GTG I;  3VAR A;  4UIB A;  2VQY A;  2PJC A;  3IWG A;  1TWA I;  3WT4 A;  3CCU Z;  4C7I A;  3SJF A;  4MRI A;  4CGN A;  1CBX A;  4E33 A;  2Q04 A;  1VQ8 Z;  1VQM Z;  2EK9 A;  2PM9 A;  4NBB A;  2RBL A;  4CYQ A;  2J8M A;  4MD9 A;  4FD4 A;  1XIX A;  2CNS A;  5HVG A;  4JXQ A;  4PV6 A;  3R9F A;  4NGP A;  2HUZ A;  3TO9 A;  2K5T A;  1KZF A;  1FDO A;  3CCE 1;  2DF5 A;  4R6T A;  3RZA A;  3LWU A;  2LFU A;  3SXO A;  3SI2 A;  3RZD I;  2Q0Y A;  4FD6 A;  2OTJ Z;  2PRQ A;  4JJX A;  1NUI A;  4IHM A;  2NSM A;  4HPS A;  2QR1 B;  5D1P A;  4KSA A;  1XFO A;  2HV2 A;  3DLJ A;  5DS0 A;  2QRE B;  2QYV A;  1DL6 A;  1YI2 1;  4MCR A;  1VQ9 Z;  1L0C A;  2DXQ A;  3EO4 A;  4B5P B;  4A94 A;  3PB9 X;  5T67 A;  4MD8 A;  1Z4R A;  4PXE A;  4XPL A;  4LX9 A;  2QEX 1;  2ZW7 A;  1IYL A;  3KIF A;  4RVH A;  2VUM I;  3F8K A;  3I1U A;  4NGM A;  4BBS I;  3IC1 A;  3CCS 1;  1N71 A;  4ZY2 A;  5IB9 A;  2AJ6 A;  2XEI A;  2AE6 A;  5A2Q b;  2K5R A;  2GRE A;  4DNC A;  4P4J A;  3OW2 Y;  5IT9 b;  1QSM A;  4EWT A;  3FYN A;  4DUK A;  4CS0 B;  2C6P A;  1YUK A;  1WII A;  3FVL A;  4EWC A;  1N8R 1;  5LL6 f;  3CD6 1;  4GXH A;  1NJI 2;  2FIA A;  4FAI A;  4B13 A;  3CCQ 1;  3CCM 1;  4G1P A;  2X7B A;  1SFO I;  3GB0 A;  3H4Q A;  2JNY A;  1ZO0 A;  2RPR A;  2PSW A;  4KS9 A;  4QTU A;  2HQY A;  3S9N A;  3CCV 1;  3S1N I;  4J3G A;  4QBJ A;  1S72 1;  5K8P A;  2JEV A;  4F6A A;  3VB9 A;  3D9X A;  1YVK A;  4MFZ A;  1K9M 1;  2ZED A;  4HGY A;  3GTM S;  1B87 A;  1CX8 A;  4RUH A;  3D2L A;  3S9L A;  4WJB A;  3BXM A;  4CAF A;  1QQ9 A;  2F4O A;  3B3C A;  1ZB9 A;  1CPS A;  1S5K A;  1TWG I;  3RYO A;  4HNX B;  4YRH A;  2XEG A;  2EUI A;  1K8A 2;  4BY7 I;  5HH1 A;  3DR8 A;  3M4O I;  2WAQ A;  3S17 I;  3MGD A;  2XEJ A;  1X0T A;  2ZOG A;  2JA7 I;  1L1O C;  3T8W A;  4PK2 A;  3B8G A;  3KR5 A;  3TFY A;  2V8G A;  1M90 1;  2P6E A;  1YRE A;  4C2Z A;  5DWM A;  4MD7 A;  4ZY1 A;  2V45 A;  3LOD A;  2E2J I;  1TXR A;  1Y1V S;  4KOW A;  2R98 A;  2WPX A;  3CMA 1;  4JYW A;  2M48 A;  2B3V A;  5IT9 f;  3TE4 A;  4MFL A;  4XPD C;  2JA5 I;  4R9M A;  3WAB A;  5KTD A;  2PJ5 A;  1XF8 A;  4I49 A;  3I9S A;  3TO6 A;  1YIT 1;  5T64 A;  1LOK A;  4ZY0 A;  4NBD A;  3CC4 Z;  3IGR A;  2BO9 A;  1KD1 2;  5KTC A;  3GTQ I;  1HEE A;  2V8I A;  3CCV Z;  1VQ8 1;  3W6X A;  4BBR I;  3PZJ A;  4MY3 A;  3CXP A;  3OWC A;  2Q4V A;  4DQY B;  2R92 I;  4MHP A;  4UEZ A;  5LYL A;  2NYQ A;  1QVF Z;  3GTK I;  4AG9 A;  1IID A;  4UF4 A;  3IIB A;  1R3N A;  2RT9 A;  1ARL A;  1VQN 1;  3D2P A;  3KGQ A;  3SI0 A;  1BLL E;  2V8K A;  3BI1 A;  3DSB A;  3FH4 A;  2ZPA A;  2PJ8 A;  2BSW A;  3S14 I;  2Z3O A;  3D7G A;  3PB6 X;  1YIJ 1;  4A3J I;  1TWH I;  1YK3 A;  4MON A;  4AYB A;  1VQP Z;  4Z65 A;  4MCS A;  1Y8C A;  1QVG Y;  4UBR A;  3B7I A;  2YND A;  4MFK A;  1IOI A;  1FDI A;  4DJL A;  2VF1 A;  2I00 A;  4RI1 A;  3GTL I;  1B6B A;  4F0Y A;  1VQ5 1;  4A37 A;  2HC9 A;  4NBH A;  4CYP A;  5CBM A;  2PC1 A;  5C4J I;  1QVG Z;  3FNC A;  3PBB A;  3K7A I;  3TTH A;  1IOF A;  2RC4 A;  3R1K A;  2I79 A;  4KVM E;  1Q7L A;  3NH5 A;  4E32 A;  3TT2 A;  2JA6 I;  4A3G I;  4NBA A;  2KCW A;  4IK2 A;  1RTQ A;  1I6H I;  2ZEF A;  5C3E I;  3M3Y I;  3SXN A;  3P2H A;  1QSR A;  3CCQ Z;  2DE6 A;  2PJ3 A;  3L2N A;  1K9M 2;  4BD9 A;  3WC7 A;  2AKL A;  2ZOF A;  4B12 A;  3FQM A;  3NFZ A;  2ATR A;  3G71 Z;  2OOX B;  2JIP A;  4MXU A;  1Z8T A;  1S72 Z;  1KUX A;  3ISZ A;  1FT7 A;  3CCU 1;  1M1K 2;  4A3K I;  3JVN A;  3D68 A;  3CXC Z;  4HKF A;  4M3S A;  5HMN A;  4F9V A;  1Z4E A;  2ZAE B;  4A3C I;  1R57 A;  4B5P A;  3KAS A;  1QSO A;  2VEZ A;  5F48 A;  2B5G A;  2CTC A;  5G22 A;  5LYD A;  3NDI A;  3KHZ A;  3DNS A;  1WJ2 A;  3R95 A;  1YI2 Z;  2QRD B;  4AVC A;  1QYP A;  2P0W A;  3NE7 A;  3E0K A;  4C7H A;  4R87 A;  2JIQ A;  4U5Y A;  4CAV A;  2ZEL A;  4A3B I;  2E9H A;  4HGZ A;  4KLW A;  3KHX A;  3P2F A;  4GS4 A;  2ZEN A;  3PO3 S;  2CY2 A;  1WCM I;  2PJB A;  3IO1 A;  1YW4 A;  4MFJ A;  2IZ4 A;  1X10 A;  4BBH A;  2OR4 A;  3IFE A;  2OZG A;  4XNH B;  5C82 A;  2D4P A;  2VZY A;  3H8E A;  3PB8 X;  2REE A;  4XX2 A;  3EC4 A;  1YJW Z;  1LRZ A;  3PEI A;  4MH4 A;  3MZK B;  2ZEE A;  5C44 I;  1IGB A;  3H0G I;  4E2Z A;  2CNM A;  3PGP A;  4P4E A;  1PFT A;  3EY5 A;  1YIJ Z;  1Z02 A;  3CCL Z;  1X12 A;  1MJ9 A;  3D3S A;  2Z3L A;  3MN8 A;  8CPA A;  4A3D I;  4P44 A;  2R7Z I;  4Y49 C;  1VQ7 Z;  3NE8 A;  4A93 I;  3W91 A;  4XPK A;  3CZX A;  3EFA A;  3TC8 A;  3NA6 A;  4A3I I;  4GM5 A;  3QAY A;  4L89 A;  3B2Y A;  4NOZ A;  2Q51 A;  4B5O A;  5DWN A;  2E2I I;  4MI4 A;  4DK1 A;  4NB8 A;  1YME A;  2WB1 A;  5IB0 A;  4KOV A;  3CC2 1;  1PUA A;  2O28 A;  1IYK A;  3UY5 A;  4UFV A;  1IB1 E;  2DPT A;  2EO8 A;  3CCJ Z;  2EGT A;  4B10 A;  1I1D A;  3G3S A;  3IU1 A;  3NH4 A;  4TNU A;  3HUV A;  4IAV A;  3P5J B;  4A2Z A;  5CPA A;  3LD2 A;  1CG2 A;  1VHO A;  2PDO A;  4NBC A;  4PXC A;  5LYI A;  3JAM f;  3J80 f;  1YHQ 1;  2R93 I;  2J6A A;  4ONW A;  1JWQ A;  3W6S A;  3H3V J;  1TFI A;  2J8N A;  2V77 A;  1TF9 A;  1ML8 A;  1NJI 1;  2GLJ A;  1FNO A;  1K83 I;  1N8R 2;  4NF1 A;  1BAV A;  3LUS A;  4MHN A;  3D67 A;  3IEH A;  1W2B Z;  3BG1 B;  2ZEM A;  4A32 A;  1TKF A;  5H84 A;  4ZGY B;  2ABZ A;  2ZEO A;  1VQ9 1;  1QSN A;  3VMG A;  4H2K A;  3FJU A;  3QNV A;  3D7D A;  4A3E I;  3KIH A;  5K8O A;  2B5G B;  4OME A;  4M6G A;  1I21 A;  1NSL A;  5AG5 A;  3I3G A;  2OTJ 1;  2IZ3 A;  2EK8 A;  2AYD A;  2F8H A;  4M6I A;  1YX0 A;  4A33 A;  1MJB A;  4LQG A;  4M85 A;  4KSI A;  4RVD A;  2CXA A;  2GFQ A;  1YUA A;  1S7M A;  3K9T A;  3HKZ A;  1HDQ A;  5D1O B;  3U50 C;  2PRB A;  2VPY A;  3ISX A;  1Z03 A;  1H8L A;  3GTP I;  2GIV A;  1M4L A;  1LAP A;  1VQ4 Z;  1VQK Z;  1YVO A;  1VQ4 1;  1YQE A;  1YIT Z;  1IY7 A;  4AG7 A;  1CJW A;  3I4M I;  5IV0 A;  1BPN A;  2P28 A;  3HOZ I;  4K30 A;  3EXN A;  4XNH C;  2PVW A;  3RNZ A;  3SJE A;  3CMA Z;  4YGO A;  4TWE A;  3KL9 A;  3S9M A;  2W03 A;  4OC5 A;  3ESW A;  4P6Y A;  5JH9 A;  3SJX A;  4H89 A;  3CCM Z;  1ZG9 A;  1YJ9 1;  1NE9 A;  5E96 A;  1M90 2;  4X5K A;  1ZLH A;  2XEF A;  3CXS A;  2PVV A;  2CF4 A;  4AVB A;  4NEX A;  2A4N A;  3H5Z A;  5K8N A;  4Y49 B;  3FKI I;  4NH1 C;  3KR4 A;  1QMU A;  1CP6 A;  3BHX A;  3TX8 A;  5HVF A;  3S16 I;  4CYN A;  3B35 A;  2EBJ A;  4P4D A;  1YLO A;  4NGS A;  5GCN A;  2PCU A;  1USP A;  2AFX A;  2JIR A;  1USP B;  2O4H A;  5D29 A;  1KRL A;  3IX0 A;  1U6M A;  1YHQ Z;  3G4S 1;  4O23 A;  1RO5 A;  3D8P A;  4OAE A;  2C27 A;  4AVA A;  2OTL 1;  3GY9 A;  2ZXV A;  3I55 1;  2P3Y A;  1Z2L A;  1KQS Y;  4MJ8 A;  5F49 A;  5HXD A;  3IFU A;  2IMO A;  2AFM A;  1LQL A;  4MHZ A;  1I50 I;  3N7Z A;  1Y7E A;  1K73 2;  4JZ0 A;  2JIO A;  1VQL Z;  4R3L A;  1M1D A;  4OC1 A;  1RO4 A;  2EVN A;  5JGF A;  4KOU A;  2GLF A;  4JWP A;  1MK4 A;  2WZN A;  4X2T A;  3S1Q I;  4CGP A;  2FL4 A;  5EC4 A;  4Q36 A;  3SJG A;  2IJZ A;  2YNC A;  2DPS A;  3TCV A;  1TWF I;  4AXV A;  2ZW5 A;  4R8F A;  3FRM A;  4LUA A;  3DDD A;  4XPD B;  3CPW Y;  3MZL B;  2G3T A;  2OZH A;  4CPA A;  1CPX A;  2NAP A;  3HOV I;  1VQ7 1;  4P4I A;  4PSW A;  4BY1 I;  3CCJ 1;  2QJ8 A;  1KQS Z;  5FLX f;  1Z5R A;  1S7K A;  4LQ6 A;  4ZX9 A;  1QF8 A;  1XEB A;  4R3K A;  3GCF A;  4RS2 A;  3CCL 1;  3CME 1;  3BG0 B;  3VWD A;  3PB7 X;  2OZK A;  2Q7B A;  3CDX A;  2NMT A;  4BXX I;  3PP9 A;  2R8V A;  2V8J A;  1YGH A;  3I56 1;  4OP4 A;  5J8C A;  3GKQ A;  2Q43 A;  1BO4 A;  2NVX I;  3KQZ A;  2NVQ I;  5HVH A;  2V8H A;  3HOY I;  1VQL 1;  2Q4Y A;  3FEE A;  3TDH B;  1R43 A;  1F2P A;  2JIM A;  1JJ2 Y;  2E7Z A;  2ARH A;  3B3S A;  1TKH A;  2DE5 A;  3B3T A;  1WWZ A;  2FCK A;  1ZLI A;  3S6H A;  2C6C A;  5F09 A;  4MHD A;  4JD6 A;  2PJ7 A;  2B63 I;  3DR6 A;  3D7F A;  3GTJ I;  1I12 A;  1YJW 1;  2WSA A;  3IWE A;  1X3Z A;  4MCQ A;  4KOX A;  3GTM I;  4FD5 A;  5AN9 F;  2FIW A;  2AFU A;  1Y0R A;  2G0B A;  5A2Q f;  3CPX A;  5F46 A;  1VGY A;  3IF8 A;  4B11 A;  2HU9 A;  1Q2C A;  3CCR Z;  4YWY A;  2KPI A;  4MCP A;  2IL4 A;  2PIZ A;  3S1M I;  3OW2 Z;  2QEC A;  2B3U A;  1NMT A;  2PJ6 A;  4RV9 A;  3RAM A;  4OLL A;  5IP9 I;  2VL1 A;  3HOU I;  3T90 A;  4OC3 A;  2NVY I;  1OBR A;  2ZEH A;  3H8G A;  2B4B A;  3K2K A;  2LEX A;  2C1C A;  2WPW A;  3CME Z;  5G21 A;  2CNT A;  1W2B Y;  3IU2 A;  3RBU A;  5JQ4 A;  3B3W A;  4Y52 I;  3D66 A;  1M4G A;  1F2O A;  1VIX A;  1KUV A;  3R9G A;  2ZEP A;  1A2Z A;  2OTL Z;  4OID A;  1AUG A;  1XBU A;  4F0X A;  1VLA A;  4KUB A;  1WK4 A;  4HNY B;  1UFH A;  5AG7 A;  4FWU A;  2YAD A;  4NJQ A;  4P4B A;  3R96 A;  3GYA A;  3JUW A;  4A3L I;  1VQP 1;  1BOB A;  3G8W A;  3BJ7 A;  4X6A I;  4HH4 A;  2OB0 A;  1RNI A;  3CC7 Z;  1AA6 A;  2RFH A;  2EWB A;  3FIX A;  2ZW6 A;  1Q7Y 2;  3DGV A;  4B6Z A;  1XRY A;  5FLM I;  1N2F A;  2C6G A;  5H86 A;  4KZT A;  4H6U A;  1NP6 A;  1HDU A;  1SQH A;  4HNW B;  3I56 Z;  4CRY B;  1YJ9 Z;  4EVY A;  3J7A 4;  4NGQ A;  2Z3M A;  4MHY A;  1Y1W I;  5A27 A;  1VQ5 Z;  3VMI A; 
#chains in the Genus database with same CATH homology
 3CMA 1;  4RVF A;  3G4S Z;  1R9T I;  3JAM b;  1S7M A;  3J80 b;  4JYW A;  2M48 A;  3K9T A;  5IT9 f;  2JR6 A;  1YJN Z;  3HKZ A;  1HDQ A;  5D1O B;  3U50 C;  2JA5 I;  1TWC I;  3Q87 A;  3ISX A;  1Z03 A;  3EED A;  1GYT A;  5LRJ A;  2ZEG A;  3WAB A;  1H8L A;  2PJ5 A;  3GTP I;  5K8M A;  3NDJ A;  3KI9 A;  1M4L A;  1YIT 1;  5T64 A;  2Q4Z A;  1LOK A;  4ZY0 A;  4NBD A;  5LRK A;  3CC4 Z;  1LAP A;  1VQ4 Z;  1KD1 2;  2BO9 A;  1VQK Z;  4OC0 A;  3GTQ I;  3I07 A;  1VQ4 1;  4A38 A;  1VQM 1;  1HEE A;  1DTD A;  2V8I A;  3CCV Z;  4EME A;  1VQ8 1;  4ZI6 A;  4DYO A;  4YU9 A;  1YIT Z;  4BBR I;  1IY7 A;  1YW6 A;  4OC4 A;  1KWM A;  4F9U A;  3WC5 A;  1F57 A;  3TE5 B;  3VAT A;  3I4M I;  1BPN A;  2P28 A;  4DQY B;  3CXC Y;  2R92 I;  3HOZ I;  2PVW A;  4MHP A;  4A39 A;  2JBJ A;  3SJE A;  1LCP A;  3GUX A;  1KC8 2;  2PIY A;  4UEZ A;  3CMA Z;  4TWE A;  3KL9 A;  3S9M A;  5LYL A;  2W03 A;  3VMH A;  4FUU A;  2NYQ A;  2M6N A;  1CP7 A;  4OC5 A;  3ESW A;  4P6Y A;  5JH9 A;  3SJX A;  2J9A A;  3CCM Z;  1ZG9 A;  1QVF Z;  3GTK I;  1YJ9 1;  3IWW A;  3T4N B;  4UF4 A;  3IIB A;  1R3N A;  2WYR A;  2RT9 A;  1WW9 A;  1RO0 A;  1M90 2;  1ARL A;  4WWV A;  1VQN 1;  1ZLH A;  3NH8 A;  3KGQ A;  2RIQ A;  3SI0 A;  2XEF A;  1BLL E;  2V8K A;  3BI1 A;  2HB6 A;  3FH4 A;  4A3F I;  1Y0Y A;  1X3W A;  2PVV A;  2CF4 A;  4E30 A;  3S2H I;  2JEW A;  2PJ8 A;  2W04 A;  2QA4 1;  3S14 I;  5K8N A;  1AYE A;  3FKI I;  4ZX8 A;  3D7G A;  2FVG A;  4NH1 C;  3F3F C;  1PCA A;  3KR4 A;  2RB7 A;  1QMU A;  1CP6 A;  3BHX A;  3TX8 A;  2O53 A;  3PB6 X;  1ELL P;  5HVF A;  3S16 I;  5T6B A;  4NBE A;  1VQK 1;  4K3N A;  3B35 A;  1YIJ 1;  3CC4 1;  1TWH I;  4A3J I;  1KC8 1;  4P4D A;  1YLO A;  4MON A;  4NGS A;  4AYB A;  4W9Y A;  4R76 A;  2PCU A;  1VQP Z;  2PJ0 A;  4Z65 A;  1USP A;  2AFX A;  4MCS A;  3VTN A;  2JBK A;  4S1T A;  1QVG Y;  2GTI A;  3N5F A;  1Z01 A;  1USP B;  3I55 Z;  2O4H A;  3PBE A;  3B7I A;  5D29 A;  1KRL A;  3IX0 A;  1YJN 1;  2DEA A;  3KZW A;  4DJL A;  1K73 1;  1YHQ Z;  3G4S 1;  2CIJ A;  2R6M A;  4O23 A;  2VF1 A;  3GTL I;  5CM2 M;  1K8A 1;  2QEX Z;  4NBG A;  4Y7N I;  1VQ5 1;  4FBE A;  4A37 A;  2HC9 A;  4NBF A;  2PJ1 A;  4NBH A;  1ZG7 A;  3VH9 A;  5CBM A;  2PE3 A;  3FMC A;  2OTL 1;  4NFR A;  3PRT A;  3I55 1;  1AMP A;  1XMB A;  3HOX I;  2GU2 A;  4PPZ A;  2NVT I;  3MRU A;  4NGR A;  2P3Y A;  5C4J I;  1QVG Z;  3JRU A;  1Z2L A;  4ZYQ A;  4OC2 A;  1P9N A;  3S2D I;  2PK7 A;  1LFW A;  3G6E Z;  1KQS Y;  4DGL A;  2G2K A;  2PJA A;  5HXD A;  4UEF A;  3IFU A;  2IMO A;  4NB9 A;  3BI0 A;  4R7M A;  1M1K 1;  2JUB A;  2AFM A;  1LQL A;  2AFZ A;  3D4U A;  4MHZ A;  1I50 I;  3K7A I;  3PBB A;  2AFS A;  3CC2 Z;  3EER A;  2JA8 I;  1Y7E A;  1K73 2;  2QVP A;  4UIA A;  3CC7 1;  4JZ0 A;  3S15 I;  4X3R A;  5C4X I;  1VQL Z;  1Q7L A;  3NH5 A;  4E32 A;  2JA6 I;  4A3G I;  5LRG A;  4OC1 A;  1RO4 A;  2QA4 Z;  5JGF A;  3IJ3 A;  4NBA A;  2GLF A;  3F3P C;  4NGN A;  1Q81 1;  4P45 A;  2ANP A;  2PJ9 A;  4IK2 A;  1RTQ A;  4OKO A;  1BPM A;  2PJ4 A;  2WZN A;  2LIY A;  1XJO A;  4X2T A;  5LYF A;  4CL1 A;  3MON A;  3S1Q I;  2V8D A;  1I6H I;  1VHE A;  3WC6 A;  2ZEF A;  5C3E I;  3M3Y I;  3SJG A;  2IJZ A;  2JMO A;  2K3R A;  1TWF I;  4AXV A;  1VQO 1;  3CCQ Z;  3PFE A;  4R8F A;  4Q7A A;  2F4M A;  3GLJ A;  4NGT A;  3CD6 Z;  4QTT A;  3S1R I;  2DE6 A;  2PJ3 A;  1YSJ A;  3L2N A;  3CPW Y;  1K9M 2;  2OOT A;  4BD9 A;  3MZL B;  2POK A;  3GTG I;  3VAR A;  3WC7 A;  4CPA A;  1CPX A;  2AKL A;  3FED A;  4UIB A;  1Q86 1;  2PJC A;  2VUG A;  2ZOF A;  2AFO A;  3HOV I;  3PO3 I;  1TWA I;  3FQM A;  2HF1 A;  3NFZ A;  1VQ7 1;  4P4I A;  3CCU Z;  1LAM A;  3G71 Z;  3WT4 A;  4BY1 I;  3CCJ 1;  2QJ8 A;  1KQS Z;  2OOX B;  4MRI A;  5FLX f;  3SJF A;  5I4M A;  1Z5R A;  2BOA A;  4ZX9 A;  2QLV B;  1CBX A;  4E33 A;  1QF8 A;  4A3M I;  1VQ6 1;  1VQ8 Z;  1VQM Z;  4MXU A;  2EK9 A;  2PM9 A;  4OIW A;  4NBB A;  3GCF A;  1S72 Z;  3CCL 1;  3G71 1;  1FT7 A;  2RBL A;  3CCU 1;  1M1K 2;  3ISZ A;  4A3K I;  4MD9 A;  3CME 1;  3BG0 B;  3I4N I;  4EFD A;  1I3Q I;  3D68 A;  1Q86 2;  3PB7 X;  5HVG A;  2OZK A;  2G9D A;  3CXC Z;  4MMO A;  4NGP A;  4F9V A;  2ZAE B;  4A3C I;  3CDX A;  3KAS A;  2AFW A;  1VQO Z;  4RS4 A;  3J81 b;  4BXX I;  1EE3 P;  3CCE 1;  2CTC A;  4E2W A;  2DE7 A;  4R6T A;  3FEC A;  5LYD A;  3RZA A;  2V8J A;  2BCO A;  3LWU A;  2QRC B;  2LFU A;  3NDI A;  3FX6 A;  3KHZ A;  3I56 1;  4OP4 A;  3GKQ A;  2Q43 A;  2NVX I;  3KQZ A;  3SI2 A;  2NVQ I;  3RZD I;  5HVH A;  2OTJ Z;  2PRQ A;  2Y0S A;  1YI2 Z;  2QRD B;  1QYP A;  1NUI A;  4IHM A;  2NSM A;  3HOY I;  2RHB A;  2V8H A;  2QR1 B;  5D1P A;  1VQL 1;  3FEE A;  3TDH B;  1R43 A;  4PQA A;  1XFO A;  1F2P A;  1Q82 2;  1Q82 1;  1JJ2 Y;  2ZEL A;  4NJR A;  1Z8L A;  4A3B I;  1ZB8 A;  5THW A;  1RLY A;  2E9H A;  3DLJ A;  4HGZ A;  3CT9 A;  2QRE B;  1TKH A;  3B3S A;  2DE5 A;  5DS0 A;  3KHX A;  3B3T A;  2ZEN A;  3PO3 S;  1TF8 A;  1ZLI A;  2QYV A;  1UWY A;  1DL6 A;  2C6C A;  1YI2 1;  1WCM I;  3KQX A;  2PJB A;  1VQ9 Z;  3IO1 A;  4MCR A;  1YW4 A;  5F09 A;  2IZ4 A;  4A94 A;  2PJ7 A;  2B63 I;  3PB9 X;  3D7F A;  5T67 A;  2PMZ A;  4MD8 A;  3GTJ I;  4PXE A;  1YJW 1;  3PB4 X;  1X3Z A;  2OR4 A;  4MCQ A;  3CCE Z;  5FLX b;  2QEX 1;  3IFE A;  3KIF A;  3GTM I;  4RVH A;  2VUM I;  3I1U A;  3H8E A;  3PB8 X;  3V38 A;  4XX2 A;  5AN9 F;  1YJW Z;  2AFU A;  1Y0R A;  3PEI A;  4MH4 A;  3MZK B;  2ZEE A;  4NGM A;  3D7H A;  5C44 I;  4BBS I;  1IGB A;  3H0G I;  4E2Z A;  5A2Q f;  3IC1 A;  3CPX A;  3CCS 1;  4P4E A;  1VGY A;  1PFT A;  4ZY2 A;  3J81 f;  5IB9 A;  1YIJ Z;  1Z02 A;  2XEI A;  3CCL Z;  3IF8 A;  2HU9 A;  4YWY A;  5A2Q b;  2K5R A;  3CCR Z;  1QVF Y;  1VQ6 Z;  2GRE A;  3MN8 A;  1JWH C;  2KPI A;  3OW2 Y;  1DE4 C;  4P4J A;  5IT9 b;  8CPA A;  2IQ6 A;  1ZH1 A;  4F8Z A;  4A3D I;  4EWT A;  2E2H I;  4MCP A;  4P44 A;  2R7Z I;  1VQ7 Z;  2QKD A;  3CPA A;  4DUK A;  2C6P A;  2PIZ A;  4A93 I;  1ARM A;  1YUK A;  3S1M I;  1WII A;  3OW2 Z;  3FVL A;  4P4F A;  4EWC A;  1VQN Z;  3TC8 A;  1N8R 1;  4E2X A;  2I3C A;  5LL6 f;  3CD6 1;  4X8I A;  2PJ6 A;  1NJI 2;  3HOW I;  3NA6 A;  4A3I I;  4FAI A;  3CCQ 1;  3QWU A;  4E31 A;  2F7V A;  3CCM 1;  4GM5 A;  1KD1 1;  3B2Y A;  4RV9 A;  4NOZ A;  4G1P A;  2Q51 A;  3RAM A;  5IP9 I;  2YU9 I;  1SFO I;  2VL1 A;  5D1O A;  3GB0 A;  3HOU I;  4OC3 A;  2E2I I;  2BJO A;  2NVY I;  2JNY A;  1OBR A;  2ZEH A;  3FF3 A;  3H8G A;  3K2K A;  4P10 A;  2RPR A;  4DK1 A;  4NB8 A;  1YME A;  2WB1 A;  4QTU A;  2C1C A;  3CME Z;  3S9N A;  2OOY B;  1Q7Y 1;  3CCV 1;  3S1N I;  2GTH A;  1S72 1;  1W2B Y;  3CC2 1;  3PFO A;  3RBU A;  3B3W A;  4Y52 I;  1NSA A;  5D8N A;  3D66 A;  4PXD A;  5K8P A;  1F2O A;  1VIX A;  3G6E 1;  3CCR 1;  4UEE A;  1RQF A;  1LAN A;  3CCJ Z;  3HLP A;  2ZEP A;  2EGT A;  3VB9 A;  5J1Q A;  3D9X A;  3NH4 A;  4TNU A;  3CCS Z;  1TKJ A;  3FQQ A;  3HUV A;  2OTL Z;  4IAV A;  3P5J B;  5CPA A;  3RZO I;  4OID A;  1RO2 A;  1K9M 1;  2JS4 A;  2CTB A;  1CG2 A;  2ZED A;  3SI1 A;  4HGY A;  3GTM S;  1VHO A;  3B3V A;  4NBC A;  4PXC A;  1XBU A;  5LYI A;  3JAM f;  3J80 f;  2KI7 B;  1YHQ 1;  2R93 I;  1CX8 A;  4RUH A;  2J6A A;  4ONW A;  1VLA A;  2V77 A;  3H3V J;  1TFI A;  6CPA A;  3S9L A;  4WJB A;  1TF9 A;  1ML8 A;  1NJI 1;  3BXM A;  4FWU A;  5JM6 A;  2YAD A;  2GLJ A;  1FNO A;  4NJQ A;  1QQ9 A;  1K83 I;  1N8R 2;  4P4B A;  3PO2 I;  1BAV A;  3LUS A;  3D6W A;  2F4O A;  4A3L I;  3B3C A;  3D67 A;  4MHN A;  7CPA A;  3IEH A;  1W2B Z;  3BG1 B;  1ZB9 A;  1VQP 1;  1CPS A;  2ZEM A;  1PYT B;  1TKF A;  2PJ2 A;  2ABZ A;  4X6A I;  2ZEO A;  1ELM P;  3GTO I;  1VQ9 1;  3H8F A;  1TWG I;  3VMG A;  4H2K A;  3V7Z A;  4HH4 A;  3FJU A;  2XEG A;  3QNV A;  3D7D A;  1K8A 2;  4BY7 I;  4A3E I;  1RNI A;  3KIH A;  3M4O I;  3CC7 Z;  2RFH A;  2EWB A;  5K8O A;  1JJ2 Z;  2WAQ A;  4OME A;  3S17 I;  2XEJ A;  1Q7Y 2;  1X0T A;  2ZOG A;  3DGV A;  5ELY A;  4B6Z A;  2JA7 I;  1L1O C;  4RVG A;  1XRY A;  3T8W A;  1JQG A;  1ZG8 A;  3CPW Z;  5FLM I;  1N2F A;  4PXB A;  2C6G A;  3KR5 A;  1Q81 2;  2V8V A;  2V8G A;  1M90 1;  2OTJ 1;  2IZ3 A;  2EK8 A;  1NP6 A;  1HDU A;  2F8H A;  2H85 A;  3CQZ I;  3I56 Z;  1YJ9 Z;  4E2Y A;  3J7A 4;  4NGQ A;  4MD7 A;  4ZY1 A;  4LQG A;  1Y1V I;  4MHY A;  4KSI A;  2E2J I;  4RVD A;  5IP7 I;  1Y1W I;  1TXR A;  1VQ5 Z;  1Y1V S;  3VMI A;  1YUA A;  3LMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...