4TNUA

Human brain aspartoacylase mutant y231c complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
b'HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDCPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
molecule tags Hydrolase
source organism Homo sapiens
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4tnuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4tnuA01
3KHXA 2V77A 3GLJA 2PIZA 5IB9A 3K9TA 3FEDA 2JBJA 2PIYA 4H2KA 2AFMA 2JEWA 2Q51A 4OMEA 3FF3A 2PJ3A 2ZELA 5K8NA 4G1PA 1LANA 1IY7A 3FEEA 4DJLA 4NGNA 5I4MA 6CPAA 3S9MA 3D4UA 5LRGA 1RTQA 3BXMA 1ARMA 4ONWA 4OC1A 3B3VA 1ELMP 4NGQA 2F7VA 4P4DA 2Q4ZA 2V8GA 4KSIA 4MHYA 2XEJA 4F8ZA 3WC6A 4UEZA 2AFUA 1XMBA 2ZEHA 3IJ3A 4JYWA 2F8HA 3SI0A 5HVFA 4MRIA 2JBKA 3IO1A 2AFXA 3WC5A 3PB9X 2AFOA 5LYDA 3KI9A 4NGSA 4P4JA 4UEEA 5CBMA 3WC7A 3KL9A 3VARA 2XEGA 3PRTA 4Z65A 2WYRA 2ZOGA 4MCRA 1ZLIA 2ZEDA 3FVLA 4P4IA 2ABZA 1Z8LA 5LYLA 1PCAA 3KQXA 3KR5A 1UWYA 1EE3P 3B7IA 1YW6A 1XFOA 5LRKA 3ISXA 3B3TA 4F9VA 2QYVA 2O4HA 1YSJA 3CPAA 2OR4A 4W9YA 2ZENA 2PJCA 3TC8A 2PCUA 3S9LA 2PVVA 1TKJA 3RAMA 2O53A 4FAIA 1XJOA 1CBXA 4NGMA 3LWUA 2AFZA 4YU9A 3CDXA 3H8EA 3CPXA 1VHOA 5DS0A 4OC2A 1HDUA 2GLJA 1AYEA 4P4BA 1LCPA 1JQGA 3MRUA 2PE3A 3PBEA 4ZX8A 4B6ZA 4A39A 2G9DA 2CTBA 4OIDA 3TX8A 4FWUA 4NGTA 3H8FA 3HLPA 4R8FA 4NGPA 4PXEA 4P44A 4R76A 3D7HA 1Y0YA 1LFWA 4ZY0A 3NFZA 3FECA 3PFEA 2BOAA 3CT9A 4P4EA 2CF4A 2CTCA 2C6GA 4UF4A 1YW4A 5CPAA 3SJFA 3KR4A 4X2TA 4MCSA 4PPZA 4IK2A 1LAPA 4OC4A 3H8GA 1TXRA 4PXDA 3NH5A 4DUKA 4UIAA 4OC5A 4MMOA 4NJRA 3FJUA 4DYOA 4P4FA 4MCQA 5D8NA 5JGFA 2EWBA 4IHMA 1KWMA 2ZEFA 4A94A 5JH9A 1R3NA 4UIBA 2ZEEA 2PJ4A 4EFDA 3SI2A 1ELLP 3PEIA 4CPAA 1Q7LA 1Z2LA 1PYTB 2PJ6A 2J9AA 3L2NA 2PJ5A 2NSMA 3I1UA 3LMSA 2AFSA 4F9UA 3MN8A 3B35A 3V38A 3IC1A 2VL1A 3K2KA 3IEHA 3NH8A 1XRYA 3NH4A 3B3CA 5THWA 3B2YA 4MHZA 4OC0A 3JRUA 1TF9A 2EK8A 3PBBA 2IMOA 1QMUA 4NFRA 3FH4A 5K8PA 3KASA 4MCPA 2HB6A 2QJ8A 1LOKA 2DEAA 3D7DA 4Q7AA 1TKFA 4OIWA 3GB0A 3RZAA 1BPMA 1Z5RA 2POKA 5JM6A 5K8MA 2C6CA 4R7MA 4TWEA 3D7GA 1CPXA 3BI0A 1AMPA 3SI1A 1CPSA 2BO9A 1F2OA 2QVPA 1HDQA 3KZWA 1ZG9A 3GUXA 5LRJA 2V8HA 4X8IA 4AXVA 4BD9A 2CIJA 3B3WA 2XEIA 3KQZA 4PQAA 4IAVA 4P10A 2FVGA 3SJXA 3ISZA 1CX8A 3FX6A 1NSAA 2RB7A 1R43A 4MHNA 3DGVA 3FMCA 4MHPA 1BPNA 4K3NA 4A37A 1OBRA 2EK9A 5K8OA 4FBEA 1VGYA 3NA6A 3V7ZA 1F57A 5HVGA 1ARLA 3SJGA 1YLOA 3IFEA 3WT4A 3WABA 4A38A 5HXDA 2ZEMA 2PJ0A 3PB6X 4EMEA 1M4LA 4UEFA 3QNVA 4X3RA 4PXBA 4NJQA 3PB4X 4OKOA 1QQ9A 4ZY2A 5D29A 1Y7EA 5LYFA 1DTDA 1FT7A 2XEFA 1GYTA 3IWWA 2HC9A 5ELYA 2PJBA 4WWVA 2PJ8A 3BI1A 1VHEA 1BLLE 3B3SA 3PFOA 2V8VA 4FUUA 3VATA 1HEEA 2PJ1A 4YWYA 1BAVA 1ZLHA 3D68A 4R6TA 5LYIA 4ZX9A 5J1QA 4OP4A 4TNUA 1ZG8A 2I3CA 2PJ7A 1DE4C 1TF8A 2RFHA 2ZEPA 1FNOA 5F09A 5HVHA 4JZ0A 2Q43A 4GM5A 2ZEOA 1H8LA 2C6PA 3DLJA 3RBUA 2V8DA 4WJBA 2C1CA 2ANPA 4RUHA 1CP6A 3PB7X 4OC3A 3T8WA 2ZEGA 4EWTA 4P45A 3D67A 2PRQA 2OOTA 7CPAA 1Y0RA 3D66A 3KGQA 4P6YA 4MXUA 1VIXA 2GU2A 3PB8X 2IJZA 3S9NA 3SJEA 1XBUA 3IIBA 2AFWA 4ZI6A 2WZNA 4NGRA 3D7FA 2ZOFA 8CPAA 1LAMA 1CG2A 1YMEA 1ZG7A 2GLFA 2IQ6A 4ZY1A 2GREA 1TKHA 4ZYQA 3VH9A 2BCOA 3KHZA 2NYQA 4PXCA 4LQGA 1F2PA 1CP7A 2PJ2A 2PVWA 2PJAA 2PJ9A 3N5FA 4O23A 1IGBA 3HUVA 3BHXA
chains in the Genus database with same CATH superfamily
3KHXA 2V77A 5IB9A 3K9TA 4CGOA 5D1OB 4KLVA 3QWUA 3TCVA 2GTIA 4A3FI 2V8IA 2B5GA 2PJ3A 4Q38A 4G1PA 3PP9A 1IY7A 2QKDA 3GTMS 2ODFA 2WUUA 1RXTA 4NGNA 5KTCA 1RTQA 1ARMA 1YHQ1 1IYKA 3B3VA 4AG9A 5T67A 3D2LA 3VMGA 4ZGYB 4H6ZA 2IZ3A 4NGQA 2F7VA 2Q4ZA 1M4DA 2NVYI 5IV0A 5F46A 4UA3A 2JIQA 2V45A 3VTNA 1R57A 1VQN1 1VQNZ 4YGOA 4MRIA 5DWMA 4NBGA 1WJ2A 5FLXb 3CC71 2YNDA 3D6WA 1Z9UA 4CYQA 5AGEA 3WC7A 2P28A 3IF8A 1IU8A 2WYRA 3BJ8A 2JMOA 1P0HA 1S7MA 1UWYA 1RQFA 2JS4A 3B3TA 2QYVA 1K731 3CCQZ 2DPSA 3TC8A 2PCUA 3S9LA 2PVVA 1PFTA 3RAMA 4KUBA 1IOFA 2O53A 1XJOA 2VPYA 3GCFA 3CCM1 4NGMA 4A3KI 4RVFA 3I551 4JXRA 4UFXA 2FCKA 1AYEA 2CNTA 2Z3OA 3G4SZ 1LCPA 1JQGA 1Y7RA 1VHSA 4FD6A 5F49A 5F47A 1QSNA 4I49A 4OIDA 3M4OI 4DK1A 2EGTA 2HV2A 3H8FA 4NGTA 4PXEA 2OZHA 1X3WA 1LFWA 1XOVA 3GIUA 2CF4A 2F4OA 1YI21 1YW4A 3SJFA 4MCSA 4PPZA 4IK2A 1LAPA 4PXDA 4DUKA 4UIAA 4MMOA 4F6AA 1IOIA 1QYPA 2OZGA 4CYPA 4U9ZA 5D8NA 4A3EI 1QVGZ 4B5OA 2EWBA 4A94A 3F8KA 2LEXA 1KUXA 4ORFA 4UIBA 2PJ4A 1KD12 2K5RA 1PYTB 4B5PA 3BG1B 3LUSA 2PR8A 2AFSA 3GTKI 3RZDI 3FYNA 2K3RA 3D9XA 3I3GA 1Q7Y1 2BL1A 2ZPAA 4C2XA 1XRYA 1Q2CA 3NH4A 3B3CA 3H4QA 2Z10A 2WAQA 2EK8A 3JRUA 2IMOA 3PBBA 1QMUA 1YIJ1 2Q4VA 1Y1VI 3U50C 5K8PA 3GTGI 4UCPA 2ARHA 1S7NA 2HB6A 1N2FA 3IR7A 2F5IA 4AVBA 1N71A 4QTTA 4X6AI 4OADA 4KS9A 4OIWA 2B3VA 1BPMA 3CXCY 2R7HA 2Q4YA 3MGDA 5K8MA 4KSAA 3GTMI 2C6CA 2OTJZ 5EC4A 3SI1A 2BO9A 5IX3A 1F2OA 2JA6I 2QREB 2Y0MA 3J7A4 2EUIA 2BUEA 2HU9A 1YJ9Z 1KQSZ 4R9MA 5A27A 5H84A 4BD9A 5JPHA 1USPA 1W2BZ 4IAVA 1YK3A 1KC81 2Q7BA 4MFQA 3ISZA 1M44A 3EEDA 4MONA 1Z8TA 1Z8XA 4MHNA 4PK3A 4RVDA 4MHPA 1BPNA 4K3NA 3CCU1 2B3UA 4MH4A 2EK9A 5AG4A 3VWDA 1VQOZ 3I4MI 2JEVA 2JA8I 4IUSA 2Q44A 2BEIA 3MZLB 1RLYA 1GHEA 4XPDB 1YJW1 1YJNZ 3WT4A 2CY2A 2WSAA 3TT2A 1TWHI 3PB6X 3RYOA 2IZ4A 3QNVA 2OOXB 3PB4X 1Q861 4CYOA 5D29A 3K9UA 1DTDA 1FT7A 1YITZ 1GYTA 2HC9A 2PJBA 2JUBA 2PJ8A 5LL6f 3P2FA 2V8VA 2Z3PA 1HEEA 4Y52I 1B87A 4NBBA 4R6TA 5LYIA 1I21A 3H3VJ 4MHDA 3J80f 2P6GA 2OTJ1 4E2XA 4A95A 1VQPZ 3S6GA 1M1K2 5T6BA 1NMTA 3RBUA 4UWIA 4WJBA 3G71Z 3T8WA 2ZEGA 3D67A 3JUWA 2GTHA 4JXQA 2PRQA 3SHPA 4MXUA 3PB8X 1TFIA 1XE4A 2E2JI 4ZI6A 4KOYA 3EFAA 4NGRA 4XNHC 8CPAA 1LAMA 3WR7A 2GLFA 1K9M1 4X5KA 5G1ZA 2M6NA 2JDCA 2RBLA 1USPB 2QIRA 2YNCA 4FD5A 1CP7A 4A30A 2WPXA 2PJ9A 3N5FA 1M902 3BHXA 1J4JA 2R98A 3F5BA 3GLJA 4UFVA 5T64A 2B4DB 3FEDA 4QVTA 2JBJA 2PIYA 4H2KA 2OOYB 2FIWA 2AFMA 1ZO0A 2JEWA 2FS5A 1TWCI 1VQL1 4DJLA 4AVCA 6CPAA 1VQP1 3D4UA 5LRGA 2PQ8A 3EERA 3BXMA 1Q2DA 4ONWA 2E2HI 4PK2A 1K4JA 4ONUA 3CC7Z 3DR6A 2FT0A 4P4DA 2I00A 3OW2Z 4A3LI 4ZBGA 2H5MA 3TOAA 2QRCB 5CM2M 3CXCZ 3GKQA 5G22A 4C7IA 3UY5A 2OZUA 4YRHA 2ZAEB 2R92I 3Q87A 2JBKA 3J81b 1VQMZ 3NDJA 2K5TA 2NVQI 5C88A 2AFOA 1S72Z 2RIQA 3KI9A 5DWNA 1M1DA 1KUVA 4Z65A 2H85A 2ZEDA 4MFZA 3I07A 3FQQA 1Z8LA 5LYLA 1PCAA 3KQXA 5D1OA 3CCMZ 4A32A 2IV2X 3DSBA 3FQMA 3VMIA 1JJ2Z 1RO4A 2Z3LA 2PJCA 2NMTA 1QVFZ 4R57A 1K8A2 4FAIA 1RNIA 1PU9A 1I12A 1CBXA 4UCMA 1YREA 3M3YI 2AFZA 3MZKB 3CPXA 1VHOA 2NVXI 5DS0A 4OC2A 2GLJA 4XPKA 4P4BA 3MRUA 4Y49B 4ZX8A 3S17I 1Q16A 4A39A 3R96A 3HLPA 1NSLA 4J3GA 4NGPA 2W03A 4P44A 4R76A 1AA6A 2V3VA 4ZY0A 3GTLI 2KI7B 3LD2A 3T9YA 4NF1A 3HOUI 4X2TA 2Z11A 1VQ51 3CC41 3FJUA 4P4FA 1VQK1 3OW2Y 5JGFA 2ZXVA 1KWMA 1V0CA 1XIXA 2CNMA 3FIXA 1QSTA 4CL1A 5JH9A 1R3NA 1KUYA 1Z03A 3SI2A 2GIVA 4CPAA 1Z2LA 1VQ6Z 2J9AA 2PJ5A 3LMSA 3NE8A 2PR1A 3MN8A 2QEX1 3J81f 4F0YA 3IEHA 4KOXA 2RC4A 3B2YA 4HPSA 2DXQA 1QVFY 2OH1A 4A3BI 4KOWA 4BINA 3CC2Z 3CC21 2FL4A 3CPWY 3I56Z 2Q04A 4CAFA 3IWEA 1P4NA 4C68A 2CXAA 1VLAA 2FSRA 1QXFA 5JM6A 2POKA 4R7MA 4TWEA 3D7GA 1CPXA 3FRMA 4RI1A 4RVHA 1AMPA 1CPSA 3T4NB 5C4JI 3W6SA 3G4S1 2Y0SA 3H5ZA 1HDQA 3KZWA 3GUXA 3TOBA 1XEBA 3CZXA 4AXVA 1YJN1 4PQAA 3KQZA 3J80b 3QAYA 3CCSZ 4P10A 2FVGA 2JA5I 2CNSA 4CAWA 2RB7A 3FMCA 1OBRA 1Z4EA 5K8OA 3FBUA 2J6AA 1Y1WI 4NOZA 3V7ZA 1F57A 3SJGA 2DPTA 3WABA 1FDIA 1VQ8Z 2PJ0A 4EMEA 1M4LA 4XPDC 4A33A 2VXKA 4UEFA 5EMIA 5C4XI 4NJQA 1M901 1S3ZA 1Y9KA 3TE5B 1Y7EA 4R87A 4JLYA 4BXXI 4E32A 5GCNA 4WWVA 4A93I 1SFOI 1BLLE 3G6E1 3VATA 4YWYA 5CNPA 3VMHA 1BAVA 4NBFA 5EBVA 1MJBA 3S1RI 5J1QA 4OP4A 2R1IA 3N7ZA 2PJ7A 2RFHA 1FNOA 1YIT1 1TWFI 2ZEOA 2EVNA 4MBUA 1H8LA 3DLJA 2VZYA 1IICA 4MD8A 1CJWA 2C1CA 3GKRA 4RUHA 1W2BY 1CP6A 4E2WA 3PB7X 2Z3NA 4EWTA 1P9NA 4NXYA 3I4NI 3KGQA 4P6YA 3CD6Z 1VIXA 5AG5A 3S9NA 1OZPA 3SJEA 2GE3A 2WZNA 2WB1A 2JIRA 4QTUA 5AG7A 1CG2A 4E2AA 2QMLA 2I79A 2IQ6A 2GANA 4EVYA 4H89A 2VPZA 1YVKA 3R9GA 5FLXf 2NYQA 4PXCA 1WK4A 1X0TA 2PJ2A 4NBEA 4M3SA 3D2PA 1IIDA 1VQ7Z 3TDHB 1ZB9A 4MFJA 3RO0A 3GTQI 4XPLA 1Q2YA 3D2MA 2Z0ZA 1WZNA 2PMZA 1VQ9Z 4UWJA 3FF3A 2ZELA 3CME1 3FEEA 4FD7A 5I4MA 1X3ZA 3S15I 3TFYA 5J8FA 4RVGA 1I50I 4OC1A 4E31A 4MJ8A 1KC82 3CCL1 2V8GA 2B4BA 2PRBA 2JR6A 4KSIA 4MHYA 4BBSI 1LRZA 3HOYI 2XEJA 4F8ZA 4KLWA 2C27A 2P0WA 4NB9A 4II9A 4JYWA 4E33A 3V8IA 2F8HA 1KQSY 3OWCA 5HH1A 5HVFA 4Y7NI 1YHQZ 4C7HA 3PB9X 2VI7A 1S721 2QA4Z 4PV6A 3G6EZ 5LYDA 3DR8A 4NGSA 3KL9A 3VARA 4AVAA 3PRTA 3JVNA 2ZOGA 2ZW5A 3KIHA 1NJI1 3FVLA 3IX0A 4P4IA 5KTAA 3R9EA 2IL4A 1JWHC 1TIQA 1EE3P 3B7IA 3KR5A 4C2YA 2F4MA 4MD7A 1XFOA 3ISXA 4F9VA 2BSWA 2O4HA 1UFHA 1K8A1 4W9YA 3P2HA 3W6XA 1MK4A 2DE6A 1KD11 1U6MA 2VEZA 1DL6A 3GY9A 4BY1I 3DDDA 1RO2A 3CCV1 5G20A 3H8EA 1YUAA 4RV9A 1HDUA 4NBCA 4QBJA 5H86A 2AYDA 2PE3A 3TO9A 4MI4A 4XX2A 2Q0YA 5A2Qb 4B6ZA 3CCE1 4NBHA 3TX8A 4FWUA 4CAVA 2PM9A 2R93I 3P5JB 3CCLZ 4M6GA 1Q821 3EXNA 3G3SA 3NFZA 3CT9A 4KUAA 4P4EA 2CTCA 4BBRI 1X12A 2C6GA 5CPAA 2YGWA 5IP9I 3H8GA 3NH5A 4FD4A 4OC5A 1KRLA 4DYOA 2DE5A 4KSFA 2LIYA 5KTDA 4MCQA 2VUMI 2ZW7A 3LACA 4IHMA 2ZEFA 2VF1A 2HUZA 4EFDA 1ELLP 4R3LA 3CQZI 3QB8A 3EC4A 1S60A 3HKZA 2FE7A 4KOSA 4U9YA 4A3GI 1M4IA 3FB3A 2NSMA 3I1UA 1L1OC 2OTLZ 2BJOA 2V8KA 5AG6A 4HNWB 2P3YA 3B35A 3V38A 3IC1A 2VL1A 3FKII 3K2KA 4K30A 4KZTA 4JWPA 3KKWA 4BBHA 3LODA 5THWA 4MHZA 3NE7A 4OC0A 2RT9A 4DGLA 4MD9A 1TF9A 5G21A 1K732 3TO7A 3KASA 4AYBA 2P6EA 3ZJ0A 2PK7A 2RPRA 2QJ8A 1LOKA 3I561 1N8R1 2EBJA 1RO0A 2DEAA 2QEXZ 3D7DA 1TKFA 3F0AA 3CCR1 3RZAA 4H6UA 3T90A 1B6BA 2VUGA 1ZH1A 2G2KA 2V8JA 3R9FA 2B63I 3D3SA 4HH4A 2GFQA 2QVPA 1YJWZ 2ZW6A 1ZG9A 4E30A 1VKCA 4X8IA 2JA7I 2XEIA 4B12A 1NP6A 3K7AI 5IT9b 4L89A 3S16I 2YADA 2G0BA 1M1K1 3SJXA 3MONA 1WW9A 1NSAA 1WIIA 4R3KA 2PSWA 2M48A 4A37A 1X10A 2KPIA 1XMTA 2VZZA 3CCJ1 1QSMA 4NSQA 2R8VA 2NAPA 4FBEA 1VGYA 4AB7A 1YJ91 1VQM1 4M6HA 4JD6A 5HVGA 1VQ41 3S2HI 1YLOA 5HXDA 2HF1A 4X3RA 4KVXA 4OKOA 1TWGI 4A3JI 3EY5A 1QQ9A 4E2ZA 4ZY2A 2WPWA 4MY3A 4CGMA 1MJ9A 3IWWA 3HOWI 3PFOA 4FUUA 3CXPA 2DF5A 3H0GI 2PJ1A 4KVOE 1K9M2 2JIPA 1ZLHA 2X7BA 4MFPA 3G711 2VQYA 2ZW4A 1QVGY 1YVOA 2JIMA 2I3CA 2B58A 1DE4C 1TF8A 2ZEPA 3KIFA 1SQHA 5F09A 5HVHA 2Q43A 3I55Z 4GM5A 4B10A 3TE4A 4CGNA 3JTKA 1BO4A 2E9HA 4C2ZA 1VQKZ 3B8GA 4OLLA 1FY7A 1I1DA 2ANPA 5FLMI 4B13A 4OC3A 4BY7I 4P45A 4NCZA 1Y0RA 1Z01A 3D66A 1YX0A 4EWCA 3PO3S 2QECA 4RS4A 1XBUA 2AFWA 2VBQA 2W04A 4IF5A 5I0CA 3VWEA 1I3QI 3VB9A 3D7FA 1IYLA 2ZOFA 5A28A 5E96A 2G3AA 2NVTI 4KVME 1N8R2 4NBAA 3BJ7A 1ZG7A 3CCRZ 2AKLA 3VH9A 2BCOA 4A3MI 5IP7I 3IU1A 1L0CA 4O23A 1VQ71 3IU2A 1IGBA 3HUVA 4HGYA 2PIZA 1YR0A 2FXFA 3F3FC 2Q51A 3RZOI 3BLNA 4OMEA 5C44I 5K8NA 1LANA 2QRDB 3PGPA 3CCJZ 5HMNA 3S9MA 1ELMP 4A3DI 4BMHA 1Q811 2OU2A 3CCS1 2QR1B 1I6HI 4HNXB 1QSOA 5AN9F 3WC6A 1VQ91 3CXSA 3GTOI 1S5KA 4UEZA 2AFUA 1XMBA 2ZEHA 3IJ3A 3CMEZ 2KCWA 3SI0A 5A2Qf 2LFUA 1VQ61 2Q7SA 3IO1A 4S1TA 4M85A 2AFXA 3S6FA 3WC5A 1LQLA 2Z3KA 2QA41 3NDIA 4UEEA 4P4JA 1A2ZA 1R9TI 5CBMA 4NH1C 3F3PC 2XEGA 3S1NI 4CAXA 4MCRA 1ZLIA 4HKFA 3ZZIA 1Q7Y2 2ABZA 1RO5A 2HQYA 1WWZA 1YW6A 1QF8A 5LRKA 4A2ZA 1XF8A 1YSJA 3CPAA 2OR4A 4HNYB 1VQO1 4UBRA 2YU9I 3S14I 1AUGA 3I9SA 1YLEA 2ZENA 2D4OA 1TKJA 2FIAA 4F0XA 3TO6A 4RN7A 4QUSA 4YFJA 3LWUA 1S7LA 4YU9A 3S6KA 3CDXA 2AJ6A 1Y8CA 4MFKA 3G8WA 5C3EI 4AG7A 4CGLA 3GTPI 1VQ5Z 3PBEA 4LQ6A 3HOXI 2G9DA 2CTBA 4R8FA 5FVJA 1Z8WA 1Y1VS 4JJXA 3D7HA 1Y0YA 3FECA 2ATRA 3PFEA 2B4DA 3FNCA 1ON0A 2BOAA 4UF4A 3KR4A 1WCMI 1VQLZ 4OC4A 1TXRA 2R7ZI 2A4NA 4NJRA 4UFWA 1ZB8A 2OTL1 2J8RA 1SIWA 1Q822 3A9LA 1PUAA 1CM0A 2JIOA 2EO8A 3DNSA 1S7FA 1Z4RA 2OB0A 4KOUA 3S1QI 4HGZA 2ZEEA 3EO4A 3PEIA 4QC6A 1QSRA 1Q7LA 4CRYB 3C26A 4CS0B 5J8CA 2PJ6A 4CGPA 3L2NA 3JAMf 3CC4Z 1VQ4Z 4F9UA 2JLMA 4B14A 4A31A 3IWGA 4MFLA 1KZFA 1NJI2 3NH8A 1IB1E 3HOVI 3HOZI 2QLVB 4E0AA 4NFRA 3FH4A 2E7ZA 4MCPA 1S7KA 3TTHA 1NUIA 3JAMb 2PC1A 2E2II 5IB0A 1YUKA 1MJAA 4Q7AA 3ESWA 3GB0A 4E8OA 1Z5RA 1JWQA 3IGRA 2D4PA 4LX9A 2JDDA 1K83I 2JNYA 3BI0A 5C82A 3PO3I 4B5PB 2YNEA 5LRJA 2V8HA 5IT9f 2P6FA 4B11A 2CIJA 3B3WA 3S1MI 2RHBA 1CX8A 3FX6A 1YGHA 1NE9A 1R43A 3DGVA 4CAEA 3CCEZ 3S2DI 3NA6A 2YNCC 4KORA 1ARLA 4GS4A 4Q36A 3CPWZ 3IFEA 2Z3MA 4A38A 4CRZB 2ZEMA 4PSWA 3PO2I 1ML8A 1TWAI 4GXHA 2B5GB 3W91A 2J8NA 1JJ2Y 4PXBA 4NBDA 3R1KA 2OZKA 3E0KA 3CCUZ 1M4GA 2O28A 3CMAZ 3CMA1 5LYFA 2XEFA 5ELYA 3BI1A 4DQYB 1VHEA 4A3II 3B3SA 1VQ81 4NEXA 3D68A 4ZX9A 4UCNA 3CXQA 4U5YA 4TNUA 2PDOA 1ZG8A 1Q812 2G3TA 4JZ0A 3CCQ1 2C6PA 3IFUA 3QAHA 2V8DA 3D8PA 3RNZA 3SXNA 3SXOA 3GTJI 2REFA 3FXTA 1Z02A 4E2YA 2DE7A 2OOTA 4OAEA 7CPAA 2J8MA 4LUAA 4QB9A 5BWAB 5D1PA 1YIJZ 4KOTA 2GU2A 1BOBA 2IJZA 4KOVA 3IIBA 2VPWA 4DNCA 4MY0A 2VPXA 1FDOA 1Q862 4M6IA 1YMEA 4ZY1A 5JQ4A 4A3CI 1Y9WA 4XNHB 2GREA 1TKHA 3S6HA 4ZYQA 4NB8A 3CCVZ 3KHZA 4LQGA 4L8AA 1YI2Z 1F2PA 5ISVA 3CD61 2R6MA 3PZJA 3GYAA 4CYNA 4Y49C 4RS2A 2PVWA 2PJAA 3R95A 2AE6A 4PSXA 2REEA 3BG0B 1YQEA 5F48A
chains in the Genus database with same CATH topology
3KHXA 2V77A 3GLJA 2PIZA 5IB9A 3K9TA 5T64A 5D1OB 3FEDA 3F3FC 2JBJA 2PIYA 3QWUA 4H2KA 2PMZA 1VQ9Z 2OOYB 2GTIA 2AFMA 2JEWA 2Q51A 4A3FI 2V8IA 3RZOI 4OMEA 3FF3A 2PJ3A 2ZELA 3CME1 5C44I 5K8NA 4G1PA 1LANA 2QRDB 1IY7A 3FEEA 2QKDA 1TWCI 3GTMS 1VQL1 3CCJZ 4DJLA 4NGNA 5I4MA 6CPAA 1VQP1 3D4UA 5LRGA 3S9MA 3EERA 1RTQA 1X3ZA 3BXMA 1ARMA 3S15I 4ONWA 2E2HI 1YHQ1 4RVGA 1I50I 4OC1A 3B3VA 5T67A 1ELMP 4E31A 3CC7Z 4A3DI 1KC82 3VMGA 2IZ3A 1Q811 4NGQA 3CCL1 2F7VA 4P4DA 2Q4ZA 3CCS1 2V8GA 3OW2Z 2JR6A 4KSIA 2QR1B 4A3LI 4MHYA 1I6HI 4BBSI 2NVYI 5AN9F 3HOYI 2XEJA 4F8ZA 3WC6A 1VQ91 4UEZA 3GTOI 2QRCB 2AFUA 4NB9A 1XMBA 2ZEHA 5CM2M 3IJ3A 3CXCZ 4JYWA 4E33A 3GKQA 2F8HA 1KQSY 3CMEZ 3VTNA 3SI0A 5A2Qf 2LFUA 2ZAEB 1VQN1 5HVFA 1VQNZ 2R92I 1VQ61 4MRIA 4Y7NI 3Q87A 2JBKA 3IO1A 4S1TA 1YHQZ 3J81b 2AFXA 1VQMZ 4NBGA 3WC5A 5FLXb 3PB9X 1LQLA 3NDJA 2NVQI 3CC71 2QA41 1S721 1S72Z 2QA4Z 3G6EZ 2AFOA 5LYDA 3NDIA 3D6WA 2RIQA 3KI9A 4NGSA 4P4JA 4UEEA 1R9TI 5CBMA 3WC7A 3KL9A 4NH1C 3F3PC 3VARA 2P28A 3IF8A 2XEGA 3PRTA 4Z65A 3S1NI 2WYRA 2ZOGA 2H85A 4MCRA 3KIHA 1NJI1 1ZLIA 2ZEDA 3FVLA 3IX0A 3I07A 4P4IA 3FQQA 1Q7Y2 2JMOA 2ABZA 1Z8LA 5LYLA 1S7MA 1PCAA 3KQXA 1JWHC 5D1OA 3CCMZ 1EE3P 1UWYA 3B7IA 2F4MA 4MD7A 1YW6A 3KR5A 1XFOA 1RQFA 1QF8A 3FQMA 5LRKA 3ISXA 2JS4A 3VMIA 3B3TA 4F9VA 2QYVA 2O4HA 1YSJA 3CPAA 1JJ2Z 1K8A1 2OR4A 1K731 4W9YA 3CCQZ 1VQO1 1RO4A 2YU9I 3S14I 2ZENA 2PJCA 2DE6A 3TC8A 1QVFZ 2PCUA 3S9LA 2PVVA 1PFTA 1KD11 1TKJA 3RAMA 2O53A 1K8A2 4FAIA 1XJOA 1RNIA 1DL6A 4BY1I 3GCFA 3CCM1 1CBXA 4NGMA 1RO2A 3LWUA 3M3YI 2AFZA 3CCV1 3MZKB 3CDXA 4YU9A 3H8EA 3CPXA 4A3KI 1YUAA 1VHOA 2NVXI 5DS0A 4RVFA 4OC2A 4RV9A 3I551 1HDUA 4NBCA 5C3EI 2GLJA 1AYEA 4P4BA 3G4SZ 1LCPA 1JQGA 3MRUA 2PE3A 3GTPI 1VQ5Z 3PBEA 4ZX8A 3S17I 4XX2A 3HOXI 5A2Qb 4B6ZA 3CCE1 4NBHA 4A39A 2G9DA 2CTBA 4OIDA 3M4OI 3TX8A 4DK1A 2EGTA 4FWUA 4NGTA 3H8FA 2PM9A 3HLPA 2R93I 4R8FA 3P5JB 3CCLZ 4NGPA 4PXEA 1Y1VS 2W03A 1X3WA 1Q821 4P44A 4R76A 3D7HA 1Y0YA 1LFWA 4ZY0A 3NFZA 3FECA 3PFEA 3GTLI 2BOAA 3CT9A 4P4EA 2CF4A 2CTCA 2F4OA 4BBRI 2KI7B 1YI21 2C6GA 4UF4A 1YW4A 5CPAA 5IP9I 3KR4A 3HOUI 3SJFA 1WCMI 1VQLZ 4MCSA 4X2TA 4PPZA 4IK2A 1LAPA 1VQ51 3H8GA 1TXRA 2R7ZI 3NH5A 4OC4A 4PXDA 4DUKA 4UIAA 3CC41 4OC5A 1KRLA 4MMOA 4NJRA 3FJUA 1ZB8A 2OTL1 4DYOA 2DE5A 1QYPA 4P4FA 2LIYA 1Q822 1VQK1 4MCQA 5D8NA 4A3EI 1QVGZ 2VUMI 3OW2Y 5JGFA 2EWBA 4IHMA 1KWMA 2ZEFA 4A94A 2VF1A 4CL1A 3S1QI 5JH9A 1R3NA 4HGZA 4UIBA 1Z03A 2PJ4A 1KD12 2ZEEA 4EFDA 3SI2A 1ELLP 3PEIA 4CPAA 1Q7LA 1Z2LA 3CQZI 2K5RA 1PYTB 3HKZA 3BG1B 3LUSA 1VQ6Z 4A3GI 2PJ6A 2J9AA 2PJ5A 3L2NA 2NSMA 3I1UA 1L1OC 2OTLZ 2BJOA 3JAMf 3CC4Z 3LMSA 2V8KA 1VQ4Z 2AFSA 4F9UA 3GTKI 3RZDI 3MN8A 2P3YA 2K3RA 3D9XA 3B35A 2QEX1 3IC1A 3V38A 1Q7Y1 2VL1A 3J81f 3FKII 3K2KA 3IEHA 1NJI2 3NH8A 1XRYA 3NH4A 3B3CA 5THWA 3HOVI 3HOZI 3B2YA 2QLVB 4MHZA 4OC0A 2RT9A 4DGLA 3JRUA 2WAQA 4MD9A 1TF9A 2EK8A 2IMOA 3PBBA 1K732 1QVFY 1QMUA 1YIJ1 4NFRA 3FH4A 1Y1VI 4A3BI 3U50C 5K8PA 3GTGI 3KASA 4AYBA 4MCPA 2HB6A 1N2FA 2PK7A 3CC2Z 3CC21 2RPRA 1NUIA 2QJ8A 1LOKA 3JAMb 2E2II 3I561 1N8R1 3I56Z 3CPWY 4QTTA 4X6AI 1RO0A 1YUKA 2DEAA 2QEXZ 3D7DA 4Q7AA 1TKFA 3ESWA 4OIWA 3CCR1 3GB0A 3RZAA 1VLAA 1BPMA 1Z5RA 3CXCY 2POKA 5JM6A 5K8MA 2VUGA 3GTMI 2C6CA 2OTJZ 4R7MA 1ZH1A 4TWEA 1K83I 3D7GA 2JNYA 1CPXA 2G2KA 3BI0A 4RVHA 1AMPA 3SI1A 1CPSA 2BO9A 2V8JA 3T4NB 5C4JI 1F2OA 2B63I 2JA6I 2QREB 3G4S1 3J7A4 3PO3I 4HH4A 2Y0SA 2QVPA 1YJWZ 1HDQA 3KZWA 2HU9A 1ZG9A 3GUXA 1YJ9Z 1KQSZ 4E30A 5LRJA 2V8HA 5IT9f 4X8IA 4AXVA 2JA7I 4BD9A 1YJN1 2CIJA 3B3WA 2XEIA 3KQZA 3J80b 1NP6A 4PQAA 3K7AI 5IT9b 1USPA 1W2BZ 3S1MI 4IAVA 1KC81 3CCSZ 3S16I 4P10A 2YADA 2FVGA 1M1K1 3SJXA 2RHBA 3ISZA 1CX8A 2JA5I 3FX6A 3EEDA 4MONA 3MONA 1WW9A 1NSAA 2RB7A 1WIIA 1R43A 4MHNA 3DGVA 3FMCA 2M48A 4RVDA 4MHPA 1BPNA 4K3NA 3CCU1 4A37A 1OBRA 2KPIA 4MH4A 2EK9A 3CCJ1 5K8OA 1VQOZ 3I4MI 2J6AA 2JA8I 1Y1WI 4FBEA 3CCEZ 1VGYA 3S2DI 3MZLB 1RLYA 4NOZA 1VQM1 1YJ91 3NA6A 3V7ZA 1YJW1 1F57A 5HVGA 1VQ41 1ARLA 1YJNZ 3SJGA 3S2HI 1YLOA 3CPWZ 3IFEA 3WABA 3WT4A 4A38A 5HXDA 1VQ8Z 2ZEMA 2PJ0A 1TWHI 3PB6X 2HF1A 1M4LA 3PO2I 1ML8A 1TWAI 4EMEA 4UEFA 1JJ2Y 2IZ4A 3QNVA 4X3RA 5C4XI 4PXBA 4NBDA 2OZKA 2OOXB 4NJQA 1M901 3PB4X 1Q861 1TWGI 3CCUZ 4OKOA 4A3JI 1QQ9A 4E2ZA 3TE5B 4ZY2A 5D29A 1Y7EA 3CMAZ 3CMA1 5LYFA 1DTDA 1FT7A 1YITZ 2XEFA 1GYTA 3IWWA 2HC9A 4BXXI 5ELYA 4E32A 2PJBA 4WWVA 2JUBA 2PJ8A 4A93I 3BI1A 4DQYB 1SFOI 3HOWI 1BLLE 1VHEA 5LL6f 4A3II 3G6E1 3B3SA 3PFOA 2V8VA 4FUUA 3VATA 1HEEA 1VQ81 3H0GI 2PJ1A 4YWYA 3VMHA 1K9M2 1BAVA 1ZLHA 4Y52I 4NBFA 3G711 4NBBA 3D68A 4R6TA 5LYIA 3S1RI 4ZX9A 1QVGY 5J1QA 4OP4A 3H3VJ 3J80f 4TNUA 1ZG8A 2OTJ1 2I3CA 4E2XA 1DE4C 2PJ7A 1TF8A 2RFHA 1Q812 2ZEPA 3KIFA 1VQPZ 1FNOA 1M1K2 5F09A 5HVHA 5T6BA 1YIT1 4JZ0A 2Q43A 1TWFI 3I55Z 2ZEOA 4GM5A 3CCQ1 1H8LA 2C6PA 3DLJA 3IFUA 2E9HA 1VQKZ 3RBUA 4MD8A 2V8DA 4WJBA 2C1CA 2ANPA 4RUHA 5FLMI 1W2BY 3G71Z 1CP6A 3GTJI 4E2WA 3PB7X 4OC3A 4BY7I 1Z02A 3T8WA 2ZEGA 4E2YA 4P45A 1P9NA 3D67A 2DE7A 2GTHA 4EWTA 2PRQA 2OOTA 7CPAA 1Y0RA 3I4NI 1Z01A 3D66A 4EWCA 3KGQA 4P6YA 4MXUA 5D1PA 1YIJZ 3CD6Z 1VIXA 2GU2A 3PO3S 3PB8X 2IJZA 3S9NA 3SJEA 4RS4A 1XBUA 3IIBA 1TFIA 2E2JI 2AFWA 2W04A 4ZI6A 2WZNA 1I3QI 2WB1A 3VB9A 4NGRA 3D7FA 2ZOFA 8CPAA 1LAMA 4QTUA 1CG2A 1Q862 2NVTI 1N8R2 4NBAA 1YMEA 1ZG7A 3CCRZ 2GLFA 2IQ6A 4ZY1A 1K9M1 4A3CI 2GREA 2M6NA 2AKLA 1TKHA 2RBLA 4ZYQA 1USPB 4NB8A 3VH9A 2BCOA 3CCVZ 4A3MI 3KHZA 5FLXf 2NYQA 4PXCA 4LQGA 1YI2Z 1F2PA 3CD61 5IP7I 1X0TA 2R6MA 1CP7A 2PJ2A 4NBEA 2PVWA 2PJAA 2PJ9A 3N5FA 1M902 4O23A 1VQ71 1VQ7Z 1IGBA 3TDHB 1ZB9A 3HUVA 3BHXA 3BG0B 4HGYA 3GTQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHX A;  2V77 A;  3GLJ A;  2PIZ A;  5IB9 A;  3K9T A;  3FED A;  2JBJ A;  2PIY A;  4H2K A;  2AFM A;  2JEW A;  2Q51 A;  4OME A;  3FF3 A;  2PJ3 A;  2ZEL A;  5K8N A;  4G1P A;  1LAN A;  1IY7 A;  3FEE A;  4DJL A;  4NGN A;  5I4M A;  6CPA A;  3S9M A;  3D4U A;  5LRG A;  1RTQ A;  3BXM A;  1ARM A;  4ONW A;  4OC1 A;  3B3V A;  1ELM P;  4NGQ A;  2F7V A;  4P4D A;  2Q4Z A;  2V8G A;  4KSI A;  4MHY A;  2XEJ A;  4F8Z A;  3WC6 A;  4UEZ A;  2AFU A;  1XMB A;  2ZEH A;  3IJ3 A;  4JYW A;  2F8H A;  3SI0 A;  5HVF A;  4MRI A;  2JBK A;  3IO1 A;  2AFX A;  3WC5 A;  3PB9 X;  2AFO A;  5LYD A;  3KI9 A;  4NGS A;  4P4J A;  4UEE A;  5CBM A;  3WC7 A;  3KL9 A;  3VAR A;  2XEG A;  3PRT A;  4Z65 A;  2WYR A;  2ZOG A;  4MCR A;  1ZLI A;  2ZED A;  3FVL A;  4P4I A;  2ABZ A;  1Z8L A;  5LYL A;  1PCA A;  3KQX A;  3KR5 A;  1UWY A;  1EE3 P;  3B7I A;  1YW6 A;  1XFO A;  5LRK A;  3ISX A;  3B3T A;  4F9V A;  2QYV A;  2O4H A;  1YSJ A;  3CPA A;  2OR4 A;  4W9Y A;  2ZEN A;  2PJC A;  3TC8 A;  2PCU A;  3S9L A;  2PVV A;  1TKJ A;  3RAM A;  2O53 A;  4FAI A;  1XJO A;  1CBX A;  4NGM A;  3LWU A;  2AFZ A;  4YU9 A;  3CDX A;  3H8E A;  3CPX A;  1VHO A;  5DS0 A;  4OC2 A;  1HDU A;  2GLJ A;  1AYE A;  4P4B A;  1LCP A;  1JQG A;  3MRU A;  2PE3 A;  3PBE A;  4ZX8 A;  4B6Z A;  4A39 A;  2G9D A;  2CTB A;  4OID A;  3TX8 A;  4FWU A;  4NGT A;  3H8F A;  3HLP A;  4R8F A;  4NGP A;  4PXE A;  4P44 A;  4R76 A;  3D7H A;  1Y0Y A;  1LFW A;  4ZY0 A;  3NFZ A;  3FEC A;  3PFE A;  2BOA A;  3CT9 A;  4P4E A;  2CF4 A;  2CTC A;  2C6G A;  4UF4 A;  1YW4 A;  5CPA A;  3SJF A;  3KR4 A;  4X2T A;  4MCS A;  4PPZ A;  4IK2 A;  1LAP A;  4OC4 A;  3H8G A;  1TXR A;  4PXD A;  3NH5 A;  4DUK A;  4UIA A;  4OC5 A;  4MMO A;  4NJR A;  3FJU A;  4DYO A;  4P4F A;  4MCQ A;  5D8N A;  5JGF A;  2EWB A;  4IHM A;  1KWM A;  2ZEF A;  4A94 A;  5JH9 A;  1R3N A;  4UIB A;  2ZEE A;  2PJ4 A;  4EFD A;  3SI2 A;  1ELL P;  3PEI A;  4CPA A;  1Q7L A;  1Z2L A;  1PYT B;  2PJ6 A;  2J9A A;  3L2N A;  2PJ5 A;  2NSM A;  3I1U A;  3LMS A;  2AFS A;  4F9U A;  3MN8 A;  3B35 A;  3V38 A;  3IC1 A;  2VL1 A;  3K2K A;  3IEH A;  3NH8 A;  1XRY A;  3NH4 A;  3B3C A;  5THW A;  3B2Y A;  4MHZ A;  4OC0 A;  3JRU A;  1TF9 A;  2EK8 A;  3PBB A;  2IMO A;  1QMU A;  4NFR A;  3FH4 A;  5K8P A;  3KAS A;  4MCP A;  2HB6 A;  2QJ8 A;  1LOK A;  2DEA A;  3D7D A;  4Q7A A;  1TKF A;  4OIW A;  3GB0 A;  3RZA A;  1BPM A;  1Z5R A;  2POK A;  5JM6 A;  5K8M A;  2C6C A;  4R7M A;  4TWE A;  3D7G A;  1CPX A;  3BI0 A;  1AMP A;  3SI1 A;  1CPS A;  2BO9 A;  1F2O A;  2QVP A;  1HDQ A;  3KZW A;  1ZG9 A;  3GUX A;  5LRJ A;  2V8H A;  4X8I A;  4AXV A;  4BD9 A;  2CIJ A;  3B3W A;  2XEI A;  3KQZ A;  4PQA A;  4IAV A;  4P10 A;  2FVG A;  3SJX A;  3ISZ A;  1CX8 A;  3FX6 A;  1NSA A;  2RB7 A;  1R43 A;  4MHN A;  3DGV A;  3FMC A;  4MHP A;  1BPN A;  4K3N A;  4A37 A;  1OBR A;  2EK9 A;  5K8O A;  4FBE A;  1VGY A;  3NA6 A;  3V7Z A;  1F57 A;  5HVG A;  1ARL A;  3SJG A;  1YLO A;  3IFE A;  3WT4 A;  3WAB A;  4A38 A;  5HXD A;  2ZEM A;  2PJ0 A;  3PB6 X;  4EME A;  1M4L A;  4UEF A;  3QNV A;  4X3R A;  4PXB A;  4NJQ A;  3PB4 X;  4OKO A;  1QQ9 A;  4ZY2 A;  5D29 A;  1Y7E A;  5LYF A;  1DTD A;  1FT7 A;  2XEF A;  1GYT A;  3IWW A;  2HC9 A;  5ELY A;  2PJB A;  4WWV A;  2PJ8 A;  3BI1 A;  1VHE A;  1BLL E;  3B3S A;  3PFO A;  2V8V A;  4FUU A;  3VAT A;  1HEE A;  2PJ1 A;  4YWY A;  1BAV A;  1ZLH A;  3D68 A;  4R6T A;  5LYI A;  4ZX9 A;  5J1Q A;  4OP4 A;  4TNU A;  1ZG8 A;  2I3C A;  2PJ7 A;  1DE4 C;  1TF8 A;  2RFH A;  2ZEP A;  1FNO A;  5F09 A;  5HVH A;  4JZ0 A;  2Q43 A;  4GM5 A;  2ZEO A;  1H8L A;  2C6P A;  3DLJ A;  3RBU A;  2V8D A;  4WJB A;  2C1C A;  2ANP A;  4RUH A;  1CP6 A;  3PB7 X;  4OC3 A;  3T8W A;  2ZEG A;  4EWT A;  4P45 A;  3D67 A;  2PRQ A;  2OOT A;  7CPA A;  1Y0R A;  3D66 A;  3KGQ A;  4P6Y A;  4MXU A;  1VIX A;  2GU2 A;  3PB8 X;  2IJZ A;  3S9N A;  3SJE A;  1XBU A;  3IIB A;  2AFW A;  4ZI6 A;  2WZN A;  4NGR A;  3D7F A;  2ZOF A;  8CPA A;  1LAM A;  1CG2 A;  1YME A;  1ZG7 A;  2GLF A;  2IQ6 A;  4ZY1 A;  2GRE A;  1TKH A;  4ZYQ A;  3VH9 A;  2BCO A;  3KHZ A;  2NYQ A;  4PXC A;  4LQG A;  1F2P A;  1CP7 A;  2PJ2 A;  2PVW A;  2PJA A;  2PJ9 A;  3N5F A;  4O23 A;  1IGB A;  3HUV A;  3BHX A; 
#chains in the Genus database with same CATH topology
 3KHX A;  2V77 A;  5IB9 A;  3K9T A;  4CGO A;  5D1O B;  4KLV A;  3QWU A;  3TCV A;  2GTI A;  4A3F I;  2V8I A;  2B5G A;  2PJ3 A;  4Q38 A;  4G1P A;  3PP9 A;  1IY7 A;  2QKD A;  3GTM S;  2ODF A;  2WUU A;  1RXT A;  4NGN A;  5KTC A;  1RTQ A;  1ARM A;  1YHQ 1;  1IYK A;  3B3V A;  4AG9 A;  5T67 A;  3D2L A;  3VMG A;  4ZGY B;  4H6Z A;  2IZ3 A;  4NGQ A;  2F7V A;  2Q4Z A;  1M4D A;  2NVY I;  5IV0 A;  5F46 A;  4UA3 A;  2JIQ A;  2V45 A;  3VTN A;  1R57 A;  1VQN 1;  1VQN Z;  4YGO A;  4MRI A;  5DWM A;  4NBG A;  1WJ2 A;  5FLX b;  3CC7 1;  2YND A;  3D6W A;  1Z9U A;  4CYQ A;  5AGE A;  3WC7 A;  2P28 A;  3IF8 A;  1IU8 A;  2WYR A;  3BJ8 A;  2JMO A;  1P0H A;  1S7M A;  1UWY A;  1RQF A;  2JS4 A;  3B3T A;  2QYV A;  1K73 1;  3CCQ Z;  2DPS A;  3TC8 A;  2PCU A;  3S9L A;  2PVV A;  1PFT A;  3RAM A;  4KUB A;  1IOF A;  2O53 A;  1XJO A;  2VPY A;  3GCF A;  3CCM 1;  4NGM A;  4A3K I;  4RVF A;  3I55 1;  4JXR A;  4UFX A;  2FCK A;  1AYE A;  2CNT A;  2Z3O A;  3G4S Z;  1LCP A;  1JQG A;  1Y7R A;  1VHS A;  4FD6 A;  5F49 A;  5F47 A;  1QSN A;  4I49 A;  4OID A;  3M4O I;  4DK1 A;  2EGT A;  2HV2 A;  3H8F A;  4NGT A;  4PXE A;  2OZH A;  1X3W A;  1LFW A;  1XOV A;  3GIU A;  2CF4 A;  2F4O A;  1YI2 1;  1YW4 A;  3SJF A;  4MCS A;  4PPZ A;  4IK2 A;  1LAP A;  4PXD A;  4DUK A;  4UIA A;  4MMO A;  4F6A A;  1IOI A;  1QYP A;  2OZG A;  4CYP A;  4U9Z A;  5D8N A;  4A3E I;  1QVG Z;  4B5O A;  2EWB A;  4A94 A;  3F8K A;  2LEX A;  1KUX A;  4ORF A;  4UIB A;  2PJ4 A;  1KD1 2;  2K5R A;  1PYT B;  4B5P A;  3BG1 B;  3LUS A;  2PR8 A;  2AFS A;  3GTK I;  3RZD I;  3FYN A;  2K3R A;  3D9X A;  3I3G A;  1Q7Y 1;  2BL1 A;  2ZPA A;  4C2X A;  1XRY A;  1Q2C A;  3NH4 A;  3B3C A;  3H4Q A;  2Z10 A;  2WAQ A;  2EK8 A;  3JRU A;  2IMO A;  3PBB A;  1QMU A;  1YIJ 1;  2Q4V A;  1Y1V I;  3U50 C;  5K8P A;  3GTG I;  4UCP A;  2ARH A;  1S7N A;  2HB6 A;  1N2F A;  3IR7 A;  2F5I A;  4AVB A;  1N71 A;  4QTT A;  4X6A I;  4OAD A;  4KS9 A;  4OIW A;  2B3V A;  1BPM A;  3CXC Y;  2R7H A;  2Q4Y A;  3MGD A;  5K8M A;  4KSA A;  3GTM I;  2C6C A;  2OTJ Z;  5EC4 A;  3SI1 A;  2BO9 A;  5IX3 A;  1F2O A;  2JA6 I;  2QRE B;  2Y0M A;  3J7A 4;  2EUI A;  2BUE A;  2HU9 A;  1YJ9 Z;  1KQS Z;  4R9M A;  5A27 A;  5H84 A;  4BD9 A;  5JPH A;  1USP A;  1W2B Z;  4IAV A;  1YK3 A;  1KC8 1;  2Q7B A;  4MFQ A;  3ISZ A;  1M44 A;  3EED A;  4MON A;  1Z8T A;  1Z8X A;  4MHN A;  4PK3 A;  4RVD A;  4MHP A;  1BPN A;  4K3N A;  3CCU 1;  2B3U A;  4MH4 A;  2EK9 A;  5AG4 A;  3VWD A;  1VQO Z;  3I4M I;  2JEV A;  2JA8 I;  4IUS A;  2Q44 A;  2BEI A;  3MZL B;  1RLY A;  1GHE A;  4XPD B;  1YJW 1;  1YJN Z;  3WT4 A;  2CY2 A;  2WSA A;  3TT2 A;  1TWH I;  3PB6 X;  3RYO A;  2IZ4 A;  3QNV A;  2OOX B;  3PB4 X;  1Q86 1;  4CYO A;  5D29 A;  3K9U A;  1DTD A;  1FT7 A;  1YIT Z;  1GYT A;  2HC9 A;  2PJB A;  2JUB A;  2PJ8 A;  5LL6 f;  3P2F A;  2V8V A;  2Z3P A;  1HEE A;  4Y52 I;  1B87 A;  4NBB A;  4R6T A;  5LYI A;  1I21 A;  3H3V J;  4MHD A;  3J80 f;  2P6G A;  2OTJ 1;  4E2X A;  4A95 A;  1VQP Z;  3S6G A;  1M1K 2;  5T6B A;  1NMT A;  3RBU A;  4UWI A;  4WJB A;  3G71 Z;  3T8W A;  2ZEG A;  3D67 A;  3JUW A;  2GTH A;  4JXQ A;  2PRQ A;  3SHP A;  4MXU A;  3PB8 X;  1TFI A;  1XE4 A;  2E2J I;  4ZI6 A;  4KOY A;  3EFA A;  4NGR A;  4XNH C;  8CPA A;  1LAM A;  3WR7 A;  2GLF A;  1K9M 1;  4X5K A;  5G1Z A;  2M6N A;  2JDC A;  2RBL A;  1USP B;  2QIR A;  2YNC A;  4FD5 A;  1CP7 A;  4A30 A;  2WPX A;  2PJ9 A;  3N5F A;  1M90 2;  3BHX A;  1J4J A;  2R98 A;  3F5B A;  3GLJ A;  4UFV A;  5T64 A;  2B4D B;  3FED A;  4QVT A;  2JBJ A;  2PIY A;  4H2K A;  2OOY B;  2FIW A;  2AFM A;  1ZO0 A;  2JEW A;  2FS5 A;  1TWC I;  1VQL 1;  4DJL A;  4AVC A;  6CPA A;  1VQP 1;  3D4U A;  5LRG A;  2PQ8 A;  3EER A;  3BXM A;  1Q2D A;  4ONW A;  2E2H I;  4PK2 A;  1K4J A;  4ONU A;  3CC7 Z;  3DR6 A;  2FT0 A;  4P4D A;  2I00 A;  3OW2 Z;  4A3L I;  4ZBG A;  2H5M A;  3TOA A;  2QRC B;  5CM2 M;  3CXC Z;  3GKQ A;  5G22 A;  4C7I A;  3UY5 A;  2OZU A;  4YRH A;  2ZAE B;  2R92 I;  3Q87 A;  2JBK A;  3J81 b;  1VQM Z;  3NDJ A;  2K5T A;  2NVQ I;  5C88 A;  2AFO A;  1S72 Z;  2RIQ A;  3KI9 A;  5DWN A;  1M1D A;  1KUV A;  4Z65 A;  2H85 A;  2ZED A;  4MFZ A;  3I07 A;  3FQQ A;  1Z8L A;  5LYL A;  1PCA A;  3KQX A;  5D1O A;  3CCM Z;  4A32 A;  2IV2 X;  3DSB A;  3FQM A;  3VMI A;  1JJ2 Z;  1RO4 A;  2Z3L A;  2PJC A;  2NMT A;  1QVF Z;  4R57 A;  1K8A 2;  4FAI A;  1RNI A;  1PU9 A;  1I12 A;  1CBX A;  4UCM A;  1YRE A;  3M3Y I;  2AFZ A;  3MZK B;  3CPX A;  1VHO A;  2NVX I;  5DS0 A;  4OC2 A;  2GLJ A;  4XPK A;  4P4B A;  3MRU A;  4Y49 B;  4ZX8 A;  3S17 I;  1Q16 A;  4A39 A;  3R96 A;  3HLP A;  1NSL A;  4J3G A;  4NGP A;  2W03 A;  4P44 A;  4R76 A;  1AA6 A;  2V3V A;  4ZY0 A;  3GTL I;  2KI7 B;  3LD2 A;  3T9Y A;  4NF1 A;  3HOU I;  4X2T A;  2Z11 A;  1VQ5 1;  3CC4 1;  3FJU A;  4P4F A;  1VQK 1;  3OW2 Y;  5JGF A;  2ZXV A;  1KWM A;  1V0C A;  1XIX A;  2CNM A;  3FIX A;  1QST A;  4CL1 A;  5JH9 A;  1R3N A;  1KUY A;  1Z03 A;  3SI2 A;  2GIV A;  4CPA A;  1Z2L A;  1VQ6 Z;  2J9A A;  2PJ5 A;  3LMS A;  3NE8 A;  2PR1 A;  3MN8 A;  2QEX 1;  3J81 f;  4F0Y A;  3IEH A;  4KOX A;  2RC4 A;  3B2Y A;  4HPS A;  2DXQ A;  1QVF Y;  2OH1 A;  4A3B I;  4KOW A;  4BIN A;  3CC2 Z;  3CC2 1;  2FL4 A;  3CPW Y;  3I56 Z;  2Q04 A;  4CAF A;  3IWE A;  1P4N A;  4C68 A;  2CXA A;  1VLA A;  2FSR A;  1QXF A;  5JM6 A;  2POK A;  4R7M A;  4TWE A;  3D7G A;  1CPX A;  3FRM A;  4RI1 A;  4RVH A;  1AMP A;  1CPS A;  3T4N B;  5C4J I;  3W6S A;  3G4S 1;  2Y0S A;  3H5Z A;  1HDQ A;  3KZW A;  3GUX A;  3TOB A;  1XEB A;  3CZX A;  4AXV A;  1YJN 1;  4PQA A;  3KQZ A;  3J80 b;  3QAY A;  3CCS Z;  4P10 A;  2FVG A;  2JA5 I;  2CNS A;  4CAW A;  2RB7 A;  3FMC A;  1OBR A;  1Z4E A;  5K8O A;  3FBU A;  2J6A A;  1Y1W I;  4NOZ A;  3V7Z A;  1F57 A;  3SJG A;  2DPT A;  3WAB A;  1FDI A;  1VQ8 Z;  2PJ0 A;  4EME A;  1M4L A;  4XPD C;  4A33 A;  2VXK A;  4UEF A;  5EMI A;  5C4X I;  4NJQ A;  1M90 1;  1S3Z A;  1Y9K A;  3TE5 B;  1Y7E A;  4R87 A;  4JLY A;  4BXX I;  4E32 A;  5GCN A;  4WWV A;  4A93 I;  1SFO I;  1BLL E;  3G6E 1;  3VAT A;  4YWY A;  5CNP A;  3VMH A;  1BAV A;  4NBF A;  5EBV A;  1MJB A;  3S1R I;  5J1Q A;  4OP4 A;  2R1I A;  3N7Z A;  2PJ7 A;  2RFH A;  1FNO A;  1YIT 1;  1TWF I;  2ZEO A;  2EVN A;  4MBU A;  1H8L A;  3DLJ A;  2VZY A;  1IIC A;  4MD8 A;  1CJW A;  2C1C A;  3GKR A;  4RUH A;  1W2B Y;  1CP6 A;  4E2W A;  3PB7 X;  2Z3N A;  4EWT A;  1P9N A;  4NXY A;  3I4N I;  3KGQ A;  4P6Y A;  3CD6 Z;  1VIX A;  5AG5 A;  3S9N A;  1OZP A;  3SJE A;  2GE3 A;  2WZN A;  2WB1 A;  2JIR A;  4QTU A;  5AG7 A;  1CG2 A;  4E2A A;  2QML A;  2I79 A;  2IQ6 A;  2GAN A;  4EVY A;  4H89 A;  2VPZ A;  1YVK A;  3R9G A;  5FLX f;  2NYQ A;  4PXC A;  1WK4 A;  1X0T A;  2PJ2 A;  4NBE A;  4M3S A;  3D2P A;  1IID A;  1VQ7 Z;  3TDH B;  1ZB9 A;  4MFJ A;  3RO0 A;  3GTQ I;  4XPL A;  1Q2Y A;  3D2M A;  2Z0Z A;  1WZN A;  2PMZ A;  1VQ9 Z;  4UWJ A;  3FF3 A;  2ZEL A;  3CME 1;  3FEE A;  4FD7 A;  5I4M A;  1X3Z A;  3S15 I;  3TFY A;  5J8F A;  4RVG A;  1I50 I;  4OC1 A;  4E31 A;  4MJ8 A;  1KC8 2;  3CCL 1;  2V8G A;  2B4B A;  2PRB A;  2JR6 A;  4KSI A;  4MHY A;  4BBS I;  1LRZ A;  3HOY I;  2XEJ A;  4F8Z A;  4KLW A;  2C27 A;  2P0W A;  4NB9 A;  4II9 A;  4JYW A;  4E33 A;  3V8I A;  2F8H A;  1KQS Y;  3OWC A;  5HH1 A;  5HVF A;  4Y7N I;  1YHQ Z;  4C7H A;  3PB9 X;  2VI7 A;  1S72 1;  2QA4 Z;  4PV6 A;  3G6E Z;  5LYD A;  3DR8 A;  4NGS A;  3KL9 A;  3VAR A;  4AVA A;  3PRT A;  3JVN A;  2ZOG A;  2ZW5 A;  3KIH A;  1NJI 1;  3FVL A;  3IX0 A;  4P4I A;  5KTA A;  3R9E A;  2IL4 A;  1JWH C;  1TIQ A;  1EE3 P;  3B7I A;  3KR5 A;  4C2Y A;  2F4M A;  4MD7 A;  1XFO A;  3ISX A;  4F9V A;  2BSW A;  2O4H A;  1UFH A;  1K8A 1;  4W9Y A;  3P2H A;  3W6X A;  1MK4 A;  2DE6 A;  1KD1 1;  1U6M A;  2VEZ A;  1DL6 A;  3GY9 A;  4BY1 I;  3DDD A;  1RO2 A;  3CCV 1;  5G20 A;  3H8E A;  1YUA A;  4RV9 A;  1HDU A;  4NBC A;  4QBJ A;  5H86 A;  2AYD A;  2PE3 A;  3TO9 A;  4MI4 A;  4XX2 A;  2Q0Y A;  5A2Q b;  4B6Z A;  3CCE 1;  4NBH A;  3TX8 A;  4FWU A;  4CAV A;  2PM9 A;  2R93 I;  3P5J B;  3CCL Z;  4M6G A;  1Q82 1;  3EXN A;  3G3S A;  3NFZ A;  3CT9 A;  4KUA A;  4P4E A;  2CTC A;  4BBR I;  1X12 A;  2C6G A;  5CPA A;  2YGW A;  5IP9 I;  3H8G A;  3NH5 A;  4FD4 A;  4OC5 A;  1KRL A;  4DYO A;  2DE5 A;  4KSF A;  2LIY A;  5KTD A;  4MCQ A;  2VUM I;  2ZW7 A;  3LAC A;  4IHM A;  2ZEF A;  2VF1 A;  2HUZ A;  4EFD A;  1ELL P;  4R3L A;  3CQZ I;  3QB8 A;  3EC4 A;  1S60 A;  3HKZ A;  2FE7 A;  4KOS A;  4U9Y A;  4A3G I;  1M4I A;  3FB3 A;  2NSM A;  3I1U A;  1L1O C;  2OTL Z;  2BJO A;  2V8K A;  5AG6 A;  4HNW B;  2P3Y A;  3B35 A;  3V38 A;  3IC1 A;  2VL1 A;  3FKI I;  3K2K A;  4K30 A;  4KZT A;  4JWP A;  3KKW A;  4BBH A;  3LOD A;  5THW A;  4MHZ A;  3NE7 A;  4OC0 A;  2RT9 A;  4DGL A;  4MD9 A;  1TF9 A;  5G21 A;  1K73 2;  3TO7 A;  3KAS A;  4AYB A;  2P6E A;  3ZJ0 A;  2PK7 A;  2RPR A;  2QJ8 A;  1LOK A;  3I56 1;  1N8R 1;  2EBJ A;  1RO0 A;  2DEA A;  2QEX Z;  3D7D A;  1TKF A;  3F0A A;  3CCR 1;  3RZA A;  4H6U A;  3T90 A;  1B6B A;  2VUG A;  1ZH1 A;  2G2K A;  2V8J A;  3R9F A;  2B63 I;  3D3S A;  4HH4 A;  2GFQ A;  2QVP A;  1YJW Z;  2ZW6 A;  1ZG9 A;  4E30 A;  1VKC A;  4X8I A;  2JA7 I;  2XEI A;  4B12 A;  1NP6 A;  3K7A I;  5IT9 b;  4L89 A;  3S16 I;  2YAD A;  2G0B A;  1M1K 1;  3SJX A;  3MON A;  1WW9 A;  1NSA A;  1WII A;  4R3K A;  2PSW A;  2M48 A;  4A37 A;  1X10 A;  2KPI A;  1XMT A;  2VZZ A;  3CCJ 1;  1QSM A;  4NSQ A;  2R8V A;  2NAP A;  4FBE A;  1VGY A;  4AB7 A;  1YJ9 1;  1VQM 1;  4M6H A;  4JD6 A;  5HVG A;  1VQ4 1;  3S2H I;  1YLO A;  5HXD A;  2HF1 A;  4X3R A;  4KVX A;  4OKO A;  1TWG I;  4A3J I;  3EY5 A;  1QQ9 A;  4E2Z A;  4ZY2 A;  2WPW A;  4MY3 A;  4CGM A;  1MJ9 A;  3IWW A;  3HOW I;  3PFO A;  4FUU A;  3CXP A;  2DF5 A;  3H0G I;  2PJ1 A;  4KVO E;  1K9M 2;  2JIP A;  1ZLH A;  2X7B A;  4MFP A;  3G71 1;  2VQY A;  2ZW4 A;  1QVG Y;  1YVO A;  2JIM A;  2I3C A;  2B58 A;  1DE4 C;  1TF8 A;  2ZEP A;  3KIF A;  1SQH A;  5F09 A;  5HVH A;  2Q43 A;  3I55 Z;  4GM5 A;  4B10 A;  3TE4 A;  4CGN A;  3JTK A;  1BO4 A;  2E9H A;  4C2Z A;  1VQK Z;  3B8G A;  4OLL A;  1FY7 A;  1I1D A;  2ANP A;  5FLM I;  4B13 A;  4OC3 A;  4BY7 I;  4P45 A;  4NCZ A;  1Y0R A;  1Z01 A;  3D66 A;  1YX0 A;  4EWC A;  3PO3 S;  2QEC A;  4RS4 A;  1XBU A;  2AFW A;  2VBQ A;  2W04 A;  4IF5 A;  5I0C A;  3VWE A;  1I3Q I;  3VB9 A;  3D7F A;  1IYL A;  2ZOF A;  5A28 A;  5E96 A;  2G3A A;  2NVT I;  4KVM E;  1N8R 2;  4NBA A;  3BJ7 A;  1ZG7 A;  3CCR Z;  2AKL A;  3VH9 A;  2BCO A;  4A3M I;  5IP7 I;  3IU1 A;  1L0C A;  4O23 A;  1VQ7 1;  3IU2 A;  1IGB A;  3HUV A;  4HGY A;  2PIZ A;  1YR0 A;  2FXF A;  3F3F C;  2Q51 A;  3RZO I;  3BLN A;  4OME A;  5C44 I;  5K8N A;  1LAN A;  2QRD B;  3PGP A;  3CCJ Z;  5HMN A;  3S9M A;  1ELM P;  4A3D I;  4BMH A;  1Q81 1;  2OU2 A;  3CCS 1;  2QR1 B;  1I6H I;  4HNX B;  1QSO A;  5AN9 F;  3WC6 A;  1VQ9 1;  3CXS A;  3GTO I;  1S5K A;  4UEZ A;  2AFU A;  1XMB A;  2ZEH A;  3IJ3 A;  3CME Z;  2KCW A;  3SI0 A;  5A2Q f;  2LFU A;  1VQ6 1;  2Q7S A;  3IO1 A;  4S1T A;  4M85 A;  2AFX A;  3S6F A;  3WC5 A;  1LQL A;  2Z3K A;  2QA4 1;  3NDI A;  4UEE A;  4P4J A;  1A2Z A;  1R9T I;  5CBM A;  4NH1 C;  3F3P C;  2XEG A;  3S1N I;  4CAX A;  4MCR A;  1ZLI A;  4HKF A;  3ZZI A;  1Q7Y 2;  2ABZ A;  1RO5 A;  2HQY A;  1WWZ A;  1YW6 A;  1QF8 A;  5LRK A;  4A2Z A;  1XF8 A;  1YSJ A;  3CPA A;  2OR4 A;  4HNY B;  1VQO 1;  4UBR A;  2YU9 I;  3S14 I;  1AUG A;  3I9S A;  1YLE A;  2ZEN A;  2D4O A;  1TKJ A;  2FIA A;  4F0X A;  3TO6 A;  4RN7 A;  4QUS A;  4YFJ A;  3LWU A;  1S7L A;  4YU9 A;  3S6K A;  3CDX A;  2AJ6 A;  1Y8C A;  4MFK A;  3G8W A;  5C3E I;  4AG7 A;  4CGL A;  3GTP I;  1VQ5 Z;  3PBE A;  4LQ6 A;  3HOX I;  2G9D A;  2CTB A;  4R8F A;  5FVJ A;  1Z8W A;  1Y1V S;  4JJX A;  3D7H A;  1Y0Y A;  3FEC A;  2ATR A;  3PFE A;  2B4D A;  3FNC A;  1ON0 A;  2BOA A;  4UF4 A;  3KR4 A;  1WCM I;  1VQL Z;  4OC4 A;  1TXR A;  2R7Z I;  2A4N A;  4NJR A;  4UFW A;  1ZB8 A;  2OTL 1;  2J8R A;  1SIW A;  1Q82 2;  3A9L A;  1PUA A;  1CM0 A;  2JIO A;  2EO8 A;  3DNS A;  1S7F A;  1Z4R A;  2OB0 A;  4KOU A;  3S1Q I;  4HGZ A;  2ZEE A;  3EO4 A;  3PEI A;  4QC6 A;  1QSR A;  1Q7L A;  4CRY B;  3C26 A;  4CS0 B;  5J8C A;  2PJ6 A;  4CGP A;  3L2N A;  3JAM f;  3CC4 Z;  1VQ4 Z;  4F9U A;  2JLM A;  4B14 A;  4A31 A;  3IWG A;  4MFL A;  1KZF A;  1NJI 2;  3NH8 A;  1IB1 E;  3HOV I;  3HOZ I;  2QLV B;  4E0A A;  4NFR A;  3FH4 A;  2E7Z A;  4MCP A;  1S7K A;  3TTH A;  1NUI A;  3JAM b;  2PC1 A;  2E2I I;  5IB0 A;  1YUK A;  1MJA A;  4Q7A A;  3ESW A;  3GB0 A;  4E8O A;  1Z5R A;  1JWQ A;  3IGR A;  2D4P A;  4LX9 A;  2JDD A;  1K83 I;  2JNY A;  3BI0 A;  5C82 A;  3PO3 I;  4B5P B;  2YNE A;  5LRJ A;  2V8H A;  5IT9 f;  2P6F A;  4B11 A;  2CIJ A;  3B3W A;  3S1M I;  2RHB A;  1CX8 A;  3FX6 A;  1YGH A;  1NE9 A;  1R43 A;  3DGV A;  4CAE A;  3CCE Z;  3S2D I;  3NA6 A;  2YNC C;  4KOR A;  1ARL A;  4GS4 A;  4Q36 A;  3CPW Z;  3IFE A;  2Z3M A;  4A38 A;  4CRZ B;  2ZEM A;  4PSW A;  3PO2 I;  1ML8 A;  1TWA I;  4GXH A;  2B5G B;  3W91 A;  2J8N A;  1JJ2 Y;  4PXB A;  4NBD A;  3R1K A;  2OZK A;  3E0K A;  3CCU Z;  1M4G A;  2O28 A;  3CMA Z;  3CMA 1;  5LYF A;  2XEF A;  5ELY A;  3BI1 A;  4DQY B;  1VHE A;  4A3I I;  3B3S A;  1VQ8 1;  4NEX A;  3D68 A;  4ZX9 A;  4UCN A;  3CXQ A;  4U5Y A;  4TNU A;  2PDO A;  1ZG8 A;  1Q81 2;  2G3T A;  4JZ0 A;  3CCQ 1;  2C6P A;  3IFU A;  3QAH A;  2V8D A;  3D8P A;  3RNZ A;  3SXN A;  3SXO A;  3GTJ I;  2REF A;  3FXT A;  1Z02 A;  4E2Y A;  2DE7 A;  2OOT A;  4OAE A;  7CPA A;  2J8M A;  4LUA A;  4QB9 A;  5BWA B;  5D1P A;  1YIJ Z;  4KOT A;  2GU2 A;  1BOB A;  2IJZ A;  4KOV A;  3IIB A;  2VPW A;  4DNC A;  4MY0 A;  2VPX A;  1FDO A;  1Q86 2;  4M6I A;  1YME A;  4ZY1 A;  5JQ4 A;  4A3C I;  1Y9W A;  4XNH B;  2GRE A;  1TKH A;  3S6H A;  4ZYQ A;  4NB8 A;  3CCV Z;  3KHZ A;  4LQG A;  4L8A A;  1YI2 Z;  1F2P A;  5ISV A;  3CD6 1;  2R6M A;  3PZJ A;  3GYA A;  4CYN A;  4Y49 C;  4RS2 A;  2PVW A;  2PJA A;  3R95 A;  2AE6 A;  4PSX A;  2REE A;  3BG0 B;  1YQE A;  5F48 A; 
#chains in the Genus database with same CATH homology
 3KHX A;  2V77 A;  3GLJ A;  2PIZ A;  5IB9 A;  3K9T A;  5T64 A;  5D1O B;  3FED A;  3F3F C;  2JBJ A;  2PIY A;  3QWU A;  4H2K A;  2PMZ A;  1VQ9 Z;  2OOY B;  2GTI A;  2AFM A;  2JEW A;  2Q51 A;  4A3F I;  2V8I A;  3RZO I;  4OME A;  3FF3 A;  2PJ3 A;  2ZEL A;  3CME 1;  5C44 I;  5K8N A;  4G1P A;  1LAN A;  2QRD B;  1IY7 A;  3FEE A;  2QKD A;  1TWC I;  3GTM S;  1VQL 1;  3CCJ Z;  4DJL A;  4NGN A;  5I4M A;  6CPA A;  1VQP 1;  3D4U A;  5LRG A;  3S9M A;  3EER A;  1RTQ A;  1X3Z A;  3BXM A;  1ARM A;  3S15 I;  4ONW A;  2E2H I;  1YHQ 1;  4RVG A;  1I50 I;  4OC1 A;  3B3V A;  5T67 A;  1ELM P;  4E31 A;  3CC7 Z;  4A3D I;  1KC8 2;  3VMG A;  2IZ3 A;  1Q81 1;  4NGQ A;  3CCL 1;  2F7V A;  4P4D A;  2Q4Z A;  3CCS 1;  2V8G A;  3OW2 Z;  2JR6 A;  4KSI A;  2QR1 B;  4A3L I;  4MHY A;  1I6H I;  4BBS I;  2NVY I;  5AN9 F;  3HOY I;  2XEJ A;  4F8Z A;  3WC6 A;  1VQ9 1;  4UEZ A;  3GTO I;  2QRC B;  2AFU A;  4NB9 A;  1XMB A;  2ZEH A;  5CM2 M;  3IJ3 A;  3CXC Z;  4JYW A;  4E33 A;  3GKQ A;  2F8H A;  1KQS Y;  3CME Z;  3VTN A;  3SI0 A;  5A2Q f;  2LFU A;  2ZAE B;  1VQN 1;  5HVF A;  1VQN Z;  2R92 I;  1VQ6 1;  4MRI A;  4Y7N I;  3Q87 A;  2JBK A;  3IO1 A;  4S1T A;  1YHQ Z;  3J81 b;  2AFX A;  1VQM Z;  4NBG A;  3WC5 A;  5FLX b;  3PB9 X;  1LQL A;  3NDJ A;  2NVQ I;  3CC7 1;  2QA4 1;  1S72 1;  1S72 Z;  2QA4 Z;  3G6E Z;  2AFO A;  5LYD A;  3NDI A;  3D6W A;  2RIQ A;  3KI9 A;  4NGS A;  4P4J A;  4UEE A;  1R9T I;  5CBM A;  3WC7 A;  3KL9 A;  4NH1 C;  3F3P C;  3VAR A;  2P28 A;  3IF8 A;  2XEG A;  3PRT A;  4Z65 A;  3S1N I;  2WYR A;  2ZOG A;  2H85 A;  4MCR A;  3KIH A;  1NJI 1;  1ZLI A;  2ZED A;  3FVL A;  3IX0 A;  3I07 A;  4P4I A;  3FQQ A;  1Q7Y 2;  2JMO A;  2ABZ A;  1Z8L A;  5LYL A;  1S7M A;  1PCA A;  3KQX A;  1JWH C;  5D1O A;  3CCM Z;  1EE3 P;  1UWY A;  3B7I A;  2F4M A;  4MD7 A;  1YW6 A;  3KR5 A;  1XFO A;  1RQF A;  1QF8 A;  3FQM A;  5LRK A;  3ISX A;  2JS4 A;  3VMI A;  3B3T A;  4F9V A;  2QYV A;  2O4H A;  1YSJ A;  3CPA A;  1JJ2 Z;  1K8A 1;  2OR4 A;  1K73 1;  4W9Y A;  3CCQ Z;  1VQO 1;  1RO4 A;  2YU9 I;  3S14 I;  2ZEN A;  2PJC A;  2DE6 A;  3TC8 A;  1QVF Z;  2PCU A;  3S9L A;  2PVV A;  1PFT A;  1KD1 1;  1TKJ A;  3RAM A;  2O53 A;  1K8A 2;  4FAI A;  1XJO A;  1RNI A;  1DL6 A;  4BY1 I;  3GCF A;  3CCM 1;  1CBX A;  4NGM A;  1RO2 A;  3LWU A;  3M3Y I;  2AFZ A;  3CCV 1;  3MZK B;  3CDX A;  4YU9 A;  3H8E A;  3CPX A;  4A3K I;  1YUA A;  1VHO A;  2NVX I;  5DS0 A;  4RVF A;  4OC2 A;  4RV9 A;  3I55 1;  1HDU A;  4NBC A;  5C3E I;  2GLJ A;  1AYE A;  4P4B A;  3G4S Z;  1LCP A;  1JQG A;  3MRU A;  2PE3 A;  3GTP I;  1VQ5 Z;  3PBE A;  4ZX8 A;  3S17 I;  4XX2 A;  3HOX I;  5A2Q b;  4B6Z A;  3CCE 1;  4NBH A;  4A39 A;  2G9D A;  2CTB A;  4OID A;  3M4O I;  3TX8 A;  4DK1 A;  2EGT A;  4FWU A;  4NGT A;  3H8F A;  2PM9 A;  3HLP A;  2R93 I;  4R8F A;  3P5J B;  3CCL Z;  4NGP A;  4PXE A;  1Y1V S;  2W03 A;  1X3W A;  1Q82 1;  4P44 A;  4R76 A;  3D7H A;  1Y0Y A;  1LFW A;  4ZY0 A;  3NFZ A;  3FEC A;  3PFE A;  3GTL I;  2BOA A;  3CT9 A;  4P4E A;  2CF4 A;  2CTC A;  2F4O A;  4BBR I;  2KI7 B;  1YI2 1;  2C6G A;  4UF4 A;  1YW4 A;  5CPA A;  5IP9 I;  3KR4 A;  3HOU I;  3SJF A;  1WCM I;  1VQL Z;  4MCS A;  4X2T A;  4PPZ A;  4IK2 A;  1LAP A;  1VQ5 1;  3H8G A;  1TXR A;  2R7Z I;  3NH5 A;  4OC4 A;  4PXD A;  4DUK A;  4UIA A;  3CC4 1;  4OC5 A;  1KRL A;  4MMO A;  4NJR A;  3FJU A;  1ZB8 A;  2OTL 1;  4DYO A;  2DE5 A;  1QYP A;  4P4F A;  2LIY A;  1Q82 2;  1VQK 1;  4MCQ A;  5D8N A;  4A3E I;  1QVG Z;  2VUM I;  3OW2 Y;  5JGF A;  2EWB A;  4IHM A;  1KWM A;  2ZEF A;  4A94 A;  2VF1 A;  4CL1 A;  3S1Q I;  5JH9 A;  1R3N A;  4HGZ A;  4UIB A;  1Z03 A;  2PJ4 A;  1KD1 2;  2ZEE A;  4EFD A;  3SI2 A;  1ELL P;  3PEI A;  4CPA A;  1Q7L A;  1Z2L A;  3CQZ I;  2K5R A;  1PYT B;  3HKZ A;  3BG1 B;  3LUS A;  1VQ6 Z;  4A3G I;  2PJ6 A;  2J9A A;  2PJ5 A;  3L2N A;  2NSM A;  3I1U A;  1L1O C;  2OTL Z;  2BJO A;  3JAM f;  3CC4 Z;  3LMS A;  2V8K A;  1VQ4 Z;  2AFS A;  4F9U A;  3GTK I;  3RZD I;  3MN8 A;  2P3Y A;  2K3R A;  3D9X A;  3B35 A;  2QEX 1;  3IC1 A;  3V38 A;  1Q7Y 1;  2VL1 A;  3J81 f;  3FKI I;  3K2K A;  3IEH A;  1NJI 2;  3NH8 A;  1XRY A;  3NH4 A;  3B3C A;  5THW A;  3HOV I;  3HOZ I;  3B2Y A;  2QLV B;  4MHZ A;  4OC0 A;  2RT9 A;  4DGL A;  3JRU A;  2WAQ A;  4MD9 A;  1TF9 A;  2EK8 A;  2IMO A;  3PBB A;  1K73 2;  1QVF Y;  1QMU A;  1YIJ 1;  4NFR A;  3FH4 A;  1Y1V I;  4A3B I;  3U50 C;  5K8P A;  3GTG I;  3KAS A;  4AYB A;  4MCP A;  2HB6 A;  1N2F A;  2PK7 A;  3CC2 Z;  3CC2 1;  2RPR A;  1NUI A;  2QJ8 A;  1LOK A;  3JAM b;  2E2I I;  3I56 1;  1N8R 1;  3I56 Z;  3CPW Y;  4QTT A;  4X6A I;  1RO0 A;  1YUK A;  2DEA A;  2QEX Z;  3D7D A;  4Q7A A;  1TKF A;  3ESW A;  4OIW A;  3CCR 1;  3GB0 A;  3RZA A;  1VLA A;  1BPM A;  1Z5R A;  3CXC Y;  2POK A;  5JM6 A;  5K8M A;  2VUG A;  3GTM I;  2C6C A;  2OTJ Z;  4R7M A;  1ZH1 A;  4TWE A;  1K83 I;  3D7G A;  2JNY A;  1CPX A;  2G2K A;  3BI0 A;  4RVH A;  1AMP A;  3SI1 A;  1CPS A;  2BO9 A;  2V8J A;  3T4N B;  5C4J I;  1F2O A;  2B63 I;  2JA6 I;  2QRE B;  3G4S 1;  3J7A 4;  3PO3 I;  4HH4 A;  2Y0S A;  2QVP A;  1YJW Z;  1HDQ A;  3KZW A;  2HU9 A;  1ZG9 A;  3GUX A;  1YJ9 Z;  1KQS Z;  4E30 A;  5LRJ A;  2V8H A;  5IT9 f;  4X8I A;  4AXV A;  2JA7 I;  4BD9 A;  1YJN 1;  2CIJ A;  3B3W A;  2XEI A;  3KQZ A;  3J80 b;  1NP6 A;  4PQA A;  3K7A I;  5IT9 b;  1USP A;  1W2B Z;  3S1M I;  4IAV A;  1KC8 1;  3CCS Z;  3S16 I;  4P10 A;  2YAD A;  2FVG A;  1M1K 1;  3SJX A;  2RHB A;  3ISZ A;  1CX8 A;  2JA5 I;  3FX6 A;  3EED A;  4MON A;  3MON A;  1WW9 A;  1NSA A;  2RB7 A;  1WII A;  1R43 A;  4MHN A;  3DGV A;  3FMC A;  2M48 A;  4RVD A;  4MHP A;  1BPN A;  4K3N A;  3CCU 1;  4A37 A;  1OBR A;  2KPI A;  4MH4 A;  2EK9 A;  3CCJ 1;  5K8O A;  1VQO Z;  3I4M I;  2J6A A;  2JA8 I;  1Y1W I;  4FBE A;  3CCE Z;  1VGY A;  3S2D I;  3MZL B;  1RLY A;  4NOZ A;  1VQM 1;  1YJ9 1;  3NA6 A;  3V7Z A;  1YJW 1;  1F57 A;  5HVG A;  1VQ4 1;  1ARL A;  1YJN Z;  3SJG A;  3S2H I;  1YLO A;  3CPW Z;  3IFE A;  3WAB A;  3WT4 A;  4A38 A;  5HXD A;  1VQ8 Z;  2ZEM A;  2PJ0 A;  1TWH I;  3PB6 X;  2HF1 A;  1M4L A;  3PO2 I;  1ML8 A;  1TWA I;  4EME A;  4UEF A;  1JJ2 Y;  2IZ4 A;  3QNV A;  4X3R A;  5C4X I;  4PXB A;  4NBD A;  2OZK A;  2OOX B;  4NJQ A;  1M90 1;  3PB4 X;  1Q86 1;  1TWG I;  3CCU Z;  4OKO A;  4A3J I;  1QQ9 A;  4E2Z A;  3TE5 B;  4ZY2 A;  5D29 A;  1Y7E A;  3CMA Z;  3CMA 1;  5LYF A;  1DTD A;  1FT7 A;  1YIT Z;  2XEF A;  1GYT A;  3IWW A;  2HC9 A;  4BXX I;  5ELY A;  4E32 A;  2PJB A;  4WWV A;  2JUB A;  2PJ8 A;  4A93 I;  3BI1 A;  4DQY B;  1SFO I;  3HOW I;  1BLL E;  1VHE A;  5LL6 f;  4A3I I;  3G6E 1;  3B3S A;  3PFO A;  2V8V A;  4FUU A;  3VAT A;  1HEE A;  1VQ8 1;  3H0G I;  2PJ1 A;  4YWY A;  3VMH A;  1K9M 2;  1BAV A;  1ZLH A;  4Y52 I;  4NBF A;  3G71 1;  4NBB A;  3D68 A;  4R6T A;  5LYI A;  3S1R I;  4ZX9 A;  1QVG Y;  5J1Q A;  4OP4 A;  3H3V J;  3J80 f;  4TNU A;  1ZG8 A;  2OTJ 1;  2I3C A;  4E2X A;  1DE4 C;  2PJ7 A;  1TF8 A;  2RFH A;  1Q81 2;  2ZEP A;  3KIF A;  1VQP Z;  1FNO A;  1M1K 2;  5F09 A;  5HVH A;  5T6B A;  1YIT 1;  4JZ0 A;  2Q43 A;  1TWF I;  3I55 Z;  2ZEO A;  4GM5 A;  3CCQ 1;  1H8L A;  2C6P A;  3DLJ A;  3IFU A;  2E9H A;  1VQK Z;  3RBU A;  4MD8 A;  2V8D A;  4WJB A;  2C1C A;  2ANP A;  4RUH A;  5FLM I;  1W2B Y;  3G71 Z;  1CP6 A;  3GTJ I;  4E2W A;  3PB7 X;  4OC3 A;  4BY7 I;  1Z02 A;  3T8W A;  2ZEG A;  4E2Y A;  4P45 A;  1P9N A;  3D67 A;  2DE7 A;  2GTH A;  4EWT A;  2PRQ A;  2OOT A;  7CPA A;  1Y0R A;  3I4N I;  1Z01 A;  3D66 A;  4EWC A;  3KGQ A;  4P6Y A;  4MXU A;  5D1P A;  1YIJ Z;  3CD6 Z;  1VIX A;  2GU2 A;  3PO3 S;  3PB8 X;  2IJZ A;  3S9N A;  3SJE A;  4RS4 A;  1XBU A;  3IIB A;  1TFI A;  2E2J I;  2AFW A;  2W04 A;  4ZI6 A;  2WZN A;  1I3Q I;  2WB1 A;  3VB9 A;  4NGR A;  3D7F A;  2ZOF A;  8CPA A;  1LAM A;  4QTU A;  1CG2 A;  1Q86 2;  2NVT I;  1N8R 2;  4NBA A;  1YME A;  1ZG7 A;  3CCR Z;  2GLF A;  2IQ6 A;  4ZY1 A;  1K9M 1;  4A3C I;  2GRE A;  2M6N A;  2AKL A;  1TKH A;  2RBL A;  4ZYQ A;  1USP B;  4NB8 A;  3VH9 A;  2BCO A;  3CCV Z;  4A3M I;  3KHZ A;  5FLX f;  2NYQ A;  4PXC A;  4LQG A;  1YI2 Z;  1F2P A;  3CD6 1;  5IP7 I;  1X0T A;  2R6M A;  1CP7 A;  2PJ2 A;  4NBE A;  2PVW A;  2PJA A;  2PJ9 A;  3N5F A;  1M90 2;  4O23 A;  1VQ7 1;  1VQ7 Z;  1IGB A;  3TDH B;  1ZB9 A;  3HUV A;  3BHX A;  3BG0 B;  4HGY A;  3GTQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...