4TNUA

Human brain aspartoacylase mutant y231c complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDCPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4tnuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4tnuA01
4PXCA 4K3NA 3D7FA 5HVGA 5THWA 2I3CA 4PXEA 3MN8A 4OIWA 2PJ3A 4LQGA 5HXDA 3KI9A 4WWVA 4X3RA 2PJBA 1CP6A 4IHMA 5LRJA 1ELMP 1LOKA 4FUUA 3KZWA 4P4FA 3WC6A 2GU2A 2J9AA 3K2KA 4BD9A 3H8EA 1YMEA 4P4IA 2JBJA 2PJ2A 3NA6A 4EMEA 1F2OA 4MCRA 3WABA 3BI0A 1UWYA 3NH8A 1KWMA 4MHZA 2ZEMA 5D8NA 2V8GA 4OC3A 4F8ZA 3KASA 4ZYQA 2V8DA 4P4JA 3VH9A 2AFZA 3FF3A 4F9UA 1JQGA 3DGVA 4JZ0A 5LYIA 4R7MA 4A94A 1ZG8A 1LANA 1ZLHA 3D67A 4X2TA 3S9NA 4YWYA 4PXBA 4NGPA 4R76A 3KL9A 3IEHA 2CTBA 4P4DA 1VHOA 4F9VA 4P45A 2ZOFA 1ZG7A 5LYFA 2V77A 3B3TA 1FNOA 3N5FA 3MRUA 2ZOGA 2PJ5A 3B35A 2O4HA 4ZI6A 4MHNA 2ZENA 1HEEA 5LYDA 4ZX8A 3GB0A 5HVHA 2Q4ZA 2EWBA 2EK8A 2IQ6A 1HDUA 4UF4A 4MMOA 2AFUA 2XEGA 2CTCA 3FX6A 3QNVA 3IC1A 5ELYA 4PXDA 2ZEPA 4P4BA 2AFXA 1YSJA 4UIAA 4G1PA 2BO9A 3PBEA 3PB4X 4UIBA 5DS0A 5F09A 3SJGA 2ZEFA 3BHXA 3PB6X 4JYWA 1XJOA 4EFDA 2AFMA 8CPAA 4OP4A 4ZY2A 2NSMA 2JEWA 4P4EA 4FAIA 5JH9A 2ZEGA 1TKFA 2XEIA 2VL1A 4OC2A 4MRIA 3PFOA 3TC8A 4IAVA 4OC1A 1LAPA 2AFWA 4WJBA 3FJUA 1YW6A 3D7DA 1PCAA 2POKA 3SI1A 4A38A 4EWTA 2ANPA 3SJXA 1ARLA 1GYTA 3LMSA 1QMUA 4OC5A 1YLOA 4H2KA 4NGNA 3V7ZA 2F7VA 4MCSA 1VGYA 3T8WA 2ZEHA 3FEDA 1LAMA 1OBRA 4OC0A 2AFOA 1Z8LA 2Q43A 3SI2A 5CBMA 2PVWA 2PIZA 3FVLA 4MCQA 1ARMA 1BLLE 4W9YA 1TKHA 3PRTA 1QQ9A 3K9TA 5K8PA 4DJLA 3FEEA 4UEEA 2PJAA 4OMEA 4MHPA 1PYTB 4MXUA 3B3SA 4DUKA 1Y7EA 3D4UA 5IB9A 2PCUA 6CPAA 1Y0RA 3CPAA 2GLJA 3B3CA 4PPZA 3HLPA 3PB8X 1TKJA 4R8FA 4ONWA 3VARA 1VIXA 3CDXA 3SJEA 2PIYA 4TNUA 4B6ZA 3GUXA 1XRYA 3LWUA 3S9LA 5CPAA 1EE3P 3IO1A 1BAVA 1RTQA 3PBBA 3H8FA 1TXRA 3DLJA 3FMCA 4P44A 1ELLP 1ZLIA 2EK9A 5J1QA 2RFHA 2PJ0A 1VHEA 4NFRA 1DE4C 4YU9A 3JRUA 3IIBA 1ZG9A 5LRGA 1XMBA 3B7IA 4NGMA 4FBEA 4RUHA 2ZELA 3FECA 2CF4A 4NGRA 3L2NA 3HUVA 2FVGA 7CPAA 3I1UA 1F2PA 3SJFA 1IGBA 3D7HA 5JM6A 4NJRA 4ZY1A 1TF9A 1Z2LA 1BPMA 4TWEA 1CP7A 4P6YA 2XEJA 2PJ8A 3ISXA 4ZY0A 2QYVA 1F57A 2PJ1A 2OOTA 1FT7A 4NGTA 1NSAA 4UEZA 2PE3A 2BOAA 5LYLA 4Q7AA 4Z65A 1TF8A 2NYQA 3PB7X 3PFEA 5LRKA 1IY7A 3PEIA 2PRQA 5K8NA 5I4MA 4MHYA 4GM5A 5K8OA 3RZAA 4MCPA 4UEFA 2WZNA 2GLFA 3WC5A 1XFOA 1AMPA 5K8MA 4OC4A 4KSIA 3GLJA 3H8GA 3KGQA 3BI1A 3RBUA 2QVPA 3IWWA 1CPXA 1Z5RA 4AXVA 4IK2A 3S9MA 2CIJA 3PB9X 2G9DA 3B2YA 1HDQA 3IFEA 2PJ6A 3ISZA 3WC7A 3KHZA 3NH5A 2JBKA 4A37A 5HVFA 1LFWA 2DEAA 1R43A 4R6TA 3D66A 1H8LA 1M4LA 2V8VA 1CPSA 2HB6A 1Q7LA 3CPXA 2C6CA 4NGSA 4DYOA 2PVVA 2PJ4A 2ZEEA 4OKOA 3SI0A 4NJQA 2HC9A 1Y0YA 2ABZA 2V8HA 2XEFA 3TX8A 2BCOA 4O23A 1CBXA 2C1CA 2C6GA 3D68A 1LCPA 5D29A 1BPNA 2GREA 3KHXA 2RB7A 3B3WA 3KQZA 4FWUA 2O53A 4ZX9A 1R3NA 2PJ7A 1CX8A 2ZEDA 1DTDA 4CPAA 2WYRA 3KR4A 3B3VA 2AFSA 3KR5A 2PJCA 1AYEA 3IJ3A 3NFZA 2F8HA 2OR4A 2ZEOA 4A39A 1YW4A 2Q51A 3VATA 3KQXA 2IMOA 3FH4A 3D7GA 2IJZA 2QJ8A 3BXMA 4X8IA 1CG2A 4PQAA 3V38A 4P10A 3RAMA 3WT4A 3NH4A 3CT9A 2C6PA 2PJ9A 1XBUA 5JGFA 4NGQA 4OIDA
chains in the Genus database with same CATH superfamily
3HOVI 3CMEZ 3I9SA 1QSRA 2Q7BA 1YJNZ 4LQGA 2ZW5A 3VB9A 1XEBA 4QC6A 4HNYB 4BBSI 1ELMP 2FIWA 4JWPA 3FBUA 3WC6A 4QBJA 2W04A 2FXFA 4A30A 2FE7A 5G22A 3H8EA 4PSXA 1VQ51 3FB3A 3Q87A 1Z4RA 3CQZI 1R9TI 2JBJA 4B11A 3B8GA 3RNZA 3OW2Z 3H0GI 1K732 1S72Z 4OC3A 4F8ZA 3BG0B 3EERA 4P4JA 4F9UA 1JQGA 2VZYA 3CC41 3MONA 5AN9F 4NGPA 4PXBA 4R76A 1KRLA 3KL9A 2OZHA 2R7HA 3CCLZ 2CTBA 1IB1E 4P45A 1ZG7A 5E96A 1I12A 3M4OI 4NBGA 1I21A 5IP9I 3N5FA 4RVDA 4KOUA 2BSWA 1HEEA 4R3KA 4CGMA 5HVHA 4EVYA 1NMTA 4HKFA 2AFUA 4R3LA 2XEGA 3FX6A 2REFA 3QNVA 3MZKB 3QAYA 1VQ61 1X12A 3PBEA 2FIAA 4UIBA 2B3VA 5F49A 3BHXA 3EFAA 1Q811 4JYWA 1XJOA 3GTOI 8CPAA 1L0CA 4ZY2A 1M4GA 2RC4A 3CME1 2XEIA 2VL1A 4OC2A 2Q0YA 1WK4A 3TC8A 3VWEA 4UCPA 3D7DA 4RV9A 1I1DA 4HNWB 4EWTA 1GYTA 3PGPA 5C44I 4H2KA 1VQPZ 3K7AI 2JNYA 1JWQA 1VQMZ 2DE6A 5H84A 1S60A 1UFHA 1Z8LA 1X3ZA 2OZKA 2JA6I 3SI2A 5CBMA 1CJWA 4MY0A 1IICA 3R9FA 2VQYA 1ZO0A 4MCQA 1ARMA 3K9TA 4UEEA 2PJAA 3CCU1 4YRHA 4IF5A 3HOWI 5C4JI 4KUAA 3QB8A 1PYTB 1VQ8Z 1M4IA 3S6KA 2X7BA 2ATRA 2P6FA 3TT2A 5FLXf 2K3RA 5AGEA 1YVKA 1Y0RA 4BXXI 3BJ7A 2GLJA 1R57A 4PPZA 4CGLA 1QVFY 4RS2A 4R8FA 3CD6Z 1M1DA 2R7ZI 5EMIA 4MBUA 4F0XA 2P3YA 3TTHA 2BUEA 4NBDA 2E2JI 1QSOA 2QEXZ 3FRMA 2QKDA 4NFRA 3F0AA 5LRGA 1XMBA 4RVGA 3CXCZ 2D4OA 4NGRA 3L2NA 3EXNA 2AKLA 1F2PA 3SJFA 1IGBA 3D7HA 1S5KA 1VQO1 4NJRA 1KD12 2B58A 1TF9A 4U9ZA 1Z2LA 1S3ZA 4QB9A 2V8IA 4AG9A 2OH1A 2GTHA 4AVBA 1F57A 4CAXA 2IZ3A 3K9UA 1NSAA 3CXQA 4ORFA 5KTCA 3RZDI 3T90A 4CYQA 5FLMI 5LRKA 2Y0MA 3PEIA 4MHYA 2JS4A 1USPB 4HNXB 3CCQ1 3WC5A 3GKRA 4KSIA 1KC82 3H8GA 4E2AA 1X3WA 4LUAA 3IWWA 1QXFA 1KQSY 2NMTA 1YIJ1 4KVOE 3I4MI 4AXVA 1K8A2 2G9DA 3B2YA 1YVOA 3TOBA 2PJ6A 3I561 4NBFA 4C7IA 2JBKA 3IWEA 1YIT1 3S6HA 2DEAA 4R6TA 2QA41 3ESWA 1RXTA 3LD2A 4NJQA 1VQ5Z 1K9M2 2BCOA 1CBXA 2C1CA 4KS9A 5D29A 1BPNA 2FL4A 2JA8I 3CXSA 2ZW7A 5HMNA 3B3VA 1K9M1 3IFUA 1AYEA 2ZEOA 2OR4A 4CYPA 3H5ZA 3G71Z 4C2YA 4K30A 3RYOA 3N7ZA 1Q862 2IJZA 4E2ZA 1CG2A 1JWHC 4B12A 3TO7A 4LX9A 2C6PA 2PJ9A 1XBUA 2G3AA 2ZPAA 4PXCA 1MJ9A 4K3NA 5HVGA 4A3DI 3GYAA 4PXEA 3D8PA 3GTMS 3MN8A 4OIWA 4S1TA 2JIMA 3I551 3LODA 1M1K1 1B6BA 4NF1A 2R98A 4WWVA 2VUGA 3TDHB 1M902 4X3RA 1TWGI 4MI4A 1CP6A 4R87A 3KIFA 3KZWA 2H5MA 5KTAA 1KC81 2J9AA 4BMHA 4BD9A 1YI21 1YMEA 4RN7A 1IYLA 1M901 3R1KA 1X10A 4IUSA 4NCZA 3GIUA 4KLVA 2VI7A 4E30A 3QAHA 1F2OA 3BI0A 5D8NA 3BJ8A 3KKWA 5AG6A 4E2XA 2O28A 2AFZA 1K83I 2KPIA 1Y9KA 5LYIA 4R7MA 1ZG8A 4JXRA 4YWYA 3IU1A 3CCM1 3OW2Y 2WB1A 1TWAI 4YFJA 3HOXI 2YU9I 5IV0A 3LACA 2ZOFA 3R9EA 2V77A 1FNOA 1QSNA 1Q861 3HKZA 1ON0A 4PV6A 4UFVA 2RIQA 1I3QI 1QF8A 4Y52I 4FD4A 2Q4ZA 2EWBA 2EK8A 3HOUI 4PSWA 2VBQA 4XNHB 2CTCA 2PR8A 2I00A 3IC1A 3DR8A 4Q38A 5ELYA 4KOTA 1Z8WA 2Q44A 1IOFA 5T6BA 3JTKA 4ZGYB 2AFXA 4CAWA 3D6WA 4UIAA 1RO5A 1DL6A 4KVME 3W6XA 1Z8XA 5LL6f 1QSTA 3PB6X 1P9NA 1QSMA 1Y9WA 1Y7RA 2AFMA 4UCNA 2NSMA 3FQMA 2JEWA 2EBJA 5JH9A 2R93I 3WR7A 3GTJI 1NUIA 1S7MA 4MRIA 3I55Z 3IGRA 1FDIA 2R8VA 2JLMA 2HU9A 2POKA 3J80b 4A38A 3SJXA 3A9LA 4OC5A 3CCL1 1YLOA 4QVTA 3EEDA 4NBCA 3T8WA 4B13A 2ZEHA 3FEDA 4OLLA 2C27A 2AFOA 4KUBA 1Z03A 2Q43A 4Q36A 2GE3A 1VQN1 2JA7I 2PIZA 3FVLA 1VLAA 4ONUA 4A3EI 3PRTA 1QQ9A 1CM0A 1YGHA 4B10A 2QECA 1I50I 3IWGA 2VPYA 3CCV1 2YNCC 4MXUA 1Z02A 1YUKA 2F4OA 1TWFI 2OOXB 5IB9A 1JJ2Z 2PCUA 1Q7Y2 4A3KI 1GHEA 6CPAA 3FYNA 1N71A 4OADA 4A3LI 3B3CA 3HLPA 4A33A 2PSWA 4A3BI 3VARA 4ONWA 2JDCA 2PIYA 5AG5A 3I3GA 4B6ZA 2EO8A 4BY1I 3S9LA 2HUZA 3IR7A 1YHQ1 5DWNA 4A3JI 3DLJA 4P44A 4QTTA 1ZH1A 1ELLP 3I07A 3CCR1 5J1QA 3S1MI 2PJ0A 1DE4C 4YU9A 3JRUA 4E8OA 4GS4A 2VPXA 4LQ6A 3GTGI 5IT9b 3B7IA 4PK3A 4KVXA 4FBEA 4RUHA 2ZELA 2NVTI 2PMZA 1P4NA 5I0CA 5IP7I 3VWDA 4CAVA 4FD5A 4X5KA 2DPSA 2OTJ1 4NH1C 4ZY1A 4EWCA 4TWEA 4E32A 1OZPA 3SHPA 4P6YA 5D1PA 3DDDA 2PJ8A 3ISXA 3GKQA 2QYVA 1U6MA 2BOAA 1FY7A 1X0TA 4JD6A 3TOAA 4M6IA 4Z65A 2Z3LA 1TF8A 5EBVA 1YREA 2IV2X 4NOZA 1VQK1 1Z8TA 1IY7A 2PRQA 3SXOA 2H85A 5K8OA 4H6ZA 3RZAA 4MCPA 3LUSA 4UEFA 2NVQI 4E31A 2V3VA 2AYDA 4UWIA 1AMPA 4CAFA 3G8WA 3FQQA 2HV2A 1ZB8A 4A3CI 2OZUA 4BBRI 4XPDC 1BOBA 2D4PA 1CPXA 2PC1A 3S9MA 2CIJA 3PP9A 3PB9X 2Z10A 4AVCA 2P6EA 3ISZA 1Q812 3KHZA 3NH5A 1QVGY 3G4SZ 1Y1VS 1LFWA 4II9A 4M85A 5BWAB 4NEXA 4Y49B 1CPSA 1Q7LA 2DXQA 3CPXA 4B5PA 4DYOA 2PVVA 1Q7Y1 3TO6A 4L89A 4CGNA 4JLYA 3FNCA 2BL1A 1WJ2A 2Q4YA 3NE8A 4O23A 2C6GA 2PR1A 1LCPA 3DR6A 1AUGA 3J7A4 2GREA 1S7LA 2RB7A 3KHXA 1MJBA 3PO3S 2ZEDA 4DNCA 4CGOA 2F8HA 3CMA1 4A39A 5A2Qb 3VATA 3KQXA 2IMOA 3J80f 2IL4A 4MFZA 2QJ8A 2YNDA 2JA5I 2DE7A 2VEZA 1VHSA 3IU2A 4MFJA 2B5GA 3D7FA 5THWA 1YX0A 2JUBA 3D9XA 3CCE1 1USPA 1NE9A 1K8A1 4XNHC 3MGDA 2Q4VA 3W91A 3KI9A 3P5JB 2PJBA 5LRJA 1LOKA 4FUUA 2G0BA 5G20A 1A2ZA 4B5OA 2GU2A 4UBRA 4QUSA 4FD6A 1M4DA 3NE7A 4MH4A 3PO2I 2OB0A 1YLEA 4P4IA 2FT0A 2Z3PA 2PJ2A 3NA6A 4B5PB 4CAEA 4X6AI 2F4MA 4MCRA 3PO3I 4MFPA 1IU8A 1UWYA 3CC4Z 5T67A 3EO4A 1KWMA 2ZEMA 2VUMI 3FIXA 4A93I 3S1NI 2VZZA 1VQ81 3D3SA 3KASA 2V8DA 3VH9A 1M1K2 1LQLA 3DGVA 4JZ0A 5GCNA 1LANA 1ZLHA 3D67A 5A2Qf 2QRCB 3IEHA 4F9VA 2DF5A 5LYFA 3B3TA 4NBEA 3EY5A 2CXAA 3UY5A 4A32A 2O4HA 1VQ9Z 2JDDA 1VQNZ 5FLXb 5LYDA 3S17I 2QEX1 3GB0A 1PUAA 2A4NA 2Y0SA 1J4JA 3CC21 1YR0A 2HQYA 1HDUA 4UF4A 4MMOA 4XPKA 2DE5A 4B14A 4AB7A 4UFWA 5D1OA 4PXDA 3S6GA 4P4BA 3NDIA 3GTQI 4G1PA 2BO9A 1VQ71 3PB4X 3PZJA 5F09A 1XOVA 3TCVA 2ZEFA 2V8KA 1I6HI 3R96A 4KSFA 4EFDA 4UCMA 3E0KA 3ZJ0A 1Y1WI 4NBBA 5A27A 4Y7NI 4OP4A 2YADA 4P4EA 4FD7A 1LAPA 2AFWA 4WJBA 2J8NA 3FJUA 1YW6A 1N2FA 3W6SA 4RS4A 1WWZA 4CS0B 3H4QA 5EC4A 1W2BY 1RO0A 3P2FA 1QMUA 4JJXA 3V7ZA 2OTLZ 2Z11A 3CCS1 3CCEZ 4OC0A 1P0HA 1RQFA 2QA4Z 2OTJZ 1QYPA 1VQM1 3GY9A 4W9YA 1TKHA 4C68A 3IF8A 4DJLA 3S15I 3FEEA 3J81b 4MHPA 2FSRA 4H6UA 4DGLA 3B3SA 3T9YA 1Y7EA 3D4UA 3OWCA 2QMLA 3GCFA 4C2ZA 2HF1A 4XPDB 3PB8X 1TKJA 1VIXA 3SJEA 1ML8A 1NP6A 1MK4A 2Z3MA 1XRYA 4MONA 3LWUA 3CXCY 5CPAA 1EE3P 2B4DB 5F46A 4I49A 5DWMA 3H8FA 1TXRA 4L8AA 2QR1B 3CPWY 1ZLIA 2J6AA 4M3SA 3CC71 2KCWA 4HGZA 3IIBA 1PU9A 3JAMf 4NGMA 4M6HA 3F5BA 2E7ZA 4KORA 1IIDA 2PDOA 3I1UA 3HOYI 1VQ6Z 1VQ7Z 5JM6A 2Z0ZA 2Z3NA 4XX2A 2FS5A 3G6EZ 5C4XI 1XIXA 4ZY0A 3S1RI 2VPZA 4UA3A 3MZLB 2JIRA 2OOTA 2E2II 4UEZA 1NSLA 5LYLA 4Q7AA 2R6MA 3HOZI 4E2YA 1KZFA 4GXHA 2NYQA 3PB7X 4KOVA 4U5YA 5I4MA 4GM5A 2QRDB 1YJ9Z 2CY2A 1SQHA 1XFOA 3TO9A 1VQP1 5K8MA 4KOYA 4MD7A 4OC4A 2QIRA 3KGQA 2K5TA 3M3YI 5IB0A 3VMGA 3JVNA 3RBUA 4MJ8A 1W2BZ 1FDOA 1Z4EA 2ARHA 2FCKA 4MFKA 2P6GA 1Z5RA 4CL1A 1VQ4Z 4A3MI 1YITZ 4IK2A 2Q7SA 4DQYB 3S1QI 2LIYA 4ZBGA 5H86A 2RBLA 2GANA 3WC7A 3GTPI 2Z3KA 2Q04A 1YIJZ 2OTL1 4AYBA 5IT9f 2REEA 3CCMZ 1M4LA 1Q2CA 4UWJA 2HB6A 2C6CA 4NGSA 2RHBA 2PJ4A 3SI0A 4OKOA 1WZNA 2VPWA 4XPLA 2HC9A 1Y0YA 2ABZA 2V8HA 2XEFA 5A28A 3TX8A 4F6AA 4A31A 3VTNA 2YNCA 1K4JA 2G3TA 5F48A 1LRZA 4FWUA 2O53A 1VKCA 3KIHA 4ZX9A 4DK1A 1S721 2PJ7A 4CRZB 3CC7Z 5IX3A 4CPAA 3KR4A 1TFIA 5G21A 2AFSA 1YW4A 4E33A 3F3FC 1PFTA 3D7GA 4MFQA 4R9MA 1RNIA 1JJ2Y 4X8IA 2WSAA 4PQAA 3V38A 3WT4A 3NH4A 3CT9A 2PK7A 4BY7I 5JGFA 4YGOA 4OIDA 4H89A 2KI7B 1KUYA 3CCJZ 2I3CA 1AA6A 5CNPA 2OOYB 2LEXA 1VQ91 2PJ3A 2V45A 5HXDA 5G1ZA 3ZZIA 2ZW6A 2JIOA 1XMTA 4KLWA 5C82A 3RO0A 4IHMA 1SIWA 4P4FA 2LFUA 3BG1B 3BLNA 5JQ4A 4MD8A 3K2KA 5C3EI 2JIQA 1Z01A 1KD11 4NB9A 3TFYA 4EMEA 2VF1A 3WABA 3NH8A 2E9HA 4MHZA 2V8GA 2G2KA 5J8FA 3CCQZ 4ZYQA 3FF3A 5FVJA 1L1OC 3S2DI 4A94A 1BO4A 3CZXA 2ODFA 4KZTA 4X2TA 2PM9A 3S9NA 1YQEA 4AG7A 1KUVA 2JIPA 3JAMb 2ZAEB 2J8RA 1MJAA 4P4DA 1VHOA 4Y49C 2R1IA 2QLVB 3CCSZ 3MRUA 2ZOGA 2PJ5A 3B35A 2RPRA 4ZI6A 1YJN1 4MHNA 2ZENA 1YHQZ 3QWUA 2B3UA 1WW9A 3G3SA 4ZX8A 4CGPA 4E0AA 2IQ6A 3R95A 3CCUZ 2PQ8A 1Q2YA 1WIIA 2ZW4A 2WPWA 2DPTA 4PK2A 1Q2DA 1TIQA 2W03A 3G711 2ZEPA 1YSJA 2P0WA 3DNSA 1VQKZ 5DS0A 3F3PC 3SJGA 3IX0A 4C7HA 1XF8A 4HPSA 3SXNA 2J8MA 2B63I 3CD61 4JXQA 2AE6A 1B87A 3CCJ1 2V8JA 4FAIA 2ZEGA 1TKFA 3P2HA 4MFLA 1RO2A 3PFOA 4IAVA 2B5GB 4OC1A 2ZXVA 1RO4A 2CNMA 2QREB 1PCAA 2M48A 3SI1A 1K731 2ANPA 4F0YA 1TWHI 1ARLA 3LMSA 2Z3OA 2GTIA 1Z9UA 4NGNA 4MY3A 4A95A 2F7VA 4MCSA 2CNSA 2JEVA 5JPHA 1VGYA 2GIVA 1S7FA 1LAMA 1OBRA 4KSAA 4NSQA 3CCVZ 2CNTA 2EGTA 2PVWA 5D1OB 1BLLE 3G6E1 4HGYA 5K8PA 4A3FI 3TE4A 4OMEA 2R92I 4DUKA 1S7NA 4NB8A 1YI2Z 2YGWA 4NBHA 4M6GA 3CPAA 1YJ91 1YK3A 3CDXA 2BJOA 2WUUA 3CMAZ 4RVHA 4TNUA 3GUXA 3U50C 1N8R1 1Y8CA 3IO1A 1BAVA 1RTQA 1IOIA 3PBBA 3FMCA 4BINA 4HH4A 1VQ41 1SFOI 2EK9A 1N8R2 2RFHA 3J81f 2WAQA 1VHEA 4NXYA 1VQLZ 1ZG9A 3S16I 3GTKI 3I56Z 3RZOI 2RT9A 3FECA 4BBHA 3F8KA 2CF4A 3D2PA 3CCRZ 3HUVA 2FVGA 7CPAA 3V8IA 5HH1A 2VXKA 5F47A 4QTUA 4KOXA 4AVAA 2JR6A 1XE4A 4CYOA 4J3GA 1BPMA 1CP7A 3GTMI 5CM2M 2WPXA 2XEJA 3FXTA 1NJI1 2GFQA 1M44A 2EUIA 3TE5B 2PJ1A 2JMOA 1FT7A 4NGTA 2PE3A 4KOSA 3D2MA 3T4NB 2YNEA 3NDJA 3PFEA 1S7KA 1YJW1 5K8NA 3R9GA 5KTDA 2EVNA 3DSBA 1Y1VI 2WZNA 2GLFA 1IYKA 4E2WA 3JUWA 3GLJA 1YJWZ 3VMIA 3BI1A 1QVFZ 4UFXA 3S14I 4CYNA 2F5IA 2QVPA 1RLYA 3G4S1 1TWCI 4MHDA 2I79A 2PRBA 2B4DA 3CXPA 2B4BA 1HDQA 3FKII 3IFEA 5AG4A 5ISVA 2OZGA 4A37A 5HVFA 5J8CA 1NJI2 1R43A 2NVXI 3D66A 3EC4A 1H8LA 2OU2A 2V8VA 1QVGZ 4A3GI 1VQOZ 2IZ4A 4KOWA 2ZEEA 1WCMI 4MD9A 2E2HI 1Q821 1Q822 5C88A 1V0CA 3D2LA 3GTLI 4C2XA 2BEIA 4R57A 4A3II 5AG7A 3D68A 2K5RA 4U9YA 3H3VJ 4RI1A 3S2HI 3KQZA 3B3WA 4RVFA 1KUXA 2NAPA 4NBAA 1R3NA 1CX8A 1VQL1 3CC2Z 1DTDA 2WYRA 2AJ6A 2P28A 3KR5A 2M6NA 2PJCA 1Q16A 3S6FA 3IJ3A 3NFZA 3VMHA 1KQSZ 2Q51A 3C26A 3FH4A 3BXMA 3CPWZ 4CRYB 2NVYI 1YUAA 1ZB9A 4A2ZA 4P10A 3RAMA 4OAEA 5T64A 3I4NI 4NGQA
chains in the Genus database with same CATH topology
2KI7B 3HOVI 4K3NA 3D7FA 4PXCA 5HVGA 5THWA 3CCJZ 2I3CA 3CMEZ 4A3DI 4PXEA 2JUBA 2OOYB 3D9XA 3CCE1 3GTMS 1USPA 3MN8A 1K8A1 4OIWA 4S1TA 1VQ91 2PJ3A 1YJNZ 4LQGA 3VB9A 5HXDA 3I551 1M1K1 3KI9A 3P5JB 4WWVA 2VUGA 3TDHB 1M902 4X3RA 1TWGI 2PJBA 1CP6A 4BBSI 4IHMA 5LRJA 1ELMP 1LOKA 3KIFA 4FUUA 3KZWA 4P4FA 2LFUA 3BG1B 1KC81 3WC6A 2GU2A 2J9AA 2W04A 4MD8A 3K2KA 4BD9A 5C3EI 4MH4A 3H8EA 1YI21 3PO2I 1VQ51 1YMEA 4P4IA 1KD11 1Z01A 3Q87A 4NB9A 3CQZI 1R9TI 1M901 2JBJA 2PJ2A 3NA6A 4E30A 4EMEA 4X6AI 2VF1A 2F4MA 3OW2Z 1F2OA 3PO3I 4MCRA 3WABA 3BI0A 1UWYA 3CC4Z 3NH8A 2E9HA 5T67A 1KWMA 4MHZA 3H0GI 1K732 2ZEMA 5D8NA 2V8GA 1S72Z 2VUMI 2G2KA 4OC3A 4A93I 3S1NI 1VQ81 4F8ZA 3CCQZ 3BG0B 3KASA 4ZYQA 2V8DA 3EERA 4E2XA 4P4JA 3VH9A 2AFZA 3FF3A 4F9UA 1K83I 2KPIA 1JQGA 1M1K2 1L1OC 1LQLA 3MONA 3CC41 3S2DI 3DGVA 4JZ0A 4R7MA 5LYIA 1ZG8A 4A94A 1LANA 1ZLHA 3D67A 4X2TA 2PM9A 3S9NA 4YWYA 3CCM1 5AN9F 4NGPA 4PXBA 3OW2Y 4R76A 1KRLA 2WB1A 1TWAI 5A2Qf 2QRCB 3KL9A 3JAMb 2ZAEB 3IEHA 3CCLZ 2CTBA 3HOXI 2YU9I 4P4DA 1VHOA 4F9VA 4P45A 2ZOFA 1ZG7A 2QLVB 3M4OI 4NBGA 5LYFA 2V77A 3CCSZ 5IP9I 3B3TA 1FNOA 4NBEA 3N5FA 3MRUA 4RVDA 1Q861 2ZOGA 3HKZA 2PJ5A 3B35A 2O4HA 1VQ9Z 2RPRA 4ZI6A 1VQNZ 1YJN1 4MHNA 2ZENA 1YHQZ 5FLXb 1HEEA 3QWUA 2RIQA 5LYDA 1I3QI 3S17I 2QEX1 1QF8A 1WW9A 4ZX8A 3GB0A 4Y52I 5HVHA 2Q4ZA 2EWBA 2EK8A 2IQ6A 3HOUI 2Y0SA 3CCUZ 3CC21 1HDUA 4UF4A 4MMOA 2AFUA 2XEGA 2CTCA 3FX6A 1WIIA 3QNVA 2DE5A 3MZKB 3IC1A 5ELYA 2W03A 5D1OA 3G711 4PXDA 5T6BA 2ZEPA 4P4BA 3NDIA 2AFXA 1YSJA 3D6WA 4UIAA 3GTQI 4G1PA 1DL6A 1VQ61 1VQKZ 2BO9A 3PBEA 1VQ71 3PB4X 4UIBA 5DS0A 5F09A 3F3PC 3SJGA 3IX0A 5LL6f 2ZEFA 3BHXA 2V8KA 1I6HI 3PB6X 1Q811 4JYWA 1P9NA 1XJOA 4EFDA 2B63I 3CD61 2AFMA 3GTOI 1Y1WI 8CPAA 4NBBA 4Y7NI 4OP4A 4ZY2A 2NSMA 3CCJ1 2V8JA 2YADA 3FQMA 3CME1 2JEWA 4P4EA 4FAIA 5JH9A 2ZEGA 2R93I 1TKFA 2XEIA 2VL1A 4OC2A 3GTJI 1RO2A 1NUIA 1S7MA 4MRIA 3PFOA 3TC8A 4IAVA 3I55Z 4OC1A 1LAPA 2AFWA 4WJBA 3FJUA 1YW6A 1RO4A 1N2FA 3D7DA 4RS4A 2QREB 1PCAA 2HU9A 2M48A 4RV9A 2POKA 3J80b 3SI1A 1K731 4A38A 4EWTA 2ANPA 1W2BY 3SJXA 1TWHI 1RO0A 1ARLA 1GYTA 3LMSA 5C44I 2GTIA 1QMUA 4OC5A 3CCL1 1YLOA 4H2KA 4NGNA 3V7ZA 1VQPZ 3K7AI 3EEDA 2F7VA 2JNYA 4MCSA 4NBCA 1VQMZ 2DE6A 2OTLZ 1VGYA 3T8WA 2ZEHA 3FEDA 1LAMA 3CCS1 1OBRA 3CCEZ 4OC0A 2AFOA 1Z8LA 1Z03A 2Q43A 1X3ZA 2OZKA 2JA6I 1RQFA 3SI2A 2QA4Z 5CBMA 2OTJZ 1VQN1 2JA7I 3CCVZ 1QYPA 2EGTA 2PVWA 2PIZA 3FVLA 1VLAA 5D1OB 1VQM1 4MCQA 1ARMA 4A3EI 1BLLE 4W9YA 1TKHA 3PRTA 3G6E1 1QQ9A 4HGYA 3IF8A 3K9TA 5K8PA 4DJLA 4A3FI 3S15I 3FEEA 3J81b 4UEEA 2PJAA 3CCU1 4OMEA 4MHPA 1I50I 3HOWI 3CCV1 5C4JI 2R92I 1PYTB 1VQ8Z 4MXUA 1Z02A 4DGLA 3B3SA 1YUKA 4DUKA 4NB8A 1YI2Z 2F4OA 1TWFI 1Y7EA 2OOXB 5FLXf 1JJ2Z 3D4UA 5IB9A 4NBHA 2PCUA 2K3RA 1Q7Y2 4A3KI 6CPAA 1Y0RA 3CPAA 3GCFA 4BXXI 4A3LI 1YJ91 2GLJA 3B3CA 4PPZA 1QVFY 3HLPA 2HF1A 4A3BI 3PB8X 1TKJA 4R8FA 4ONWA 3VARA 1VIXA 3CDXA 2BJOA 3CMAZ 3SJEA 2PIYA 1ML8A 4RVHA 3CD6Z 4TNUA 2R7ZI 1NP6A 4B6ZA 3GUXA 3U50C 2P3YA 1N8R1 4MONA 4BY1I 3CXCY 1XRYA 3LWUA 3S9LA 5CPAA 1EE3P 3IO1A 1BAVA 1RTQA 3PBBA 4NBDA 3H8FA 1YHQ1 4A3JI 1TXRA 3DLJA 3FMCA 4P44A 4QTTA 2QR1B 2E2JI 3CPWY 4HH4A 1ZH1A 1ELLP 1VQ41 1SFOI 1ZLIA 2QEXZ 2J6AA 3I07A 3CCR1 2EK9A 5J1QA 1N8R2 2RFHA 3J81f 2WAQA 3S1MI 3CC71 2PJ0A 2QKDA 4NFRA 1DE4C 1VQLZ 1VHEA 3JRUA 4YU9A 4HGZA 1ZG9A 3IIBA 5LRGA 3S16I 3GTKI 1XMBA 3GTGI 5IT9b 3B7IA 3I56Z 3JAMf 4NGMA 4FBEA 4RVGA 3CXCZ 4RUHA 2ZELA 3RZOI 2RT9A 2NVTI 3FECA 2CF4A 2PMZA 4NGRA 3CCRZ 3L2NA 3HUVA 5IP7I 2FVGA 7CPAA 2AKLA 3I1UA 3HOYI 1F2PA 1VQ6Z 3SJFA 1VQ7Z 4QTUA 1IGBA 3D7HA 5JM6A 1VQO1 2OTJ1 4NJRA 2JR6A 4NH1C 1KD12 4XX2A 4ZY1A 1TF9A 1Z2LA 4EWCA 1BPMA 2V8IA 1CP7A 4TWEA 4E32A 3GTMI 5CM2M 4P6YA 2XEJA 5D1PA 3G6EZ 5C4XI 2PJ8A 3ISXA 2GTHA 3GKQA 4ZY0A 3S1RI 1NJI1 2QYVA 1F57A 3TE5B 2PJ1A 3MZLB 2JMOA 2E2II 1FT7A 4NGTA 2OOTA 2IZ3A 1NSAA 4UEZA 2PE3A 2BOAA 5LYLA 1X0TA 4Q7AA 2R6MA 3RZDI 3T4NB 3HOZI 4Z65A 1TF8A 3NDJA 4E2YA 5FLMI 2NYQA 3PB7X 3PFEA 5LRKA 4NOZA 1VQK1 1IY7A 3PEIA 1YJW1 2PRQA 5K8NA 5I4MA 4MHYA 4GM5A 2JS4A 1USPB 2H85A 5K8OA 2QRDB 3RZAA 4MCPA 3LUSA 1YJ9Z 1Y1VI 4UEFA 2NVQI 2WZNA 2GLFA 3CCQ1 4E31A 3WC5A 1XFOA 4E2WA 1AMPA 1VQP1 5K8MA 4MD7A 4OC4A 3FQQA 4KSIA 1KC82 3GLJA 1YJWZ 3H8GA 3KGQA 3VMIA 3BI1A 1QVFZ 1ZB8A 4A3CI 3M3YI 3VMGA 3RBUA 1W2BZ 3S14I 1X3WA 4BBRI 2QVPA 3IWWA 1KQSY 1RLYA 3G4S1 1YIJ1 1CPXA 1Z5RA 1TWCI 4CL1A 1VQ4Z 4A3MI 1YITZ 3I4MI 4IK2A 4AXVA 3S9MA 2CIJA 4DQYB 1K8A2 3PB9X 3S1QI 2G9DA 3B2YA 1HDQA 3FKII 3IFEA 2LIYA 2RBLA 2PJ6A 3I561 1Q812 3ISZA 3KHZA 3NH5A 1QVGY 3WC7A 4NBFA 3GTPI 2JBKA 3G4SZ 1YIJZ 1Y1VS 2OTL1 4A37A 5HVFA 1YIT1 1LFWA 4AYBA 1NJI2 1R43A 2DEAA 4R6TA 5IT9f 3CCMZ 2NVXI 3D66A 1H8LA 1M4LA 2V8VA 1CPSA 2HB6A 1Q7LA 2QA41 3CPXA 2C6CA 1QVGZ 4A3GI 4NGSA 4DYOA 2PVVA 2RHBA 3ESWA 1VQOZ 1Q7Y1 2IZ4A 2PJ4A 2ZEEA 4OKOA 1WCMI 3SI0A 4MD9A 2E2HI 4NJQA 1Q821 1Q822 2HC9A 1VQ5Z 1Y0YA 2ABZA 2V8HA 1K9M2 3GTLI 2XEFA 3TX8A 2BCOA 4A3II 4O23A 1CBXA 2C1CA 2C6GA 3D68A 2K5RA 3VTNA 1LCPA 3H3VJ 5D29A 1BPNA 3J7A4 3S2HI 2GREA 3KHXA 2RB7A 3B3WA 3KQZA 2JA8I 4FWUA 2O53A 3KIHA 3PO3S 4ZX9A 4RVFA 4NBAA 4DK1A 1S721 1CX8A 1R3NA 2PJ7A 3CC7Z 1VQL1 3CC2Z 1DTDA 2WYRA 2ZEDA 4CPAA 3KR4A 3B3VA 1TFIA 1K9M1 2AFSA 2P28A 3KR5A 2M6NA 3IFUA 2PJCA 1AYEA 3IJ3A 3NFZA 2F8HA 2OR4A 2ZEOA 3VMHA 3CMA1 3G71Z 1KQSZ 1YW4A 4A39A 4E33A 2Q51A 5A2Qb 3VATA 3KQXA 2IMOA 3F3FC 3FH4A 3J80f 1PFTA 3D7GA 1RNIA 1Q862 2IJZA 2QJ8A 4E2ZA 3CPWZ 1JJ2Y 1CG2A 3BXMA 4X8IA 2NVYI 1JWHC 1YUAA 1ZB9A 4PQAA 3V38A 4P10A 2JA5I 3RAMA 2DE7A 3WT4A 3NH4A 3CT9A 2PK7A 5T64A 2C6PA 2PJ9A 4BY7I 1XBUA 5JGFA 3I4NI 4NGQA 4OIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXC A;  4K3N A;  3D7F A;  5HVG A;  5THW A;  2I3C A;  4PXE A;  3MN8 A;  4OIW A;  2PJ3 A;  4LQG A;  5HXD A;  3KI9 A;  4WWV A;  4X3R A;  2PJB A;  1CP6 A;  4IHM A;  5LRJ A;  1ELM P;  1LOK A;  4FUU A;  3KZW A;  4P4F A;  3WC6 A;  2GU2 A;  2J9A A;  3K2K A;  4BD9 A;  3H8E A;  1YME A;  4P4I A;  2JBJ A;  2PJ2 A;  3NA6 A;  4EME A;  1F2O A;  4MCR A;  3WAB A;  3BI0 A;  1UWY A;  3NH8 A;  1KWM A;  4MHZ A;  2ZEM A;  5D8N A;  2V8G A;  4OC3 A;  4F8Z A;  3KAS A;  4ZYQ A;  2V8D A;  4P4J A;  3VH9 A;  2AFZ A;  3FF3 A;  4F9U A;  1JQG A;  3DGV A;  4JZ0 A;  5LYI A;  4R7M A;  4A94 A;  1ZG8 A;  1LAN A;  1ZLH A;  3D67 A;  4X2T A;  3S9N A;  4YWY A;  4PXB A;  4NGP A;  4R76 A;  3KL9 A;  3IEH A;  2CTB A;  4P4D A;  1VHO A;  4F9V A;  4P45 A;  2ZOF A;  1ZG7 A;  5LYF A;  2V77 A;  3B3T A;  1FNO A;  3N5F A;  3MRU A;  2ZOG A;  2PJ5 A;  3B35 A;  2O4H A;  4ZI6 A;  4MHN A;  2ZEN A;  1HEE A;  5LYD A;  4ZX8 A;  3GB0 A;  5HVH A;  2Q4Z A;  2EWB A;  2EK8 A;  2IQ6 A;  1HDU A;  4UF4 A;  4MMO A;  2AFU A;  2XEG A;  2CTC A;  3FX6 A;  3QNV A;  3IC1 A;  5ELY A;  4PXD A;  2ZEP A;  4P4B A;  2AFX A;  1YSJ A;  4UIA A;  4G1P A;  2BO9 A;  3PBE A;  3PB4 X;  4UIB A;  5DS0 A;  5F09 A;  3SJG A;  2ZEF A;  3BHX A;  3PB6 X;  4JYW A;  1XJO A;  4EFD A;  2AFM A;  8CPA A;  4OP4 A;  4ZY2 A;  2NSM A;  2JEW A;  4P4E A;  4FAI A;  5JH9 A;  2ZEG A;  1TKF A;  2XEI A;  2VL1 A;  4OC2 A;  4MRI A;  3PFO A;  3TC8 A;  4IAV A;  4OC1 A;  1LAP A;  2AFW A;  4WJB A;  3FJU A;  1YW6 A;  3D7D A;  1PCA A;  2POK A;  3SI1 A;  4A38 A;  4EWT A;  2ANP A;  3SJX A;  1ARL A;  1GYT A;  3LMS A;  1QMU A;  4OC5 A;  1YLO A;  4H2K A;  4NGN A;  3V7Z A;  2F7V A;  4MCS A;  1VGY A;  3T8W A;  2ZEH A;  3FED A;  1LAM A;  1OBR A;  4OC0 A;  2AFO A;  1Z8L A;  2Q43 A;  3SI2 A;  5CBM A;  2PVW A;  2PIZ A;  3FVL A;  4MCQ A;  1ARM A;  1BLL E;  4W9Y A;  1TKH A;  3PRT A;  1QQ9 A;  3K9T A;  5K8P A;  4DJL A;  3FEE A;  4UEE A;  2PJA A;  4OME A;  4MHP A;  1PYT B;  4MXU A;  3B3S A;  4DUK A;  1Y7E A;  3D4U A;  5IB9 A;  2PCU A;  6CPA A;  1Y0R A;  3CPA A;  2GLJ A;  3B3C A;  4PPZ A;  3HLP A;  3PB8 X;  1TKJ A;  4R8F A;  4ONW A;  3VAR A;  1VIX A;  3CDX A;  3SJE A;  2PIY A;  4TNU A;  4B6Z A;  3GUX A;  1XRY A;  3LWU A;  3S9L A;  5CPA A;  1EE3 P;  3IO1 A;  1BAV A;  1RTQ A;  3PBB A;  3H8F A;  1TXR A;  3DLJ A;  3FMC A;  4P44 A;  1ELL P;  1ZLI A;  2EK9 A;  5J1Q A;  2RFH A;  2PJ0 A;  1VHE A;  4NFR A;  1DE4 C;  4YU9 A;  3JRU A;  3IIB A;  1ZG9 A;  5LRG A;  1XMB A;  3B7I A;  4NGM A;  4FBE A;  4RUH A;  2ZEL A;  3FEC A;  2CF4 A;  4NGR A;  3L2N A;  3HUV A;  2FVG A;  7CPA A;  3I1U A;  1F2P A;  3SJF A;  1IGB A;  3D7H A;  5JM6 A;  4NJR A;  4ZY1 A;  1TF9 A;  1Z2L A;  1BPM A;  4TWE A;  1CP7 A;  4P6Y A;  2XEJ A;  2PJ8 A;  3ISX A;  4ZY0 A;  2QYV A;  1F57 A;  2PJ1 A;  2OOT A;  1FT7 A;  4NGT A;  1NSA A;  4UEZ A;  2PE3 A;  2BOA A;  5LYL A;  4Q7A A;  4Z65 A;  1TF8 A;  2NYQ A;  3PB7 X;  3PFE A;  5LRK A;  1IY7 A;  3PEI A;  2PRQ A;  5K8N A;  5I4M A;  4MHY A;  4GM5 A;  5K8O A;  3RZA A;  4MCP A;  4UEF A;  2WZN A;  2GLF A;  3WC5 A;  1XFO A;  1AMP A;  5K8M A;  4OC4 A;  4KSI A;  3GLJ A;  3H8G A;  3KGQ A;  3BI1 A;  3RBU A;  2QVP A;  3IWW A;  1CPX A;  1Z5R A;  4AXV A;  4IK2 A;  3S9M A;  2CIJ A;  3PB9 X;  2G9D A;  3B2Y A;  1HDQ A;  3IFE A;  2PJ6 A;  3ISZ A;  3WC7 A;  3KHZ A;  3NH5 A;  2JBK A;  4A37 A;  5HVF A;  1LFW A;  2DEA A;  1R43 A;  4R6T A;  3D66 A;  1H8L A;  1M4L A;  2V8V A;  1CPS A;  2HB6 A;  1Q7L A;  3CPX A;  2C6C A;  4NGS A;  4DYO A;  2PVV A;  2PJ4 A;  2ZEE A;  4OKO A;  3SI0 A;  4NJQ A;  2HC9 A;  1Y0Y A;  2ABZ A;  2V8H A;  2XEF A;  3TX8 A;  2BCO A;  4O23 A;  1CBX A;  2C1C A;  2C6G A;  3D68 A;  1LCP A;  5D29 A;  1BPN A;  2GRE A;  3KHX A;  2RB7 A;  3B3W A;  3KQZ A;  4FWU A;  2O53 A;  4ZX9 A;  1R3N A;  2PJ7 A;  1CX8 A;  2ZED A;  1DTD A;  4CPA A;  2WYR A;  3KR4 A;  3B3V A;  2AFS A;  3KR5 A;  2PJC A;  1AYE A;  3IJ3 A;  3NFZ A;  2F8H A;  2OR4 A;  2ZEO A;  4A39 A;  1YW4 A;  2Q51 A;  3VAT A;  3KQX A;  2IMO A;  3FH4 A;  3D7G A;  2IJZ A;  2QJ8 A;  3BXM A;  4X8I A;  1CG2 A;  4PQA A;  3V38 A;  4P10 A;  3RAM A;  3WT4 A;  3NH4 A;  3CT9 A;  2C6P A;  2PJ9 A;  1XBU A;  5JGF A;  4NGQ A;  4OID A; 
#chains in the Genus database with same CATH topology
 3HOV I;  3CME Z;  3I9S A;  1QSR A;  2Q7B A;  1YJN Z;  4LQG A;  2ZW5 A;  3VB9 A;  1XEB A;  4QC6 A;  4HNY B;  4BBS I;  1ELM P;  2FIW A;  4JWP A;  3FBU A;  3WC6 A;  4QBJ A;  2W04 A;  2FXF A;  4A30 A;  2FE7 A;  5G22 A;  3H8E A;  4PSX A;  1VQ5 1;  3FB3 A;  3Q87 A;  1Z4R A;  3CQZ I;  1R9T I;  2JBJ A;  4B11 A;  3B8G A;  3RNZ A;  3OW2 Z;  3H0G I;  1K73 2;  1S72 Z;  4OC3 A;  4F8Z A;  3BG0 B;  3EER A;  4P4J A;  4F9U A;  1JQG A;  2VZY A;  3CC4 1;  3MON A;  5AN9 F;  4NGP A;  4PXB A;  4R76 A;  1KRL A;  3KL9 A;  2OZH A;  2R7H A;  3CCL Z;  2CTB A;  1IB1 E;  4P45 A;  1ZG7 A;  5E96 A;  1I12 A;  3M4O I;  4NBG A;  1I21 A;  5IP9 I;  3N5F A;  4RVD A;  4KOU A;  2BSW A;  1HEE A;  4R3K A;  4CGM A;  5HVH A;  4EVY A;  1NMT A;  4HKF A;  2AFU A;  4R3L A;  2XEG A;  3FX6 A;  2REF A;  3QNV A;  3MZK B;  3QAY A;  1VQ6 1;  1X12 A;  3PBE A;  2FIA A;  4UIB A;  2B3V A;  5F49 A;  3BHX A;  3EFA A;  1Q81 1;  4JYW A;  1XJO A;  3GTO I;  8CPA A;  1L0C A;  4ZY2 A;  1M4G A;  2RC4 A;  3CME 1;  2XEI A;  2VL1 A;  4OC2 A;  2Q0Y A;  1WK4 A;  3TC8 A;  3VWE A;  4UCP A;  3D7D A;  4RV9 A;  1I1D A;  4HNW B;  4EWT A;  1GYT A;  3PGP A;  5C44 I;  4H2K A;  1VQP Z;  3K7A I;  2JNY A;  1JWQ A;  1VQM Z;  2DE6 A;  5H84 A;  1S60 A;  1UFH A;  1Z8L A;  1X3Z A;  2OZK A;  2JA6 I;  3SI2 A;  5CBM A;  1CJW A;  4MY0 A;  1IIC A;  3R9F A;  2VQY A;  1ZO0 A;  4MCQ A;  1ARM A;  3K9T A;  4UEE A;  2PJA A;  3CCU 1;  4YRH A;  4IF5 A;  3HOW I;  5C4J I;  4KUA A;  3QB8 A;  1PYT B;  1VQ8 Z;  1M4I A;  3S6K A;  2X7B A;  2ATR A;  2P6F A;  3TT2 A;  5FLX f;  2K3R A;  5AGE A;  1YVK A;  1Y0R A;  4BXX I;  3BJ7 A;  2GLJ A;  1R57 A;  4PPZ A;  4CGL A;  1QVF Y;  4RS2 A;  4R8F A;  3CD6 Z;  1M1D A;  2R7Z I;  5EMI A;  4MBU A;  4F0X A;  2P3Y A;  3TTH A;  2BUE A;  4NBD A;  2E2J I;  1QSO A;  2QEX Z;  3FRM A;  2QKD A;  4NFR A;  3F0A A;  5LRG A;  1XMB A;  4RVG A;  3CXC Z;  2D4O A;  4NGR A;  3L2N A;  3EXN A;  2AKL A;  1F2P A;  3SJF A;  1IGB A;  3D7H A;  1S5K A;  1VQO 1;  4NJR A;  1KD1 2;  2B58 A;  1TF9 A;  4U9Z A;  1Z2L A;  1S3Z A;  4QB9 A;  2V8I A;  4AG9 A;  2OH1 A;  2GTH A;  4AVB A;  1F57 A;  4CAX A;  2IZ3 A;  3K9U A;  1NSA A;  3CXQ A;  4ORF A;  5KTC A;  3RZD I;  3T90 A;  4CYQ A;  5FLM I;  5LRK A;  2Y0M A;  3PEI A;  4MHY A;  2JS4 A;  1USP B;  4HNX B;  3CCQ 1;  3WC5 A;  3GKR A;  4KSI A;  1KC8 2;  3H8G A;  4E2A A;  1X3W A;  4LUA A;  3IWW A;  1QXF A;  1KQS Y;  2NMT A;  1YIJ 1;  4KVO E;  3I4M I;  4AXV A;  1K8A 2;  2G9D A;  3B2Y A;  1YVO A;  3TOB A;  2PJ6 A;  3I56 1;  4NBF A;  4C7I A;  2JBK A;  3IWE A;  1YIT 1;  3S6H A;  2DEA A;  4R6T A;  2QA4 1;  3ESW A;  1RXT A;  3LD2 A;  4NJQ A;  1VQ5 Z;  1K9M 2;  2BCO A;  1CBX A;  2C1C A;  4KS9 A;  5D29 A;  1BPN A;  2FL4 A;  2JA8 I;  3CXS A;  2ZW7 A;  5HMN A;  3B3V A;  1K9M 1;  3IFU A;  1AYE A;  2ZEO A;  2OR4 A;  4CYP A;  3H5Z A;  3G71 Z;  4C2Y A;  4K30 A;  3RYO A;  3N7Z A;  1Q86 2;  2IJZ A;  4E2Z A;  1CG2 A;  1JWH C;  4B12 A;  3TO7 A;  4LX9 A;  2C6P A;  2PJ9 A;  1XBU A;  2G3A A;  2ZPA A;  4PXC A;  1MJ9 A;  4K3N A;  5HVG A;  4A3D I;  3GYA A;  4PXE A;  3D8P A;  3GTM S;  3MN8 A;  4OIW A;  4S1T A;  2JIM A;  3I55 1;  3LOD A;  1M1K 1;  1B6B A;  4NF1 A;  2R98 A;  4WWV A;  2VUG A;  3TDH B;  1M90 2;  4X3R A;  1TWG I;  4MI4 A;  1CP6 A;  4R87 A;  3KIF A;  3KZW A;  2H5M A;  5KTA A;  1KC8 1;  2J9A A;  4BMH A;  4BD9 A;  1YI2 1;  1YME A;  4RN7 A;  1IYL A;  1M90 1;  3R1K A;  1X10 A;  4IUS A;  4NCZ A;  3GIU A;  4KLV A;  2VI7 A;  4E30 A;  3QAH A;  1F2O A;  3BI0 A;  5D8N A;  3BJ8 A;  3KKW A;  5AG6 A;  4E2X A;  2O28 A;  2AFZ A;  1K83 I;  2KPI A;  1Y9K A;  5LYI A;  4R7M A;  1ZG8 A;  4JXR A;  4YWY A;  3IU1 A;  3CCM 1;  3OW2 Y;  2WB1 A;  1TWA I;  4YFJ A;  3HOX I;  2YU9 I;  5IV0 A;  3LAC A;  2ZOF A;  3R9E A;  2V77 A;  1FNO A;  1QSN A;  1Q86 1;  3HKZ A;  1ON0 A;  4PV6 A;  4UFV A;  2RIQ A;  1I3Q I;  1QF8 A;  4Y52 I;  4FD4 A;  2Q4Z A;  2EWB A;  2EK8 A;  3HOU I;  4PSW A;  2VBQ A;  4XNH B;  2CTC A;  2PR8 A;  2I00 A;  3IC1 A;  3DR8 A;  4Q38 A;  5ELY A;  4KOT A;  1Z8W A;  2Q44 A;  1IOF A;  5T6B A;  3JTK A;  4ZGY B;  2AFX A;  4CAW A;  3D6W A;  4UIA A;  1RO5 A;  1DL6 A;  4KVM E;  3W6X A;  1Z8X A;  5LL6 f;  1QST A;  3PB6 X;  1P9N A;  1QSM A;  1Y9W A;  1Y7R A;  2AFM A;  4UCN A;  2NSM A;  3FQM A;  2JEW A;  2EBJ A;  5JH9 A;  2R93 I;  3WR7 A;  3GTJ I;  1NUI A;  1S7M A;  4MRI A;  3I55 Z;  3IGR A;  1FDI A;  2R8V A;  2JLM A;  2HU9 A;  2POK A;  3J80 b;  4A38 A;  3SJX A;  3A9L A;  4OC5 A;  3CCL 1;  1YLO A;  4QVT A;  3EED A;  4NBC A;  3T8W A;  4B13 A;  2ZEH A;  3FED A;  4OLL A;  2C27 A;  2AFO A;  4KUB A;  1Z03 A;  2Q43 A;  4Q36 A;  2GE3 A;  1VQN 1;  2JA7 I;  2PIZ A;  3FVL A;  1VLA A;  4ONU A;  4A3E I;  3PRT A;  1QQ9 A;  1CM0 A;  1YGH A;  4B10 A;  2QEC A;  1I50 I;  3IWG A;  2VPY A;  3CCV 1;  2YNC C;  4MXU A;  1Z02 A;  1YUK A;  2F4O A;  1TWF I;  2OOX B;  5IB9 A;  1JJ2 Z;  2PCU A;  1Q7Y 2;  4A3K I;  1GHE A;  6CPA A;  3FYN A;  1N71 A;  4OAD A;  4A3L I;  3B3C A;  3HLP A;  4A33 A;  2PSW A;  4A3B I;  3VAR A;  4ONW A;  2JDC A;  2PIY A;  5AG5 A;  3I3G A;  4B6Z A;  2EO8 A;  4BY1 I;  3S9L A;  2HUZ A;  3IR7 A;  1YHQ 1;  5DWN A;  4A3J I;  3DLJ A;  4P44 A;  4QTT A;  1ZH1 A;  1ELL P;  3I07 A;  3CCR 1;  5J1Q A;  3S1M I;  2PJ0 A;  1DE4 C;  4YU9 A;  3JRU A;  4E8O A;  4GS4 A;  2VPX A;  4LQ6 A;  3GTG I;  5IT9 b;  3B7I A;  4PK3 A;  4KVX A;  4FBE A;  4RUH A;  2ZEL A;  2NVT I;  2PMZ A;  1P4N A;  5I0C A;  5IP7 I;  3VWD A;  4CAV A;  4FD5 A;  4X5K A;  2DPS A;  2OTJ 1;  4NH1 C;  4ZY1 A;  4EWC A;  4TWE A;  4E32 A;  1OZP A;  3SHP A;  4P6Y A;  5D1P A;  3DDD A;  2PJ8 A;  3ISX A;  3GKQ A;  2QYV A;  1U6M A;  2BOA A;  1FY7 A;  1X0T A;  4JD6 A;  3TOA A;  4M6I A;  4Z65 A;  2Z3L A;  1TF8 A;  5EBV A;  1YRE A;  2IV2 X;  4NOZ A;  1VQK 1;  1Z8T A;  1IY7 A;  2PRQ A;  3SXO A;  2H85 A;  5K8O A;  4H6Z A;  3RZA A;  4MCP A;  3LUS A;  4UEF A;  2NVQ I;  4E31 A;  2V3V A;  2AYD A;  4UWI A;  1AMP A;  4CAF A;  3G8W A;  3FQQ A;  2HV2 A;  1ZB8 A;  4A3C I;  2OZU A;  4BBR I;  4XPD C;  1BOB A;  2D4P A;  1CPX A;  2PC1 A;  3S9M A;  2CIJ A;  3PP9 A;  3PB9 X;  2Z10 A;  4AVC A;  2P6E A;  3ISZ A;  1Q81 2;  3KHZ A;  3NH5 A;  1QVG Y;  3G4S Z;  1Y1V S;  1LFW A;  4II9 A;  4M85 A;  5BWA B;  4NEX A;  4Y49 B;  1CPS A;  1Q7L A;  2DXQ A;  3CPX A;  4B5P A;  4DYO A;  2PVV A;  1Q7Y 1;  3TO6 A;  4L89 A;  4CGN A;  4JLY A;  3FNC A;  2BL1 A;  1WJ2 A;  2Q4Y A;  3NE8 A;  4O23 A;  2C6G A;  2PR1 A;  1LCP A;  3DR6 A;  1AUG A;  3J7A 4;  2GRE A;  1S7L A;  2RB7 A;  3KHX A;  1MJB A;  3PO3 S;  2ZED A;  4DNC A;  4CGO A;  2F8H A;  3CMA 1;  4A39 A;  5A2Q b;  3VAT A;  3KQX A;  2IMO A;  3J80 f;  2IL4 A;  4MFZ A;  2QJ8 A;  2YND A;  2JA5 I;  2DE7 A;  2VEZ A;  1VHS A;  3IU2 A;  4MFJ A;  2B5G A;  3D7F A;  5THW A;  1YX0 A;  2JUB A;  3D9X A;  3CCE 1;  1USP A;  1NE9 A;  1K8A 1;  4XNH C;  3MGD A;  2Q4V A;  3W91 A;  3KI9 A;  3P5J B;  2PJB A;  5LRJ A;  1LOK A;  4FUU A;  2G0B A;  5G20 A;  1A2Z A;  4B5O A;  2GU2 A;  4UBR A;  4QUS A;  4FD6 A;  1M4D A;  3NE7 A;  4MH4 A;  3PO2 I;  2OB0 A;  1YLE A;  4P4I A;  2FT0 A;  2Z3P A;  2PJ2 A;  3NA6 A;  4B5P B;  4CAE A;  4X6A I;  2F4M A;  4MCR A;  3PO3 I;  4MFP A;  1IU8 A;  1UWY A;  3CC4 Z;  5T67 A;  3EO4 A;  1KWM A;  2ZEM A;  2VUM I;  3FIX A;  4A93 I;  3S1N I;  2VZZ A;  1VQ8 1;  3D3S A;  3KAS A;  2V8D A;  3VH9 A;  1M1K 2;  1LQL A;  3DGV A;  4JZ0 A;  5GCN A;  1LAN A;  1ZLH A;  3D67 A;  5A2Q f;  2QRC B;  3IEH A;  4F9V A;  2DF5 A;  5LYF A;  3B3T A;  4NBE A;  3EY5 A;  2CXA A;  3UY5 A;  4A32 A;  2O4H A;  1VQ9 Z;  2JDD A;  1VQN Z;  5FLX b;  5LYD A;  3S17 I;  2QEX 1;  3GB0 A;  1PUA A;  2A4N A;  2Y0S A;  1J4J A;  3CC2 1;  1YR0 A;  2HQY A;  1HDU A;  4UF4 A;  4MMO A;  4XPK A;  2DE5 A;  4B14 A;  4AB7 A;  4UFW A;  5D1O A;  4PXD A;  3S6G A;  4P4B A;  3NDI A;  3GTQ I;  4G1P A;  2BO9 A;  1VQ7 1;  3PB4 X;  3PZJ A;  5F09 A;  1XOV A;  3TCV A;  2ZEF A;  2V8K A;  1I6H I;  3R96 A;  4KSF A;  4EFD A;  4UCM A;  3E0K A;  3ZJ0 A;  1Y1W I;  4NBB A;  5A27 A;  4Y7N I;  4OP4 A;  2YAD A;  4P4E A;  4FD7 A;  1LAP A;  2AFW A;  4WJB A;  2J8N A;  3FJU A;  1YW6 A;  1N2F A;  3W6S A;  4RS4 A;  1WWZ A;  4CS0 B;  3H4Q A;  5EC4 A;  1W2B Y;  1RO0 A;  3P2F A;  1QMU A;  4JJX A;  3V7Z A;  2OTL Z;  2Z11 A;  3CCS 1;  3CCE Z;  4OC0 A;  1P0H A;  1RQF A;  2QA4 Z;  2OTJ Z;  1QYP A;  1VQM 1;  3GY9 A;  4W9Y A;  1TKH A;  4C68 A;  3IF8 A;  4DJL A;  3S15 I;  3FEE A;  3J81 b;  4MHP A;  2FSR A;  4H6U A;  4DGL A;  3B3S A;  3T9Y A;  1Y7E A;  3D4U A;  3OWC A;  2QML A;  3GCF A;  4C2Z A;  2HF1 A;  4XPD B;  3PB8 X;  1TKJ A;  1VIX A;  3SJE A;  1ML8 A;  1NP6 A;  1MK4 A;  2Z3M A;  1XRY A;  4MON A;  3LWU A;  3CXC Y;  5CPA A;  1EE3 P;  2B4D B;  5F46 A;  4I49 A;  5DWM A;  3H8F A;  1TXR A;  4L8A A;  2QR1 B;  3CPW Y;  1ZLI A;  2J6A A;  4M3S A;  3CC7 1;  2KCW A;  4HGZ A;  3IIB A;  1PU9 A;  3JAM f;  4NGM A;  4M6H A;  3F5B A;  2E7Z A;  4KOR A;  1IID A;  2PDO A;  3I1U A;  3HOY I;  1VQ6 Z;  1VQ7 Z;  5JM6 A;  2Z0Z A;  2Z3N A;  4XX2 A;  2FS5 A;  3G6E Z;  5C4X I;  1XIX A;  4ZY0 A;  3S1R I;  2VPZ A;  4UA3 A;  3MZL B;  2JIR A;  2OOT A;  2E2I I;  4UEZ A;  1NSL A;  5LYL A;  4Q7A A;  2R6M A;  3HOZ I;  4E2Y A;  1KZF A;  4GXH A;  2NYQ A;  3PB7 X;  4KOV A;  4U5Y A;  5I4M A;  4GM5 A;  2QRD B;  1YJ9 Z;  2CY2 A;  1SQH A;  1XFO A;  3TO9 A;  1VQP 1;  5K8M A;  4KOY A;  4MD7 A;  4OC4 A;  2QIR A;  3KGQ A;  2K5T A;  3M3Y I;  5IB0 A;  3VMG A;  3JVN A;  3RBU A;  4MJ8 A;  1W2B Z;  1FDO A;  1Z4E A;  2ARH A;  2FCK A;  4MFK A;  2P6G A;  1Z5R A;  4CL1 A;  1VQ4 Z;  4A3M I;  1YIT Z;  4IK2 A;  2Q7S A;  4DQY B;  3S1Q I;  2LIY A;  4ZBG A;  5H86 A;  2RBL A;  2GAN A;  3WC7 A;  3GTP I;  2Z3K A;  2Q04 A;  1YIJ Z;  2OTL 1;  4AYB A;  5IT9 f;  2REE A;  3CCM Z;  1M4L A;  1Q2C A;  4UWJ A;  2HB6 A;  2C6C A;  4NGS A;  2RHB A;  2PJ4 A;  3SI0 A;  4OKO A;  1WZN A;  2VPW A;  4XPL A;  2HC9 A;  1Y0Y A;  2ABZ A;  2V8H A;  2XEF A;  5A28 A;  3TX8 A;  4F6A A;  4A31 A;  3VTN A;  2YNC A;  1K4J A;  2G3T A;  5F48 A;  1LRZ A;  4FWU A;  2O53 A;  1VKC A;  3KIH A;  4ZX9 A;  4DK1 A;  1S72 1;  2PJ7 A;  4CRZ B;  3CC7 Z;  5IX3 A;  4CPA A;  3KR4 A;  1TFI A;  5G21 A;  2AFS A;  1YW4 A;  4E33 A;  3F3F C;  1PFT A;  3D7G A;  4MFQ A;  4R9M A;  1RNI A;  1JJ2 Y;  4X8I A;  2WSA A;  4PQA A;  3V38 A;  3WT4 A;  3NH4 A;  3CT9 A;  2PK7 A;  4BY7 I;  5JGF A;  4YGO A;  4OID A;  4H89 A;  2KI7 B;  1KUY A;  3CCJ Z;  2I3C A;  1AA6 A;  5CNP A;  2OOY B;  2LEX A;  1VQ9 1;  2PJ3 A;  2V45 A;  5HXD A;  5G1Z A;  3ZZI A;  2ZW6 A;  2JIO A;  1XMT A;  4KLW A;  5C82 A;  3RO0 A;  4IHM A;  1SIW A;  4P4F A;  2LFU A;  3BG1 B;  3BLN A;  5JQ4 A;  4MD8 A;  3K2K A;  5C3E I;  2JIQ A;  1Z01 A;  1KD1 1;  4NB9 A;  3TFY A;  4EME A;  2VF1 A;  3WAB A;  3NH8 A;  2E9H A;  4MHZ A;  2V8G A;  2G2K A;  5J8F A;  3CCQ Z;  4ZYQ A;  3FF3 A;  5FVJ A;  1L1O C;  3S2D I;  4A94 A;  1BO4 A;  3CZX A;  2ODF A;  4KZT A;  4X2T A;  2PM9 A;  3S9N A;  1YQE A;  4AG7 A;  1KUV A;  2JIP A;  3JAM b;  2ZAE B;  2J8R A;  1MJA A;  4P4D A;  1VHO A;  4Y49 C;  2R1I A;  2QLV B;  3CCS Z;  3MRU A;  2ZOG A;  2PJ5 A;  3B35 A;  2RPR A;  4ZI6 A;  1YJN 1;  4MHN A;  2ZEN A;  1YHQ Z;  3QWU A;  2B3U A;  1WW9 A;  3G3S A;  4ZX8 A;  4CGP A;  4E0A A;  2IQ6 A;  3R95 A;  3CCU Z;  2PQ8 A;  1Q2Y A;  1WII A;  2ZW4 A;  2WPW A;  2DPT A;  4PK2 A;  1Q2D A;  1TIQ A;  2W03 A;  3G71 1;  2ZEP A;  1YSJ A;  2P0W A;  3DNS A;  1VQK Z;  5DS0 A;  3F3P C;  3SJG A;  3IX0 A;  4C7H A;  1XF8 A;  4HPS A;  3SXN A;  2J8M A;  2B63 I;  3CD6 1;  4JXQ A;  2AE6 A;  1B87 A;  3CCJ 1;  2V8J A;  4FAI A;  2ZEG A;  1TKF A;  3P2H A;  4MFL A;  1RO2 A;  3PFO A;  4IAV A;  2B5G B;  4OC1 A;  2ZXV A;  1RO4 A;  2CNM A;  2QRE B;  1PCA A;  2M48 A;  3SI1 A;  1K73 1;  2ANP A;  4F0Y A;  1TWH I;  1ARL A;  3LMS A;  2Z3O A;  2GTI A;  1Z9U A;  4NGN A;  4MY3 A;  4A95 A;  2F7V A;  4MCS A;  2CNS A;  2JEV A;  5JPH A;  1VGY A;  2GIV A;  1S7F A;  1LAM A;  1OBR A;  4KSA A;  4NSQ A;  3CCV Z;  2CNT A;  2EGT A;  2PVW A;  5D1O B;  1BLL E;  3G6E 1;  4HGY A;  5K8P A;  4A3F I;  3TE4 A;  4OME A;  2R92 I;  4DUK A;  1S7N A;  4NB8 A;  1YI2 Z;  2YGW A;  4NBH A;  4M6G A;  3CPA A;  1YJ9 1;  1YK3 A;  3CDX A;  2BJO A;  2WUU A;  3CMA Z;  4RVH A;  4TNU A;  3GUX A;  3U50 C;  1N8R 1;  1Y8C A;  3IO1 A;  1BAV A;  1RTQ A;  1IOI A;  3PBB A;  3FMC A;  4BIN A;  4HH4 A;  1VQ4 1;  1SFO I;  2EK9 A;  1N8R 2;  2RFH A;  3J81 f;  2WAQ A;  1VHE A;  4NXY A;  1VQL Z;  1ZG9 A;  3S16 I;  3GTK I;  3I56 Z;  3RZO I;  2RT9 A;  3FEC A;  4BBH A;  3F8K A;  2CF4 A;  3D2P A;  3CCR Z;  3HUV A;  2FVG A;  7CPA A;  3V8I A;  5HH1 A;  2VXK A;  5F47 A;  4QTU A;  4KOX A;  4AVA A;  2JR6 A;  1XE4 A;  4CYO A;  4J3G A;  1BPM A;  1CP7 A;  3GTM I;  5CM2 M;  2WPX A;  2XEJ A;  3FXT A;  1NJI 1;  2GFQ A;  1M44 A;  2EUI A;  3TE5 B;  2PJ1 A;  2JMO A;  1FT7 A;  4NGT A;  2PE3 A;  4KOS A;  3D2M A;  3T4N B;  2YNE A;  3NDJ A;  3PFE A;  1S7K A;  1YJW 1;  5K8N A;  3R9G A;  5KTD A;  2EVN A;  3DSB A;  1Y1V I;  2WZN A;  2GLF A;  1IYK A;  4E2W A;  3JUW A;  3GLJ A;  1YJW Z;  3VMI A;  3BI1 A;  1QVF Z;  4UFX A;  3S14 I;  4CYN A;  2F5I A;  2QVP A;  1RLY A;  3G4S 1;  1TWC I;  4MHD A;  2I79 A;  2PRB A;  2B4D A;  3CXP A;  2B4B A;  1HDQ A;  3FKI I;  3IFE A;  5AG4 A;  5ISV A;  2OZG A;  4A37 A;  5HVF A;  5J8C A;  1NJI 2;  1R43 A;  2NVX I;  3D66 A;  3EC4 A;  1H8L A;  2OU2 A;  2V8V A;  1QVG Z;  4A3G I;  1VQO Z;  2IZ4 A;  4KOW A;  2ZEE A;  1WCM I;  4MD9 A;  2E2H I;  1Q82 1;  1Q82 2;  5C88 A;  1V0C A;  3D2L A;  3GTL I;  4C2X A;  2BEI A;  4R57 A;  4A3I I;  5AG7 A;  3D68 A;  2K5R A;  4U9Y A;  3H3V J;  4RI1 A;  3S2H I;  3KQZ A;  3B3W A;  4RVF A;  1KUX A;  2NAP A;  4NBA A;  1R3N A;  1CX8 A;  1VQL 1;  3CC2 Z;  1DTD A;  2WYR A;  2AJ6 A;  2P28 A;  3KR5 A;  2M6N A;  2PJC A;  1Q16 A;  3S6F A;  3IJ3 A;  3NFZ A;  3VMH A;  1KQS Z;  2Q51 A;  3C26 A;  3FH4 A;  3BXM A;  3CPW Z;  4CRY B;  2NVY I;  1YUA A;  1ZB9 A;  4A2Z A;  4P10 A;  3RAM A;  4OAE A;  5T64 A;  3I4N I;  4NGQ A; 
#chains in the Genus database with same CATH homology
 2KI7 B;  3HOV I;  4K3N A;  3D7F A;  4PXC A;  5HVG A;  5THW A;  3CCJ Z;  2I3C A;  3CME Z;  4A3D I;  4PXE A;  2JUB A;  2OOY B;  3D9X A;  3CCE 1;  3GTM S;  1USP A;  3MN8 A;  1K8A 1;  4OIW A;  4S1T A;  1VQ9 1;  2PJ3 A;  1YJN Z;  4LQG A;  3VB9 A;  5HXD A;  3I55 1;  1M1K 1;  3KI9 A;  3P5J B;  4WWV A;  2VUG A;  3TDH B;  1M90 2;  4X3R A;  1TWG I;  2PJB A;  1CP6 A;  4BBS I;  4IHM A;  5LRJ A;  1ELM P;  1LOK A;  3KIF A;  4FUU A;  3KZW A;  4P4F A;  2LFU A;  3BG1 B;  1KC8 1;  3WC6 A;  2GU2 A;  2J9A A;  2W04 A;  4MD8 A;  3K2K A;  4BD9 A;  5C3E I;  4MH4 A;  3H8E A;  1YI2 1;  3PO2 I;  1VQ5 1;  1YME A;  4P4I A;  1KD1 1;  1Z01 A;  3Q87 A;  4NB9 A;  3CQZ I;  1R9T I;  1M90 1;  2JBJ A;  2PJ2 A;  3NA6 A;  4E30 A;  4EME A;  4X6A I;  2VF1 A;  2F4M A;  3OW2 Z;  1F2O A;  3PO3 I;  4MCR A;  3WAB A;  3BI0 A;  1UWY A;  3CC4 Z;  3NH8 A;  2E9H A;  5T67 A;  1KWM A;  4MHZ A;  3H0G I;  1K73 2;  2ZEM A;  5D8N A;  2V8G A;  1S72 Z;  2VUM I;  2G2K A;  4OC3 A;  4A93 I;  3S1N I;  1VQ8 1;  4F8Z A;  3CCQ Z;  3BG0 B;  3KAS A;  4ZYQ A;  2V8D A;  3EER A;  4E2X A;  4P4J A;  3VH9 A;  2AFZ A;  3FF3 A;  4F9U A;  1K83 I;  2KPI A;  1JQG A;  1M1K 2;  1L1O C;  1LQL A;  3MON A;  3CC4 1;  3S2D I;  3DGV A;  4JZ0 A;  4R7M A;  5LYI A;  1ZG8 A;  4A94 A;  1LAN A;  1ZLH A;  3D67 A;  4X2T A;  2PM9 A;  3S9N A;  4YWY A;  3CCM 1;  5AN9 F;  4NGP A;  4PXB A;  3OW2 Y;  4R76 A;  1KRL A;  2WB1 A;  1TWA I;  5A2Q f;  2QRC B;  3KL9 A;  3JAM b;  2ZAE B;  3IEH A;  3CCL Z;  2CTB A;  3HOX I;  2YU9 I;  4P4D A;  1VHO A;  4F9V A;  4P45 A;  2ZOF A;  1ZG7 A;  2QLV B;  3M4O I;  4NBG A;  5LYF A;  2V77 A;  3CCS Z;  5IP9 I;  3B3T A;  1FNO A;  4NBE A;  3N5F A;  3MRU A;  4RVD A;  1Q86 1;  2ZOG A;  3HKZ A;  2PJ5 A;  3B35 A;  2O4H A;  1VQ9 Z;  2RPR A;  4ZI6 A;  1VQN Z;  1YJN 1;  4MHN A;  2ZEN A;  1YHQ Z;  5FLX b;  1HEE A;  3QWU A;  2RIQ A;  5LYD A;  1I3Q I;  3S17 I;  2QEX 1;  1QF8 A;  1WW9 A;  4ZX8 A;  3GB0 A;  4Y52 I;  5HVH A;  2Q4Z A;  2EWB A;  2EK8 A;  2IQ6 A;  3HOU I;  2Y0S A;  3CCU Z;  3CC2 1;  1HDU A;  4UF4 A;  4MMO A;  2AFU A;  2XEG A;  2CTC A;  3FX6 A;  1WII A;  3QNV A;  2DE5 A;  3MZK B;  3IC1 A;  5ELY A;  2W03 A;  5D1O A;  3G71 1;  4PXD A;  5T6B A;  2ZEP A;  4P4B A;  3NDI A;  2AFX A;  1YSJ A;  3D6W A;  4UIA A;  3GTQ I;  4G1P A;  1DL6 A;  1VQ6 1;  1VQK Z;  2BO9 A;  3PBE A;  1VQ7 1;  3PB4 X;  4UIB A;  5DS0 A;  5F09 A;  3F3P C;  3SJG A;  3IX0 A;  5LL6 f;  2ZEF A;  3BHX A;  2V8K A;  1I6H I;  3PB6 X;  1Q81 1;  4JYW A;  1P9N A;  1XJO A;  4EFD A;  2B63 I;  3CD6 1;  2AFM A;  3GTO I;  1Y1W I;  8CPA A;  4NBB A;  4Y7N I;  4OP4 A;  4ZY2 A;  2NSM A;  3CCJ 1;  2V8J A;  2YAD A;  3FQM A;  3CME 1;  2JEW A;  4P4E A;  4FAI A;  5JH9 A;  2ZEG A;  2R93 I;  1TKF A;  2XEI A;  2VL1 A;  4OC2 A;  3GTJ I;  1RO2 A;  1NUI A;  1S7M A;  4MRI A;  3PFO A;  3TC8 A;  4IAV A;  3I55 Z;  4OC1 A;  1LAP A;  2AFW A;  4WJB A;  3FJU A;  1YW6 A;  1RO4 A;  1N2F A;  3D7D A;  4RS4 A;  2QRE B;  1PCA A;  2HU9 A;  2M48 A;  4RV9 A;  2POK A;  3J80 b;  3SI1 A;  1K73 1;  4A38 A;  4EWT A;  2ANP A;  1W2B Y;  3SJX A;  1TWH I;  1RO0 A;  1ARL A;  1GYT A;  3LMS A;  5C44 I;  2GTI A;  1QMU A;  4OC5 A;  3CCL 1;  1YLO A;  4H2K A;  4NGN A;  3V7Z A;  1VQP Z;  3K7A I;  3EED A;  2F7V A;  2JNY A;  4MCS A;  4NBC A;  1VQM Z;  2DE6 A;  2OTL Z;  1VGY A;  3T8W A;  2ZEH A;  3FED A;  1LAM A;  3CCS 1;  1OBR A;  3CCE Z;  4OC0 A;  2AFO A;  1Z8L A;  1Z03 A;  2Q43 A;  1X3Z A;  2OZK A;  2JA6 I;  1RQF A;  3SI2 A;  2QA4 Z;  5CBM A;  2OTJ Z;  1VQN 1;  2JA7 I;  3CCV Z;  1QYP A;  2EGT A;  2PVW A;  2PIZ A;  3FVL A;  1VLA A;  5D1O B;  1VQM 1;  4MCQ A;  1ARM A;  4A3E I;  1BLL E;  4W9Y A;  1TKH A;  3PRT A;  3G6E 1;  1QQ9 A;  4HGY A;  3IF8 A;  3K9T A;  5K8P A;  4DJL A;  4A3F I;  3S15 I;  3FEE A;  3J81 b;  4UEE A;  2PJA A;  3CCU 1;  4OME A;  4MHP A;  1I50 I;  3HOW I;  3CCV 1;  5C4J I;  2R92 I;  1PYT B;  1VQ8 Z;  4MXU A;  1Z02 A;  4DGL A;  3B3S A;  1YUK A;  4DUK A;  4NB8 A;  1YI2 Z;  2F4O A;  1TWF I;  1Y7E A;  2OOX B;  5FLX f;  1JJ2 Z;  3D4U A;  5IB9 A;  4NBH A;  2PCU A;  2K3R A;  1Q7Y 2;  4A3K I;  6CPA A;  1Y0R A;  3CPA A;  3GCF A;  4BXX I;  4A3L I;  1YJ9 1;  2GLJ A;  3B3C A;  4PPZ A;  1QVF Y;  3HLP A;  2HF1 A;  4A3B I;  3PB8 X;  1TKJ A;  4R8F A;  4ONW A;  3VAR A;  1VIX A;  3CDX A;  2BJO A;  3CMA Z;  3SJE A;  2PIY A;  1ML8 A;  4RVH A;  3CD6 Z;  4TNU A;  2R7Z I;  1NP6 A;  4B6Z A;  3GUX A;  3U50 C;  2P3Y A;  1N8R 1;  4MON A;  4BY1 I;  3CXC Y;  1XRY A;  3LWU A;  3S9L A;  5CPA A;  1EE3 P;  3IO1 A;  1BAV A;  1RTQ A;  3PBB A;  4NBD A;  3H8F A;  1YHQ 1;  4A3J I;  1TXR A;  3DLJ A;  3FMC A;  4P44 A;  4QTT A;  2QR1 B;  2E2J I;  3CPW Y;  4HH4 A;  1ZH1 A;  1ELL P;  1VQ4 1;  1SFO I;  1ZLI A;  2QEX Z;  2J6A A;  3I07 A;  3CCR 1;  2EK9 A;  5J1Q A;  1N8R 2;  2RFH A;  3J81 f;  2WAQ A;  3S1M I;  3CC7 1;  2PJ0 A;  2QKD A;  4NFR A;  1DE4 C;  1VQL Z;  1VHE A;  3JRU A;  4YU9 A;  4HGZ A;  1ZG9 A;  3IIB A;  5LRG A;  3S16 I;  3GTK I;  1XMB A;  3GTG I;  5IT9 b;  3B7I A;  3I56 Z;  3JAM f;  4NGM A;  4FBE A;  4RVG A;  3CXC Z;  4RUH A;  2ZEL A;  3RZO I;  2RT9 A;  2NVT I;  3FEC A;  2CF4 A;  2PMZ A;  4NGR A;  3CCR Z;  3L2N A;  3HUV A;  5IP7 I;  2FVG A;  7CPA A;  2AKL A;  3I1U A;  3HOY I;  1F2P A;  1VQ6 Z;  3SJF A;  1VQ7 Z;  4QTU A;  1IGB A;  3D7H A;  5JM6 A;  1VQO 1;  2OTJ 1;  4NJR A;  2JR6 A;  4NH1 C;  1KD1 2;  4XX2 A;  4ZY1 A;  1TF9 A;  1Z2L A;  4EWC A;  1BPM A;  2V8I A;  1CP7 A;  4TWE A;  4E32 A;  3GTM I;  5CM2 M;  4P6Y A;  2XEJ A;  5D1P A;  3G6E Z;  5C4X I;  2PJ8 A;  3ISX A;  2GTH A;  3GKQ A;  4ZY0 A;  3S1R I;  1NJI 1;  2QYV A;  1F57 A;  3TE5 B;  2PJ1 A;  3MZL B;  2JMO A;  2E2I I;  1FT7 A;  4NGT A;  2OOT A;  2IZ3 A;  1NSA A;  4UEZ A;  2PE3 A;  2BOA A;  5LYL A;  1X0T A;  4Q7A A;  2R6M A;  3RZD I;  3T4N B;  3HOZ I;  4Z65 A;  1TF8 A;  3NDJ A;  4E2Y A;  5FLM I;  2NYQ A;  3PB7 X;  3PFE A;  5LRK A;  4NOZ A;  1VQK 1;  1IY7 A;  3PEI A;  1YJW 1;  2PRQ A;  5K8N A;  5I4M A;  4MHY A;  4GM5 A;  2JS4 A;  1USP B;  2H85 A;  5K8O A;  2QRD B;  3RZA A;  4MCP A;  3LUS A;  1YJ9 Z;  1Y1V I;  4UEF A;  2NVQ I;  2WZN A;  2GLF A;  3CCQ 1;  4E31 A;  3WC5 A;  1XFO A;  4E2W A;  1AMP A;  1VQP 1;  5K8M A;  4MD7 A;  4OC4 A;  3FQQ A;  4KSI A;  1KC8 2;  3GLJ A;  1YJW Z;  3H8G A;  3KGQ A;  3VMI A;  3BI1 A;  1QVF Z;  1ZB8 A;  4A3C I;  3M3Y I;  3VMG A;  3RBU A;  1W2B Z;  3S14 I;  1X3W A;  4BBR I;  2QVP A;  3IWW A;  1KQS Y;  1RLY A;  3G4S 1;  1YIJ 1;  1CPX A;  1Z5R A;  1TWC I;  4CL1 A;  1VQ4 Z;  4A3M I;  1YIT Z;  3I4M I;  4IK2 A;  4AXV A;  3S9M A;  2CIJ A;  4DQY B;  1K8A 2;  3PB9 X;  3S1Q I;  2G9D A;  3B2Y A;  1HDQ A;  3FKI I;  3IFE A;  2LIY A;  2RBL A;  2PJ6 A;  3I56 1;  1Q81 2;  3ISZ A;  3KHZ A;  3NH5 A;  1QVG Y;  3WC7 A;  4NBF A;  3GTP I;  2JBK A;  3G4S Z;  1YIJ Z;  1Y1V S;  2OTL 1;  4A37 A;  5HVF A;  1YIT 1;  1LFW A;  4AYB A;  1NJI 2;  1R43 A;  2DEA A;  4R6T A;  5IT9 f;  3CCM Z;  2NVX I;  3D66 A;  1H8L A;  1M4L A;  2V8V A;  1CPS A;  2HB6 A;  1Q7L A;  2QA4 1;  3CPX A;  2C6C A;  1QVG Z;  4A3G I;  4NGS A;  4DYO A;  2PVV A;  2RHB A;  3ESW A;  1VQO Z;  1Q7Y 1;  2IZ4 A;  2PJ4 A;  2ZEE A;  4OKO A;  1WCM I;  3SI0 A;  4MD9 A;  2E2H I;  4NJQ A;  1Q82 1;  1Q82 2;  2HC9 A;  1VQ5 Z;  1Y0Y A;  2ABZ A;  2V8H A;  1K9M 2;  3GTL I;  2XEF A;  3TX8 A;  2BCO A;  4A3I I;  4O23 A;  1CBX A;  2C1C A;  2C6G A;  3D68 A;  2K5R A;  3VTN A;  1LCP A;  3H3V J;  5D29 A;  1BPN A;  3J7A 4;  3S2H I;  2GRE A;  3KHX A;  2RB7 A;  3B3W A;  3KQZ A;  2JA8 I;  4FWU A;  2O53 A;  3KIH A;  3PO3 S;  4ZX9 A;  4RVF A;  4NBA A;  4DK1 A;  1S72 1;  1CX8 A;  1R3N A;  2PJ7 A;  3CC7 Z;  1VQL 1;  3CC2 Z;  1DTD A;  2WYR A;  2ZED A;  4CPA A;  3KR4 A;  3B3V A;  1TFI A;  1K9M 1;  2AFS A;  2P28 A;  3KR5 A;  2M6N A;  3IFU A;  2PJC A;  1AYE A;  3IJ3 A;  3NFZ A;  2F8H A;  2OR4 A;  2ZEO A;  3VMH A;  3CMA 1;  3G71 Z;  1KQS Z;  1YW4 A;  4A39 A;  4E33 A;  2Q51 A;  5A2Q b;  3VAT A;  3KQX A;  2IMO A;  3F3F C;  3FH4 A;  3J80 f;  1PFT A;  3D7G A;  1RNI A;  1Q86 2;  2IJZ A;  2QJ8 A;  4E2Z A;  3CPW Z;  1JJ2 Y;  1CG2 A;  3BXM A;  4X8I A;  2NVY I;  1JWH C;  1YUA A;  1ZB9 A;  4PQA A;  3V38 A;  4P10 A;  2JA5 I;  3RAM A;  2DE7 A;  3WT4 A;  3NH4 A;  3CT9 A;  2PK7 A;  5T64 A;  2C6P A;  2PJ9 A;  4BY7 I;  1XBU A;  5JGF A;  3I4N I;  4NGQ A;  4OID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...