4TOYL

Structure of 35o22 fab, a hiv-1 neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 35O22 Fab Heavy chain
publication title Broad and potent HIV-1 neutralization by a human antibody that binds the gp41-gp120 interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2014-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4toyL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4toyL02
4DGVH 4Y4FA 1GGCH 3L3OA 5DJ8B 1IFHH 1WK0A 1J1OH 3LPFA 4M1CC 1HSBA 3ME0A 5DMIL 5E03A 5JR1H 5KSBF 2BNUB 1CFVH 2QQNH 4IRJD 5IK3A 3HA0A 1FDLH 1WWAX 2BXZA 4JR9L 2JELL 1FNGB 4NBZB 4ORZC 2EO1A 3CC5A 2ZUSA 5DZOA 3BMWA 1RUPH 5JOFA 4LIQE 3WFEH 1MCPL 4JY5H 1ZT1A 2GK0A 3TH2T 2AEQL 3W11D 1OY3B 3A6CH 4JO2H 3L3GA 3LB6D 4TSCH 3UJJL 1QFOA 4UILH 1QFWL 3LN4B 1RZFH 4R90L 3KJ4B 4JN2B 1L9MA 5C71A 2ICWJ 3GMRB 4NRYA 5I1HH 4NKMA 3HE7D 4PGCA 4RGND 1FSKB 2VLRA 3KS0J 2DLTA 3SBWC 2XFXA 4P23D 2YHGA 4G6JL 2VKWA 4OLUL 4H5SA 1T5XA 3LZFH 5DI8A 3KDMB 5IMKB 5IQ7H 4BKLA 2R0KH 3JTTA 4K3EH 2FX7L 3RWIA 3MZGB 2WUCL 3UDWC 3WUZA 1FO0H 3C5SA 1Z5LB 4PB0L 3WN5A 4IBLT 3AGVA 4U1IA 1ORSA 1OAYH 3DGGB 4QWWD 5A2LH 4HWZB 1RZ7L 3UTSA 3DLQR 4C4KO 1JUFA 4LCYB 1T20B 43C9A 2K3TA 1MUJA 1X44A 3VH8A 2ED8A 1KNOA 4ZSOA 1U8MB 3WNMA 3H42H 3DXAA 2IANB 4ALAH 2BVQB 5IBLC 3KVQA 2PTTB 1T1YA 3IFPB 3QFJD 4PRBA 1U91A 4Z8FH 1CR9L 1HXYB 4DZ8B 2ITDA 1J0IA 3MUGB 4TPRH 3BWUC 3KJ6H 5F89B 4XPBH 1W0VA 1XGTB 3LQAC 2HTKD 1LEGA 4KDTA 1BJ1H 1MCWW 2PO6D 3FT2A 3HE6D 3L3IB 4APQC 1S9XA 4RAVB 4IRZL 5CEXA 3VCLB 4P2CG 5FOBB 1F6LL 2NZ9D 4RCAA 2HP4A 1FGNH 5E00B 2R4RL 3QEQD 1TZIA 3PGCA 4LAJH 3V7AG 2VXTH 3V0AC 5HHVH 3QPXH 1BREA 1T6WA 3LRSA 3QAZB 3FT4B 2OYPA 3I3BA 1QFWM 5J6GB 3BOVA 4U31A 4V1DE 3UTTB 5AUMA 4XNMA 1SYSA 3TYFB 5CUSH 5EUOB 4J3UA 2HT3C 5DFWH 1RULL 1E4WH 1YPZE 1Z9OA 2D31A 1LO0L 1VHPA 5FECB 1N4XL 2Y6SD 1UFUA 2H32A 1V7NL 1ACYL 5GGQL 4RNRA 1NC4B 2WBKA 2HN7B 2EH7H 3HZMA 5KW9L 5DD1H 4GBXB 4TUOB 4J8RA 3ZDYE 1NGQH 4J1UB 5D7IA 3N0PB 1KB5H 4CVWA 2I5YH 3HZKB 2RBLA 2YA1A 5B3JE 1P7QA 3P3YA 4R96A 5C0JA 4LSTL 1YYLL 1P4BL 2X4RA 4RBPK 3QHZL 1PZ5A 3I2CL 2X4UB 4PJCB 1TJIL 2ENSA 2PETA 1WCQA 3BKYL 5FYJL 3U4EB 3BYTA 4U6XB 2HJFA 4KKLC 5FKAA 4N9GA 5KSVA 3LIZH 1WICA 5ACZA 2X4NA 3FFCA 1KJVA 4KVNL 3MFGB 1XF5A 1DVFC 3B9DA 5TDOA 2QADD 3CK0H 2WIMA 4XCYB 3WFZA 1INEH 3WKMH 4F58H 2CO7B 4V2CB 4WWKD 4LCUA 5EO0A 2NTSP 5C07B 4W4OA 4HKZB 2NY7H 4OV6F 1OGTA 3BP5B 3QUXD 2YRZA 4I0KA 5DMIH 3CDGB 4W4NA 1DFBL 4B0MM 3I50L 4WUUA 1YN6A 4UQ2A 2CRYA 2GSGB 5IG7A 4AK1A 4JR9H 3RNQA 4UIMA 3S36X 2ZKHH 5F9JB 4DVBA 3B9KA 1MCNA 1KULA 3U9UA 1XH3A 4QRRD 4FQXA 2AEQH 4JFXB 1BEYL 1KLFA 4Y7MA 5EC2B 3UJJH 2VXVL 3L3DB 5FYKD 2VH5L 1KXTB 3DI3B 1F11B 5ERWA 3CU7A 1RV6X 3HRPA 1TDQA 1OAXL 5DHXB 1U8HB 5ISZB 5I76A 3NMEA 4PGBA 1URLA 2H32H 2ZUVA 3KPMA 3FQXA 5IFJA 3BUTA 4MSWB 1D9KB 3NN8B 5E6YA 4OLUH 4HG4J 4OTXH 5IROA 3T77A 4GRWB 1CXFA 4QOKD 3DV6A 3EHBD 4PJ7A 1FVEA 4RBPH 2NY4B 4ZDHA 2B5IB 1YY8B 4QHMB 1T0MA 3EYOA 1FG9C 5EU6E 1T04B 2FX7H 2JJSA 4ZUSA 2WUCH 2BSSB 1RUKL 1R5IA 3QJFA 1OGAE 2CIIA 1CN4A 4N8PA 4DUVA 1P2CB 1RZ7H 2ZSWA 2BJML 3G04A 1KSRA 2ID5A 2ADFL 4UDUA 1OSZA 5IKCB 1P5UA 3BEVB 1YEHL 4R0LC 4F33B 5JIPA 3T04D 1PGRB 1F2QA 1IM9D 3U0PA 3V5HB 1DJSA 1R5WB 3DV4B 1AD9B 3SJVE 3B9VA 4OF0A 3BXNA 5JW4N 1JFQL 4LSRL 1ACZA 2FBOJ 2VDKL 1MCEA 1Q0YL 4YBLC 4LLYB 1U93A 4WW1B 5A3ID 1B0GB 1KCUL 2GAZB 2IH1B 1MIEL 2X4PA 5SWSE 5IIEB 4PG2A 43CAB 3ZHDA 3KLHD 3ZSTA 3QNZB 2EXWC 5TF1H 1MJ7H 3V6ZA 3ZSSA 5F3BA 1ZHLA 2LAAA 2W92A 4P46B 3MO1A 4IRZH 1H15A 5HI3D 4L29A 3L9RB 4FMKA 2APXA 1I1AC 4LKCB 3ILPB 2QLVB 2R4RH 4JFEA 1G7LB 1CICB 2OJEB 1EAJA 2GKIA 4PGZA 5DC4B 5IF0B 4ONHA 2Z31B 3O3EB 5GIRB 4KI5E 4JDVB 1CVRA 4F7EA 4LRNL 4YXHL 3QG6A 1QPXA 3QULA 4PRHE 3BRFA 1U6AL 2VN4A 4DGYL 1MVFA 1LO0H 2XKNB 1N4XH 2YUWA 3UJTH 1ACYH 3WLBA 1E4XH 1YUHA 1Z3GL 3K0WA 3NPSC 4GFTB 3GO1H 5KW9H 2MSPA 3TBSA 3IS0X 4JPIA 3BGMB 3HCVA 4NQXA 4HH9B 4JO4L 1ZWIA 5L2KB 4N9OB 3WJJA 1DUZB 1N3NA 4XCNB 5EFIB 5GZOD 2F5AH 3U4AA 2BXYA 1XIWD 5CBAB 1IM3A 4LSTH 1YYLH 1P4BH 2A0LC 1UKSA 4I9WE 1QLEL 3QHZH 3BP7B 4Y1AD 1A9BB 3ARBA 2FHFA 5B4MD 4L3CA 3SO5A 1JTPA 4M1CD 1U2CA 2D2OA 4ODHL 5E9DA 5I75C 5GSVB 4A2MA 4LPTA 3BKYH 2Z8VC 4LSSL 5FYJH 1LE9A 4E41B 1CVSC 4YUEL 2IADB 2AW2A 1ONQA 4L9LA 5HPOA 2C3VA 3C8KA 4KTEH 5BQ7B 3IXTB 4OM0L 4Y2OA 3H9ZA 1CLYL 1W72B 3W39B 3BUYA 4KVNH 1LMKA 1HOCB 3BGFB 4XXDA 5FDWA 5EC1A 3EOBA 1NBVL 5F88A 1A3RL 3LD8B 4XMPH 5FYKU 1ZT7B 3MRGA 3TIDB 1XCQB 4PJBA 4DKFL 5IW6B 5K93A 4KK6C 1VADA 4O51B 4Z18A 2IPKA 4OQ1A 3RY6A 1ZVSA 1GJIA 1UYWL 1JPGA 1C8PA 4IRSB 1DFBH 3I50H 3WFCL 4TYUA 1RZIA 4HJGA 3GSOB 4ETQA 4O00A 2DJ4A 4GW5A 3RPIB 3MACL 3MGOA 4ZAKC 5JPMA 3X12A 5CLTA 3QT2A 1IAIH 3MXVL 1MREL 2F53E 1IEHA 4UTBL 1BEYH 4GRMA 1IL1A 2H8PB 2VXVH 5TE7L 2X05A 4QRSA 1F6FB 3VGAC 3VD4A 3JWDH 8CGTA 5DK0A 4XH2B 4Y16B 4PP2A 5DJZB 5FF6A 1H0DA 4MQXC 1NAKL 5IM7B 2MNUA 1FFPA 2Z9TA 1JNHB 4WI9A 2LABA 4YO0A 4MQ7B 2GIYA 5ENWA 2PXYB 5KVDL 1CT8B 1D5XA 2CDGA 3E6FB 1X7QB 3P2TA 4HIIA 5JORB 2P8LB 3VWKC 2D7OA 3EFDL 4MB4A 3BHBA 3RIAF 3DBXA 3V5DA 2FH6A 5LXGL 1INQB 4MQTB 4YDVA 2CD0A 4X7TA 4U7KA 1T2QL 2AJVL 4MDIA 2DMBA 3CFKB 4PJDE 4GRLB 4EDWL 3IJSA 3O3UN 4AH2B 1FNEA 3P9WB 4HAFA 4MXQC 2WM0A 2BJMH 4PRIA 3GJFK 3EUUA 2ADFH 1IARB 2ATKA 4APQD 1BPVA 4CN4A 3LEXA 3C9NA 3QIUC 5J11B 1YEHH 3GJEB 4OKDA 3MRPB 4L1DA 2YPVL 1CL7L 3SGJA 5D5MF 4EI5C 4Y4FC 3D0VB 4ZFFB 2D0HA 1N5YL 1AQKH 1JFQH 2GYSA 4HKBA 4LK4A 4LSRH 5CFHA 2OZ4A 5K9KB 1D5ZA 4HPYL 4NM8H 2WANA 1KCUH 4WHTA 1MIEH 1NCUA 4K9EL 2XWJA 3K1KC 4ODXA 1IAKA 3PV6B 4P5MB 2DQUL 5DUBA 1Y18A 4R4NC 5DJ2B 3P4OB 1OP5H 4MXWL 4L5FL 4PJ5E 5DVLA 2B1HL 4FQ1L 3WNKA 2VNCA 3U36B 5ICYA 2ICWB 4M48H 3QUMA 1B0RA 4GG6F 4O2EA 5HY9B 2LTQC 2HRLA 4M1GL 1AGEB 3VGBA 2AK1L 1LNUB 4LNRB 1II4E 2DQTL 5F7LB 3MRHA 2MTPA 3ZMRA 4DN3H 1MHEA 3LY6A 1DQJB 1U6AH 5BOPA 2AQ3A 4NZJA 4DGYH 3HZYA 4G8EB 1NBQA 2I9LB 4PG9A 5BOZG 1RVFH 4YLQT 2FSEB 1NGPL 3CJJA 3CCHA 5C3LD 5MERA 4JRYE 4GQ9H 3VFUA 3WN5C 2X9YA 5GSRB 4M7ZC 2W0PA 2AJYL 4KKLD 1Z3GH 2NMSA 1FYHB 5IVXE 1FLRH 1FL3B 5EUKB 3OJVC 2M2DA 4JO4H 1KACB 4ORGB 5JDJA 1RK1B 3OJMB 3UBXG 4L8DA 1DVFD 1Q8MA 1DL7H 1SBSL 4MJIB 4Y88A 3SKMA 4PGEA 1X5FA 3D87B 3MREA 1QSVA 3GJFH 2WNGA 4HK3N 5T3XE 2GTZB 1QLEH 5DDHB 5FGRA 3CDFA 5GISH 3PWVA 3D0LB 1GZQA 4NC1E 1N59B 1OAKH 5E94B 4JFQB 4TTDC 4X4XB 4KC3B 5HVFB 4ODHH 2EYRA 1MHHA 4D3CL 1KN4L 4LSSH 3EYSH 1WSST 2VYRE 4YUEH 1SEBB 1MJJA 4V2BA 3FO0L 4KDTC 1LK3L 1YMMB 5GRVK 3MRLA 4LVHB 1CLYH 3MGTA 4HPOL 3P0GB 4TVPD 3WE6B 4LHUD 2V5SA 4JVPA 3TV3L 4U0RC 4NN5B 5IHLB 3QDMD 3U46B 1G7HB 1QR4A 5IJKC 1A3RH 5F7DB 4YZFF 2R56L 1AIFA 2AJZA 3OHXA 3IFOA 1A2YA 1EHXA 1HILB 4KPHL 2VERN 4Q58C 4WFFD 1G7MB 4CW1A 2DF3A 2D7TL 5EU5B 3CGTA 3THML 3GMQB 3WFCH 3O9WB 1NFDE 3KYOA 3LS4L 4NQCE 3RDTB 3KPLA 3MACH 1QG3A 3GFUA 4X6BB 5H94B 4NZUL 5D6CA 1JWUA 1TITA 3MXVH 1LEKA 3HI1B 1G1CA 1QKZL 1WJ3A 5MEPB 1PKQB 5MHSE 1EZVX 5C0GA 4OZIB 1NGXA 4ZXBB 3ULVH 2N4IA 1OQOA 2PW1B 1NAMB 4BFEA 2AJ3A 5EPMB 2GJ6A 5I8KL 1B6UA 4S1QL 4Z95H 5HHOD 1V5JA 3F7PC 4RX4D 3RVVC 1U3HA 4AT6A 1ZT4A 5KVDH 4JO1H 2WV3A 4L8CB 1D6VL 3B2VL 4NQVB 3AREA 1GYAA 1NDMB 2UYLB 1JHKL 4BFBD 3FRPG 3IDMA 4ZPTB 3FB5A 4LLMA 3EFDH 2VLLA 5LXGH 2Q87A 4I4WA 4Q0XL 3KGRA 1T2QH 1XGUB 2VWEE 5JHDA 2I26N 2DLFH 4EDWH 1FZMB 1HHGB 3B9EA 4LLDB 5SWSA 2ADGA 4NZRL 3Q5OA 4GW4A 2EXWD 2JCCF 4WTZA 3LKOA 2DM3A 1BOYA 5ESAB 1JTOA 4UBDD 1FJ1B 1I1AD 1MCLA 4GAJL 4XX1G 2FL5A 4LBEA 4W4OC 3W0WE 2EDEA 4Q7DA 2XRAL 4JVUA 4NQDD 1HH9A 4XCEA 1CL7H 1MCHA 4PRAA 4KK9C 3CX5K 1MOEA 1I9JH 1DBKL 2XQBH 2N7BA 3U83A 4DZBA 1JHLL 1ZGLP 4HPYH 3S37L 2AV1B 2C26A 1KB5B 3H3KA 1ITCA 3B9KC 1CGYA 3KPSA 4JPVH 4K9EH 4N0CC 2R69H 2OQJA 4Z0XA 4PYGA 2DQUH 1I8LA 4M8QA 4FQXC 2P4AB 4MXWH 4L5FH 3BJLA 3NFPB 4QRUB 2V2XB 3GSNB 2JF1A 3WIFB 4KJYB 4WENB 3I6LE 3G6JB 2F54B 1EV2E 4YGVB 5M7QA 4X0KA 2J88L 3FQRA 3VDBA 4LMQE 3ARSA 4QTHB 1JE6A 2ADJA 4M1GH 4RGOL 1M71B 1TPXB 2AK1H 5IESL 2DQTH 3R06B 1IGYB 3BT2H 3O6LH 1Z2KA 2HTLC 3D2UA 2D0FA 4PLOB 4ZUTB 4NUJB 3SCMA 1QR1A 1CF8L 1G7JB 4MA7L 4Y8DC 1D6EB 2B20A 2A0LD 2CLVA 3GSVA 2D7MA 4D9RE 1B0WA 4U1JA 4HJJH 4XVSL 2XZCH 4C59B 1CE1H 1NGPH 2JJSC 2K7PA 3T8XA 3VD9A 5DC9B 3AB0C 4MJ6B 4MHHI 1IGIL 2AJYH 3VI4E 5E8DL 1T83C 3QQNA 1IGTA 1UJ3B 2FYYB 3JV6A 4LF3A 1E4XI 2VISB 3INUL 2NXYC 3TGXA 3OJ2C 1K9TA 5CGMA 5INCB 4ZFOB 4PJGF 4X6EA 3IDGA 1RIHL 1RK0B 4G9FB 3ROLB 1BF8A 3OKYA 5D1QA 4QRQA 3FB6A 4WFGD 4D3CH 5DVOA 1OT1A 4HT1L 1P1ZA 4R4FL 5GGSA 4PG2C 4R97C 1G7QB 1CD1B 4ZO6A 3FO0H 4QHLB 3WNNA 1YEIL 3DVGB 4GT7A 4ZAKD 4HPOH 3VFRA 3BZEB 4OZGA 2R1XA 1Q94B 4WJ5B 3S35X 3WDHA 3TV3H 2F53A 1KPUB 1PG7L 2ARJB 3CXHJ 3HAEG 2DB8A 1GC1C 2R56H 4MQXD 4DN4L 3V95A 4ERSL 1UM6L 1I9RL 2Z4QA 1RZJL 3JWDC 5D2LF 4LGSB 2BMKB 3MUZ1 4KPHH 4NYLB 5DR5H 4FQQA 5T3ZL 2D7TH 3THMH 4JDZA 1QQDA 5F9DC 2DDQL 1A7NL 1HHIB 2HFGL 3TIEB 1HNGA 1JWMA 5L8KB 4X6CE 2XZAL 4P23B 3VWKD 1NEZA 3T4YB 3WUWG 1KBGL 4DVRH 4QRPA 3F12A 4HIJA 5D96B 4Y4HB 3V7AE 3MCKA 3OPZH 1E4KA 4NN7C 3WJJC 1MH5A 2XN9D 4PJDA 1TTGA 3IJYB 5I8KH 3IF1B 4MXQD 2E9IA 5HJ3A 2CRMA 1FFNA 3RQ3A 2HKFL 4JQIL 1CDIA 3QIUD 4NKIL 3NABL 2YPLD 1D6VH 1F4WL 3B2VH 4NO2A 5ILTH 1CXLA 3ARBC 3LS5L 4HBQA 4XBPA 3EDKA 4EI5D 5DSCB 4NPYB 1JHKH 3AU1B 4Y4FD 5GGVL 4OZFA 2W38A 3RL2B 3HLAA 5D7KD 1C16A 2H9GB 4U3CA 4LP4A 1HWHB 5CCKL 4NFBA 1J10A 5DD6A 2O5ZL 4WRLA 5IUSA 1Q9LB 4KRPC 3OKNB 5E56A 5FO8B 3CPLA 2L7UA 4MNGB 4R4ND 4NZRH 1PDKA 3QH3A 1DQDL 1KTRL 4J3SA 3TVMA 1F3RB 1R3HB 2QHRH 3ES6B 5D7LE 3TC9A 2NY2B 1M4KA 2APTA 2R9HC 2LVCA 3LKPA 2EDWA 2PO6B 4GAJH 4DW2L 3HE6B 3NIDF 1IGFL 3BIKA 1KG0A 2XRAH 2OTUA 1IC4H 3I02B 4MX7B 1UXSA 4YHPB 2VLRD 1AE6L 1DBKH 3NCBB 3QEQB 4WUKH 4U2YA 1JHLH 4L8BA 3B8YA 1S8DB 2ZJSL 3S37H 1U8LA 1F45A 1A1OB 4U6VH 3RHWF 4FQIL 1JGVH 3BDXA 4MDJA 4Q9QL 2X70B 2A38A 3DYMA 1BFSA 4WI2A 4LLWB 4Z7NE 3IU4L 5B38B 3VFSB 2IEPA 1N26A 3E8UH 3MRIB 1Q9KB 1AC0A 3DYOA 1K2DA 1CI5A 4KWUA 4XXCA 3B6SB 3UTSD 3VFVA 4PJAB 4Z78B 1BQHG 2J88H 5IVXA 3QXWA 2F8VA 4XC3H 1XEDA 5CD3A 4HIHB 4RGOH 3VFWB 1BVKA 4EN3A 5E2JA 3DXAD 4GXUM 1JF1A 3MYJB 4W68A 3VG0L 1CF8H 3VGHA 4YEFA 4X98A 4POZD 5C3TA 5JPNB 4M62H 3F5WB 1RHHB 4BZ1L 4Z7WF 4XVSH 4Y19A 5F7EL 5BVPL 3D18A 4TTDD 1YQVL 2R0LL 3BZ4A 4GAYB 3MOQA 2YPKB 3ZKSD 3P4NA 1IC7L 1SYVA 4CVZA 1IGIH 5E8DH 5MENB 3ZO0A 1BBJA 1CFSB 2DQGL 3O6FA 2D7NA 1ZHBB 3FZUC 3ZLQC 1JI2A 2DMKA 4PTTB 1QSEE 4OGZA 5TQ0L 3BZFA 2HJLA 3VMPA 4POYA 4Z76A 3DURA 4HHAA 3QZWB 2BNRA 1AGCB 1H3GA 3P73A 4M43L 1M6OB 4GW1B 4OD2A 3SGJC 2FR4B 3CFEA 2ZCHL 5M95B 1UEYA 4I2XE 4WU5A 3WO3B 4WWKB 4ZMAT 2FIKA 2YBRA 4WIQA 3OX8B 4O4YH 4JG0L 4TULL 3EO0B 4WI3A 4R4FH 3BDYH 4C54A 5JHLL 2GT9B 2LU7A 1S78C 4H1LG 3OKDB 4RWHA 3FHQA 4YHKL 3IAQA 1MAJA 1QBLL 1IILE 1NFDA 3KYMB 4OAWB 4ZYKA 2N56A 1KJMB 1YEIH 4MVBC 1F5WA 1ZLSL 3RWCB 2PW2A 1QBAA 3AVEA 3VWJA 1PG7H 2VDPL 5KAQF 4HV8B 4UOW0 1UH4A 2HRPL 2JIXA 4DN4H 5BZWA 3WYRA 4KROC 1S7QA 1UJTA 3MOBL 1P7QD 1UM6H 4JRXA 4ERSH 1I9RH 1BVZA 1UM4L 2CK0L 3RVVD 3ULVC 1JPSL 5T3ZH 1NUFA 5DJCB 3IFNH 4RMWA 4F8QA 4JY6B 1FYTA 2V17L 4CN6A 5CD5C 4BSWA 5I19L 3UCRA 3W5MA 2XZAH 4I3GA 5CJQH 4HGKC 3H3PH 1RU9L 4QOKB 4F9PA 2F19L 3GM0A 4QLRA 3HR5B 1UWXH 2P5EB 3QO0B 1KCKA 4OFIA 1S9YB 3UTQA 3G6AA 3FB8A 3FFCD 2CSPA 1QYGL 1S7VB 4QF1A 1FCCA 1MFNA 2BSTA 3RKPA 1QUNA 2E9WA 4X7SH 1ERNA 5FB8B 2ZG1A 3S3SA 2QR0B 1KC5H 4DGIL 2HKFH 5KJRL 1ADQL 3CFJB 4PJ9C 3NABH 3O4LA 1U3JA 4JPWL 3LS5H 1I4FA 1ZOXA 5DVNA 5IEHB 3ULSA 4KK9D 5GGVH 3V0VA 4L4VA 1IM9B 1AGDB 3V6FB 4U1SA 1BIIB 2AK4E 3F62A 1B88A 5BO1L 1EX0A 4WUUD 5HI4C 5D71L 5B8CB 1MCBA 1MCQA 3FO2B 5CCKH 1HYSC 2O5ZH 4PJXE 4WEBL 3B9KD 3SGDH 4N0CD 5AZ2L 4K7FA 1T21B 2HWZL 1F3DH 2XWBB 2EYTA 4FQXD 4BH8B 3L3HB 1BQSA 4NWTL 4I48B 1DQDH 4Q6IA 1XGQB 5IBUG 4L4TE 1MF2H 4P2QA 4G8GA 2BX5A 4DW2H 1MFDL 3OG6B 4J4PA 3U7AA 1AE6H 4LL9A 5I8CA 5F6IB 5I1IH 3SDXA 2DQJL 5CJ8A 4OCSH 2HTLD 2ZJSH 2C3GA 4NNXB 1DN0A 5J12B 4ZUVB 4NN6C 5FUOL 4OCXL 4Q9QH 2J8UE 3H9SE 3IU4H 5J6HB 4OFKA 4LDLB 1KCSL 1FE8L 3WSQL 1K5NA 1FC1A 5D7IF 4CVXB 5KS9E 4XNQB 5JW5A 1G0YR 5E4EB 5T5FL 1R3KB 1PKQE 3BKJH 3GHEH 5AAWA 5K9QG 4L3EB 5DYOA 1Y6NR 3TJEL 2MQ3A 2NXYD 4IIQB 3QUYA 4N1CA 2VE6B 2HG5A 3PGFL 5FOJA 4WFED 4RFNB 1QRNE 3VG0H 1G0XA 3AREC 3GSWA 4X5WA 4U1GC 4HFWA 5SX4H 4PJEF 5GGRY 1SQ2N 1XIWB 1F4YH 5F7EH 1H3WM 1YQVH 1B2WL 1F3JB 4FHBD 4LHUG 3VRJB 1OAQL 2DIBA 5KANG 1IC7H 5F1NB 2DYPB 5ID1B 1NBYA 1X6LA 3G5VB 4YFDB 4EVNB 4JPKL 3UC0L 4NNYA 3FO1A 3PL6C 2DQGH 3PWPE 3BP6A 4Z7UB 3MRQA 5KSBE 3PWLB 2VLME 5TQ0H 1BFVL 4NT6A 1I1YB 1MI5B 4NRXB 3UP1A 4JCLA 5HGBB 4A6YA 5EULV 4JFED 3ZKXC 5EBWB 1ZHKB 2ZCHH 3CVHA 3RP1A 4QEGA 2X4TB 2NX5B 3HTLX 1NGYA 3U30B 1WZMA 3QCVL 3SDCB 4NCC2 3B5HA 2ZSVB 5AEAA 2XQYG 4JG0H 3QYCA 1EXUB 5EIIB 5JHLH 3VXMA 1I8LC 3O2WL 4BSJA 4YHKH 3CAFA 1QBLH 5BJTB 5HYSA 4X6CA 1EGJL 3FQTB 2G9HA 2WBJB 4DUXA 3QXVA 3VXSA 2ICEA 5A2IH 4N90E 1SMAA 2X42A 3R4DA 2HRPH 2F54E 1MLBB 3HPLA 5BCAA 4GG8A 3AC0A 1E0OB 5CZKA 4OLVL 5GGTA 4PRNB 3SCMC 3AS2A 4XGZB 4MAYA 3SE9L 1JNNL 4H25B 2CKBL 3JUZA 2J12B 2Q8BL 4PJ7F 4EDXB 3ARBD 3MLPA 4Z7QF 5I18H 2V17H 1HEZA 3G5ZA 4ONGL 3O2VL 1MFAL 5E9DD 1MAML 2X09A 5ALBL 4H88L 4Z7VB 3CSYA 3PQYE 4KHXH 1R3JB 1T5WA 2F19H 2RHEA 4G6AC 4HUNB 4KRPD 1ZSDB 4OV5B 4K94L 5HD8C 2BC4B 5E08L 4ZOEA 1LP9A 1S9WB 3KXFE 4DEPC 3MLTA 5E2UL 2KBGA 4YHYB 5IHZA 4DGIH 4WW2A 3GK8H 3M45A 4U7SA 1ADQH 1HCVA 2IBGA 3OKLA 2R9HD 4HS6A 4KKNA 5IB3A 1CG9B 4JPWH 2X9XA 4NDMB 4LSPL 1HQRA 2WINA 1WWBX 4FQCH 5D1QC 5HYJB 3WDJA 3PG2A 1CE6A 5D71H 5I74B 2X2YA 5JO5B 3VGDA 5I66B 3PGDB 5HGDA 4LCCA 5IFAH 1MCCA 2OCFD 4A6YH 4TUJA 4KTDH 1P6AB 3OKEB 4LIQL 3CVHH 4FRWA 5DHVA 3L5WB 3T0VA 4NWTH 2EDNA 5TE6L 3EOAB 5MEOB 3I9GH 4GSDL 2JTDA 3KPNB 2V7HA 4KGLA 1W2KT 1KIUA 4AEFA 1Y6KR 4JY4B 1W8OA 3AM8A 4J7RA 5SWQA 3VXTB 1C1EL 3K8MA 5DJYB 5DRWA 5E0QA 1AO7A 1MCSA 3ZKNC 3SE8L 2DQJH 3U9PH 4X9HA 4Y5XB 4HUVB 4GS7C 1NGWA 3V2AR 2A6KA 5F9AC 1J1PH 2DS4A 3C5ZA 4RGNE 1LE5A 3FT3A 5FUOH 4OCXH 5K9OA 1T1XA 3BQUA 1DQQB 4JREB 1H3XA 1BJ8A 2FWOB 3FQWA 2ZUXA 3GSRA 3MRDA 1KCSH 1FE8H 3WSQH 1E4KC 3NZHL 1T0NB 2FBJH 1BGXL 2X1PA 4OD3L 4OQTA 4QXUH 3FZUD 4PRID 4ZO7A 4GLRI 2FJFB 2CUIA 4FOMA 2WIIB 1QSEA 5ESVA 1AQDB 2H3NA 4OCYL 2XZQL 1EJOL 3S5LB 2VABB 4PGDB 2BOCB 1MVUB 1N6UA 1DUYA 3MV9E 4XPAL 4GOSA 1B2WH 5LAXA 4K7PY 1FVCA 3KNBA 4CMMA 2YOCA 2ZCKH 3P30H 4JPKH 3C6SA 1S78D 5H8DA 3QFJE 4UUJA 2Y7QA 4Q9BA 4MVBD 4O2FA 5ESQA 5ICXB 3RI5K 3TVMC 1WBZA 5DJAA 5GJTL 2R2CA 1U8NA 5KZCD 3D69B 4PJBF 3G08B 1HKLL 3ECBA 4UQ3B 3ARUA 1TIUA 4HC1L 4KROD 3LKQB 3O2DA 4X4YA 4YIQA 1QO3A 2R4SL 1YYMH 3HC4L 3ULVD 3DECA 2ZUWA 2QEJA 2CLRB 4RFOH 4N8VB 1RY7B 3MOAH 3O2WH 3QNYA 1IMHC 2COQA 1T1ZA 3OL2A 1HH6B 5E5MB 1RZKL 3DETC 1EGJH 1GGBH 2X7LB 2DLIA 1I3RA 1OARL 1QZ1A 5F3HA 3DVNB 2E6JA 2JE8A 4MYWB 1GRWA 3OKMB 4KV5F 4MCYB 1L7TL 2V9QA 3F7YA 4OUUA 4EN3C 4HCRL 4OLVH 1LVEA 3CMGA 3DARA 1X4XA 4QY8A 1KLGB 2A1WH 3WJLA 2VO5A 3B83A 1AGFB 4M5ZL 5HBBA 3PDDA 3VJ6B 2XYCA 2CKBH 2MKWA 2VDRL 1T7WA 2Q8BH 5IR1A 1ZEAL 4NC1C 4OQTH 4EUPA 1GOGA 2BSED 4ONGH 3O2VH 1MAMH 4GKZA 3UTZB 4H88H 1ZS8A 4XHJC 5HI4D 4C83A 4YR6B 3DIFA 3MJ8A 1BBDL 3O6FC 4ISVB 1HYSD 1FVDB 4FG6C 4PJIB 1IVLA 2VUOA 5J3HC 4PJXA 4YHNB 5KAQG 4YBLB 4K94H 2O93L 3HPJA 1JYNA 2V7NA 3UPAA 2LU4A 4FFZL 4C58B 5E2UH 5IB5B 4HKXA 3EKCA 1I7RA 2R1WB 5I1LA 1YC7A 4YWGL 5IT2L 4BH7B 5JLZA 2JB6A 4U6YA 1BFTA 3EW3B 4LSPH 7FABL 2C1PB 2JK5B 1BLNB 2AABL 4U4BA 4OSUL 4UT7L 2EIZA 4U1LA 3IKCB 4R9HA 2IAMA 2QQLH 3WHXB 1BM3L 1MHCB 4HUWB 4ESKA 4OF8A 1ULVA 4LIQH 3VH8G 5C0FA 1U8KA 3I75B 2HFEB 4JFPB 3MGAA 4NOFA 2J8UA 3DJ9A 3SGDI 1ES0B 1FZJA 1WFTA 4PREB 1BOGA 32C2B 4MNHA 4GSDH 2W0FA 1CDBA 1MWAL 5E1AB 2P7TA 5D1XC 4WI7A 2A83A 2GJ6D 1NSNH 3LHPL 4QRRE 3RWHA 5C0AA 3IB4A 5IJVA 1C1EH 3NPSB 4FXGB 3TCLA 1U3HD 5FYKE 3ULVF 1EHAA 2H2PC 3RBGA 1MCFA 3ARED 1FV1B 1QRNA 1XR8B 2PYEA 5FYLD 3OXSA 1KJ3H 2DWDA 2B0SL 2R0WL 1JPTL 2Z92A 4MD4B 3H7BB 1FG2A 1H3PL 4XTRD 5ITFA 5DHYB 5T1DL 4F9PC 3L7FB 2VOTA 5ANME 4C56B 5EBLA 5JHDD 2XV6B 2VDQL 3NZHH 4QOKE 5SWSD 1A3LL 4OD3H 3F7VA 3PHOB 1JMXA 3VFMA 4M3KB 4EUPH 4LPVA 4JFOB 2DQFB 1HHKB 4P4RB 2B4CC 3RIFK 2YSSB 4PRPE 4ZG1A 5DUPL 2NY3C 3O41A 3KPPB 4KQ4L 5ADPL 5BS0A 1VFAA 2HLAB 2XZQH 5EWIL 1CFTA 1EJOH 4G43A 3R1GH 4XPAH 4WU7B 5DMJB 1HHHB 4X4ME 1LO2L 3GMLB 1KEML 4JAMB 5AD0B 1LO5B 3BEWA 3KPSD 3TESA 3ALXA 1YNKH 3CFDB 1PG7W 2J2ZA 1V8HA 4OZHB 4KUZH 4XNYL 1ZGLM 5GHWL 2BVEA 2B2XL 5DJ0B 3C5JA 2V9TA 3LCYA 4E0RB 1KELH 2NY0C 3HI5L 3PIQB 5EA0H 5GJTH 3SDAB 4ZAKB 1PSKH 4Y2DA 4JJ5B 5C09A 1JVKA 4UDTA 1HKLH 2DWEB 4J4PC 3HC0B 5JQ6L 3Q6FB 4OF5A 3OJDA 2E7BA 4JKLA 4HC1H 2FD6L 1PYWA 3D2UD 2Y36L 1KV3A 4HKJA 3SCMD 2DN7A 2YMXL 4PRDA 5DRNA 3DMMA 4NO3A 4R2GC 3S96A 2R4SH 1WFUA 3HC4H 5CAYB 1RZGB 1CGVA 3PHSA 4I9WD 3SGEI 2YC1A 3QJHA 2CJUL 4YC2C 4JLRB 4MA8L 1M7IB 1SM3L 3DSNA 1CDUA 3IETA 1YEDA 2EDJA 2GSIB 4U1NB 1I7UA 1JNLL 1EJ6A 3MA9L 3PQYA 1CQKA 2P8MA 4G6AD 4RIRA 4LMQI 3E6HB 1BZ9A 1CWVA 5HD8D 1WISA 3QUYC 1L7TH 1LDPH 5KVGL 1RHFA 3FFDB 4JFDB 2VR5A 5JZ7C 1A6AB 3MRCA 2Z8SA 4HCRH 2AS5M 1YY9C 2XN9B 5DURD 5DQ9A 2UZYB 3VXOA 4ZQKB 4Y89A 2NCMA 5HHPA 3HS0A 1R3LA 4IMLA 2VDRH 5E2TL 3F58L 1EHLL 5BXFB 3DRTB 1ZEAH 5D1QD 3BIBX 1N6QH 4Y4FB 3L3OB 3EJZC 1BBDH 1BAFL 1OTTC 3E2HB 4Y1AE 5GGUB 3BISA 5D5ME 4HUUA 5IK3B 3GB7A 2Q86A 3CFCL 4P5KA 1FZOA 5EOTB 4IHOB 1A4KB 5TQ2L 3UMTA 4XPTL 3TBVA 4FFZH 1HCFX 2F53D 2VR9A 5JOFB 2L4OA 3MJ9L 5T1LA 1BZ7B 1ZT1B 1LILA 1E6OL 1YEFL 5B3NA 5IT2H 2AXHA 3RWEA 7FABH 1U9KA 1EFXA 1O7SA 4KZDL 3MNWA 2Y1VA 2XY1A 2AABH 4AG4L 4CVUA 4OSUH 2HMIC 4NKMB 4UT7H 4F2MB 2EE2A 4BSVA 5KG9A 4YAQB 2PCPB 3IKKA 5BV7H 4GG6E 3ARFC 3PWUA 2CIKB 1BM3H 2UUDH 3U6RB 3JVGA 3RZCB 2QJDA 4H5SB 4QRPD 1U92B 3MLUH 1OSPL 5DI8B 3TNNA 1UXWA 3BWAB 1BFOA 4XAWL 2X1QA 3RWIB 3EGSA 3RX7A 1RUAL 3OF6A 3SE4A 5D2NB 3C5SB 3WN5B 1FFOA 4XVTH 2EIBA 1FN4A 4XI5C 4U1HA 1DBBH 2C1OB 4MAYC 3UTSB 8FABB 1N5AA 3G5YA 3P4MA 1X5GA 3GSQB 3MNVA 5BRZB 3PE9A 4X7FC 3WNPA 2LE9A 4JZNB 1E28A 1T1WA 2R0WH 1EVTC 5D70L 3G9AB 4KAQL 4PFEA 2A9NL 1H3PH 4FN0A 1T1YB 4NJ9L 3MV9A 4PRBB 4ZODA 5KBNC 2B1AL 5ITBL 1Z9LA 1F90L 1U91B 1RJLA 1A6UL 2VDQH 3MC0A 4O2CA 2ITDB 1A3LH 3QPQC 1WBYB 1IAOA 1KCVL 1W0WB 1W0VB 5AZEL 2UWEF 3TVMD 5I1GL 4WW2C 2ZOLA 3STLA 3MV7B 5GS0L 1BJMA 4HS3B 5CEXB 3CLEH 4FQLL 3J8F7 3T2NL 2ZUQC 2AXGB 4KQ4H 5EU4A 3LRGA 5ECJE 4NGHL 5EWIH 3FRPA 3VGFA 4I3RL 1TZIB 3VXQA 1LO2H 4LCCC 5BZDA 4D0BA 4NWUL 4YZFE 3LRSB 4R4BB 2J8OA 3QNXB 4NNPH 3HI6L 2BCKA 1CD0A 3LEYL 4OZGF 2C5DC 4XNMB 5ID0B 3O11A 4N0YL 2BOBB 4MNQE 5GHWH 2B2XH 2R2EA 5F1KC 3TBTB 3DETD 4FQHA 3WO4C 3TNMB 1JGEB 1EAPA 3CU1A 3HI5H 2D31B 2AI0H 2GITA 5L2JA 1N2RA 4M03A 1TQBC 1VACB 4JGJA 4RNRB 3OSKA 3AM8C 4XB8A 1CLCA 1P7KA 3HZMB 2XG5A 5JQ6H 3BVNB 2VSCA 3BPCA 4J8RB 5IHUH 4EN3D 5IOPA 15C8L 2FD6H 4R7NB 2Y36H 1B90A 1UKQA 5DO2C 1CGWA 3S37X 1P7QB 5T3XD 2HVKA 2P5WA 3C5ZC 3ZE1F 2CDEA 5C0JB 4Y19D 3V6OA 2CJUH 3QIBA 4MA8H 3BQUC 4N0RA 4AIZA 3O3BB 1BD2B 3I84A 3O8XA 2EDXA 4XHJD 2FJHB 3MLYL 2XICA 3LQZB 4K8RH 4S1SL 1JNLH 3MA9H 3O6FD 4FG6D 3WEXB 4NSKA 2IWGA 1PBYA 5J3HD 1WIUA 2X1OA 5CKGA 5FKAB 4BFIB 2CUHA 4HIXH 5KVGH 4LPYA 3TZVA 4N9GB 3CLFL 3VXPB 4YBHA 4ELMB 3N1GC 5ACZB 2X4NB 1KJVB 2BNRD 4GQPH 3G6DL 4K94C 1MFCL 3RPKA 1U42A 4QYOA 1OQXA 1CD8A 1UQSB 3U2SB 2CGRL 3F58H 1GPOL 3CX5J 1EHLH 3RAJL 4J6RL 2JCCE 3ZDZF 5EO0B 1REIA 3QP3A 5IEKA 3D39B 2P49B 2VKXA 2J8HA 4GJTB 2XTJC 1OGTB 1IZJA 1BAFH 3VFNB 4WUUB 3TO2B 2NNAB 3R0MA 3VXNA 3BW9B 3RUGA 4PJ8C 3CFCH 4UQ2B 1PAMA 5IG7B 4AENB 3BIAX 2V5RA 3RNQB 2EEDA 4UIMB 4DVBB 1JRHI 5DJ8A 3B9KB 5TQ2H 2G2RB 4XPTH 1QP1A 2BNUA 3KPRB 1ZLVH 1U8OB 3VWJD 3MJ9H 4QCIA 5J4MA 2IQ9L 2JIXD 1FNGA 2OX5A 2NY5C 4WFHE 4HS8L 2V9RA 2GY7B 4JRXD 3Q3GA 3GIVB 5ERWB 4K71B 5EIVA 1VEOA 2RQ8A 3QDME 5I76B 4OCNC 2H2PD 4PGBB 1G9NC 1LHZA 1MLCB 3LN4A 3VE0B 5E8PB 5EU3B 5DS8B 1FYTD 4QRTA 5IFJB 2O26U 1QFUL 3IAPA 4WFFE 1OSPH 1IEAB 3TYGL 1N64L 4EBQL 5H35A 5HXMA 3DV6B 3EZ8A 4ZDHB 1HN1A 4LSQL 1EHNA 4XAWH 3VFPB 3FTGA 4ZUSB 1RUAH 4IOFD 5GXBB 4G42B 2WK2A 3QJFB 5IMKA 4JANB 1FORL 3V0WH 3WJLC 3GKWH 4C55A 4NQSB 3ESVF 4UDUB 3O4LD 1Z5LA 3K4AA 2NXYB 1FL6B 3T2QA 1OSZB 2NY3D 3DGGA 4PRPA 3EDEA 3ETBF 3RA7L 4L4VD 1JIBA 1WIOA 4OZ4B 4OLWL 1F4XL 5F7NC 5HHOE 2NPLX 1T20A 5JDSA 4BELD 5D70H 3WUWA 4KAQH 2A9NH 1U8MA 1Q38A 4PJGE 2F9BT 3W9DB 4UV7L 4HLJA 3HUJF 2IANA 5ITBH 1F90H 1NMCB 4JFFE 4XCFH 5DJXB 4TN9A 5F1SA 1U93B 2HLFC 2PTTA 2YZ8A 4G6FD 3GIZL 3IFPA 1T4KB 5AG9A 5JIIA 2HJKB 5I1GH 4P2QD 5JW4R 1AXIB 1WCBB 3MUGA 4OIBA 3KLSA 4G8GD 3GEWB 5F3BB 3MO1B 5I0DA 4FQLH 1XGTA 3T2NH 4J4PD 4NGHH 1K3IA 3DROB 1CK0L 3M1BB 4JFEB 4RAVA 3WMSA 3VCLA 1OP9A 4R2GD 3N1MC 2IAMC 4ONHB 5FOBA 4NQDE 3VXUB 2VR4A 4D9RD 5FO7B 3TT3L 3HI6H 2HAZA 3ARPA 3N06B 4J23A 3LEYH 3ELAT 1XGYL 4Z5RB 1RUQL 3QULB 5J0BA 1G6RL 4OJFL 4GO6B 5D2LE 4G8FA 3ULUL 2A6JA 3N1FC 5J6GA 3IU3B 4JQXA 1VGEL 3TYFA 2Q3ZA 4P3CL 2AEIT 3WLBB 1J5OL 2XA8L 1YUHB 1OL0A 3QQ9C 2I24N 3T0DA 2DD8H 3QUYD 4O9HL 5FECA 5JZ7D 15C8H 1J8HA 1ZA3B 2NY1D 3NH7L 3DSFH 1YY9D 2HN7A 5F7MC 4RGMB 4GBXA 4HMCA 4TUOA 4JHAL 1IM3B 4J1UA 4PS4L 5LG1A 5CP3H 4U1MB 5BW7A 2ZNXA 3SQBA 3MLSL 2O5XL 1E6JL 1NEUA 1FPTH 3ARBB 3IDJA 4LAQL 2XA3A 2ZWLT 3MLYH 4OFVA 5HVHC 2Y23A 2NTFB 1U8IA 3EJZD 2DTSA 1OTTD 1DEEA 3WS3B 1WLHA 1BQHA 4MS8C 4NQEE 1E4JA 3BGAA 1HZHL 2X4UA 1KF9B 4F7PB 4CMHC 2FX8H 3OGOE 5HDQH 4L9LB 4U0QB 1A7QL 2C3VB 1F8TL 2DJUA 3CLFH 4KRPB 3U4EA 1P84K 3BUYB 4JG1L 4XXDB 4MJ5A 1DSFH 1NCTA 1MFCH 3EOBB 4FTVE 1K8DA 1GPOH 3V5KA 1TETL 3VMNA 3U0WH 4QHNB 1UH3A 3RAJH 3OAZK 4P59H 1C12A 1K4CB 4JZOA 4KRNA 1GCFA 2HMID 2IPKB 4XCYA 1TJHL 1ZVSB 3VXMD 3Q5YA 3TT1L 3NIDE 5GRJL 2YKLH 1MCDA 5BMFL 1JGDA 3BAEL 5JXEC 4WFGE 5F96H 2KQMA 4HJGB 1M7DB 3BP5A 3E0GA 1WVZA 3VXSD 3SBWA 5BV7C 2W9DH 3S97C 3X12B 4Y2DC 5KTEL 5SWZE 2GSGA 2IQ9H 2EO9A 2EDHA 4CJ0A 5F9JA 4GRMB 1IL1B 2IG2L 1P4IL 2EDQA 4HS8H 4XI5D 2NZIA 3SDXF 5DK0B 3UZVB 3T2OA 1I8IB 3DMMC 3HMWL 3BN9C 5AG8A 4MAYD 5EC2A 1YZZA 5J1AB 3UDWA 2GFBA 4YO0B 3C09C 2Z93A 2MWCA 5ENWB 2HH0L 1SJHB 1D5XB 4H20H 1U8HA 5ISZA 2CRIA 1QFUH 3OR6B 4HIIB 4P2OC 2XNAB 1Q9WA 1JYWA 4EBQH 4DOHE 2V2TB 3GM8A 3NIGF 1AJ7L 3UAJC 4QNPF 5EBMB 4MSWA 2YUVA 1D9KA 3SDYL 2VL4A 3EO9H 4X7TB 4Z7WE 1FFQA 4IM8A 3REWB 3WIIL 1AGBA 1N0XL 1FORH 1YY8A 2VZOA 5MEQA 4DAGL 3K8KA 1EH9A 2A74B 1U0QA 4PRIB 2BSSA 3OKOA 3LEXB 3RA7H 1P2CA 5C0CE 4K23L 1MRDL 1GGIL 1F4XH 2FHBA 3ABZA 3BH9B 3MQIA 4OLWH 5DEFA 5C70A 5HVGB 2YPLE 5IKCA 1A14H 2QL1A 4UV7H 1WZKA 4F33A 5A2KH 1YEEL 5C08E 4HKBB 2FO1A 4OF7A 3V5HA 1XF2A 5CIPA 5D7KE 5F7WC 3GIZH 2MCPH 4V1DB 1NQBA 4MNQA 4P9HL 1I9IL 1Y18B 4LLYA 1YPZB 4WW1A 2NLJB 4X6FB 2GAZA 2IH1A 5A16B 4N8VG 1JGLL 2PYFA 3BJ91 4MA1B 5KZCB 3TO4B 3T0EC 1AO7D 3VGGA 2ESVE 3QUMB 1B0RB 4O2EB 3MXWL 2P8PB 4LKCA 1J1XL 2FDBP 3ILPA 5DO2D 3MRHB 3JVGC 3C5ZD 4FQ2L 5E6IC 1IT9L 2VLRE 1B3JA 3TT3H 2DQHL 2OJEA 1XGYH 1TNMA 3BQUD 4ZS7L 5IF0A 3NCCB 2Z31A 3O3EA 1S7TB 2YRPA 1EPFA 3ULUH 4JDVA 3MTRA 5MERB 4OFDA 3WNOA 3VFUB 3SE4C 2VQ1A 4P3CH 2V5TA 4AZ8A 2XA8H 1S3KL 4O9HH 3MRFA 4K8RC 1QSED 1WZ1L 2ZP0T 5HDOA 3UTSE 1H3UA 5DVMA 4YH6A 1P5VA 3SKMB 5CILL 4PGEB 5EORL 4ZSOE 4JHAH 4PS4H 4HH9A 5HGHB 5CWSA 5L2KA 1X6NA 1L7IH 3O3DA 4GRWH 3DXAE 2DI9A 3MLSH 2O5XH 4XCNA 5H37H 2NXZC 3PWVB 5EFIA 3QDGE 2JCCA 1C5DA 3K2UL 1TLKA 3LDBB 5DD3L 2XTJD 1I3GL 1WAAA 3TA3B 1YJDL 1MHHB 1LP9F 5ACMA 1ZGLB 2OK0L 3VD3A 1A02N 1HZHH 5HHQA 3WXVH 1MJJB 4JO3H 2KL6A 4WW2F 1A7QH 4DUWA 1F8TH 3Q0HA 3X3FH 4U6HA 1MCIA 4JG1H 1TTUA 3MGTB 4E41A 4XCCL 1PEZA 2FX9L 4HIEA 4OM1L 5HDBF 1V3LA 5GGSY 5CP7A 4G9DB 1ZLWK 3QRFM 5D6DC 1W72A 4HW6A 4LVOB 3FCTA 2IPUK 3D9AL 5JQHC 1MWAB 2FECI 1AIFB 2AJZB 2YN3A 3FN0L 3IFOB 2ARJQ 4LPXA 1TJHH 3EYUL 3TT1H 4E9LA 1UB5B 5BMFH 4CW1B 1ZT7A 4U2ZA 3UXFA 1XCQA 3BAEH 3D85B 2VXSH 5IW6A 1YDPA 2ZG2A 5LWYL 4FZ8L 4LQFL 2VXUH 1VPOL 3VFTA 1XGRA 2RR3A 5CGYC 1KENH 4P3WA 4NC0B 5EOCH 4IRSA 1X5LA 3LSOB 4JB9H 4OFPA 3MPCA 1NCDL 1AI1L 1JWUB 4UB0L 3KYAA 3GSOA 5EU6B 1Z6JT 4D94A 2IG2H 1P4IH 2Y5TA 4G80B 3FOMA 3HMWH 1QA9A 2AJ3B 1OGAB 5D7IE 1IC5L 3V6OC 4XH2A 2K7QA 3QIBC 1U3HB 4AT6B 1KXVC 5IM7A 1O5DT 1WT5A 1JNHA 3O8XC 4XMKL 4XNUH 3OAYK 4W6YB 2F8OA 2VDOL 4QHUB 2OTWA 4LLMB 4PJGA 4DKDC 1QBML 3SJVB 1CT8A 2EKJA 5CEZL 3SDYH 2VLLB 4PJEE 1X7QA 3C87A 1UG9A 5C0EB 5JORA 4PP1D 3JZ7A 4JFFA 2DBLL 2HLFD 2P8LA 3TZVC 3WLWC 3WIIH 1N0XH 4S11A 1EMTH 5SWSB 1INQA 5IFHL 3M17B 1NCAL 3KPQA 3SKUD 3FFCE 3LKOB 3UZQA 3BPNB 3MV11 1DBAL 1MRDH 4LBEB 1GGIH 3KPOA 1RQ5A 3RI5F 1ZLWH 4JKMA 1U58B 2Y07H 1J8KA 4NZTL 2Q7NA 4GKNA 2IAMD 3MRPA 5CJXA 2JJUA 4YPGB 4DZBB 1PJ9A 1KCLA 1X4ZA 4LCWE 4ODWB 3D0VA 1WIPA 1W72H 2FB4H 2GCYB 2IBZX 3OMZA 4PRHB 4GMSL 4P9HH 1JZ3A 5K9KA 4M8QB 1JZ5A 4YK4C 3HB3C 2ADIA 5I30L 4M1DH 2EC9U 1YEKL 1TQCC 5C0AD 1JGLH 1D5BB 4P5TB 2QKIA 3PV6A 3QQ9D 4X8JA 4PV9B 5DJ2A 2DI8A 3P4OA 2E7CA 3FQRB 5C6TL 2MHAA 3EZJB 2ADJB 2W65A 2YK1L 1QRND 2PYED 3KJ4C 1IQDA 1J1XH 3FQUA 1KN2L 2D9CA 3D2UB 7CGTA 4OCMC 1QR1B 3BD5A 4FQ2H 1A7BA 5DMYA 1IT9H 5FM8A 4CL7A 2IMNA 2CLVB 1FSKC 5HY9A 4W70A 4ZS7H 2ZCLL 4U1JB 4G5ZH 1LNUA 2EKSA 1RZ8A 1UCBL 1U3ZA 2X40A 5CHNB 3QCUL 3O4OB 2CQVA 5CSZA 3S6CA 1ZHNB 3ARWA 1TZGH 2OI9B 3OAYH 4PJ7E 1DQJA 4EQ3A 4Z7QE 1Q1JL 4FMFA 2I9LA 2LU3A 1MPAL 4PUBL 4NQEA 1IGTB 4M6OL 4LF3B 1C08A 3JV6B 3TM6A 5C0IA 5GSRA 1WZ1H 1JF5A 1HE7A 4AEEA 4LLAA 4DEPB 4X9IA 5BS0D 2EZ0C 2Z8RA 2KKQA 5HHNA 5EORH 4X6EB 3KWWB 4L8SB 4ZUUA 5I1DB 5EUKA 3IDGB 3DO3A 3VDAA 4ORGA 4FTVA 4WFEE 3GMOB 4BQ8A 2C3WA 4ODVL 1GAFL 4KRMB 4N5EC 4DJMA 5TDNA 3K2UH 1UT9A 2W59A 5JNYA 3MLWL 5D1QB 2GTZA 4JQVA 1YJDH 3FB6B 5DDHA 4OD1L 5J56B 2OK0H 1JWSA 3HMXL 1FH5L 5E94A 3ILQC 2BVTA 3RFZC 3SQOL 2WMPA 5I15L 3UPRA 3QRGL 5CEYB 3Q1SH 3S34L 3BSZL 4XCCH 5GRZA 4Y2DD 1A1NB 2R1XB 5C09D 3EJYC 1XZ0B 2FX9H 5SWZA 4JM2B 4N90D 3BD4A 2BVYA 5E8EA 2F53B 5IMMA 1YMHB 1OWWA 5FGCB 5AYUL 4P57B 3D9AH 3DMMD 3K81A 3BN9D 5JUEL 2WUBL 5IQ9B 4M4RA 1UWGH 2VMFA 3ZDXF 2Z4QB 3EYUH 1G84A 5F7DA 2BY3A 1BVLB 2APBA 5HYIA 1EO8H 5GJSL 5LWYH 4GS7B 4FZ8H 3QAZC 3S4SG 1FO0A 4D9QD 3LKRB 4JQXC 3PWJB 1G7MA 2XY2A 3PQYD 3QBTB 1NEZB 3KR3L 3UAJD 4Y4KA 1NCDH 3GBLA 5EU5A 3VXRE 3GMQA 4QRPB 2BY2A 3O9WA 4UB0H 3QG7L 3UTOA 4RQQB 5C86A 2D03L 4Z7WA 3CUPB 3KS0H 5H94A 1MH5B 1N8ZB 3ARDB 4PJDB 1M05B 3HI1A 3NA4A 4DFIA 4H8WL 4HDIA 4QXGL 4R6UA 4GBXC 5MEPA 4HMEA 4ZFGL 5DFVC 4M5YL 4KVCH 4OZIA 5HJ3B 4ZXBA 5BW7C 2ED7A 4RISH 2PW1A 1NAMA 5EPMA 5F9WC 3GMMA 4XMKH 5C0CA 4XBPB 2VN7A 2VDOH 4OZFB 1UENA 3RIFF 1OM3H 1P6FA 1QBMH 3VFOB 5CEZH 3HC3L 5C08A 5E9DE 1L0XA 2UYLA 4PJHF 4W6WB 1UZ8B 4X8XA 4KK8C 2DBLH 4JDTH 1NUDA 3L95B 1JP5A 3BH8B 3BE1L 3U7WL 4YGAB 5T1LD 5IFHH 4XMLH 4KU1A 4XZUA 1NCAH 4ZFOL 2FLBT 1WFOA 4PJ5B 1FZMA 1HHGA 4LLDA 1DBAH 1EFXD 1FAIL 5E8NB 1CGUA 1ZK9A 1RURL 1I1FB 2OTUB 2VDNL 2YN5A 1QEWA 2ESVA 5ESAA 3TBYA 2Q7YB 2EDTA 1FJ1A 4PJBE 4NZTH 3WIHL 3BP4B 5F8QC 1IBGH 3WHE1 3ARGB 2XKUA 4QXWA 1A7OL 3CH8A 2A6DB 4MDJB 1MEXL 3P9LB 1X4YA 2AV1A 5I30H 1S7RB 1KB5A 2VRAA 3TPUA 3OF6D 5D1ZB 1YEKH 4JRYB 1FFRA 5DUML 1ZKAA 4E5XB 2EH8L 1G9MC 1PFCA 5C92A 3GBNH 4P2RE 3VFVB 2NY6B 1CXKA 3CZFA 5IVXB 4K8RD 3MLXL 3ORJA 3GSNA 1A5FL 2VLJE 3G6JA 2OLDA 1KN2H 4KV5E 5INDA 1CLOL 2DI7A 4QTHA 4OBRA 2BY0A 1KT2B 2ZCLH 1M71A 2NXZD 3MV9D 1FRGL 1IGYA 3EDFA 4N0FA 1UCBH 2YD4A 1D9KC 4M7LT 4NUJA 4J12A 1EEYA 3QDGA 4I18B 2VXQL 5I71B 4O02L 1Q1JH 4PTUB 2AJSH 2NY4C 2B5IC 1MPAH 1NAMH 2IMMA 4F3FA 4KXZH 1JF6A 3O6FB 4HG4K 4XC1L 4M6OH 4YDIH 4HF5L 4M9PA 1IZKA 1CXEA 4ZPVB 5C0NC 4PRIE 2HJLB 3MROA 1VA9A 3DURB 1MJUL 4HHAB 1UJ3A 2VISA 5HYSG 3S36L 3MBEA 3GRWL 3JWOL 5JA9A 4ODVH 1EVUA 1GAFH 5INCA 5DQDL 2H6PA 4WU5B 2VIRB 2M1KA 3MLWH 5IJKA 1RK0A 1T0PB 4G9FA 3V9FA 3ROLA 3TF7C 3RWFA 3MLRH 1KIPB 4G6KL 1FH5H 1JI1A 2E27L 5FUZL 4F57H 5GQBA 5J9PB 1FGVL 5LGKA 3SQOH 4LDOB 5CGYD 5I15H 1R24B 3QRGH 1NFDB 4GUPB 3S34H 3BSZH 4ODUB 1SY6L 4NQCB 4YFLF 3DX9A 2XACC 1PX4A 1OOAA 3FL7A 3ZYIA 2OTPA 2GJJA 2H45A 1CD1A 5E2VL 4QHLA 2DTML 3FAXA 1OAUH 2YRLA 4D2NA 3VWJB 3GSUB 4WJ5A 2WUBH 5BZWB 3RY5A 4JRXB 4ZNEA 1KPUA 2P5WD 1FHGA 3K1DA 3SHSA 3DO7B 1JGUL 2ARJA 1CICC 2BDNL 1Q0XH 3QIBD 2L7JA 3FOLB 2Z31C 5FCUL 4KKAD 3O8XD 2X1XR 4LKXB 3ULVE 3AS1A 3MODH 2HT4C 1T89A 5DEZA 4YDJA 3RVUC 3GSNH 1CGXA 3GMNA 2WWKT 4GKOA 2FZ3A 3QG7H 2DM7A 4UOJA 4PJEA 3TIEA 2G75B 4XAKE 3UO1H 3TZVD 3WLWD 2D03H 3T4YA 3TLRA 3G6AB 4QF1B 1CXIA 3KG5A 1LK2B 4QXGH 5B21A 4Y4HA 1PVHA 4M5YH 2E9BA 5C9JA 5AWNH 3SKJH 3IJYA 4X99A 2XT1B 2DQDL 3ULSB 5E1HB 1I85C 3W0WB 5IB1B 1A7RL 4PGJA 4U7MA 3V0VB 1BQUA 4QXTA 5B22A 3LKSB 1YN7A 4WV1B 1SMOA 3M8OL 2PN5A 3MCLH 5DSCA 1HXMA 4OCRL 1SBBA 3VI3F 4LCWA 3RVTC 2H9GA 5JIHA 2F15A 3BE1H 4G3YL 4PV8B 2Z8WC 3HB3D 2JELH 1NCNA 4I1NB 1Q9LA 2X89A 4Q6IB 1G6RB 3C08L 1MCPH 5FO8A 3BGFC 5L6YL 1DP0A 2AV7B 3L7EB 1UCTA 3IYLW 1PZUB 2VDNH 3LPGA 1QFWH 1RJCA 5K9QI 1ORQA 4R90H 5HHXL 5F7HA 3MRMA 4PD4J 1F4HA 1S7XB 2PKDA 2B7DT 4JZJB 2MOVA 4N0UE 3I02A 4R2GB 4MX7A 4DFHA 3KHOA 1UM5L 4ZUWB 4IRSC 5LGHL 3WL9A 2H1PL 2H26A 2EC9T 3GUTA 4G6JH 1MEXH 2I9TB 1S7WB 1A1MA 1S8DA 4Z0BL 1A1OA 3A6OA 3BD3A 5KANI 1ROWA 3QEUA 4OLXL 5FYKL 1YEJL 1IC1A 5DYOB 5B38A 4PB0H 3MLXH 4AIXA 4Y16C 2YD6A 2GJ6E 3C60A 4PRPD 4TOYL 1T83A 2HG5B 2NY1B 5J1SC 3B6SA 1WT5C 4CADB 2EZ0D 1CLOH 4PJAA 4Z78A 3EOTL 3GSWB 2E9JA 3DX8A 4X5WB 4F37K 3UYPA 1S9VB 4HFWB 2CLZB 5I17B 3L3JB 4HIHA 3VFWA 3NCYP 2HFTA 5FYLE 1QVOB 2IAND 4N5ED 3STZB 3EYVB 4WO4A 3VD7A 2FHCA 2VXQH 3C6LA 3JXAA 1NBYB 1RHHA 4HXBL 1GVIA 2IBZY 5L9DL 1CR9H 3FO1B 4YX2L 4M7KL 4OLZL 5JHDE 4XC1H 3BP6B 3WFDL 2XG4A 5DGQA 4HF5H 4HUMB 1UEMA 3EJYD 5MENA 1CFSA 4DKEL 1MJUH 1OTSC 1ZHBA 4FXLA 1QSFE 1F6AB 3GRWH 4IJ3B 3VGEA 5J11C 4P9ML 4NO0A 5CJXC 1R5VB 3MRBA 3QZWA 4I77L 5GZNC 3RUGF 1M6OA 4GW1A 1X5ZA 5ACLA 5I2IA 3IDYB 3U1SL 2M8XA 3VXMB 2E27H 1FGVH 1AR1C 4LLQB 3KPSE 3MCG1 3OX8A 2ERJB 3OQ3B 4X6CB 4YEEA 2FCBA 1RULH 2G9HB 1CDYA 5F21B 4OLYL 3OKDA 5E2VH 1ETZB 4EUPG 3VXRA 2ICEB 5E8OB 3HG1E 3KYMA 2DTMH 4OAWA 1J8HD 1V7NH 5GGQH 1TZHA 2JLLA 5K9JL 3HPLB 4GG8B 4GBXD 2DL9A 3PF2A 1EEZA 3U79A 3DYPA 4HV8A 2BDNH 4MAYB 4HSQA 2FLRT 5KSAB 3VW3L 5FCUH 4E42B 1HEZB 1WBXB 2RGSA 4JKKA 1NGZA 3G5ZB 3OGCB 1CCZA 1P4LB 5DZNA 3MMEB 5DJCA 3I2CH 1TJIH 1T5WB 2IFGA 4LSVL 1BF2A 1DBJL 1C5CL 3RNKB 2HVJB 3HR5A 1KIQB 2P5EA 4DCQB 2Z91A 5D7JB 2N7AA 1LEIA 3T3MF 4KUCD 1EFQA 4B53A 2K1MA 1TFHA 2OL3L 3OKLB 5D7LB 1LD9B 4Y5VB 5IB3B 2IPTL 2UWEE 3NFNB 6FABL 2DQDH 1P7HL 3N1QC 2DBJA 4M6NL 5C0DA 1LO4L 5FB8A 1A7RH 1DTUA 3PJSA 4JQVC 3GHBL 1P53A 5CJ5A 4F7MA 1FNLA 4AM0B 5ABDE 1Y0LB 3M8OH 5IEHA 1J18A 5HGDB 4FS0A 4OCRH 2WSKA 2CH8A 4KMQA 1AGDA 2BHYA 4TUJB 1BIIA 2AVGA 4RMTA 3V6FA 2Z0BA 3SPVB 2P43B 4G3YH 1OP5K 1MY5A 1EDQA 4LPCA 1TXKA 4LVHC 4OZGE 3OKKA 1T21A 3C08H 2V7HB 3EDJA 2XWBA 3TFKC 3V8OA 2GJZA 4XNZB 4HEPG 4BH8A 3L3HA 4FNLL 1MCWM 4OKVB 4P2RA 4R26L 5FGCE 2P24A 1K6QL 2C7UB 2VH5H 3NTCL 5SWQB 4BFGA 1XCTB 3A6BL 5HHXH 2VLJA 4TUKL 1OAXH 2J5LB 1NC2A 5ISZD 1NGWB 4N8CL 2A6KB 3C2SA 2ITCA 3X14A 3NCEB 1UM5H 4LFHD 1FLTX 1ZMYA 3FT3B 5EUOF 2VLKE 4Y4KC 1D9KD 4ZTOL 1CTNA 5C8JA 3O9WC 5IBLD 2Q76A 4NNXA 3ZE1E 4F7TB 2XOTA 4ENEC 2BHUA 3D3VE 4QRPE 1U3YA 2NY4D 5EZIL 2RFXB 3GJFA 4OLXH 5FYKH 4IOIA 2FEEI 1RUKH 4UU9A 4ZXBC 1JHTA 4LPWA 4TOYH 1DQTA 1KPRA 3QDJE 5C0ND 4N68A 1QSEB 2YUZA 5ESVB 4HZLB 4L3EA 1CGSL 3BRDA 2JJTA 1XFPA 1CFNA 2VE6A 2XI9A 3HAEH 4RSVA 1DUYB 2J4WL 4X9GA 3SE3A 5LAXB 1QOKA 4I2XB 3KPTA 1FVCB 1BX2A 3KNBB 2GQHA 4ACPA 3RGVB 4DQOL 5D8JL 3ZKQD 4HXBH 3ZDZE 2VDKH 4MNQD 1Q0YH 2PR4L 2KPNA 4BUHA 4M7KH 4YHIB 5F1NA 3LQAL 2DYPA 4O2FB 1WV7T 5ID1A 2HT3D 1NH6A 4EVNA 5DJAB 4KUCF 4ELKB 2I07A 1E27A 1U8NB 1T3FA 3K7UA 4Z7UA 3SDDB 2BZDA 4F15B 1LQSR 3PWLA 1T6VN 3AMKA 4P9MH 4MLIA 1I1YA 1MI5A 2X4QB 1H5BB 5HGBA 4IS6A 2P48B 3JV4B 4YIQB 1QO3B 1UVQA 1QPPA 5EBWA 1ZHKA 5CMAA 2X4TA 2NX5A 1M1SA 3MJGX 1CLZL 2DKSA 5TPWL 3U1SH 2Z31D 4EIGB 3SDCA 3QNYB 4LRNH 4HWBL 1T1ZB 2HT4D 2ZSVA 4D0CB 4YXHH 4O58L 1VFBB 4KJQC 3RVUD 4JJHA 1UC6A 3IJHB 1EXUA 5EIIA 3F8UB 1I3RB 3LMJL 5F3HB 3ULUF 3MBXL 4KTYA 1FC2D 5BJTA 2MCG1 4UAOB 3MV8E 3P0YL 3FQTA 3S7GA 2WBJA 5J8OA 4P3DA 2B39A 3F7YB 4EEEA 4QY8B 2C3HA 5L2KD 4OFYA 3UTPD 5T1MA 3V4UL 1TPXC 1MLBA 1UZ6F 3MLZL 3VW3H 1CDCA 1B4JL 3WFHB 4PRNA 1NFIB 4JGUA 1I8KB 1KPVB 1RD6A 2J3SA 2PF6A 4CDGC 4GKZB 5I1EL 2DQCL 4Y19E 1FCGA 4PJ9A 4GRWF 4FA8A 2AK4B 5DK2B 3S3PA 4EDXA 4OGXL 3MJ8B 3W81A 1CFQB 2V2WA 2BRQA 3DTXB 5C2UB 4UV4L 1DBJH 1C5CH 3RVTD 4PJXB 1B9ZA 1ND0A 1A0QL 3HPJB 4E41D 4Z7VA 3HUJE 1VGKB 1R3JA 5GS2H 4LDEB 1UJ3C 1RFDL 4MA3A 4OM0H 3X13B 5EZLB 3N9GL 1ZSDA 3MBEC 5T1KB 4HKXB 1I7RB 4WFHD 4L4TB 2OL3H 4LQ1A 1T2XA 2NW2B 3OR7B 1S9WA 3SEPA 2BNRE 1NBVH 2WLZA 1K4DB 1LO4H 5I8OL 2VDML 5I73B 1KTLA 3GHBH 2R23A 1AKJB 2CR6A 1OW0A 4DKFH 1CG9A 3B3IB 3QO1B 3U48A 2EIZB 2ZZUT 3FO9A 1VDGA 4RMUA 1UYWH 2GEEA 2E7HA 2IAMB 5HYJA 3X11B 4N0UA 4IRSD 3RBSA 4ZTPL 1U8KB 3RWDA 2VITA 5I66A 2DOCA 2J8UB 3D25A 1WTLA 3H9SB 4NCC1 4MNHB 2AQ1A 4TVPL 5DTFB 1KIRB 3OKEA 2XWTB 2UY6A 5H2BB 1MREH 3L5WA 2YEZB 4UTBH 4FNLH 3VG9C 5KS9B 5DZLA 2GTWB 3EOAA 4R26H 5TE7H 5IJVB 3NTCH 4NIKB 3A6BH 3TCLB 1KTDA 3BESR 1NAKH 4JRXE 4WCYL 1QFWI 5JOEA 4M61A 4N8CH 1QRNB 3OXSB 5DJYA 1T89C 5DQJB 2DWDB 3CXHK 3ARRA 2Z92B 1BECA 3HR6A 3PXHA 1IEBA 3KYNB 4Y5XA 1FYTE 4ZTOH 4HUVA 5ITFB 3FQNB 4JFFD 3B43A 4OBSA 5C0BE 3EO1B 5EBLB 5D7SL 2Z35A 4QKXB 2J6EL 5I1AB 2OP4L 2FWOA 1KB9J 5D96C 4RWYL 2AJVH 5CKAA 3VFMB 4H1LH 3PWPB 4Y4HC 3FRUB 5CZVL 4CMHB 1T0NA 2PNDA 5KSBB 3PL6A 3FJTA 1CGSH 1OTSD 3O41B 4WI4A 2FJFA 3TN0B 3L5HA 4LU5L 1QSFA 1T22B 3O4LE 1VFAB 1C5BL 2R2HA 3WS6C 2WIIA 1HIML 1WAAF 1XF3B 1A6TA 2YPVH 1G6VK 3S35L 5AAMA 3ZE2F 2J4WH 5GZND 1GSMA 4L4VE 2BVUA 1FP5A 1RJYB 3BKCL 1N5YH 5D8JH 3S5LA 2X44D 3T4AA 4PGDA 2BOCA 3MFFA 2PR4H 1HQ4B 1AR1D 3QXAB 4HLZH 3G5XA 4JGMA 3RX5A 4LOUC 3QB7C 2WQRA 3WD5L 5F7UA 3V7MA 4LRIA 4D9LL 2NYYC 1Z0MA 4Y2DB 3HG1A 4KKCC 4P2QE 5ICXA 2B1HH 4FQ1H 1PQZA 1LDSA 4G8GE 2NY2C 3V4VL 2PO6C 4PY7B 3D69A 4HKJB 4NC2B 5DRNB 3G08A 2BERA 3S96B 3ZL4L 1XR9B 3SDXE 3BPOB 4UQ3A 1UB6A 1CLZH 4MQSB 2YC1B 1VSCA 1G7PB 1CZ8L 3RL1A 4HWBH 4O58H 1QHOA 1DQML 3IETB 4AQOA 1KJ2L 4N8VA 3LMJH 1I7UB 4NQED 1L0YA 3PQYB 2P8MB 5FHAL 3NIFF 4JEGB 3NIGE 5IW1A 2X7LA 4QNPE 3C60C 2D7QA 3DHJA 4ONOA 3OXRA 3KXFB 2A73A 4Q9RL 2FNBA 3OKMA 4B50A 3GSXA 3CH1A 5DLML 4BA8A 3MA7A 4FTVD 3VXOB 1QSZA 5DXWA 3V4UH 3MLZH 4IMLB 3GI8L 4KHTL 1SBSH 4URTB 1B4JH 4NP4L 2IH3B 2UWEA 1FBIL 1KLGA 1PW3A 4WO4C 1NANH 1KEGL 4WDIB 1AGFA 2QSCL 3C6LC 5I1EH 2DQCH 4LEXL 5EZJA 4KK6D 4OGXH 4UIKL 4AL8L 1MQ8A 1OP3H 2F58L 3DRQA 1JTTA 2Q86B 1KN4H 3MR9B 4P5KB 3FKUS 1A0QH 2WWMC 1DL7L 1FL5B 4YR6A 1CIUA 1TTFA 1U8PB 1IFHL 1RMFL 3NAAL 3UBXB 5SWZD 4ISVA 3TBVB 1LK3H 4IRJB 3TJHC 4K7PL 1RFDH 2OR8A 4YHNA 3N9GH 2NQCA 3PHQA 3NCJL 3AROA 3TFKD 4L1HA 3RWEB 5I6XB 3T0WA 1RUPL 1YNTA 4MD5A 1FQ9C 4JY5L 2VAJA 5I8OH 3MNWB 4FXKA 3A6CL 4JO2L 2DIJA 3H3BC 4BH7A 4RAUA 3ESUF 1Z0NA 1RZFL 4WWKC 5FO9A 4BUGA 3PWUB 4K3GA 1BLNA 4AQ1B 3VXME 2YD5A 3DX7A 3F6IA 3IXAB 5I1HL 3HE7B 3N1PC 4RGNB 4Y4KD 2VLKA 3O9WD 1A4JB 1QLRB 3LS4H 3T65B 3TNNB 1UXWB 4OIAA 3WHXA 1MHCA 4M9OA 1L0QA 4HUWA 4HZAA 4TVPH 4ZO9A 4ENED 4ONFL 2BNQE 4R3SB 4NZUH 3D3VA 4JFPA 3VXSE 4ODBD 1QKZH 4LVNB 1ES0A 5EN2A 5IQ7L 4U1HB 1A7PL 2R0KL 1IAII 2HYMA 3I3DA 4ZXBD 5E1AA 2IFFL 3CIQA 2BY1A 3NACL 3D6GA 1DQLL 3T0BA 2A6IB 3P4MB 4WCYH 3QDJA 1W8NA 3K80A 5C0CD 4S1QH 4WNQA 3BO8B 2MKLC 3ZT5A 1T1WB 3H0TA 4N5UA 1AHWB 5E99L 5C08D 1I7ZA 1FV1A 3MV9B 5K33A 3IDNB 1J05A 1GL4B 1WC7B 1JPFB 1RJLB 1U8QB 4MD4A 3L7FA 4Q0XH 5J13B 3QFJB 3AXLB 4RWYH 2O61A 4C56A 4XHQA 1K8IB 1LP9E 2AJUL 2ZOLB 1T7YA 4CKVX 4BZ2L 1DANU 3PHOA 3MRJB 3QQ3B 2ESVD 3UEZA 3W2DL 4JFOA 2DQFA 1C5BH 1HIMH 1HHKA 2YSSA 3PUCA 5HDBE 4QT5B 3VXQB 3ZYZA 3P4LA 4U1KA 3CMOL 3EIFA 3BKCH 4D0BB 1FGNL 1XGPA 4NHCL 1XF4A 2BCKB 4HK3J 1BHGA 4LEOA 2P44B 5IW3A 3G9VA 3QUKB 1AP2B 1LO5A 2NW3B 3QPXL 3RWGB 4MZ3A 2Q6WB 1VFOA 5K59F 4U6TA 3WD5H 3CFDA 4OZHA 3U4BL 5HGGS 3IAGC 3V52L 1P7KB 2UZIL 4E0RA 3MV8A 3PIQA 3KLHC 3KLAB 3V4VH 3BPCB 3SDAA 3ZT6A 2AKRB 2KH2B 4XP4L 4JJ5A 4GXVL 1AO7E 5DD1L 3ZL4H 3MJ7B 4HXAL 4CRPA 5IESH 4X5XA 2HVKB 5F6IC 4XNXL 5FIEA 5MI0B 3E1F1 3QDGD 4MA7H 1NUNB 5J89A 5EO1B 4AIZB 1RI8A 1RZGA 3WV0A 3P40A 1M7IA 1UWXK 2FO4A 2I60L 5FHBL 4TNWK 1F02I 5GPRA 5ICZB 4YDLB 4OZIF 2GSIA 2MQCA 3CSGA 2D3VA 4X9FA 4HK0B 5E4EC 3ALPA 3HUJA 5FEBA 4F7CA 1G7IB 4Q9RH 3INUH 3E6HA 3MBED 2ILLA 2JJTC 1S7UA 3ARVA 4IIQC 3FFDA 3QWOA 4JFDA 3NZ8B 1A6AA 4KHTH 5EO9B 4RFNC 1J88A 2APFA 2VSDA 1FBIH 4XBGA 2W60A 3SE3C 1RIHH 5GZOC 2QSCH 3CDCA 4G9FD 3M07A 2VTFA 2Q20A 1XIWC 2QADB 4W81A 4KH2A 1XT5A 2BVOA 2VAAA 3WKML 4AL8H 5BXFA 3DRTA 3AAZB 2CDFB 2F58H 1FIGL 2F74B 2XTJE 4HT1H 1JCKA 2NY7L 1H3TA 1MCKA 2BHZA 1RMFH 3NAAH 3QUXB 2NR6C 5GGUA 3PXJA 4K7PH 3WKNA 4QCIB 4WTWA 4P99A 4YK4B 5EOTA 3NCJH 4IHOA 4NKOA 1TCMA 2ZKHL 4MJ4A 4LFHG 1A4KA 1WEJL 2CXKA 1TQCB 4EIZC 3Q3GB 4RMQA 4QRRB 2OSLB 1BZ7A 4IDLA 3QA3A 5D1XA 5H37G 3U30C 1T2JA 3SDCC 1RZJH 1JK8B 4QRTB 2X4OB 1EEQA 2ED9A 1HHJB 2V5MA 3HNSL 4TVSa 4KY1L 4F2MA 4AEHL 2W0LA 4NQUA 4YAQA 2DDQH 1A7NH 2HFGH 2PCPA 3NGBC 5H35B 1J87A 1EIBA 2E7MA 2CIKA 5FA4B 3REVA 3U6RA 3RZCA 4ONFH 5C0BA 5ANMB 3FTGB 1KBGH 3PP3K 4OTXL 3HAEB 2WBJC 1U92A 4MGXA 4BQBA 3LKNB 3G6JF 4X80L 1A7PH 4Y4HD 3BWAA 4LLUA 1UKTA 5CS7A 2IFFH 1YECL 3NACH 1DQLH 3VRIB 5D2NA 4K3HA 4PRPB 1U95B 3S4SA 2C1OA 4Y5YA 3P77B 4RZCA 4JQIH 1QD0A 4NKIH 8FABA 3FN3A 5JDSB 1F4WH 3GSQA 5E99H 3WUWB 3ZYOA 5BRZA 4UT9L 3U7YL 5KVEL 2AXFB 5L0QB 4JZNA 2J1KA 4LCWD 1C7SA 2EDRA 2SEBB 5FK9B 5HTSA 2X4SB 1BWMA 5F1OB 2X89D 3IS1X 2AJUH 4LOUD 1VKXA 4CJ1A 4BZ2H 1WBYA 5E95B 1T7XA 1W0WA 2NYYD 4KKCD 4YHYC 4UINL 4K9EC 1EZVY 3W2DH 2W9EL 5SV3A 1OWRM 5FGBA 1ED3B 3WXWL 5EIQA 3BYYA 2NY2D 3MV7A 4IMKC 1OW0C 5TF1L 1MJ7L 1IGFH 3PWNB 4HS3A 3CMOH 3JTSB 4I3SL 2AXGA 1KGCD 3GZKA 1O7VA 5SV4A 5C1MB 4NHCH 3C8DA 1CL7I 2GUOB 4KDWA 3ZDXE 5I74C 1A3QA 5DRZB 2JJWA 4G8FB 3AY4A 4R4BA 4FQIH 3QNXA 3UPCA 1DDHB 2A6JB 3E3QC 3R8QA 1S7SB 5ID0A 5IB4B 1AXSB 2BOBA 3U4BH 3DHMA 3CSPA 3V52H 2UZIH 5T5NF 3TBTA 3TNMA 1JGEA 2W07A 3C60D 3WNLA 3PP3H 5C0AE 1J8HB 1HK6A 3UJTL 1VACA 1E4XL 2HT2C 4XP4H 2C3XA 2K9UA 4GXVH 5FYJD 3GO1L 1GGUA 2O5YL 4HXAH 3UJIL 3BVNA 4XNXH 2IPUG 1T66C 2Y4SA 4R7NA 4Y5XC 2PYEE 3VRLF 3QWQB 4HX1B 4WO4D 3C6LD 2F5AL 2OL3B 5F9WB 4KJWC 4JFYB 3IDJB 5E6ZA 4BZ1H 4ODSL 4XT1C 4CBPA 2YWZA 5GS1B 4M02A 5BVPH 2R0LH 1U8IB 2WP3T 1B4RA 1DEEB 1DLHA 2I60H 1XMWA 2OR7A 4JREC 3O3BA 1BD2A 1BQHB 4Y1AB 5FHBH 1ADQA 1S5HA 4EJ1C 5D5MB 1BJ1J 2WWMD 2FJHA 3LQZA 2EYSA 1F97A 5LJYH 5MEND 25C8L 5CJOL 3WEXA 5C2BL 5IMLB 4PJHE 3TJHD 2BP3A 4MJ5B 3U82B 4BFIA 1MCOL 5EU7C 4KTEL 3V8CA 4NO0D 1K8DB 3VXPA 3V5KB 4ELMA 4KK5C 5B39B 1DEDA 4QGYA 5BS0E 3P9MA 4M43H 2IJ0C 1C12B 4JZOB 2KZWA 4FFVC 4EI6B 3SO3C 1UQSA 1P9MA 3U2SA 2DM2A 4H0GA 1NL0L 1VFMA 1NANI 1GIGL 4XMPL 1JGDB 4GG6B 1FIGH 4W6XB 1TVHA 3D39A 4TULH 3HRZA 1FNFA 1TENA 2DM4A 2YUXA 3VXRD 3ARFA 3VFNA 4LRIC 3TO2A 2NNAA 1OB1B 4PY8I 3BW9A 4AENA 5IVZB 3MRKA 3RTQA 1MRFL 1TJGL 5EBGA 4DTGL 2BNQA 1ZLSH 4X6DA 2G2RA 3LRHA 4YHLL 1WEJH 2EDLA 5I16B 1CTOA 3KPRA 5C09E 1U8OA 5KVMC 3LN5B 2I27N 1GC1L 2VDPH 4HUXA 1IAIL 2XTLA 3GNML 3ZKMC 4P4KA 2Y06L 3QFDB 4BJLA 4BZYA 2GFBB 3EFFA 3FB7B 3JWDL 3MOBH 1SJEA 4H1LB 3GIVA 2Z93B 1UM4H 2CK0H 3NOIA 5DJ6B 2BSRB 4MD0A 1JPSH 3QDHA 3HNSH 3SKNB 4KY1H 1DE4A 1MLCA 4AEHH 3VE0A 1A9EA 1Q9WB 5E8PA 4C4KT 5EU3A 5DS8A 3T1FA 4F37F 5I19H 3ISWA 3O45B 3QUZA 4D9QE 3C2AL 3OAUL 5DRXB 5KSUA 3LOWA 4AIOA 1RU9H 3TBWA 1IEAA 4X80H 1AGBB 4JRWA 2P5ED 4PJAF 4M3JA 5MEQB 3VFPA 4Q2ZB 1YECH 1QYGH 2DJSA 2VZ1A 4G42A 3OKOB 3QEHA 4JANA 2CR3A 2XZZA 3Q48A 4UMGA 4NQSA 5DEFB 5CBEB 4HMDA 1FL6A 3DUHA 4APQB 2UZXB 4YHZL 3HN3A 5F7YC 1Q9OA 4UT9H 1M7XA 1MELA 3U7YH 1FNHA 5KVEH 4FFYL 4MCZB 3H9YA 4OZ4A 4NHUB 3O3AB 5BO1H 1XF2B 5CIPB 2IBBA 3W9DA 5FFLA 3TCXA 4WEBH 1AQKL 2OR9L 1DANT 4MNQB 3I6GB 5AZ2H 5IB2A 2HWZH 5DJXA 4K2UL 4NM8L 1CS6A 4MLSA 1T4KA 5ETUB 2PYFB 4P2RD 5FKPA 4FFWC 1A6ZB 4UINH 2HJKA 1F2XK 2W9EH 3WXWH 3QIWA 4G8IB 1WCBA 5F1IB 2VLJD 1MFDH 4OGYL 1NC2D 4D0DB 4UBDC 4HQQL 4I3SH 3T0EE 1IGJB 4LASL 1EGJA 1AD0A 4M48L 5FYJU 5DA4A 3DROA 3M1BA 1KYOK 4OCWL 1IAIM 4RFEB 2UVFA 4DN3L 4KJPC 5IBUB 3VXUA 5FO7A 4YNYA 1HI6B 5CZXC 4Z5RA 2VQ1B 3RJQB 3B9AA 4XRCB 1RVFL 2CKBA 2EEBA 3IFLL 3ROOA 3MRFB 5T5FH 3IU3A 4GQ9L 1F13A 4L3ED 1OF2A 5GGRB 3TJEH 1VCAA 5IV2A 5IMOA 1FLRL 2O5YH 3UJIH 3PGFH 2OMBA 5GS2D 1ZA3A 4B5EA 5CWSB 1RAMA 3QXDA 3O3DB 4TSBL 1DVFB 1VESA 5J06A 2JCCB 1C5DB 1SJXA 3MV01 4ODSH 3IGAA 4U1MA 1OAQH 5GISL 4KMLB 2FEDC 2DYPD 1OAKL 3CFBA 5HHQB 2R15A 1HDMA 4KGJA 3UC0H 2X10A 2NTFA 3WS3A 25C8H 5I8EA 2NR6D 4U6HB 4I5BA 5CJOH 3EYSL 5C2BH 2QSTA 4PJ8A 4F7PA 1NBZA 2ZOKA 1QFPA 4HIEB 3VI3E 5CP7B 1MCOH 1BFVH 1MI5D 4M93C 3FCTB 3VD5A 1KLUB 2XPGB 4LHUB 4MMXC 4YXLL 1G1YA 4JE4B 1DLFL 2OZ4L 3QDMB 2NX5D 5LCVL 3L6FB 1NL0H 2YA0A 2ATPA 2YZ1A 1GIGH 2J7LA 2YD3A 3BX7C 3QCVH 1FNSL 4QHNA 3SDCD 1K4CA 4F9LA 1YDPB 4MWFB 3VFTB 1ZAGA 1VENA 1XGRB 3QWRA 3B2UC 4X9BA 1RZJC 2DIAA 5CD5D 1SEQL 2R1YB 2YXMA 4OF6A 1IKNA 4XAKD 1MRFH 1TJGH 4DTGH 1M7DA 2WBJD 3QUML 4XX1E 4YHLH 3SDAC 4ZFZA 2Y5TB 2EDOA 1GC1H 3FOMB 1QA9B 3LEVL 3GNMH 4OFYD 2Y06H 3MSPA 4WGVB 3ULVL 3SOBL 1I8IA 4NKDA 4AMKL 1JV5A 4GMTL 2P5WE 1NCBL 2IALA 3SE9H 2OXHA 1JNNH 5J1AA 3V6OE 4LP5A 4PJ9D 4Z95L 4CNIB 5HHOB 3SKOB