4TNWF

C. elegans glutamate-gated chloride channel (glucl) in complex with fab and popc in a lipid-modulated conformation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
EVQLQQSGPELVRPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWIGLINPYNGGTSYNQKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYYCARDGDYYRYGRYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avermectin-sensitive glutamate-gated chloride channel GluCl
publication title X-ray structures of GluCl in apo states reveal a gating mechanism of Cys-loop receptors.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transport protein/immune system
total genus 37
structure length 221
sequence length 221
chains with identical sequence G, H, I, J, U, V, W, X, Y
ec nomenclature
pdb deposition date 2014-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tnwF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tnwF02
3MRMB 5JOFA 4OLYL 4LGSB 1CLYH 1KCRL 1RURL 3HE7A 4G6ML 2IMMA 3C60A 3VE0B 4HQQH 5FIEA 4I18C 4U1MA 1A6VL 4DKFH 3QWRA 3KLHC 4HFUH 1P2CB 2XZAL 4JQIH 4ZPTB 5LWYL 1KB9J 4MJ6B 4BK5A 4LCWB 5HHOB 4K3JL 5JW4M 5J6HB 4F7TA 4BKLB 2YR3A 5K9KA 3O4OB 4CUCA 3MNVB 4X99A 2ZSWB 3GSXA 5DLML 3VU2A 1Q0XH 2R2EA 5ICYB 1N64L 4DFHA 3V0VA 4KDWA 1KLFA 5KAQF 2RFXB 3LSOB 3RL2B 1LILA 5AZEL 5EUOB 2VLME 1H15A 2PYEE 2O5XH 5K9QI 2F54D 4ZUUB 3RVWD 2C4XA 4GRLD 5IP4A 4ODUB 1N2RA 3K4ZA 4UOJA 2R8SL 2YRLA 2DKUA 1OTUC 4HJ0D 2A9ML 4N8VB 4GBXD 35C8L 3DX6B 4LKCB 2IGFL 2DQGL 1J7VR 5CS7A 5HJ3A 4EVNB 4I3RL 1PX4A 1QA9B 3O3AA 5IVZB 1I7TA 1HOCB 4JFFD 4YFEA 5FO7A 3M17B 4O51B 4YPGB 3ORJA 4JO4L 1CGVA 4G8GA 3TA3B 3GIZH 5HPMA 1XGQB 1PVHA 4Y8AA 5JUEL 3BYTA 4UIKL 4ZOEA 1U8IA 3KPSE 3WNPA 3ZHDA 3WHXB 1GGIL 4LARL 5D7LD 5IHZA 1MCBA 1A14L 5C9JB 5J0BA 3L1OL 3G6DL 1VHPA 3CCHB 5C6TH 3KPPA 4I1NB 5FUZL 3IDIB 5TE6H 5C0IA 3IU3A 4QXTB 4BQCA 4TSBL 5IUSA 1CLCA 1NAMH 2XT1B 3B43A 4Y2OA 5DRNB 2FHFA 1C1EH 1A1NB 3SKMB 2COQA 1IGCL 4HC1A 3MQIA 3KPRE 1TZHB 1KXVC 3R4DA 3RNQA 1FZKB 5TDNB 5F9DC 3JVGA 3HC3L 4Z7OF 3V5KA 4M5YH 5F1OB 4HDIA 1SY6L 1D9KD 4C55A 3EGSB 3SCMC 5DSCB 3VWKC 3O3EB 2PCPA 1MCLA 2YA2A 4U0QB 3HS0B 4P48A 2XKNA 4BSVB 3CC5B 4D9QD 1PD6A 2EEDA 1FIGL 5HVGB 4NKDB 1VPOH 4U1KA 1ZHLB 3GSRA 4XPHL 3TCXA 5FGSA 2H2PD 1XCTA 2R69H 5E8PA 2H32A 1ORQA 2VDPL 2VIRA 4I77L 5FV1L 2PO6B 3U0WL 2R0WH 3TM6A 3UZVB 3H3KA 1ONQA 5EU4A 1X5GA 4ZAKB 3VD3A 4U2ZA 1EEYB 4X8JA 3ULSA 5E2TH 2Q3ZA 4WO4D 2EO9A 2GUOA 3CZFA 2FJGB 4EBQL 3OPZL 4CVXB 5I76B 1ZLWK 3ZHKA 1JUFB 3QEQA 5EIQA 4ZXBA 1NBVH 1BFOA 1Z2KA 2YD9A 3KHQA 1FFOA 4BQBA 1JJUA 2YZ1A 2A77L 4YDVB 2I9LA 5I74C 3MLVL 3T2OA 5E08L 3GJFA 2NCMA 3NCCB 5ANME 4PGBA 5HHXL 4NJAH 3O3BB 3TBVB 5H8DA 1GPOH 4J23A 3DXAB 4BH7A 1DBJH 3HZVB 4CMMA 1UADC 2ZCLL 3K1KC 2XRAL 1I3RB 1KEMH 3BWAA 3DUUB 2R1YB 4LCYB 5TQ2H 1BVLB 1MUJB 1U91B 2I07A 2QSCH 3CFIC 1FE8H 3KDMA 2GFBA 4FN0A 3HR5B 5HYSG 3QDMB 2NY7L 1VFMA 3S98A 3MR9B 1UEMA 4N90E 1DEDA 3HUJA 3FRUA 3UTSA 4PRIA 3QT2A 5JPMA 4LSTL 4Y4HD 3B9DA 3MTRA 2J12B 3FQRB 5GGSA 2QJDA 2G5RA 3GMNA 4Y16B 3QFJB 5DMKB 1OL0A 2UVFA 3HN3A 1MFBH 1NGWA 1FO0L 3H9SA 3B2VL 3GMRB 3O0RL 2LE9A 4HIEB 1TZGL 2A6IB 1B0RB 1FVEB 5E9DA 5IMKB 3BH8B 1BMGA 5D9SB 4ISVA 1AQDB 2DLTA 4F7MA 4WV1C 3D0LA 3OF6D 2X9XA 3OGCA 4PRHA 1U8JB 3X13A 1OPGH 2AQ3A 1D6EA 5LBSL 3GBML 3QIUA 5HHMB 1LK3L 3VRJB 3QAZB 1T66D 2HG5A 4P3DA 4AENA 2NY5H 3OKDA 1KJVB 3TBWA 6FABL 2QQLH 5FHAH 5LGJA 2WIIB 4G5ZH 3AC0A 2X4TB 2V5YA 5EBLA 3QUYA 4URTB 5C7XL 1HXYB 5EU6E 1YEGH 4R9HA 2WM0A 3PWPB 1F4XL 1ZT7A 1NBYB 3KPTA 3TP4A 4HX1A 4KRMB 4LSSL 1HHIB 1B0GA 4POZC 4XNYL 4FFVC 3GGWA 4L4TE 2ILLA 4AT6B 3RNKB 3BD3A 2IH1B 3NZHH 2HN7A 1PKQA 5IQ9B 4LSQL 1EGJL 2Z31A 1J1OL 4D2NA 2J5LC 2GTZB 3QWOA 3VRIB 2BDNL 2OBGA 3LS4L 3ZO0A 1A3LL 1XF4A 3IDYB 4E5XB 1RJLA 4R2GD 3ZL4L 1E0OB 4U1SA 3QEUB 5JPNA 1U41A 2W91A 3DLQR 2AQ1A 2VABB 4NOFA 4YE4L 1S78C 3LKSB 4M7LT 4F3FA 3TH3T 2W0FB 3QIBB 4C83A 1BFTA 3O4LE 4KKBC 2EIZB 4QRTB 3TWCL 4PJHA 5M95B 2PR4H 4KVCL 1J8HD 4QWWC 3DX8A 4JG1H 3AS0A 5HYJB 3V0AC 1P5VA 5KVMC 3CFDB 1MJ8H 1N5AA 1QSFD 3NZ8B 4DVBA 3VXMA 4NQDE 1CGYA 3CSGA 4G6MH 1QTYT 1X5LA 3LRSB 2DQCL 1TVBB 3LH2H 4NJ9L 4PJ9D 5DQDL 4TTDC 2EDRA 5H35A 5I18H 1BF2A 4RGMC 3BKMH 5D1ZC 4JB9H 4U0RB 2APTA 2EZ0C 2XZAH 5EZJA 2JIXA 4HKZB 1ZLUH 3KPMB 5DR5L 5GS1A 4RFEA 1F00I 1HHKA 2I24N 3TPUB 3TEUA 3MRNA 4RGND 2XQBL 4XVJL 3JWDL 2EDEA 1CIUA 1Q0YL 2ZCKL 4X6DA 5DLMH 3W0WE 1RZKH 2LAGB 3WFBL 1IRAY 3TYGH 2DDQH 4FABL 1JGEA 3QUZC 3TLRA 2EDQA 4LSDA 5AZEH 1BLNB 2EYSB 3MRCA 1D6VL 3L95B 4D0DA 3R8QA 5DHVB 2ZUYA 3VGFA 5T1LD 2AK4B 3OXSA 2DN7A 2DS4A 5D1XB 5FGBC 3C5JB 3V52L 2A9MH 1FVCB 1QFUL 5GZND 5F9AC 4RAHA 3TIEB 4F58L 4GKSA 2Y72A 3MV7D 4RA0C 5K33A 2AXGA 3GB7A 4K2UL 1AXSA 1XAUA 2H26B 1OM3H 2Q76A 3QUMB 1BQHB 3MLSH 4OZ4B 3CXDH 4H1LA 4NNYB 1EXUB 4JRXE 5D93B 1CVRA 4I0CC 2XN9E 4LLWB 4M02A 4IS6B 1SM3H 1Q1JL 1UQSB 3HPLA 1GGIH 1ZAGA 1I1AC 5IQ7L 2BNQD 4OZIA 3MRGA 5I0ZA 5I9QC 1FBIH 4WJ5B 4K23L 3TNNB 2I27N 4FQXC 5DUBA 1JPFB 3TBTA 5ID0A 4X7EC 4ZYKB 3DTXA 4GW4A 1CYGA 2CKBB 3BXNB 4MSWB 1I1FA 3QDGE 2I9TB 1IGCH 4OZFB 4LNVA 4LVOC 3I2CL 1C5BL 4NZUL 4DGVL 1FIEA 5KTEH 3FB6A 1EH9A 3SE4C 2VDNL 3ARGD 5TQ0L 4FTVA 2ED9A 3NCJL 3QIWA 3QRGL 4QRRD 4BFIB 1P9MA 3G08B 3HC3H 3T0EC 2EIDA 1R3IH 3FO1A 1S5IL 5HGDA 1BZ7B 2FATH 4X5WB 2CLVA 4JQVC 3RTQD 1AIFB 1T3FA 3WIFB 4FZEH 4HLZH 5C0EB 3MGAA 1BD2D 1EK3A 2HVJB 1FIGH 1AP2A 5ABDE 1TITA 5EO0B 1T0NB 4U6YA 3DBXB 4OD1L 4PJFA 2DWDA 1RIVL 1N6QH 3UO1H 1WQVT 4GKNA 3Q5YA 4L5FL 5JOPE 2UWEF 1U92A 1H5BA 2ZUUA 4I77H 3U0WH 3VFPA 4HWEH 1G7QA 1IM9B 4PG2C 5AAWA 3ZDXF 5C0CD 1Q9LA 4B0MM 2W65A 1WEJL 4KMTL 4YDJB 4M6MH 5AUMB 4NKIH 5DI8B 4Z5RA 3CFJB 4LOUC 5CBAA 4Y1AE 3NFNB 4N8PA 1DBAH 1AGEA 3MPCA 2ESVA 2O5YH 1P1ZB 3IS1X 3B5GA 2P42B 32C2B 4EBQH 4PGZA 4HUUB 1YEEL 4LHUG 5IKCA 3LCYA 4G6AC 4YHOL 5I0DA 4NQEE 3ARRA 4FS0A 3QI9D 1U8PB 2PW2B 3VXSE 2FX9L 5TH2B 5MP6L 4NBYB 4K8RD 4S10A 1TFHA 5EPMA 4PGEB 2NX5B 2R0KH 3GHBH 4Y8DC 1JYWA 1IGFH 4PJIB 4G80B 2PUQT 4WFFD 4LQFL 3DX7B 4PTTB 1DL7H 4Y4FA 1EUTA 4EDWH 5D5ME 3WJJA 3B2UD 3BGMA 3HG1D 4AL8L 4K71B 3NCYP 4LLYB 1OSZB 4GBXA 4YEFA 2Y7QA 2HJLA 2NY7H 3TO2B 4Q9QH 5ENWB 1JNLH 1YZZA 1ZHNA 4PJGA 1M71A 4D0CA 4HJGB 4IBLT 4JFFA 3FQUA 3SQBA 3HC0B 1LHZA 1U8OB 4LSTH 3BRFA 4PJCB 3HPJA 3C87A 2ICWJ 4P2OC 3OKEA 1P84K 2LVEA 4GMSH 3SQOH 5DJXA 4PTUB 4LSVH 2VISA 3HLAA 4KROB 5I17B 2V9TA 1CCZA 4Z7WB 4WI7A 3B2VH 3HB3D 2VC2L 4JHAL 5D7LA 2XXMB 2X7LA 4XTRD 4P9ML 4G8EA 1IKNC 1C08A 5DXWA 2AABH 1UB5A 4M1CC 2A9NH 4N68A 3O41A 3FZUD 4YWGH 3H8NA 3E6HA 2AXJA 4UTBH 4XPAL 4F9PC 3THMH 4BFGA 1SY6A 1IT9H 3I6LE 1KCSL 1LO2L 1OAXL 3MRJA 2NY3B 2AXFB 1N6UA 3GBMH 5FFLA 4YZFF 5EZLA 1U3HB 1LK3H 1CXKA 5BOPA 1NQBA 3QXUA 2QSTA 1DDHA 1F6LL 1UWEL 1T1ZA 4JM2F 1D9KA 2NYYD 2Y25A 1DQQA 3BKYH 5BXFA 2NTFA 6FABH 5BV7B 2BSTA 1CU4L 3FB7B 4OTXL 5DVNA 3GI9L 3P73A 5IG7A 3GMOB 4WEUD 2F5AH 4HKXA 1VGKA 4HBCL 2N7BA 4ZDHB 1F4XH 1SYSB 3MFFA 2WW8A 4LSSH 4S1RL 4JCMA 5E6IA 4OCSH 1MCPH 3T4AA 4WW2C 3Q2CA 3CFKB 1H0DB 2HLAB 2BDNH 1G7PA 5KS9F 2JJSA 3RHWF 4QF1B 1QBBA 3A6BL 2FHCA 2DI8A 3GIVA 5F7KC 4JHZA 5SWSA 4S0SD 1P4IH 1WAAF 4G43B 4HXBL 5DJYB 4NT6A 4BYHA 3D3VE 5JXAH 1ADQA 3E1F1 4RMUA 4R26L 1ZT1B 1TJIL 2ZUSA 2ITCA 4YE4H 5EZOL 3ZKQD 4Y2DB 1F5WA 5TJWK 5J13B 5C86A 2B4CC 2X4RB 4KVCH 3CU1A 2VLMD 3BGAA 2QV2A 2NY6B 4FQLL 5KOVC 4PV9B 2H41A 2PYED 4G9DA 3UTTB 3VXPB 1KYOK 1BIIA 3P4MB 1DLHA 3ROLB 4C54A 3BP4A 2X9YA 2ATPB 1RZJL 4QRPB 5KANG 3GI8H 4QHLA 3ARYA 3MYJB 4V1DB 3B9EA 4MJIB 2Y5TA 3MMEB 4PY8J 4XH2B 4X6CA 5C0AB 2WBWB 4X4ZA 1P7HL 1FVDB 4CGTA 5CZVL 3D48R 1LQSR 4QTHA 1A5FL 3BZEA 2EC9T 5CP7B 1FO0A 5IEKA 1SMOA 2IF7A 3UJJH 5E8NB 4X7DC 4Y4HA 3U46B 1T0MB 4TVPH 4PJAB 2X40A 4Y4KC 3QQNA 4X4XA 3P9WB 4ZQKB 3JWDH 2ZCKH 2NQCA 4J1UA 3HZYB 4LCCC 5CSZB 5F7FA 5HYFA 3QNXB 5F6IB 2FSEB 5A16B 1ZLVK 4YAQA 2VDOH 4G7YL 5L2KE 5EBMB 4NRZA 3KPSD 3X14B 5IM7A 1ORSB 2YD3A 2MTPA 4X5LA 4KKCC 3V4PH 4RX4D 1P7KA 5JLZA 2E6QA 3RUGF 2A83A 4KK6D 1T2QL 5CEXB 4NQVB 2A74B 4ZSOE 1NMAH 2J6EH 4HIIA 1CLOL 4CU6A 1DQDH 3OF6A 4NHCH 3RHWK 4KTDH 4LPWA 5DJ0A 1MFEH 4K3EL 3S4SB 1XGRA 3KPRD 3VRLE 3BUYB 4NCC2 1BAFL 5C07E 1I8IB 3ZE1F 3JXAA 3NCBB 1BVKB 3EKCA 3SKOB 4G42A 4KKNA 4L29B 1KLUB 5DYOA 5FM8A 3R0NA 1OP3H 5J1AB 5GGTH 4ELMB 4JRWA 3ZT7A 3GSQA 4Z78A 2FL5A 1FH5L 3PWNA 3DURA 5T1MB 3DVGA 4YNYA 1BEYL 3JSSA 3HHRB 2EDYA 1ZHKA 3VRLF 2GJ6B 2BP3A 1E6JH 4JN2B 4NYLB 4P57B 3MA9L 3VG0H 5ICXA 1EGJA 2JLLA 3GEWB 4BZ2L 3P40A 1ZA6B 4IOIB 5HI5D 4WUKH 3AREC 1OGTB 1G9NH 2IH3B 2GCYB 5JHLL 4RDQG 4L8CA 3EO0B 2FWOA 5ADOL 3ZE0E 2YA0A 4JM2B 3NA9L 1R5WA 4CW1A 5ELIA 3OV6A 4C4KO 1YEJH 3O3UN 3I2CH 3W39B 1QP1A 1JZ3A 4N8CH 1HEZB 4EI5D 5MEOA 2VDNH 1NGXA 4J3SA 3DROB 4Q9BA 3OKNB 3QH3B 3G9VA 4P23B 3PL6D 1F11A 3KJ4C 4OGXL 3NH7H 4LLQB 1XR9A 4X5XB 2NY4C 2MPAL 2UY6A 3UROR 2DM3A 1MLCA 2WNGA 4UUJB 2OI9C 1EHLL 1T04B 3V6OC 3K74B 4GG6E 3WFEL 4YDLC 4LRNH 3S34L 3ZYOA 5DHXB 3PWUB 2EDTA 2ENYA 2DOCA 4LGRB 1QSFA 2RIKA 5EU5B 1YMMB 5KN5A 5T5NG 1S7XA 1X6NA 2YD8A 2Q7NA 4PJ9A 3VD5A 3L7EA 4UAOB 3E0GA 4KMTH 4CVZA 2NY0C 4NRXA 2NXYD 4HIHB 1KCVL 5DJ2A 4JDZA 2FO4A 3UAJD 3H9HB 4P2RB 1HXMB 4GG6F 1KLGB 1OAQL 3IXAB 1QSEE 4N90D 3ARFD 1J9CT 2OR7A 4QHKJ 5F9WB 5AWNL 3WFDL 3NTCL 1YEEH 4WI8A 1YMHB 4XNMB 2ZSVB 4YHOH 1FFQA 4ENEC 2CR6A 2XWJA 2FX9H 3V0WL 3MRFA 3C6SB 4KK5C 3PGFL 3KNBB 4KRPD 1U6AL 2JE8A 4PRDA 4V2CB 4OFYD 4YHNB 4JZJC 1I1YB 4P5KA 4PJ8C 2LU4A 2OSLB 4HK3N 2WBJC 4GXUM 4I18B 4XNUL 3OKMB 4PRPB 1U95B 3FMGH 1ZLSH 1CT8A 5FA3A 1K8DB 4DN3L 1A7PH 1RUAH 5T1LA 4GAYB 4MAYB 4DOHB 1X5FA 4OUUB 5SWQA 1N4XL 2V5TA 4HPOL 4JLRA 1SYVA 2FCBA 4H20L 5HD8D 2CIIB 3QG7H 3MV7A 4KTYA 2GYSA 3P30L 4HK0A 5F96L 4XVTL 4JFEE 4M9PA 5FM4A 3AU1B 5CGTA 3FFCA 1DQML 3BJ91 1AI1L 4Q7DA 4LLDB 2DQEL 3PDOA 2E27L 3QFDB 4RSVA 4WDIB 4KK9C 5J7CC 4OZGA 1G6RL 3GJEB 5FUCE 3P9LA 5BVPL 3S5LA 6CGTA 2IEPA 5EU6D 3EYVA 1MQKL 4OLUH 1CDJA 4EXKA 3IJHB 3DGCR 1RMFL 2YPLB 1BWMA 3CX5K 3MRHA 3LEXA 2BNQA 5IFAH 5HHPA 3RWCA 4P9MH 3UYRH 3PABB 4PGCA 3PWVA 2GITA 4ZFGL 3AY4A 1LEGA 4DUVA 4I2XB 3IKKA 5JDSB 4A2MA 2BHUA 4L4TD 3ARVA 5EUOE 2FRGP 5EG6C 2YMXH 4UDUA 4XPAH 5IBUG 4QYOA 4NQCE 3S9DB 4PS4L 2QQQA 1KCSH 1OAXH 2FNBA 3HE6D 3KLAA 5EOCH 3QJFA 5FO9A 1YEHH 4JR9H 2NZ9D 3ARGA 3N1FC 5TDOB 1NMBL 1WCBA 4QRRA 5A3ID 1E4WL 1UWEH 5HHVH 3MOAL 3TFKC 3B6SA 5FOBA 3NN8B 4X80L 4L9LA 5LKNA 1WZ1H 3RTQA 1HHHA 5D7IA 1T1WA 4FXKA 3LKNB 4JPKL 1BD2A 3O4LD 3RU8H 1CR9L 3STLB 5IJVB 2EE3A 3DRQB 1NLDH 2XZZA 4JO2H 5GS0D 1S9YA 4YXHH 3BKJL 1MY7A 4S1RH 3L3HA 5D7KE 3HI1A 4NQDD 1K8IB 4MNGB 3RY6C 1QBML 5C0CA 2JF1A 3OAZH 4UT7L 2C3VB 4JY5H 3HE7C 5DUPH 3IETB 1VADA 5GS0L 1QUNA 4HULB 5F89B 3BYYA 5GJSL 3SCMB 2JJTA 4UU9B 3VWKB 2YRZA 3V5HA 5D4QA 2YUWA 1LO4H 2MHAB 1GXEA 1AR2A 1C7TA 1YEFH 2OJZL 5EC2A 3QI9A 4H1LG 4M43L 5CEZH 3W0WD 3ARPA 3MBEA 3L5JA 4KQ3L 1TJIH 5EU3A 2Y36L 1E4XL 5EZOH 4PBWD 4WHYG 3O2WL 1BQLL 4GAGH 1OW0A 2EDJA 3C09B 4QOKB 4XBGA 5F7YC 2YD5A 2M1KA 5FCUL 3IDNB 1AGCB 1FGVH 1EFQA 1XIWC 3RPKA 4J7RA 4NO2A 4JFQB 3PHQA 2FX8L 1UGNA 3AB0C 3CUPB 4TNWF 3JTTA 2EH7L 2IADA 2DQDL 1AGBB 2Z8VC 3P3YA 4CU8A 3CFBA 3L7FB 5A1AA 1MFDH 1KYOJ 1NLBH 1FNLA 1D5BB 4MA8H 2P7TB 2VRAA 5I74B 5B8CA 5DA4A 3FO2B 1MEXL 1NC4B 1GAFH 4MXVF 1ZLWH 4R3SA 3QNYA 5I1DA 4JRXD 3QUKB 1ZGLP 5HY9A 2XN9D 1KCUL 3LKOA 4JZOA 5E8OB 4ZUVA 2EXYD 3EHBC 1A4JA 5HYIA 2VLLA 1QYGH 1G9MH 1WFOA 3IDUA 1Q9OA 5L8LB 1AKJB 3DX9A 2ZJSL 3BIAX 1I9RL 3FN0L 5T3ZE 2VXVL 3D2UB 5TE7H 2FGZA 2DQJL 2NLJA 1KPRB 5FXCH 1IGTA 3EYSH 3QDGD 4KGLA 3UTQB 3S88L 3TT1H 1QFWH 3L3JB 1RQ5A 1PZ5A 3MGTB 1XMWA 3TNMA 1J1PL 3TJEL 2NW3B 1JGLL 2YD2A 3MLXH 1A7QL 2H45A 4M6AA 2V5RA 5ISZE 5F88B 3G5VB 4JFYB 4NZRL 3QDME 3IJSA 5J57B 4K94L 3G5XB 4RFOL 3DUHA 1K4CA 3H3PH 5CEZE 5DJAA 3LV3B 3JVGC 3QO0A 3WFHA 3VFSB 4Q0XH 4RCAA 3HAEB 1CQKA 5H37H 4OI7A 4AM0A 3P4NB 4ZG1A 3V4VL 3MA9H 4WV1B 1VDGA 2CDEB 1V3KA 5HYEA 1A6TA 2CLRA 1A9EA 3V4UL 5JOPD 4FP8L 2BC4A 2F53E 5E1HB 1A7RL 1CD9B 5JHLH 3OTTA 5DRWA 4NWTL 4TNWK 2UYLA 2FHBA 2D9CA 2K7QA 5EC1A 2ED7A 2WINA 1JP5A 2BOBB 4Z77B 3QQ4B 1JWUB 4ZPVA 3CLEH 4Y1AD 3SDYL 1CDUA 2NY2D 4X6FB 3F7QA 4MCZB 1T20B 3TN0D 4PLNC 5I1LA 1W0VB 3BDYH 4OD3L 1T4KA 4X9FA 1SJEB 1T7ZA 4NQED 3B4NA 2PKDA 3NACL 4OGXH 5HXMA 3VXSD 4MX7B 3FTGA 4MD4B 4E42A 1EAJA 4JJ5B 3EOBA 1FFNA 2MFNA 1JNNL 5GIRB 1G7LA 5DA0B 4XP6L 1DEEB 3L9RB 1EHLH 2GAZB 5I8OH 2FR4B 4TSAL 5IBTL 2D31A 4DZ8A 2PYEA 5MI0C 1TJHL 4NWUH 2WQ8A 3EW3B 2F74B 4LEXH 4XP4L 1FN4A 1INDL 1A02N 1HSAB 4XPFL 1ACYH 4H8WL 1Q38A 3S7GA 4JEGB 5DHVH 4XXDA 3O8XC 1KCVH 1VENA 3VDCA 1L0YA 4LLVA 4UI2A 4CU7A 1GVIA 3TVMB 4Q58C 1F2XK 4U1JB 2B2XL 3NTCH 2XFXA 4RBPK 3L3OB 2WIMA 3QXAB 2BSRA 5HVWA 4Y88A 2HFGL 4DEPC 3V0WH 4K3GA 3C5SB 1XF2B 1KFAL 1CXEA 4K7PH 3KPSA 3C08L 3F5WA 1I9JL 1ZKAA 2ICWA 4PGDB 3IFNL 2YRPA 4F9LA 1EZVY 2PW1A 4RX4A 5C3LD 2CJUL 5D1ZB 2EKSA 4RGMB 1LO0H 4XNUH 5I8KL 5C0NC 5DEZA 3K3QA 1MJUH 5DD0H 4IRZL 3D18B 2V5MA 2FIKB 1HKLL 1N4XH 3I6LD 5GQBA 4KH2A 2J88H 3VXOB 4H20H 3KPRA 3RX5A 5J89A 5DJZB 5JW5B 1T1XB 3P30H 3HCVA 5DQJA 2GKIA 2CKBH 3WUWB 4KTEL 1T5XB 3QIUC 4OZFH 5GJTL 2QADD 4MXWL 4HUWA 5I2IB 3VFNB 1N59B 1AHWC 2GEEA 2GTWB 2AS5M 1DQMH 2QHLA 3QUZB 1OAUL 4JG0L 2O93L 3C6LD 3BI9X 1NCWL 5TGBB 4WW1A 1LE5A 3T2NL 1G1CA 5ICZB 5FOJA 2E7BA 4PY7A 1MLBB 2OL3B 1MQKH 2BMKB 5GHWL 1RMFH 3EOAB 4KPHH 3U82B 2RCSH 3PQYB 3QUYC 4JFPB 1W8OA 5E5MA 4HWUA 4OLEA 5IW6B 5CD3B 1YEIL 2DMBA 1FNGB 3MLTB 1IM3A 1OAKH 4GSDL 5J3HD 4HD9A 1CE6B 4OLXH 3WFZA 4HF5H 3CX5J 2AK4E 4MCYB 1EEQA 3GSUA 2GJJA 1Z6JT 3JV6B 2Z31C 4EI5A 2AJZA 2F8OA 3T1FB 1FFRA 1NMBH 2OTWA 1T5WB 3PL6A 1MFNA 1ZXQA 5FDYA 4O2EB 3D3VD 4X80H 5EFIA 1I1AB 3NCEB 4JN1H 1DFBL 4MLSA 5I9QB 5IV2B 3CMGA 1C5DA 3ULVF 4FQXB 4ZS7H 1LNUA 2RAMA 2DMCA 5ANMA 1IGYB 3U30C 1OVZA 2HFTA 3RJDA 4IMKC 5IGXH 5JTWA 4LLUB 2ARJA 3BKJH 3SGKA 3BH9B 4LVOB 2BY1A 3ETBF 4DZBA 1QLFB 2BOCA 1QBMH 4AZ8A 1XFPA 3RWIA 1MCOL 1HINL 2P45B 5GISH 4H88L 3T0EB 3I3DA 2IG2L 3SHSA 2D2OA 4U7MA 3MRKA 3JV4A 1RJYA 3ARFA 2H9GB 2IAMD 3C2AL 4FQ1L 5HDBE 4J3XA 1NGPH 5GS1C 4YBQD 2NY1C 5K93A 2FECI 3BSZH 3FO0L 2V2WB 1G0DA 3D85D 4NNXA 1G6VK 5L2KD 2UVEA 1E4XH 1QEWB 4OFYA 5ESAA 4X4YB 1MELA 5DJCA 1J05B 2BVPB 1INQB 4MWFB 4YO0B 3LPFA 5C0FA 1ED3A 2XWBA 1JGUL 1DTUA 1DQJA 4YHIA 4ERSH 4L4VE 5KSVA 3SKNA 4ODVL 2DQIH 3WIHL 3L3DA 4LIQH 3FOMA 1MCJA 2BY3A 3KJ6L 5C07D 1I7RB 3CU7A 3AMLA 2CXGA 3RQ3A 4Z18A 3VXUB 4HUXB 4JPVH 1G6RA 1LO3H 3QEHB 3TH4T 1VFBA 4WENB 1H8NA 2BVOB 4KHTH 4OUOA 1V3MA 3KYKL 3SN6N 5KVEL 5E2WL 1S7SB 4KKAD 1HHGA 4BZYA 3IDGB 3LN4B 3WL9A 4M4PA 4XNQB 2YHGA 2ITDB 1JV5B 1L6XA 2EDDA 5EU7C 1HSBA 3SDXF 3T1WA 3GSOB 3TCLA 2E8YA 1GHFL 5EU6A 3LB6C 4IRSD 1Y0LA 3D1MC 4JKLA 3RL1A 3MJ9H 1D5XB 5E7FA 1UH3A 3BQUD 4O2CA 2VAAA 2HTKC 2P5EB 1BECA 1MVFA 3MLZL 1Z9MA 4P49A 2NX5E 4L4TA 4PJIE 4KFZC 3RGVA 4B7IA 1R24A 3KS0J 1FL5B 5DRZA 4YQXH 2GI7A 3HE6A 1UB6A 1JK8B 4R90H 1CD1B 4P2OB 1S7VB 1GH7A 3KPLB 4L3AA 3ES6A 3GSWB 2CDGA 3MCKA 3OB0K 3VFGH 1RU9L 1IQDB 4AH2B 2QQNH 3BIKB 1RD6A 3FT2A 5JW4Q 3F6LA 3RJQB 2FBOJ 1V3LA 4PJCE 1C5CL 2FO1A 4NCC1 5KJRL 4LPXA 1JE6A 3O4LA 2VQ1B 5I1AB 1BPVA 3CX2A 3V6FA 3P2TA 4MB3A 4ZS6C 1CG9A 3DVNA 1DBKL 1MHPL 5IIEA 2FJHB 4Z7WE 3QA3B 4XCNA 4NQDA 2E6PA 4O9HH 3C8KB 3ZYJA 3CH8A 1NMCC 5HYSB 4B50A 1YN6B 3BEVA 4UTAL 3ROOB 3WS3B 4GKZA 4X9HA 5ETUB 4TULL 5D71L 1UH2A 4FQJL 5IB5B 1QSED 5IFHL 1EFXD 2HKFH 4JDTH 2BNUA 1RZKC 5IHUL 5D7JD 4OD3H 3TYFB 3G5YB 3S96A 3W0WA 3WFCL 5ACZB 5LGHL 5DD6A 1IQWL 4OIIL 5ITBH 1AD9A 2NPLX 1JNNH 3I02B 5IVXB 3ZKMD 3VFUA 3S5LG 1TNMA 2PYFA 3VGEA 4JANB 3I75A 2XWTB 3MXVH 4PP1D 2IPKB 3W9DB 3BP7A 4N0YL 5LXGL 3MBXH 4RAUA 3IGAB 1EX0A 4GXVH 4ZUWB 4UILH 2G5BA 1UXSB 4F33B 4ORZC 4DVRL 1RHFA 2Z8RA 3RAJL 1INDH 3BO8A 4J12A 4UQ2B 4RRPA 1NCNA 4WWKC 4Y4FC 2ZG2A 3WJJC 8FABA 3PHOA 4NN5C 1B4JL 1GGTA 2Q8AL 1CWVA 5CGYC 4JFED 3CSBA 2C26A 2E5EA 3D25B 3SDCD 1LO5B 5BZWB 1ZVHA 4GBXC 1KB5B 4W4OA 4PJ5B 3VFTA 2OS7A 4S2SA 4JKPH 3IDMA 3HI6L 4LDOB 1JL8A 5D1QD 5EULV 3D87B 4GLRH 4NUGH 4JRXA 4CNIA 3A6OA 3P0GB 2HFGH 2XN9A 4U6HB 1ZHBA 4XRCB 1KGCD 4MZ2A 2OZ4A 1KPVB 4ONFH 3EBAA 1A9BA 3M45A 5ITFB 2CJUH 2DM2A 4UNTA 5C71A 5BS0B 2K3TA 3BFOA 1RHHB 2AXHA 3QG6A 4NQCD 1IEBA 3QCUL 2FLRT 1Y6NR 4WI5A 4EI6B 3AFLA 3FONB 1KG0B 4Y4KB 3Q6FB 4LCCB 5CKGA 3BE1H 4MJIE 2PNDA 3BZ4A 1GOGA 1MHHB 1VCAA 3EDJA 5CWSA 4UV4H 1TZIA 1E27B 3BN9C 5L8KB 2YD4A 2AJUH 4D0BA 4M8QA 1RZ8B 1ZLVH 1JNHB 4PJEB 2ZCHH 4M03A 1H8SA 2QKIB 4XC1L 2FD6L 4NNPL 1CGSH 1UM5L 3IRZA 1F3DH 3PXJA 1U8MB 3SO3C 3AXLB 3V7AE 4U2YA 2A6KA 1OB1A 3R0MA 5D7KD 3QO1A 3HKFA 3T77B 2EE2A 5JA9A 2KZ1B 1HHJB 3NIGE 1VACB 2H2PC 3VJ6B 3RA7H 4HKBB 3JV5A 2DKMA 5AYUL 5E6IC 1IZKA 2AI0L 2P8MA 2VL4A 4Y1AA 5DFTA 3LQAH 3Q3GB 3W9EB 2G75A 1KJ2L 2ZOLA 2NNAA 4E41B 2JJSC 1PQZB 4Z7VB 3MACL 4ETQB 3A6CL 4S1SL 1YNLH 3NIGF 4NQEA 2WLYA 2OQJA 3ZT5A 3VXSA 1DFBH 4D9LL 1KN4H 3DWTA 2X09A 3AREB 4CADB 4OFKA 3REVB 3CMOL 1QFWI 5INDA 3JWOL 1D5IL 5L0QC 3P0YL 3FQNB 4LASH 4PJBF 3QUXC 1I85C 5D5MA 5F7EL 2JJWA 3T0VA 5CZKA 2HFFB 5IB3B 1CGUA 4OJFL 3RVTD 2PO6D 1ZT4B 5ID1B 3GFUA 1X4YA 2IG2H 3KJ4B 1FL6B 4GJTB 1BZ9B 2DIJA 4ZAKD 2AV1B 4YGAB 2Z93A 3QDJB 2X4NB 5GRJL 1IBGL 2ZNXA 4FQ1H 4GRMA 4PB0H 4TUJA 5DT1L 5BO1H 4X0KA 2OI9B 3JUYA 1RK0A 3U83A 3AS1A 3SY0B 4YDLB 4X6BB 1T0PB 4Y4HC 3SE8H 1F4YL 4JHWL 3ILPB 4W4NA 5CHNA 1U2CA 4HV8B 3QPXH 5IMOA 2OJEB 1G1YA 1J1XL 2XKSA 1YNKL 4P5MA 2C3GA 3PV6B 3PNWB 4EQ2A 4QRUB 2NY0B 2AKRA 3SE9H 5K9OB 3V95A 3UXFA 3GMMB 1XGTB 5I66B 3EJZD 4L9DA 2YEZA 4M6OL 3EOTH 2J4WL 4QO1A 1MCWW 1IGIH 1SVZA 1NFDE 4KDVA 1IC1A 5HVHC 4E9LA 5KAQG 1M7IA 2B5IB 5T3ZL 4F2MB 2VDQL 3H0TA 3ARUA 2OYPA 5ISZD 3QULA 1WGOA 3KYKH 3L3GA 4IHOB 3QDMD 3BRDA 5E2WH 5F44A 1U8NB 4JZJB 5CEZD 4FXLA 4PJ8B 5E5RB 4R4BA 3C6LA 4ZO7A 3F7VB 1DBBH 1OAZL 2WBJB 2W9DL 2YC1B 2ADGA 1CE1H 1NFDF 3BGFC 4X7TB 2GK0B 5D70H 1WT5A 1IJ9A 3T3PE 1I8MA 3QFJD 1NGYB 2CK0L 5ALCH 1WC7B 3FQWA 1A0QL 2VJXA 2BY2A 1DBML 2F53D 4EJ1C 3O6ML 4Z9KB 1Z3GL 1R3HA 4QT5B 3HZMB 4Z0BL 2KUTA 4U1NB 4U6XB 3GK8L 4J3WA 3MXWH 3D0VB 5LQBH 1M7DB 4DOHE 3T3PF 1G7JA 4PY8I 1JPGB 4LHUB 1U3YA 5D2NE 5SWZE 3U4AA 2AERT 5EUKA 1QFPA 5F3HB 5FYKH 5EWIL 3IDJA 2IPTH 1VGEL 1CFNB 3DI3B 43C9B 4I48A 1C5CH 5F7WC 2YK1H 1ODAA 1Z5LB 5JORA 3ULUF 3D69A 3HMWL 1MI5B 3OKLB 4EEEA 4X8XA 5HI4D 2AJ3A 3ZE2E 5IR1B 2VXUH 3VXQB 4HUNB 2YPLE 4HKJA 4MHHG 4W6XB 3MRPA 3LEVL 5IB4B 5BZDB 4YFLF 4XHJD 4F57H 2JJUA 5FYJH 4MA1C 2IANE 3VXTB 2DTSA 1U93A 2EYRA 1WUNT 3O81A 4X6EA 1HI6B 1I8KB 4Y5VA 3JWDC 4FFYH 3Q1SH 1HILB 3E6FB 4U1LA 2ORBH 2IAMA 5IHUH 3ZE2F 1K5NB 5C8JB 3FT4B 5DK2B 1FORL 5LGHH 1R5VA 3D85A 4HWNA 3IFPB 4RGNC 1J88A 1NANH 3SOBL 4LLMA 5FECA 1DN0B 3WIHA 5I1CH 5JOFB 2G60L 2X4OB 3QIBD 4N0YH 3G04A 3HE7B 4ZSOA 3HZKB 3PF2A 2CKNA 3N0PB 3S37L 2UZIH 1Q94B 4U1MB 1J0JA 3RAJH 2W1NA 4OIBA 5DD1L 1VA9A 1QFHA 1CXLA 3FB5B 3I6KA 3JTSA 1EMTL 1T89A 4MNGE 5TE4L 2XTJB 12E8L 1XH3A 2B1AH 4NGHL 1HWGB 5EOTA 4K9EL 5K9KB 5IB1B 4DGYL 4I0KA 5HSFA 3RVVC 1JN6B 2XQYG 4HBQA 15C8H 4OM0L 3GSXB 4OIAA 3ZKNC 1T03H 4TN9A 2R2EB 1NKOA 4EUPH 4J4PC 3CNKA 4GRWF 3V0VB 2ZG1A 4G7VL 1C12A 1KIQA 5HHNA 1MJ7H 4XCCL 4IRSA 4ZD3L 2DJ4A 4OF6A 1XIWB 3HAEH 5E00A 1XEDA 1CZ8L 4UT6H 3L3KB 3AB0B 5L6YL 3W2DH 4NN6C 1N2RB 3FRPA 3AY4C 3K1DA 4QOKE 4WFHE 4YIQA 1QKZL 1IC4H 1G7IB 2EIEA 2XOTA 3ZMRA 5HJ3B 3UMTA 1JGDA 2AK4D 2PTTA 5T5NF 1IEAB 3O3AB 2X4QB 2DJUA 4JFDB 1FNEA 5D1XD 5F70A 4GW1B 4JM4H 5FO7B 1WZMA 4G8GB 3A0OA 4M7JH 2YD6A 5HPMB 3ULVL 1F6AB 1NUNB 3DGGA 2EC9U 3OAYK 3DV6A 1U8IB 4Y19E 1RJZA 4HS3A 2Z4QA 3CD4A 4OF8A 4ODHL 4PJ7E 1RSFA 3V8CA 2DMKA 4L9LC 5IHZB 4M00A 1I7UA 3L6FA 3O6KH 2HWZH 2J7LA 1WZKA 4GG6A 2BVUA 3NPZB 4I3GA 1OTTC 3WLWC 5IT2L 5MHSE 3QR2A 3KPPB 4GAJL 1FCCA 1GIGH 5C0IB 3IU3B 5HGAA 1CFSA 3VXNA 5DMIL 1TQCC 3MV11 1PW3A 2AI0H 4PJ7F 3EO1A 2X89D 1X7QA 2P8LA 1I3UA 4XX1G 5DJ6A 4S1QL 1EVTC 5KSAD 3VWJD 1F8TH 4YHYC 4HDIB 2OXHA 1OP5K 2JJTC 2HT4D 5BRZB 3ISWA 5C0DA 4YK4C 4HSQA 3BP6A 4AEIH 3GMQA 5BOZG 4DTGH 1N0XH 4DAGL 3QQ9D 5C6WH 4MVBC 2XKNB 4FFZH 5ALBL 1F3JA 4W6WB 4U1KB 3QI9C 3GSRB 2VOTA 3MBEC 3NOIA 1XCTB 5E8PB 1MAML 2H32B 5MENE 1N3NA 1ORQB 1PGRB 2QLVB 1P6AB 1YQVL 2VIRB 5F1NA 2B39A 1OW0C 1OCWL 1W0WA 1ONQB 5EU4B 4LLAA 4N1CA 3SKJL 5GZOD 4NSKB 4PJHF 3GBNL 5E2UH 4X8JB 1U58B 2DLFH 3ULSB 3V6ZA 4OJFH 2J8HA 3LIZL 5F9JA 3H2WA 3GRWH 4JFXB 2GUOB 3CZFB 3ESUF 2FYYA 4JFEA 2MSPA 4I13B 3SDCA 2APBA 1YPZB 3EYFA 5D7SL 5B39B 2SEBA 5L88L 3QEQB 5DVMA 1BFOB 4ZPTA 3OGOE 1PG7H 1II4E 1DUZA 4FQIL 1A6AA 4LGPB 3LKRA 4LAQH 5D1QA 5C1MB 5B8CC 2DTML 2Q1EA 1F4YH 3GJFB 4M5ZL 3SBWA 1KSRA 4JVWA 5MI0B 2CH8A 3KXFE 4UQ3B 3B9AA 2ZSWA 1PDKA 1EVUA 1J1XH 4K7FA 1YNKH 4BH7B 4X6DF 5ICYA 3LMJL 2I5YL 3BMWA 4HK3J 1TCRB 2VL5B 2OL3H 2RFXA 3BWAB 3O8XB 3RDTD 2NX5D 3RL2A 4XTRC 5EUOA 2I07B 3BAEL 3C5ZC 4DFIA 2GFBB 4NQCA 1NKRA 2J4WH 3FZUC 1Y6MR 3VD9A 1L0XA 3UTSB 3HUJB 2A73B 4PRIB 2QR0B 4OF0A 5JPMB 4DEPB 1JGVH 4R8WL 2R4RH 1INEL 4GT7A 5GGSB 4U3XA 5DEFA 2IC2A 3GMNB 2F58L 4RBPH 3VGHA 5IVZA 3EYOA 5CJQL 2AEQL 1NGWB 1U8HA 3H9SB 4EOWL 3M17A 3MRRA 4OLZL 1BGXL 2NYYC 4M3KB 2MKLC 5E9DB 3V6BR 1XGQA 2MCPL 3VCLB 2BSSA 5I1KL 1A0QH 2EDXA 4PLKD 4ISVB 1XF5B 4KROD 7CGTA 5C2UB 1KT2A 4Y0GA 3D0LB 3VI4E 4PRHB 3EFDL 2O26U 1KJ2A 3X13B 3KPQA 4GLRI 1KELL 3DV4A 4RRPG 5E8EA 3QIUB 3WBDA 2D7PA 1ITBB 2D0HA 3IDIA 1AHWB 3MUY1 3OJ2C 3EDFA 1JWMA 3NIFF 2NY3D 3OKDB 3AAZA 4EXPX 3ARBD 4YHKL 1TZHA 1U3HD 1UWXK 2ID5A 3VI4F 5CILH 1MCWM 4FQQA 4X9IA 1UA6H 4KUZL 4AYFA 5LGJB 1L7IH 1MNUL 3QUYB 4DQOL 3EGSA 1ZT7B 4HLJA 5JQHC 1OLZA 2BERA 1B0GB 1KTKE 1RZJC 2W60A 1FPTH 4IDLA 5KSBE 3GGWB 4LSUH 4AG4L 1ZHLA 2HN7B 1PKQB 1KPUA 2Z31B 3UJTH 1IAKA 4K55A 2YWZA 1XF4B 1BREA 5KVDH 1ZE3C 4ZAKA 2AEPH 1Q9KA 1MPAL 4M62H 3A67L 1EEYA 4U1SB 5KSBF 5JPNB 2O5ZH 2Z91A 4Y5YA 3L5XL 3U30B 1A47A 2E9WA 2B1HH 4Y5XA 1G9MC 4F3FB 5F1KC 3KWWA 3EDKA 3CPLA 4MQSB 5I76A 3IF1A 1NCAL 2HT2D 4C83B 2IALA 4PJHB 2YPKA 3DX8B 1IL1A 5DK0B 1IKFH 3I3BA 1AQKH 3UDWC 2HMID 4O5LH 2G60H 1N5AB 5EIIA 1JVKA 4DVBB 3VXMB 5FYLH 2RHEA 4MS8D 3WXVH 3O3BA 5IBUB 1WVZA 2BZDA 5H35B 4UINL 4KK6C 3QCVL 3WE6B 1CN4A 4LF3A 5EZJB 2JIXB 1WJ3A 3WLBA 5TE4H 12E8H 4LL9A 5GS1B 4RFEB 2R1YA 2NY1B 3GMPA 1CICC 4UB0L 4MJID 3LHPL 3T0EE 3MRNB 5ISZA 1BBJA 3BDBA 1B88A 3QDMA 1WWBX 2Z9TA 4X6DB 1S7UA 3NA4A 2D7QA 4MD5A 1WBZA 2YUZA 4BQ9A 4ZTOL 1KBGL 2VLJE 1ULVA 1JGEB 5A43C 5A2FA 5LJYH 1LE9B 2AJSH 2HFEA 1ZEAH 3RWHA 4MNHA 4ZD3H 4P3WA 1FNSH 3MRCB 1K85A 4D0DB 2JB6A 3ILQD 2F53A 4K7PY 1FSKC 4YGVA 1FZOB 2R23A 4OCWL 3OXSB 3T0AA 4GS7C 1A3RH 1FVEA 2L4OA 5HI5C 4WHCA 1OAYL 5IW3A 4KJWD 1B6DA 1EAPA 3R1GL 3MROB 4GKSB 3ZSTA 2VDRL 2AXGB 1AXSB 4S1DC 3HFML 2Q76B 4KVNH 5D2LE 3WDIA 4KZEL 1HNGA 1NCCL 1CLZL 4IEFB 5C0JB 4H1LB 2X1QA 4EI5C 4YHZH 3ULVH 3VRJA 4IRJC 2AK1L 1DE4A 2E3VA 1FJ1B 1NEZA 3MLRH 3PL6C 2IQ9L 3HPLB 2CXKA 2HVKA 3PGDA 3FQXA 1WIUA 3MJGX 1WBXA 1KJVA 4WFGE 1WISA 4OZIB 1EBPA 4IOFD 4RQQA 5D2LF 3W5MA 4Z95H 3VI3E 4YXKH 2WIIA 5DUBB 4XP1H 5MERA 3B8SA 4YJZL 5ID0B 3ARDD 4YXLH 1HXYA 3QXWA 3DTXB 3I50H 4GW4B 4F7PA 3FOLB 1S9KC 3ZTJG 5HYQA 1F90L 2DBLL 2P5EE 5JO5A 2DAVA 4NDMA 3OSKA 5CBEA 3FB6B 1FHGA 2IH1A 4FTVB 3U36B 3SDAC 3VI3F 2AEWA 3CJJA 3DHJA 1JI2A 3FO1B 3D9AL 2DBJA 1W72L 5HGDB 1VEOA 3P11L 4C4KT 3ARFC 1R0AL 3OB0H 1FDLL 2YD7A 2Q87A 1R6VA 4XNZC 1T3FB 1KB5H 4P23D 2UY7A 1AP2B 3MODL 4PJFB 5KVGL 1C16A 4HCRL 2B4CH 4Z7UB 4P9HL 4GKNB 1D5ZB 5LAXB 4KRPC 1NMCB 2FH8A 1LGVA 3QIBA 3VFPB 1G7QB 3VW3H 5E2VL 4M9OA 2W65B 1H3GA 3BD5A 3HMXH 3H42L 5GGRA 1K3IA 2IQAA 2DICA 3P77A 4Z5RB 3LS5L 1W2KT 2H1PL 2ESVB 5ILTH 1JZ2A 1NFIB 1RIHL 1TVBA 4LCIL 1ZVSB 3WIIL 4S11A 1OD9A 3MCLH 5HD8C 5IKCB 4UMGA 2PTVA 5BJTA 4X6CF 4N0UA 2AGJL 4JREC 2OTPA 3B9VA 3ET9F 3QPQC 2E7LA 4PBXA 5LCVH 3PWJA 5CLTA 4R7DA 2OX5A 2R0ZL 3TPUA 1AO7E 1U36A 2DTMH 2IPUK 5EPMB 2ICES 1X44A 1H9VA 3WV0A 4P2CG 5FCSH 4XXCC 4LNRA 1CFVL 3QZWA 5IVXE 3ZSSA 5JR1L 4Y4FB 3BGMB 4NN5B 3EAKA 4ELKA 1UYWL 2CRYA 5CP3A 3ARWA 4U31A 3REWA 3MO1A 3KLHD 2V7NA 2VXQH 4GBXB 2Y7QB 2HJLB 3AMKA 3K4AA 5H94A 3RGVC 1NANI 1UWGL 3EJYD 4ZTPL 1TIUA 4AY0A 1ZHNB 5ACMA 5J6GB 1CDIA 1Q9WA 4PJGB 4PJXE 5D1XA 3WDJA 3HNTL 3C5JA 4PPTA 4D8PA 5C0GA 3FQUB 2I25N 3IDXH 3HE6C 5E99L 1FNFA 3HPJB 5C92A 2D7OA 1UM6H 4UIMA 4N0FA 3OKEB 5SWZD 1T7YA 3ARTA 2Q7YB 2VISB 4JPIA 3E2HC 1UCTA 4PJ5E 4XWGH 5JHDA 3QUMA 4TSCL 2J8OA 1BGXH 5EO1A 3ULUL 5D7LB 2X7LB 3V7MA 1NFKA 4LPVA 4PJXF 3BW9A 1JPSL 4LLWA 4PJDE 1C08B 2HTLD 2WUCH 1UB5B 4IS6A 1NCUA 3O41B 3QHZL 4MB4A 1FL3A 4KJPD 2YPVL 2VDLH 3E6HB 3DO3A 2YPLD 2EE6A 4XI5D 3TPKA 5GS0C 3CFEB 3VDBA 4YBHA 4ZFZA 3L5WA 3MRJB 2IAND 1KELH 5CUSL 2EEAA 4TUKH 5F7DA 1JPFA 5DJ8A 2X89A 5EZLB 4CL7A 3VFWA 3CZJA 1HIMH 3VWJA 1DDHB 5KSAA 4MSWA 4HAGA 2I9TA 1D9KB 2N4IA 2RJMA 1DQLL 5BXFB 5I19L 2BSTB 3QXVA 4QGTA 3P0VL 3SO3B 1J8HE 3P73B 1WCQA 2VDKL 5IG7B 1NL0H 1VGKB 5I1JH 5KSUA 1NDMB 1IAIH 1QPPA 1SMAA 1AIFA 2FEEL 4MDIB 4ODTL 5E6IB 4AQOA 1J10A 1XGYL 3S3JA 3WD5H 3RWJA 2C1PA 5EO0A 2WAHA 3T4AB 2EICA 3FRPG 4L4VA 2FB4L 5E95B 2XI9A 1QFOA 3GM8A 3KLDA 1PLGH 3RX8A 1MREH 1G7PB 4U3CA 4M7KH 1RFDH 5HGHB 5H2BB 1IC5L 4FQ2L 5C0RL 1LWRA 2OR9H 3A67H 1BX2A 5SWSB 3Q6GL 1E6OL 4YDIH 4NT6B 1CDYA 2X6MA 2BVTA 3SCMD 4NC1E 3T65A 3VWKD 4U1HA 5I8EB 4F15C 4NKOA 2MNUA 5FYKD 1JWSA 32C2A 4W4OC 2ITCB 5L0QB 4NZJA 4AEHL 4OZHE 3FKUS 3WEXA 3DECA 3QUXB 3EYUL 1U8PA 1CK0L 5TH2A 5F21B 1Y18A 4G9DB 3FB8A 4NO3A 1BIIB 1S5HB 1NCDH 3BPCB 1DLHB 1KJMB 3BP4B 1YEKH 3RDTA 2NX5A 1X5HA 3WXWH 4PJIA 4G80A 3OJDA 2Y5TB 4UINH 3VDAA 5TFSH 4D9RD 4QOKD 3TIDA 3E8UL 3GDBA 4OZHF 4WFHD 2XNAA 4PTTA 5TF0A 3JV0A 3OKYA 4QTHB 1XT5A 4O4YH 3VH8B 1QNZL 3F7YA 4K94C 1FO0B 2VH5L 4GUPA 4HZAA 1D7FA 4Y4HB 3BPNC 2FX7L 1OSZA 3BWUC 4JRYE 3TO2A 5KW9L 3EFFA 1H3PH 1ZSDB 4YAQB 5IEHA 2F8XC 1PG7X 5DK3A 3O2VH 2ENSA 4HJGA 4NRZB 4Y19D 3MJ7B 4HPYH 3HC0A 3QHFL 4PJCA 5IM7B 1NC4D 1AR1D 1NGQL 1IFHL 2V9QA 3MNWA 5JLZB 2A83B 2B0SL 1CL7L 4F7CA 1F58L 3STZB 5MHSD 4HIIB 3UYPA 4OZGF 5IF0A 4Z7WA 2MQ0A 2JCCE 4JAMA 4N0RA 5CMAA 5HVHB 4APQC 5DJ0B 5FF6A 2XG5A 5DWUL 3VFMA 1XGRB 4M3JA 4U1IB 5I1GL 2XYCA 3D2UD 2VDRH 4R4FL 4ZMAT 4G42B 5DYOB 1L6ZA 3HFMH 1EV2E 5I15H 1ES0A 4UT9H 3MOBL 2JCCF 3GSQB 3BGFB 4Z78B 3ARBA 1U3HA 2FL5B 3EDEA 3PWNB 3DVGB 4ORGA 1P53A 1ZHKB 2ZP0T 2YUXA 1LMKA 4BM7A 4C56B 5L2JA 4PP2A 5E6YA 5ICXB 4Q2ZA 1ZTXL 2IFGA 5IHBA 4QLRA 3F6IA 3FB7A 5MEND 1F2QA 1JHKH 3LKQA 4L8CB 2FWOB 4H8WC 3GMOA 1R3JA 3W11C 5SX4H 5GRUL 5AD0A 5HDQL 3FO9A 1I1CA 2XKUA 3HNVL 3BESR 1R5WB 5GS2H 4CW1B 1S9WA 3SGDH 2DBLH 1I9EA 1TTUA 1IC7L 5C09E 3KR3L 5MEOB 1NGXB 1EEUA 2W0PA 5HPOA 2R2BA 4JFZL 3TH2T 2ICCA 3FQTA 4YX2H 5BW7C 2HLAA 1F11B 4HXAH 3I6GB 2DQTL 5CIPA 2B7DT 4KY1L 5T3XL 4YHLL 4RMWA 3G6JE 4CN6A 4NO5A 3S3SA 3UC0H 2VXSH 1XR9B 4IDJH 3GUTA 4G6FD 3JUZA 5T5FH 2DIBA 3HC4H 1MLCB 4G43A 5DJYA 3KXFD 2BJML 2JELH 4M1DL 4BSWA 2VUOA 3V8OA 1ZT1A 1TJGL 1EO5A 4MA1B 3HG1E 4YLQT 5CD5C 4LU5H 4RIRB 4POZD 2I60L 5KN5B 2ZZUT 1NAKL 2X4RA 4QY8B 4V2BA 2J3SA 2Q8BL 2C5DC 3H42H 4J6RL 3V2AR 4CVZB 4EKXA 2Y07H 4JM2C 3BUTA 3VXPA 2FO4B 4D3CL 2B8OT 4OFPA 4CMHC 3BHBA 4MQTB 3OJVC 3MYJA 3FAWA 3MMEA 3TO4D 4YDKL 2BXYA 4RGNB 4H26A 3B3IB 1GGBL 4AMKH 2XZCH 1UZ6F 1YECL 2EECA 3MRFB 5D8JH 3I85A 4KUCF 3BPLC 2QADC 1UXWB 2V2XB 2WUBL 1VERA 1S78D 5JNYA 4PRDB 3NVQA 3NABL 4P5KB 5F7HA 5CSZA 5A16A 4F80A 2XA3A 1CT8B 5FA3B 1WT5C 5E1AA 4U1GC 4C58B 5T1LB 5SWQB 5DEGA 5DD5L 4K3DL 3R8BB 2HRLA 1SYVB 5F93C 4TTDD 1UYWH 5IB2A 5D1ZD 4NQVA 3MV7B 4HK0B 2EZ0D 1SEBA 4LCUB 2APXA 1UWGH 3PJSA 4TUOA 4HC1H 2ATKA 2FZ3B 5HDOA 2KQMA 5DC4B 3FFCB 4NM4H 3QYCA 5FK9B 4P2QE 5GRWA 2VN4A 1KEGH 1TTFA 4TQEH 1ZGLB 3N85L 1NC2B 1KLUA 2FDBP 5F6HJ 3P9LB 2VR5A 4JGJA 4JJHA 4OM1L 3S5LB 5J1AA 5GXBB 3EYVB 5ADPL 3BRGC 1UJ3A 4NN6B 3MRHB 5EBWA 2BNQB 3IFLH 5HHPB 4BELD 3ULUH 3RWCB 4BZ1L 1WF5A 4PGCB 5T1MA 1PZUB 3MJ8B 3PWVB 1V7NL 1LEGB 3LRHA 3GKWL 3ARDA 4JN2A 4NYLA 4O02H 1LDPH 4F37F 5JMRA 2R0LL 3M8OL 4QYOB 2H32H 4MAYC 3X3FL 3ZZ1A 4DGIH 3AM8A 1W72A 2IH3A 3QJFB 5FO9B 1HK6A 4LQ1A 2N56A 1YJDL 3TZVD 1MJJA 2R56L 1CDBA 2WK2A 3CSYB 1MIML 1WCBB 4HWBA 4QRRB 1U8QA 1AXTL 4G6JH 4HCRA 3MLYH 4L9LB 4M61A 4Y5VC 3KYMB 3UZEA 4JFDE 5I19H 1ETZA 5D7IB 2OK0L 1T1WB 4FXKB 3FN3A 1BD2B 3OAYH 4YBQC 3VFOA 2KQNA 4XNXL 3MUHL 3N9GH 2F9BT 1S9YB 3FT3A 1TQCB 4X5XA 3GJFH 4XP5H 4FQXD 4YEEA 1QLEL 1HNFA 1XGYH 4UUJA 5C0CB 2BXZA 1P4LA 5F71A 2D4DA 2HJKB 2FB4H 3PWUA 4HEPG 1KIRB 4YHYB 4M48H 1VADB 2XZQL 2BRRL 5EU5A 1BOGA 1NFDA 4WEBL 3BZDA 4EN3C 4YK4B 3V5HB 5C0RH 2ADIB 1T1YA 1LP9E 1T89C 3Q6GH 1E6OH 4XGZA 1YYML 3T0ED 5K9JH 3RZCA 2R2HB 4QTIH 5EC2B 3H9HA 3QI9B 1OP5H 4FRWA 1PSKL 3MBEB 5GPRA 3ABZA 1EO8L 1MIEL 4NO0B 1I8LA 2P5WE 4KKAC 1NEZG 2VLJD 5DDHA 4R4ND 1HH6A 1EJOL 5BRZE 2C3XA 5FKAB 1HYRC 2ZUVA 1CK0H 4F37K 2R29H 4UBDD 4KDTA 3GNML 5EB9A 1LP9F 1K4DA 5F9OH 2W38A 2X5PA 3HRZA 1I1YA 4M7LL 3VFRA 3I3EA 4NO2B 4X7SL 1X3DA 1L4IA 3PHQB 4I5BA 4I18A 5C2BL 1CFTA 3NAAL 3U48A 1R3LA 1QLRB 4LOUD 4OCRL 3X3GL 1J5OL 4NKMA 4OB5L 4GAYA 1MHEA 1QNZH 2BRQA 2VH5H 5CSBA 1TETH 2BCKA 2BK8A 5B8CB 2ARWA 2X4UA 1KTLA 3T2QA 4G6AD 5D2NA 4ODXA 4R3SB 5SWZA 1NCBH 4I0PD 4FNLH 3PIQB 5JZ7D 3QWQB 1YPZE 3U7WL 1FP5A 3LKOB 3OAUL 2IFFH 4JZOB 4ZUVB 4IIQA 2VLLB 1AFVL 1WLHA 1Q9OB 4WFGD 1X4XA 2Y4SA 3DX9B 3RVXC 3WSQH 2K1MA 5C0BA 3C5ZB 4WDIA 4WY7L 3MFGB 1RULL 3F12B 3C09C 4M6NH 1UKQA 2ZKHL 4YR6B 5FYLD 1RUKH 2NLJB 2YPLA 4ODSL 1IGTB 1KCLA 1YY8B 1KV3A 1JRHL 3TV3H 5J1TC 2IANA 3LAFA 4XMPL 3U4BL 3UBXA 2P5ED 5I1GH 3TNMB 4WGVB 3ZLQC 2XV6B 1XGPA 4HIXL 4R96B 3IT8D 3O2DL 3OKKA 3QDAA 3IJSB 3S36L 2HKHH 4MMXC 3H9ZA 3M07A 1K4CB 5TPWH 5DJAB 3QO0B 3WFHB 3G6AA 1SBSL 2BNRE 5TDOA 2KL6A 5FHBH 4AM0B 4XPBL 1ADQL 1NJ9A 4U49A 5BMFH 3QQ3B 2QQKH 4QXUL 1OARH 3NN8A 1A22B 5B3JE 3RIAF 1CF8L 1RZGA 4DN4L 1A9EB 4N5EC 5AAMA 3H9SE 3N1PC 3ZKMC 4J3VA 3QZWG 2IBZX 4X4MA 2LU3A 4H25A 4M1CD 4OKVA 1OT2A 5DRWB 2UYLB 2P47B 5E9DE 5I1EH 1IGMH 3OR6B 3EUUA 5EC1B 1X5YA 4ONGL 2QEJA 3DSFL 2WINB 2K9UA 4RMRA 2R9HC 1YY9D 1H3UA 3KG5A 1HQ4A 2WSKA 3UX9B 1T6VN 1F02I 4KI1A 4MNGA 5I1IH 5B3JF 1IC7H 3QCTL 5KVFL 1X9QA 2M2DA 4J8RB 5I1LB 3EJJX 4XPTL 1A7NL 1T4KB 4ONHA 3X11A 1CFBA 1MWAL 4PLJD 1SVCP 4Z6AT 2A2QT 4E42B 2AV7A 3FTGB 5T3XH 3SDCC 4ZFOL 2VXTH 1UWXH 3CDGA 3EOBB 2YN3A 5IESL 2ADJB 1A1OA 1AO7D 3OG4B 3RWFA 1BQHG 1ZV5A 5D1QC 3LZFH 2NW2A 1DLFL 2D31B 3MLWH 4DZ8B 1A6UH 2XXCB 3BIBX 5FUCC 1K6QH 1A8JH 2VYRE 2ZUTA 1REIA 5EA0H 1PAMA 3LKPB 4MAUL 1NAKH 3U4EA 1X6LA 2Q8BH 3DRTA 1RAMA 3OZ9L 4QOKA 1JFQL 4PB9L 4D3CH 4LLVB 2DJSA 3MRIA 4R6UA 2R39A 4NBZB 4QCIA 1RZ7L 1IAII 4PD4K 1BJ1H 4JFQA 2XFXB 4YDKH 3G5ZA 3V79C 3O6LL 5T1DH 2YKLH 1MFAL 4A6YL 2BSRB 1AGBA 2AJYL 2Z8WC 4FQHA 1YECH 2XQYK 4G6KH 4OLVL 4GMTH 3RIAK 1D5BA 4PJ5D 4Y19A 3KPSB 4UOW0 2OP4L 5ESQA 1N5YL 2W0KA 3F5WB 3FO2A 4H1LH 4G3YL 2ICWB 4O58L 4PJ7A 2A1WH 3QEGH 1ZMYA 3SDDA 2X1XR 4DKEH 2PW1B 1AD0A 5DUMH 5K59E 2EKSB 3H3BC 4WHYH 1CS6A 1U8LB 3DHMA 1S9VB 2VZ3A 1CICB 2CRMA 3SJVE 1AC6A 4YUEH 3KPRB 3VXME 1CGTA 4B53A 3JWNC 4LSPH 2H3NA 3TJHC 5DQJB 1RVFH 3N06B 4NRYB 5T33L 5GSVA 4XMKH 1MFCL 5TF1H 4HUWB 4MA3A 5J12C 1FGNL 3TVMC 3S35H 3MGTA 2YUVA 3CFCH 1MRDH 1CVSC 1LE5B 4WW1B 3QSKB 4P3CL 2APVA 4LDLB 2LU7A 3JWOC 1FSKB 3G5XA 4OLYH 1KCRH 4KKCD 4GS7B 3LV3A 3GO1L 1RURH 1MAJA 1V7NH 4L8DB 5MENA 5E5MB 3GKWH 1A6VH 4UNVA 2HLFD 4WV1A 1R5IA 3M8OH 2VLKE 5LWYH 2ZUWA 2VR9A 5J11C 1R3KA 3MNZA 3BPOC 3CLFL 4K3JH 3RKDD 1CD0A 3GSUB 5CZXD 2Y1VA 2J8UE 1YJDH 3U0TA 1EIBA 4EI5B 1QQDA 2B20A 4IRJB 2OTWB 4Z77A 4JQXA 3PL6B 1JWUA 4KZDL 1N64H 3DMMD 4JO1L 4WU5B 2VZ1A 1B3JA 5DTFA 3IAPA 1C5DB 1T20A 1A7OL 5EU7E 1DUYA 4E41D 1LNUB 1W0VA 5KZCB 1YNTA 4Y5YC 2J8UF 4UDTB 4NZDA 3KXFA 4M1GL 3MUGB 4Y5XC 1LEIA 2ARJB 3S3PA 1OHQA 2DM7A 2R8SH 1CXIA 3K8LA 5FGRA 4LK4A 1FFPA 2BOCB 4TPRL 1DEEA 3L9RA 35C8H 2E7MA 2FR4A 3CH1A 1KC5L 2IGFH 2DQGH 3SDAB 1DSFL 4I3RH 5GGQL 2AJVL 3HNSL 1OSPL 1VB9A 2XZQH 4L3EE 2F74A 4KAQL 2DQFA 3IYLW 2FH6A 3MRKB 4MD0B 1U2HA 3OR7A 4WVRA 3ARFB 1OOAA 4JO4H 1ZK9A 3JBG7 4XNZB 2OR8A 2DB8A 3TO4A 4OT1L 2RGSA 5JUEH 3HI5L 4JRYD 4UIKH 4KI5E 3BISA 2N7AA 2CRIA 5SX4I 3WMSA 2VDML 3QDJD 4LARH 4KRPB 2NY4D 4U1JA 1A14H 1MCHA 3SGDI 3VMOA 5ESAB 1EJOH 3G6DH 3L1OH 5DJCB 3QXAA 1X4ZA 2VSCA 2X41A 5FUZH 5C0FB 3MUJA 4TSBH 1KACB 3C5SA 2Y23A 3RY5A 1ED3B 1RUML 2XWBB 3TBSA 4P5TD 2BVYA 3GSVB 1DQJB 4YHIB 4KI5F 1AGDA 4Z7UE 5KSVB 3SKNB 1YDPB 3L3DB 4H0GA 4I8DA 3FOMB 5C2BH 2EDKA 2XY1A 3WKML 3NAAH 5ERWA 4KWUA 1F4WL 1QACA 4LPUA 5GGVL 4RWYL 4ZFFA 4JREB 2FGWL 1G6RB 2XACC 3D18A 4OB5H 1VFBB 1SY6H 2FIKA 5CINL 4DW2L 4XBPB 3K7UA 2CGRL 3VXOA 4HH8A 1HHGB 2A6JA 4LHQB 1FLRL 1N7ML 2ESVE 5J1SC 3WL9B 3UTZA 4ENED 4OQTL 3H7BB 2DD8L 1T5XA 4XPHH 4ACPA 2R1WA 1N59A 2W9EL 5EU6B 5FM5M 1UZ8A 2VDPH 5EORL 3I84A 4PJ8D 1RPQA 4O2CB 2K7PA 2WBJD 4BQ6A 2GSIB 5DO2D 1QRNB 5ICZA 5KSBA 1DZBA 2V5SA 3QB7C 3RGVB 1GZQA 2APFA 2F5BL 3P4OA 3RBGA 1J86A 3RPIA 1JRHH 5IK3B 4R97C 3HE6B 1UB6B 4XMPH 4WEMB 3OPZH 3SKUD 3TZVA 3VG9B 1IAIM 1YEDB 1U42A 4XHJC 3ES6B 5C09D 2YN5A 4H0HB 2CDGB 3RIFF 4FG6C 3MCKB 3MREA 1N6VA 3E2HB 5LG1A 3S36H 2A77H 3UTOA 4HMDA 3MLVH 3O9WC 5DMJB 5E5UB 5E08H 5GRZA 4YC2C 1QOKA 5HHXH 2UUDK 1K2DB 4KK9D 4H0IA 3O4LB 4XPBH 1G7HA 1ADQH 3V6FB 4QXUH 1IMHC 3HRPA 2F54A 4N5UA 1CG9B 3DVNB 3TBYA 2ZCLH 1UACL 2XRAH 5IIEB 4K8RL 4GRLA 3V7AG 1BBDL 4XCNB 1A2YB 3KPNA 3ARZA 1A21A 3OHXA 2EH8L 4I3SL 3C9NA 1VEPA 3GM0A 3KHOA 5DFVD 5DVLA 3DSFH 1FYTB 4KUCD 1ACZA 5D6DC 4LLUA 4K9EC 1CGXA 4GKZB 2O61A 1EEZA 4GQ9L 1XGUA 1AGFA 4WI6A 1FC2D 5D5MF 3AGVA 1TLKA 5HHQA 2BNUB 2PXYD 4LMQI 4XCFL 3T0EA 4Z8FL 2BFVL 3TFKD 1F6FB 3S96B 3W0WB 1FO0H 4XAWL 3O0RH 3PP4L 1AD9B 1S7QB 3QHTC 4DK6A 1TZGH 3VFUB 1TPXC 2VLJA 1MCDA 3P9MA 2PYFB 2E7LC 5GGUA 3I75B 4XVSL 2CDFA 3BP7B 1S7WB 2X4PB 2XY2A 4RAUB 5D72L 2G5BB 3PWLB 4X4YA 4PG2A 5LBSH 3BO8B 5IMMA 3CVHL 5C3TA 5I16B 4JPWL 1YYLL 4YO0A 3PHOB 8FABB 4G9FE 3OZ9H 1JFQH 2EXWD 3LEYL 3O11A 4F15B 2P4AB 1GOHA 4QXGL 1RZ7H 5D2LA 5A40E 3ULVC 5DZLA 2R4SL 4P2QD 4S2SB 1KENL 5I1HL 2QSVA 4I0PA 5C08B 4CNIB 4RZCB 5C7XH 4HUXA 3T0DA 1ZHBB 1HCVA 5ACLA 2CMRL 2EYTB 1N5YH 1MRCL 4KU1A 1UVQA 2VITB 3IDGA 2V17L 4XNYH 4PD4J 1A9BB 2D03L 4G8FA 2NZIA 1JV5A 1QSZA 4WCYL 1RUQL 3NPSC 2WANA 3O2DA 4LSQH 1EGJH 1J1OH 3UPRA 1SJHA 3LS4H 3QG6B 1XIWD 1A3LH 4Z7NE 4WO4A 1IEBB 3GSNL 3MJ6A 2P24A 3F7RA 4WU7B 2P5EA 3BPNB 4XBEL 1AJ7L 3ZL4H 3MV9B 1KIUA 2FBJL 2QHRL 2R15A 3BZ4B 5IOPA 4OD2A 4OV5A 2UWEB 3GHEL 1JK8A 3VWJC 5KSAC 5D6CA 1I4FA 4JFDD 4R0LA 3GSWA 4D0BB 5E8DL 4Z7NF 4M8QB 1T2XA 2HT3D 3TWCH 3I9GL 2ZPKL 3CDCA 5CCKL 4CVWA 3EHBD 3L3IA 4G8GD 4OF5A 2H6PA 4AH2A 3WJLA 4NP4L 3QQ9C 4APQB 2A6KB 4EIZC 1OB1B 1IKNA 2DQCH 4DUXA 4NJ9H 5DQDH 3TC9A 5JMOC 1V7ML 3WO4C 5F1IB 1QHOA 2JK5A 3HA0A 4F9PA 2CIKB 3BKCL 4XVUC 5DR5H 1MWAA 2P8MB 3V9FA 3WS6C 2FJHA 3ZDYE 5HGBA 3CK0L 4ZFOA 2F19L 4Y1AB 3QNZA 25C8L 2XQBH 4XVJH 2ZOLB 1CXFA 1Q0YH 1UCBL 4WGWB 4DJMA 3KYOA 3WFBH 4NQEB 4JO1H 3KGRA 4FABH 4PR5A 3EZ8A 4JHBA 2P5WD 3ZDYF 5C6PB 1AO7A 5INDB 5BRZD 1D6VH 3TYFA 5FA4A 1HZHL 3G5YA 4WI4A 4C56E 4NC2B 5L7XL 4HGWA 3SE3A 3V52H 4NQTA 1QFUH 1BP3B 4F58H 4WW2A 1PYWB 2DI9A 1CLYL 5GGVY 4HWZA 3K0WA 4A6YA 5GGQH 3UBXG 1DVFD 3RDTC 3HNSH 4K2UH 3IJYB 4F33A 1O5DT 2Z93B 4PJXA 4MQ7A 1QR1A 4GRMB 4JQIL 4QRSA 3D6GA 4TUJB 4X0KB 5CJOL 3RY4A 4J3UA 3HI5H 1Q1JH 1SQ2N 3PDDA 5JIIA 5BZWA 5IQ7H 4PJ5A 5CHNB 3QEQD 3MZGB 1BM3L 4Z76B 4K23H 5T1KD 4P5MB 1Q0XL 1LD9A 3WN5A 4PJDA 5F3BA 2AKRB 1D5MA 1OWRM 2AEIT 1N26A 3NFSL 3INUL 1HYSD 4CMHB 2YEZB 1C5BH 2L7UA 4NZUH 4PLKC 2O5XL 4DGVH 4M7ZC 4RNRA 3VGDA 2G2RB 3RFZC 4NQXA 5TQ0H 3NCJH 3O8XD 1F4WH 3QRGH 1M7IB 1VSCA 3H0TB 4TVPE 2V2TA 3ZE0F 1S5IH 4WNQA 4EIGB 3BPLB 5EN2A 1J12A 2QADB 3QULB 3L3GB 3U9UA 1CDCA 3GBLA 4KHXL 5DURD 3MA7A 3UTSD 1N7MH 4R4BB 4LCCA 2M8XA 3ECBA 3VA2C 4PRBA 2H8PA 1J0ZA 4MLIA 2WP3T 2ADGB 2BNRD 4OD1H 1J8HA 2DD8H 2JKXA 1RIVH 3ARBC 3GIZL 4LSRL 4U1GB 4L5FH 2X9WA 5KS9B 1I8MB 1UM4L 4M4RA 3FQWB 5FGCB 3T0WA 1MY5A 3H9SD 4X7FC 2FJFA 1JNHA 5C0ND 1GJIA 2YA1A 3QISA 1WEJH 1R3HB 5E9DD 4QGYA 1Q8MA 1U8MA 5INCA 3AXLA 2KPNA 4LEOA 2ICEA 5C6TL 2VN7A 1NAML 1G7JB 1YQ2A 1C1EL 4I4WB 1FG2A 2B5IC 4JY4A 2E9BA 3QIUD 4QHMB 2R1XA 4RFNC 5MP6H 1MVUA 1WK0A 4GOSA 4DKAA 5EUKB 1N0LA 3DMMA 3EZJB 3Q3GA 3S35X 4I48B 5HGGS 4OZHA 4L8SA 3VFVA 2QSQA 4LQFH 5JORB 1ZVYA 3KPOA 3T4YA 5BQ7B 3D69B 1GL4B 2HT2C 4FHBD 2AJ3B 4CADA 5IW1A 1VPOL 4AL8H 4HKJB 5DMGD 3MRPB 2R69L 2HMIC 3LD8C 4XWOC 2XA8L 1U93B 5JXED 1S8DA 2EYRB 3F65A 5B4MC 4X6EB 2E7CA 4Y5VB 1PJ9A 4LCWE 5HHOE 4U1LB 5GRVK 2HFFA 2IAMB 3RUGB 5E2TL 2NXZC 4JRYA 1FL6A 1KGCE 1KIPB 4NFBA 1R5VB 5E24E 2VC2H 4JHAH 1WFNA 1NBVL 4LLMB 3RVUC 4MB5A 1P6FA 1KTRL 3G04B 3QJHA 5C70A 4ZSOB 4NJAL 4P5TA 5D72H 2JCCA 1LO2H 2OJEA 4EN3B 5I75C 1DBJL 3ILQC 3SJVD 3PNWA 4JPWH 3VXMD 3JTSB 3O6FD 1KEML 1XH3B 1QR4A 4CDGC 4OQTA 5EOTB 3LEYH 4XZUB 1FE8L 5EUOF 1TENA 4MYWB 1IGJA 2EE9A 3U6RA 1T22A 1CU4H 1S7RB 2KBGA 4OTXH 4P4KD 3GI9H 2CK2A 3RI5F 4O00A 1NGZA 1KIQB 5HHNB 4HBCH 3BD4A 4IHOA 1JBJA 1KNOA 1MRCH 5A2IH 2MQ3A 1A6ZA 2V17H 4PJ8A 1XZ0A 3F7VA 5E00B 2WBJA 1UJ3C 4ONOA 1A4KB 4X7TA 2GK0A 2PF6A 3Q48A 3C60C 1IE5A 1A64A 4YHPA 2DF3A 1Z9OA 2VLKD 5E94B 4YIQB 5DHYA 1HKFA 4HW6A 3T3ME 3A6BH 1JGDB 3S6CA 2PTTB 4QT5A 3HZMA 2E6JA 1FNEB 1OPGL 2XTJC 3AM8C 3FFDA 5C09A 4QNPE 4HXBH 3DIFA 3Q5TA 4YFDB 4B5EA 1G0XA 4U6XA 3IFOA 4R26H 3MGOA 2YBRA 1HDMA 2ED8A 4ZO6A 5IROA 3DGGB 4PG9A 3G6JA 1JPGA 3DV6B 2XG4A 1RJZB 4HS3B 5E8DH 2Z4QB 2NY5L 4LVHC 3T0BA 2N1KA 3OX8A 2QQLL 4FQLH 1I7UB 4S0TD 3L6FB 4GG6B 5F3HA 5FHAL 5DRXA 1WV7T 1RZJH 4MDJA 4CJ0A 3HG1A 1YEGL 5HGAB 1RUPL 3MRQA 4BFEA 3VXNB 3IXTA 3J8F7 5CZVH 3BKCH 1U3JA 1CDHA 3EO1B 1A5FH 4XB7A 1X7QB 2P8LB 5DJ6B 4L3ED 3NZHL 2CR3A 3RI5K 2PXYA 1FV1A 5C0DB 5F7MC 4G7YH 4KI5D 3S36X 1HI6A 3DVIA 1I3VA 1RK1A 2IMNA 3V5DA 1F3JB 4LBEA 5I71B 3RZCC 5SV4A 1BIHA 1K5NA 4PYHA 4PV8A 5DC9B 3MRBA 1T2QH 1XF1A 3CVHA 4QHNA 1GYAA 4IMLA 5DK2A 1HZHH 1I8LC 1N3NB 4ZS6D 1CLOH 3MX0A 2OCFD 3DXAE 4Q74A 2OZ4L 1N8ZA 2GSGA 1DN0A 1ZS8B 4JG1L 4K3EH 3RY6A 4KDTC 1BAFH 4QHUA 2X70A 1MJ8L 3V6ZB 2VLRB 2X4OA 4EUPB 5F9JB 4FQCL 3HZKA 1S3KL 3LH2L 2A0LC 2C3WA 2FYYB 4JFEB 3Q5OA 1Q94A 5I18L 3SDCB 3BKML 3EYFB 4JB9L 4OF3A 4W6YB 2SEBB 1FH5H 1MSPA 3FB5A 1S9XA 3EJYC 1BEYH 4FXGA 4NFDA 1SBBA 4XCYA 4P2QA 1DUZB 1LDSA 1A6AB 5CJOH 2ESVD 3LKRB 4O2FA 5D1QB 3ZKSD 2NR6C 4ZUSA 4NPYA 3ULUC 5IB1A 4QRQA 3QFJE 4BZ2H 5D2NC 4YHML 1BM3H 1JN6A 3U9PL 1YA5A 1RZKL 4N0CC 4K7FB 2W0LA 3GSNA 1FYHB 4GG8A 4IIQC 3TYGL 5ADOH 2DDQL 3KYAA 4P4RB 1QO3A 5GGSY 3NA9H 3NFSH 3INUH 1JMZA 3J7HA 4NC0B 2HTLC 1JZ6A 4CN4A 5JIPA 3BN3B 1XIWA 4NQCB 4WWKD 4Y4FD 4KJPC 3L3KA 4XI5C 5CGYD 5HHME 1YC7A 2VUYA 2C7UB 2VTFA 4Q6IA 1H3XA 1G7IA 2Q86A 1BWWA 5DEFB 2D3VA 3N50A 2MPAH 4KHXH 3F8UB 4ZXBC 3UJIL 1IEAA 1Z0MA 2X4QA 4JFDA 3EYOB 1OM3L 1U8HB 4GW1A 3MLSL 3MRRB 1BF8A 3CXDL 3WFEH 3S34H 4JGMA 4DCQA 1EA9C 4LSRH 1F6AA 1LVEA 2BSSB 3QXDA 1UM4H 4D94A 2DLIA 1SM3L 3PGCA 3PWPE 4MXQC 2DYPD 1KT2B 1M6OA 5MEQA 2MQCA 1X5JA 1KJ2B 2Z35B 3B8YA 1FBIL 3KPQB 2A6DA 1VKXA 3DV4B 3HTLX 1CD8A 4Z7OE 5E8EB 1OAQH 5J12B 5AWNH 2KDGA 3WFDH 3OAZK 4JFOB 1JWMB 4LPYA 1MAKA 5J9PB 1WFTA 1NDGA 3AAZB 5IVNA 1LP9A 2IPUG 5KTEL 2V6HA 3BN9D 3PGFH 4FQQB 1U6AH 5FYKU 1NEUA 1R3IL 5B38B 1BFSA 2P5WA 4RGOL 5IWLA 2FATL 3GMLA 3LN5A 5BRZA 4ZUTA 4CAGA 4FZEL 3U7YL 4DN3H 2W60B 5HYJE 2WBKA 5J11B 5DQ9A 1L7TL 3BPOB 4HPOH 4KKLC 4ODWA 4OGAD 1J0HA 1N6QL 4WI9A 3UO1L 1KPUB 3DETC 3WO3B 4PRNA 5F96H 5E6ID 4XVTH 1IAKB 4HWEL 2XA8H 5FYJU 4G9FD 2HP4A 1B9ZA 1DVFA 1QG3A 2HH0L 5JW3L 1U0QA 4NSKA 1Q9KB 4GW5A 2IBBA 4M6ML 4NKIL 1U58A 1AI1H 2DQEH 1DBAL 2Z91B 1JF1A 4Y5YB 2E27H 4JFXA 2O5YL 1MHCA 1G6RH 4I9WE 4Y5XB 5L9DL 5BVPH 3KWWB 2EC8A 3CPLB 1YPZA 3IF1B 5SWSD 2IALB 4J2XA 4N9GA 1MRFL 5B39A 1B2WL 2YPKB 1IL1B 5T1KA 4ZFGH 5E03A 4L8BB 5EIIB 1FAIL 1AR1C 4P46D 3QUXD 2R0KL 3GHBL 4UQ3A 3SDDC 1IGFL 4PS4H 4MJ4A 2H2SC 1DL7L 4LF3B 4EDWL 3WLBB 1TCRA 2VL5A 2X2YA 5KG9B 3O8XA 5K9QG 3GMPB 1E4WH 1U8KA 3T8XA 3MZTA 5BVJB 3MOAH 4F7EB 4J3TA 5IBLD 1HQRA 2WWMD 5ISZB 1BBJB 2BHZA 4Q9QL 1DN2A 1S7UB 1JNLL 4JPKH 3O45A 4MD5B 2A73A 1WBZB 1CR9H 1LK2A 2QR0A 2BNRA 4WHTA 2HFEB 4GMSL 3RWHB 5E7BA 3SQOL 4MNHB 4YBLC 4LSVL 4NUJA 2JB6B 3S97C 1NAMA 1WSST 2F53B 5HDLA 4YGVB 2R23B 4UT7H 3VCLA 5GS0H 2AABL 5GJSH 1EAPB 2EIBA 2A9NL 3R06B 1XF5A 4YWGL 1SHMA 5B3NA 4UTBL 4HZLA 4CVUA 3THML 1XR8A 1XF3B 1IT9L 2OJZH 1MCQA 4M43H 4XX1E 2BY0A 4KQ3H 1AHWA 2F8VA 1YUHA 2Y36H 3ESVF 2Z92B 1DE4B 2GIYA 3O2WH 1NEZB 4JQXC 1BQLH 2HVKB 3PGDB 1VFOA 2HJFB 3FQXB 3BKYL 1WBXB 1J0IA 4OV6F 1M7XA 5HDBF 1G7MB 3NGBC 4RQQB 3U1SL 1CFQA 5MERB 4U6VL 4KK8C 2VB5A 5FCUH 4R97B 4C56D 2F5AL 5IHLB 2D7MA 3DO7B 1RUPH 2FX8H 4KMLB 1NBZB 2JTDA 4F7PB 2EH7H 2DQDH 5HYQB 1QRNE 4OCSL 5JW4N 5JO5B 5DGQA 1MCPL 5JXEA 4NDMB 2WZPD 5CBEB 4MQXD 4L1HA 1MEXH 3O9WB 4YC2B 1P7QB 3MC0A 2W59A 3AS3A 1JYNA 1KCUH 1GC1L 4XCEB 4KJQC 1JPTL 3TO4C 2XPGA 3H9YA 3LN9A 1P4IL 1IARB 3PV7A 2UUDH 4PIRF 1JI1A 2ZJSH 3D5OF 5JXAL 1OGAB 1C16B 1E28B 1I9RH 2NMSA 1W8NA 3FN0H 1TMCB 4R7NA 2VXVH 4IMKA 4GO6B 2DQJH 1JTTA 1EO7A 1F97A 2OZ4H 5GSRA 2WWKT 3S88H 5DK0A 5GGRB 2IQAB 2CD0A 3P77B 2UZXB 1J1PH 3TJEH 1JGLH 1QSVA 3SJVA 1A7QH 5A2JH 3O6FA 4FQCH 1S3KH 3GI8L 4NZRH 2QBWA 4TVPD 4K94H 4KXZH 1FYTE 4PJIF 4RFOH 3WE6A 5JOEA 5BJTB 3QIWC 4L3CA 5GRVL 1P9MC 4N0UB 3MV8B 1TPXB 4P4KA 3PP3K 5ESVB 2MKWA 1QVOA 3IAQA 3PWJB 4OLWL 3UJJL 4R7DB 3OXRB 3V4VH 1OF2B 4DUWA 3RWDA 5HI3C 4TVPL 4CDHA 3B9KD 4HH9A 4YHMH 3V4UH 3U9PH 3LY6A 4PUBL 4FP8H 1A7RH 1JIBA 4LNRB 5AG8A 2VDOL 3QZWB 4NWTH 3EIFA 4TRPL 1LE9A 1H5BC 2AP2A 3DOSA 1JHTA 4LIQE 3V4PL 4PJCF 4ELKB 2HRPL 3REWB 1YJDC 3MO1B 5GRYA 2V7NB 4RMQA 2VLKA 1NMAL 2J6EL 3SDYH 5F97E 4G8IB 5H94B 1FZOA 1Q9WB 1DQDL 4NHCL 4Z7WF 2J8UA 4KTDL 2CLZA 4D8PB 1MFEL 3N1GC 5C0GB 2BHYA 4DK3A 5LVEA 1OD7A 3NACH 3MROA 4UIMB 4N0FB 3TZVC 3RVVD 4QXWA 3BVNA 5DGRA