4TOYL

Structure of 35o22 fab, a hiv-1 neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
b'SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 35O22 Fab Heavy chain
publication title Broad and potent HIV-1 neutralization by a human antibody that binds the gp41-gp120 interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2014-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4toyL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4toyL02
3WLBB 1AI1L 4X4YA 1IGML 4XVTL 3L5XH 1NGYB 5C2UB 1CGUA 5HHMD 5DRWB 5GGRY 1H3VA 1RUPL 1CFSB 4P46A 2VDQH 2ITDB 5L7XL 3DSFH 5DUBB 3VFMA 1X44A 1HHJB 1B4JL 4I4WA 3WBDA 4FFYL 4M8QA 3RVVC 5GGSB 3TV3L 2XWTA 3WDHA 4MNQB 1OCWL 4WO4B 2CO7B 3OJMB 2GTZA 3GIZL 2IANA 4KI5E 5ECJE 4PJ8C 3DIFB 2VLLA 1HE7A 2FD6H 2NY3B 3HE7A 4H88H 3QFDB 1P6FA 4KHTL 4MDJA 5FGSA 5IVXA 1FBIL 3N1MC 1U2HA 4LCUA 1S3KL 3TYGL 3UBXI 4HIIA 4IJ3B 5DJ6A 3BISA 1MCPH 3U7YL 3D0VA 4KUZH 4DUWA 2V7NA 3W9DA 1S9XA 3ESVF 3C5JA 4FQ2L 4C58B 4WU7B 3KYMA 5TDNB 5K9KA 4DCQA 5FCSH 3C5ZC 2EEDA 1J0JA 3ULUH 3IB4A 1EERB 3JWNC 1D5IH 3OG6B 3K8KA 3U46B 3QRGL 2R29H 1F3RB 3AC0A 4R97B 1XH3B 3STZA 3QCVH 1JTTA 5KZCB 1I1YA 4R2GB 1S7VA 3KGRA 4NZTL 1R5WA 4CN4A 2O5ZH 5ILTL 1S7TA 3IS0X 1NH6A 3IJHA 3FT3A 3HI1A 4KC3B 5D96B 4QRQA 1C08A 1NEZB 3MOQA 5HHNB 4XMPH 2C1PB 5HSFA 4MCYB 4HWBH 3ZT5A 2AK1H 4HK0A 5FGCB 4PRPB 3C09C 1JYXA 1T6WA 4Y88A 3GI8H 4FQXA 3HMXL 4NQCD 4LCWE 1FL5B 1M7XA 1GJIA 1I1RA 3D2UA 4HWNA 1L6XA 4UV4H 4TVPE 1DQTA 5C0BE 3WD5L 1H9VA 3HB3C 2FX7L 4KI1A 2RJMA 4HF5H 5CHNA 3D5OF 3I6GB 5D7JC 2FHFA 3T0DA 4L8CA 3HAEA 2NCMA 3QQ3A 4M61A 4OTXL 1ZEAH 3TH3T 1H5BC 3F65A 2ICWJ 1U92B 3KPRE 1G7HA 3U4BH 5IMMB 3SY0A 1AHWB 3JWDC 5DEFA 4RZCA 1ZLSL 1DFBL 2CR3A 3RL2A 2J8UF 5I1DB 4HLZG 4QGYA 2Q8AH 3FT2B 5I75C 1WWAX 3RWGB 1ITCA 3NIDF 3BW9B 4Y16C 4QCIB 3STBA 3D25A 3IU4L 4I48A 2IALA 2WLYA 3ARGA 1JF5A 5SWZB 4J3VA 3LQZB 2BNRE 5F9OH 4OZHB 4J12A 5IJKA 4IIQB 2CQVA 3DTXB 4XAKE 5KZCD 3CXHJ 4R2GD 2ARWA 4YX2L 1UWEH 1MJ7H 1YEJL 1NKOA 5BJTB 4OZIE 3LQMA 3L5IA 3C9NA 4JKMA 1PX3A 1BVZA 2A6JA 1INEL 3MRIA 4JGMA 1I8IB 4PJ7B 3MUZ1 3LB6C 3MRGB 3RA7L 3MJ8A 4G8IB 1EBPA 2Y7QB 3OB0H 1NLDL 2WUBH 2VN4A 4HUWA 3W5MA 3HFMH 3NIGE 4G8GB 3MA7B 2JCCA 1TPXC 2CLZA 1U41A 1REIA 3I02A 4M1DL 4JFFB 3WSQL 4PJGE 4LPUA 4KROB 1F02I 1KIRA 5CZVL 1CT8B 2X05A 2CKBL 4U1JB 4FXKB 1Y0LA 3K4ZA 4OFYA 2FX9L 1F58L 2J7LA 4UAOC 4WTXA 5F93C 4YHML 1J8HE 4TRPH 3TVMD 3BPCA 2YK1L 3IKCB 1WGOA 3MJ6A 1XIWA 5HI3D 4E42A 1T1WA 4PJIA 3QDMB 4JGJA 3G5YA 3OGCB 1T4KA 4HHAB 2I07B 2VWEE 4JO3H 4OI7A 3F7YA 1JNJA 1OTUD 3OJDB 1F6FB 1XGYL 1RFDH 4GAGH 1HYSC 1TVBB 4C54A 1FO0A 1E6OL 3MACL 4PUBL 2DKUA 3MJ9H 5HGBB 1IEBB 3GMQB 3BIAX 2FEDC 3ELAT 3OTTA 5JLZA 4OZFA 3H42H 1IVLA 5D1XA 5C07B 1N8ZB 1NBYB 2ATPA 5T1MA 1P4IL 3DO7A 4Z7QF 1PYWA 1WTGT 5FYLL 2CLVA 1FAIH 4JHAH 1MRFL 4JO1H 3EYSL 3OG4B 3MUGA 4JKLA 4HXBH 5F7UA 5DMKB 4GKSA 4WI8A 1MAML 2ADJB 4NRYB 1WC7A 1SYVA 2CXKA 1K9TA 1MVFA 2VZUA 3TCLB 1IFHH 5F7WC 4XGZA 3SDDC 5E6IC 4L8SA 4CADA 1A6ZB 3MRMB 5CZXD 4E41B 4G8GD 3AU1A 3UZVB 3T65A 1WZ1H 1Y6NR 4JFFD 2EZ0C 2P5WE 1PG7W 1YEDB 2ADFL 4KROD 1IT9H 3HE6D 4LDLB 4QRUA 4LRNL 5JOFB 2F54B 3EFFA 3TO2A 1D6EA 1JRHH 3MR9A 5HYJB 3BE1L 3RU8H 3BMWA 4X8XA 3X13A 3VMPA 4Z7UE 1KCRL 4ZS6C 3REWB 3WEXB 4MLIA 2J6EL 1UWGL 5GRJL 4YO0B 3A6CL 1CFQA 3CUPB 5DC4B 4F9PA 1N7ML 2F8VA 2J8HA 3MMEB 3LQAL 4NFDA 3T3PE 4DEPB 4EDWL 4Y5YC 4DN4H 5IQ7L 3U0WL 2HN7A 1KNOA 4MB5A 1BVKA 3S9DB 5C0AB 4UU9A 5AZEL 5ID0B 1RJYA 1JYNA 2IFFL 2IPTL 3QCUL 5D1ZC 5IUSA 4P5KB 4RIRA 1IL1A 4PY8I 3SBWC 1H3TA 4GG6A 3Q3GA 5DZNA 4YK4C 4HMEA 1P4BH 2YBRA 2PYFB 3FRPG 4GG8A 1F4WH 4N0UB 3BT2H 3S7GA 5JDSB 4Q74A 5A2JH 1G7LA 4L1DA 3DGGA 2XZZA 4GW5A 3MO1B 1WWBX 5DJ2B 5EA0H 2HJFA 5CP7A 5D72L 4Q9QH 1U8LB 4MNHB 1A6AA 1F4YL 4X5WB 1HHGB 3SO3B 3UJIH 3WLBA 4E41D 5B38G 2RCSH 3MNWB 3PDGA 2JJSC 4NM8L 4R96B 2HKFL 5GRUL 1I75A 2XFXB 1NGYA 2BRRL 4AYFA 5B39B 3ETBF 5CBEB 1OLLA 2DWEA 4M8VA 1P4LB 5DRWA 3KR3L 4NQDD 5GZOD 1CFSA 2JJTA 2ITDA 5KJRL 5I1KL 1N64L 2YXFA 1HHJA 5C6TL 2DYPD 4K7PY 5GGSA 3IDJB 2GJ6E 2B2XL 4MNQA 4WO4A 3H9SD 3X3FL 5GQBA 3SE8H 1S9WB 3GSNH 3WFHB 3DIFA 2HTLD 1A6WH 3QFDA 5I71B 3VI3F 4X6DE 1P5UA 4POZD 2CJUH 2A9NL 1QLEL 1D3CA 2XT1B 4U6VL 1AP2A 2HKHL 1CWVA 1T03L 5I1LB 4KZDL 3FONB 1JHKL 5L9DL 4R4NC 3JVGA 1Q72L 4XP5L 1RQ5A 1YMHA 2Z31B 4LCYA 5TDNA 5KVFH 3QIBB 1JVKA 3ARPA 3U46A 3QNYA 1U3YA 1XH3A 2YD1A 4IRJB 3BIKA 4JG0H 1F6AB 1WIOA 3VXRD 4JFDD 1ZA6B 1LMKA 4PGDB 5HYSG 1TZIB 5JXAL 1QBLH 1VFUA 2FBJL 3CFEB 1NEZA 4PP2A 5DK0B 5HHNA 5HGHB 4FS0A 4ZFGL 1D9KB 1CBVH 2C1PA 4MCYA 3BSZH 5DJYA 2M26A 5DVKA 2A1WL 4Z18A 3HNTH 4NRXB 3LEVH 4A6YH 2JELH 1JRHL 2APVA 4MNGB 5ICYB 1RZKH 4AL8L 1UM5L 4PLKC 1AO7B 1FL5A 1JPST 5HD8D 1QBML 3HRZB 5DQJB 5DXWA 4ZOAA 3BPNB 3CX5J 4HEPG 3IDXH 1ZHKA 3I6GA 3MRDB 4S1QL 4RAUB 1BMGA 3O0RH 3Q2CA 4EOWH 2Q20A 4XNQA 4X98B 3TVMA 1GHFL 1U92A 4OLVL 4CRPA 2I9TB 2R4RL 3GSRB 3B9AA 5HYQB 3RIAK 4LSSH 1AHWA 4MAYC 1ADQL 2DL9A 2F8XC 3DV6B 3QUZB 3GSQB 4QLRA 4ZG1A 4FG6C 1IGIL 1EJ6A 4JQIH 3FT2A 1B88A 1WBZB 3RWGA 3IXAB 4OBSA 5DD3L 4U1KB 3BW9A 4QCIA 2R56H 3QIBD 1CE1L 1Q1JH 3NABH 5SWZA 3LQZA 1EO8H 4OZHA 3DI2B 2R2BB 4QHNB 2R0ZH 4IIQA 3H3PL 4IRJD 1QRNE 5CIPB 3DTXA 4W68A 5ITBL 5GGUA 4QRRB 1Z9OA 1MFDL 5BJTA 1P5VA 4M6NL 1AD9B 3RP1A 1NAKH 3SDXB 4O58H 3IETB 1T1YA 3CFCH 4DGVH 3BPOB 3EYUL 4DVBB 3P9MB 2VLRE 3LVEA 2KZ1B 2Y7QA 4JVWA 1NPUA 5IHUH 3VRIB 4P5MB 4G8GA 1PSKH 1TETL 4EQ3A 1YY9D 4XPFH 3G9VA 2J8UE 5EZIL 4JFFA 3GMLB 4Q0XH 4BK4A 4S0TD 5INDB 3OB8A 3HG1B 1CT8A 4U1JA 4FXKA 3EDFA 3NIDE 2MQ0A 5I8OH 4JFOB 4L4TB 3CFDB 3VGBA 1MFCL 3IKCA 1R24B 4XPTH 3ET9F 2VDPL 1BGXL 3QEQE 3QUZD 4PYHA 4XCYB 2MQCA 5GGQL 4M7ZC 5F3BB 1E27B 3WFZA 3QDMA 4Z95H 3OGCA 5JORB 4M1CC 2I07A 3F5WB 4B5EA 1YYLL 3T0EB 4ETYA 1NCBH 3OJDA 1FV1B 1WISA 35C8L 1W8NA 4NOFA 1TVBA 4QXUL 4U1MB 1LDPH 4P2QB 2R23B 1LP9F 5HGBA 1IEBA 3GMQA 4HIHB 3WFDL 5D93C 4OCSH 4J7RA 3PIQA 4QRRD 5C07A 1EHXA 1OWWA 1N8ZA 4LLMB 1NBYA 5EORH 4LF3B 3LEVL 4PYGA 4NZRH 4XNXH 1E28B 5B4MC 1TTUA 1MJUH 5DMKA 4MD4B 3MLXL 5C0JB 3RWIB 2ADJA 4NRYA 4GLRH 5IF0B 12E8L 3TCLA 1UA6H 4RNRB 5ANME 3AY4C 2H6PA 2IBZY 2NY5C 4F2MA 3KPQB 1A6ZA 2Z8RA 3HNVL 3MRMA 4JKPH 4E41A 1KBGH 5C0RH 3KNBB 4WGVB 2NY7H 4X4ZA 1MCOH 4NQDA 3OKEB 1YEDA 5IBUB 1AR2A 5HDOA 1DQQB 4XC1H 5FHAH 3BQUC 5JOFA 2WWKT 5IB2B 1SJEB 3FN0H 2H45A 3H9SA 1YEKH 1RZ7L 4L4TD 3V79C 3TJHD 3CFBB 3MRFB 7FABH 4NN7B 1VEOA 4NBYB 4M7KL 4Y4FC 3EAKA 2EKSB 3WEXA 1NFDB 4KH2A 4Z7QE 3K2UH 3RL1B 1PKQE 4YO0A 5T33H 3VFUB 3CUPA 1RMFH 1NFIB 2FB4L 3BP4B 5IFJB 3KJ4B 4J6RL 2VRAA 3UCRA 4ALAH 3BGFB 2YD8A 2J12B 5C0AA 2VQUA 4LGSB 5ID0A 4NJ9L 4P5KA 2Y72A 2DBLL 4XTRC 5I15L 4G3YH 1OD7A 1N59B 5GS3A 5EUKB 4PB0L 2PYFA 4JFDA 2DD8L 5IHUL 4N0UA 3ARFB 4D0CB 5JDSA 2EDKA 3SGKA 2LU4A 4KK5C 3FMGL 3LEYL 2I24N 4XPBL 1IC4L 1RULL 3MO1A 1X6LA 5DJ2A 3Q5OA 4M6MH 1CDCA 1U8LA 1U8QB 3HZVB 4MNHA 2QEJA 4X5WA 4HJJH 4U1IA 1NLBH 4N0FB 2DQEH 3TA3D 4R96A 4U6XA 2QQKL 2XFXA 3LDBB 4CL7A 3L7EA 3QEUB 3ZTJH 5B39A 4MD5B 4UILH 5CBEA 1U6AL 1N2RB 4WHDA 2Q7YB 4Y2DB 4Z7WB 3O3DB 4ZD3L 3ZKSD 5TQ2H 1VACA 3IDJA 1ERNA 5HHQB 4KGJA 1BJMA 4CMHB 2B7DT 3TPKA 1C5CH 1UZ8B 3O2DH 1MLBB 3WFHA 1MNUL 4P0DA 1F90L 3FOMB 2ZJSH 3KS0J 2IFGA 2XV6B 3VG9B 5KVDH 4UMGA 1CCZA 3Q1SL 25C8H 3R0NA 2GSGB 3NIFF 1EJOL 5F6IC 5I1LA 4X4ME 3FONA 5AUMB 1V3KA 3MCLH 1ONQB 3BGAA 1I1AC 2Z31A 3QIBA 5C0EB 1SM3H 2HTKD 5IMOB 1CFTB 3FQUA 3MRPB 3NMEA 4NUGL 2MCPH 1DUYB 4IRJA 1RZFL 4RX4D 2R0KH 1F6AA 4DZBB 4YE4H 4QRPB 4BFBD 4OD1H 1INDL 5IB5A 1ZA6A 3ARFD 4PGDA 4ZNEE 1IKNC 1TZIA 5T3XD 4NO0B 3Q0HA 3CFEA 3BKCL 5DK0A 4K3EL 4NN6B 4FFZH 2OZ4H 4OCRL 5HHOD 3R06B 4PIRF 2Y9RT 5HHXH 4JM2C 5TH2B 1KTDB 3QIWD 4F57H 4OT1H 4NRXA 2LTQC 7CGTA 4MNGA 3VI3E 5ICYA 3I50L 3L9RB 3Q6FB 3QXAB 3CLEH 5FYJD 3TGXA 4QRTB 3V4PL 3TBWB 3U1SH 3MLTB 2ZWLT 1AXTL 5M94B 3HRZA 5DQJA 2OR9L 5B38B 1R5VB 4HK3N 4OCYH 4ZO6A 1P7QB 1L7IL 4KV5F 1JNNH 1OOAA 4XBGB 2P8LB 2FH8A 3MRDA 4RAUA 3BDYL 3FAWA 4H8WL 4ZO8A 3HS0B 3REVB 2EDQA 4N0CC 4X98A 1MELA 4PJXF 2I9TA 3QG6B 3GSRA 5HYQA 4XAWL 4C59B 2VQTA 4C56B 3QUZA 3GSQA 5DUMH 4OUOA 4CDHA 3OMZA 3VFVB 1I7UB 3P30L 2AV1B 3ZKNC 1X5HA 2QLVB 3B9VA 3LRGA 3MLUL 1WZLA 4XWOC 3IXAA 3QUYC 1TZGH 1YEEH 1CFVH 4U1KA 3RUGB 1IAIH 4R0LC 2VXUH 3KJ6L 3OV6A 4K7PX 2XXMB 2R2BA 2RQ8A 4QHNA 4TUKH 4PRNB 4Y4HC 5EPMB 5D5MF 1LD9B 5CIPA 5JA8B 4QRRA 4YEEA 3X12A 1A2YB 1QO3A 5KTEH 3BEVB 4JM4L 5T3ZE 1AD9A 1UH4A 2DQEL 3WDIA 5I30H 2N56A 1CDBA 3SDXA 1MFNA 2W07A 4XCFH 3IETA 5BO1L 4DVBA 3P9MA 3D6GA 1HSBB 3BWUC 3RY6A 4QOKB 3HZYB 3V6FB 3LMJL 1BBDL 5C0FB 2J4WL 4UV7L 1BLNB 3VRIA 4FQ1H 4P5MA 1QNZL 1J1XH 1C5CL 1MPAL 3MLYL 4K7PH 3G6JB 5EU3B 5CD3B 3ULVD 1YQVH 4OGYL 4FQIH 2NXZD 1HI6B 5JW4M 3O2VH 3KPPA 2FATH 1NAMH 3GMLA 4RGNC 3TYFB 2I5YH 5INDA 1D5MB 3OXSA 1P7QD 2IAMC 5EZJB 2NNAB 2H9GB 4NUJB 4OFKA 1AGFA 4PJ5E 5GGSY 4TOYH 2B5IC 1BM3H 2AW2A 2FWOB 4JFOA 1DVFB 2E9WA 3CFDA 4L4TA 3O11B 5ACMA 3NCBB 3QQ4B 1R24A 4XBEL 1KJ2L 1H0DB 3NGBB 2PYEB 1W72L 4PREB 4C56D 4XCYA 2MOVA 3HZKB 2FEEL 4MZ2A 1E27A 2NTFB 3H0TB 2AJYH 3DMMC 4OD3H 4OLXL 4APQC 4JR9H 3DHMA 4PJHF 4Q6IC 4WHTB 3ZL4L 5JORA 3F5WA 3R8QA 3IDGB 2ICEB 3DUUB 3TBYB 3JZ7A 4XCCL 4GO6B 3ZKXC 1FV1A 1A3RL 5JIPA 5KN5A 4U1MA 4RMQA 5HGAB 5L88L 4YFDB 2R23A 5F21B 3DARA 5EUOB 4GJTB 2J8OA 4HIHA 2K3TA 4DUVA 4WWKB 2E6PA 3PJSB 5GS1C 5KVGH 1T83A 5C0IA 4LLMA 2R4SL 2ESVB 5J12B 5HDBF 1ZK9A 4LF3A 5F71A 4DUXA 5LGKA 4GRLB 4W6YB 3AB0B 4H5SB 1I8LC 4UDUA 1E28A 4WENB 2FGWL 1DR9A 1CICD 2DRUA 4QGTA 5C0JA 2EDDA 3QZWG 4PJAF 3RWIA 3UXFA 4QOKD 2CPCA 1OL0A 4EI6B 5C0CB 1NCTA 1N5AB 1AFVL 5DJAA 1KGCE 2NXYB 5AWNH 3KPQA 1A21A 3O4OB 1FVCB 2OJEB 1C5BH 5GRXG 1BD2E 5E2VL 5JA9A 3TA3A 3KG5A 4XP1L 5D7IF 3KNBA 5C86A 2X4QA 3OKEA 1CD9B 4JLRB 5IB1B 1DQQA 4M3KB 4X6BB 4GQPH 4YNYB 2P5ED 1SJEA 3E8UH 5IB2A 3WMSA 1MJ8H 4ODBD 2ARJB 5CCKL 3G6DL 3MXWL 3FJTA 1LP9E 1BIIA 1DZBA 2ADGB 1ACZA 3CFBA 2BFVH 2PYED 3MRFA 4LQ1A 4YHYC 4H1LG 4NO2B 2EKSA 4TPRH 3KPOB 5JUEL 1NFDA 4ZOEA 4BUGA 4Y0GA 3RL1A 1U93B 4GMTL 4ETQB 2HH0L 3VFUA 4D9LL 1NFIA 2VXTL 5IFJA 2G60L 4HQQL 4YDVB 2VR5A 3QFJB 3NA4A 4TYUA 5C9JB 2HYMA 4GLRI 1CGSH 3MROB 3LOWA 3W81A 5D2NB 2ORBL 4KPHL 2CXGA 3SGEH 1OAKH 4AM0B 4GQ9H 2X44D 3D85B 4RX4A 3JWOL 2EIDA 3AROA 1N59A 3T2QA 1DL7L 4XMLL 5EUKA 4GRLD 5EZOL 3ARFA 2DKMA 4LEXH 4D0CA 4JQVA 4NKDB 3KYOA 5ETUB 3NZ8B 4PRHE 5EOCH 3EOBB 2G5BB 3T0VA 3TT3H 4LOUC 3LRHA 1U8QA 3HZVA 5ACLA 2NXYD 3RNQB 4N0FA 2VKXA 3CGTA 1UQSB 4HWZB 2BSRB 3WDJA 4YQXL 5HVWA 4NQUA 3QEUA 1S7QB 4MD5A 1N2RA 4JRXD 2BY0A 2Q7YA 1JK8A 3H3BC 4Y2DA 4Z7WA 3O3DA 3SKMB 3BYTA 1FCGA 3BHBB 3LQAC 5HHVL 4F33B 4YDJB 1RI8A 3H8NA 3VFGL 1UZ8A 3L3OB 1RZ8B 4MCZB 1MLBA 1KCLA 2HRPL 2WBWB 1TJIL 2JKXA 4Y4KC 3RHWK 3FOMA 4CVUA 1KACB 5HI4C 3I84A 1UCBH 5BMFL 4NZDA 4ODUB 3V95A 4IRSC 4XMKL 1UJTA 1KF9B 4KJWC 2GSGA 3N85L 4RWYL 1G84A 4N5EC 3O8XB 5AUMA 1R5IB 3DBXB 2QSCL 1GOGA 3PDOB 4N68A 1ONQA 2AEIT 1TQBC 4Y1AB 3HMWH 5A2IH 3QFJD 1YYMH 3ISWA 5C0EA 4O51B 5IMOA 1CXLA 2LU7A 3IDYB 4OI9A 1CFTA 3K7UA 4Y5XB 2DTSA 4K71C 5LGHL 3MRPA 1EA9C 3QO1A 2V2TB 1OD9A 5CGYD 3D85D 1CLOL 3LEXB 4DZBA 3R8BB 2RHEA 4KK9D 4QRPA 1XGTB 3LIZH 4U49A 1IKFH 1CL7H 1OAXH 1CZ8L 2VDNH 4NO0A 5EO0B 3VFNB 3MFFA 3PHSA 3GKZA 2WANA 3R06A 5JOPE 5TH2A 1KTDA 2OMBA 3GRWL 4I9WE 4HIXH 5JMRA 3Q6FA 3L9RA 4XP4L 1KLGB 4QRTA 3MNZB 3TBWA 4LP4A 2GK0B 4ZDHB 4DWHA 2BY2A 3NIFE 3ZYJA 4X8JA 3HAEH 4HPOL 1P7QA 2JF1A 4RGNE 3WS6A 3PL6B 4XBGA 2P8LA 2BXZA 2DOCA 1XGPB 3U82B 5IBLD 4XNYL 4YBQC 1RUQH 2ED7A 5FYKH 4BSVB 3REVA 5BVPH 3LZFH 1V3LA 3QG6A 2PO6D 1MY7A 3MRJB 3UDWA 4C56A 3DRTA 3RKDD 1FLRH 1VDGA 3SDCC 5KSBF 5LWYH 1NCDH 1TNMA 3MOAL 5EU7C 3VFVA 4YXHH 1I7UA 2I9LB 2AV1A 2MPAH 1KFAH 1T7VA 3TN0C 5BV7B 3RUGA 1QR1B 3EJYC 3DVGB 5DEGB 1DLFL 1LEKB 3QIUC 3V52H 3WUWB 3TWCL 1NGXB 1X5KA 3B9KB 3RGVB 4LBEB 4PRNA 2MFNA 5EPMA 3SE4A 4H0IA 3B4NA 2H41A 3LHPL 3TT3L 1JZ7A 3S8WA 3B5GA 3O9WB 3VXUD 4YXLL 2IBGA 1FRGH 1A2YA 1QQDB 2X40A 3BEVA 2R1XB 1VGEL 2FYYB 4R26H 3LN5A 4UB0L 2W59A 4EUPB 4KV5E 2PXYC 5DSCB 1KPUB 2OS7A 2X41A 1V7MH 3M8OH 1HSBA 4Z0BH 4QOKA 3HZYA 3V6FA 2DQDL 1QACA 4J3UA 5C0FA 3BN9D 1BLNA 3O3BB 4PJXE 4PV9B 4LLYA 4LQFH 2DMCA 2W9DH 3G6JA 5CSBA 5EU3A 5CD3A 3CVHB 3V4UH 1HI6A 5EBMB 2X89D 1B4RA 3IF1B 4JB9H 3TYFA 3IRZA 5E5MB 5GS0H 1D5MA 2XZAL 3K3QA 5M95B 1YMMD 5A3ID 1EV2E 5EZJA 3PL6D 3S96A 2H9GA 4NUJA 1V7NH 1IAII 2AABH 2J5LB 3NZHL 2QQLL 2E27H 5CJOH 2FWOA 5KSUB 1CXKA 3O11A 5FXCH 1HDMB 4NFBA 2Y6SD 3QQ4A 3RY5A 2EIBA 5D5ME 3MLVL 2PYEA 4PREA 3MBXH 4ZPVB 1MCFA 3S88L 3N50A 2NTFA 3WIIL 2AP2A 1G0DA 4WHTA 1A7PH 4PRAB 3IDGA 2ICEA 5C0ND 3TBYA 1MFBH 1G6RB 4U3XA 1G7IA 4U31A 1G7QA 2ENSA 4YH6A 2A77H 4O2CB 4OLWL 4ZO9A 4BZ2H 4LCWB 1AQDB 4PJ9B 1FC1A 2AVGA 2EIEA 4N90E 5HGAA 1YA5A 2PW1B 3ARWA 3RGVD 3I3EA 3B9KD 5C0BB 5EUOA 3U7WH 2HFEB 2IGFL 1QFHA 1SEQL 3NAAL 3O9WD 2XTJC 1D7FA 3EO9L 3PJSA 4G9FE 4U7MA 3DX6B 1CG9A 4GRLA 3NPSC 3KPRB 4H5SA 3C6LB 1X5AA 1NGWA 4V1DE 4XX1E 1A8JH 5CJQL 1YEHL 2Z35B 4EI6A 5C0CA 1N5AA 5HI5D 2GAZB 5H94B 4P2RE 1RK1B 1FVCA 2OJEA 4L5FH 2DQCH 1LO5B 5I16A 1B6DA 4XPHL 4GRMB 3BAEH 1J0KA 3VFSB 2BNRB 4JRXA 4KKCD 2WP3O 4PJHE 3D0LB 1NGZB 4MMXC 1K6QH 4JLRA 1II4E 4XVJL 2QHLA 3QULB 1RUAL 4XXCC 4YNYA 4LVNB 4OZIB 5GJTL 5EN2B 4HKXB 3CZFB 4G7YH 1A7QH 1X4XA 5CILL 4NCC1 5EFIB 3EBAA 4NO2A 4JJHA 3GMOB 3KPOA 4XC3L 3NCYP 1UH2A 1XEDA 5HDBE 4ETQA 1NSNH 4K23L 4G80B 4WV1B 4N9GB 5FUOH 4FMKA 3WFCL 2OI9C 3QDJE 4Z7VF 1DBJH 1JPGA 3QFJA 2ZKHH 4PJAE 2Y25A 3S34L 5ALCH 5C9JA 4XVUD 4PJGB 4AEEA 1OT1A 1JGLH 3B2VL 5CGMA 5D2NA 2O26U 3FN3A 3O6FD 4AM0A 4WEBL 3EO1B 4Y5VA 4KKAD 2PCPB 3M8OL 2ARJQ 3D85A 1OAZL 3QR2A 5ALBL 5D7IE 4N8CH 2H2SC 1ACYL 2XQYK 3C6LD 4Z78B 4NKDA 3NZ8A 5J0BA 3NACL 4J4PD 1BQLL 3EOBA 4QXGL 2G2RB 4R6UA 2G5BA 4HXAH 5D71L 2CH8A 1D6VL 1CVSC 4XVSL 1IC5H 4LPTA 3PV7A 4O2FB 3RNQA 4RMVA 2BSRA 4N1EA 1S7QA 1WCQA 2O61A 1X4ZA 1Q0YL 2VZTA 3C2AH 3SKMA 3BHBA 4F33A 2UZXB 4YDJA 5D7SH 4NWTH 5DEZA 4LPWA 2D3VA 3L3OA 1KENL 1RZ8A 1CU4L 4MCZA 3G04B 3TT1H 3S35X 4D3CH 4HH9B 1FZOB 3TO4D 3OKMA 1C1EL 4ODUA 1P7HL 3IRPX 1H15B 5F96L 2QQNH 5B3NA 4GBXC 4S1RH 4YHPB 3O8XA 1R5IA 2DLGA 3DBXA 3PDOA 5EU7E 1IQWL 1MCNA 5D1QD 1QSZA 1S5IH 1I9IL 4O51A 3MX0A 5B21A 1Q9KB 2P5WB 5JXEC 3BKJL 4Y5XA 1O5DT 3T2NH 1OLZA 4I13B 1FYHB 1G9NH 5C09D 3LEXA 1XGTA 5C3LD 1I7RB 4Z7UB 2ZG3A 1KELH 4XP9H 4PJ8B 1FNEA 2WUCL 5EO0A 3VFNA 6FABL 1K8IB 4HGKC 2F53E 2WQ8A 4ZXBC 1EGJH 2CK0L 3O6LL 3ZE2F 1ORSB 3V5KB 5DHYB 2P48B 2VXQH 4WFGD 2VDRH 2V9RA 4X7SH 1A0QL 3SDYL 1A22B 4KQ4H 4S0SD 3MLRL 4PJFB 4XWGH 1KLGA 2PTTB 1LEGB 3MNZA 2W0PA 3HRPA 2GK0A 4ZDHA 3MRQB 1AY1L 2X89A 4BKLB 1YPZB 3C5ZB 5D8JL 3V0WL 3ZE1F 4MXQC 2WINB 3CDCA 4MXWH 2Z91A 4WJ5B 3E1F1 3PL6A 1XGPA 4IOFD 3L3DB 3LS5H 4AIZA 2C3VB 2GITB 4LRIC 3P4OA 3CXDH 5F70A 5HBBA 3L3GB 3W0WD 4BSVA 2A74B 1P6AB 1T0PB 4BZ1L 2XY1A 5HVFB 1SHMA 3WLWC 2YPLD 5IROC 3WS3B 1EIBA 1XF2B 3NCJL 1DANT 2H1PH 3QPXH 3OAUH 3L5JA 4JG1H 2I9LA 4D8PB 5B22A 5IHLB 1FFOB 1CL7I 4YC2B 3C08H 1ZWIB 3C09B 3K46A 2YD9A 5DMGC 1TTFA 1QR1A 1EPFA 5DEGA 3DVGA 4PJBF 1LEKA 3UBXG 2P5WD 3WUWA 5GISH 4U7SA 3GBLA 1NGXA 1RZJL 5I1HH 3RGVA 3B9KA 1EH9A 4LBEA 5JQ6H 3C87A 2AQ3A 5FDYA 4L9LA 2GJ6B 3O9WA 2BOCB 4X7CC 4HWEL 1MRCL 1YDPB 1QVOB 5D7JB 3K80A 1I8KA 1QQDA 2XTJE 2ZZUT 2MMXA 4NKMB 1JP5A 2R1XA 2FYYA 2VISB 8CGTA 1EAPB 4EUPA 1IGTB 3NFSL 2VZVA 1H5BB 1EBAA 5DSCA 1KPUA 2MCG1 4BQCA 2OR7A 4H8WC 3IDIB 2X2YA 2XY2A 4ODXB 4HFUH 5D7SL 3O3BA 4PV9A 5FB8B 1J86A 1TIUA 3CVHA 5KSBE 5CAYB 4Y16B 5EBMA 3IF1A 3ARTA 4TQEH 3N9GH 2ZOLB 3EDEA 3PV6B 5E5MA 3SN6N 2VIRB 2OL3L 1MF2L 2R69H 2YZ8A 2G5RA 3KHOA 1I8MB 5IV2B 2GEEA 2D03L 2E5EA 2I26N 5KSUA 3IFNH 1HDMA 1NC4B 3PWNB 2O5XH 5DZLA 4J8RB 4YDIL 4AG4L 5IT2L 2P7TB 4ZPVA 5FGBA 4OQTA 3J8F7 3IS1X 3EDKA 1CYGA 2BMKB 3TCXA 4UI2A 1LO2L 3GHEH 5DMIH 5I2IB 1G6RA 2ZCLH 3S35L 4KQ3H 4O2CA 1NBZB 1BBJA 4LCWA 3UC0H 5ADPH 1AQDA 1LO0L 2DICA 4PJ9A 3HNSH 1TPXB 2PW1A 4ODHL 3BDXA 4ZAKD 5C0BA 1ZVYA 4OKDA 1FNFA 1EGJL 2DLFH 2FECL 2HFEA 2BRQA 1JPSH 2VLKD 3OZ9L 3KXFD 5FUCC 3E2HC 2BNQB 3RZCC 4LSTH 2DM4A 3QT2A 5D7JD 3QUMB 5T5FH 4UAOB 1MCIA 3DXAE 1HZHL 3BRGC 1HXMB 4BELD 4WY7H 3C6LA 2XA8H 4JZOB 4LU5L 4J4PA 4PB9L 3KPSD 1FORH 3GNMH 3JV4B 1WEJH 5DVOA 2VYRE 3CVIH 4Q58C 4XB7A 2Z35A 2WSKA 3MV7D 2GAZA 5H94A 3IVKB 4HUVA 4KDTC 3EGSB 3SCMC 4KMTL 4NFCA 3RKPA 1AXSB 1LO5A 4U33A 4PFEA 4GRMA 1U3HD 5E08L 2ED9A 4K9EH 3VFSA 5IB4A 3D0LA 1NGZA 3CMGA 3AUVA 3TH4T 2VDOH 1GGIH 4ZQKB 3GIVB 3QULA 1QRNB 1FJ1B 5C70A 3DURB 2X9XA 4JG1L 5EN2A 1UM4H 2EDYA 1NC4D 1IE5A 1NGQH 2Y07H 3EHBC 3MXVL 3LSOB 3F6IA 5EFIA 3UTTB 3GFUA 2XYCA 2NYYC 3KYAA 3GMOA 3KLDA 2VLRB 4DGYH 3R4DA 4QYOB 3FB8B 4HG4J 2YD4A 5IHBA 4BSWB 3L1OL 3WNLA 5E6ZA 4N9GA 2VO5A 4W6XB 3ARDC 3TEUA 3SDDB 3MV8D 5A16B 1RJZA 4M7LT 3VCLA 3WHXB 5JIIA 4ZUSA 3E6FB 2OM5A 2J8UB 5CP3A 4EDXB 4PJGA 2ICWB 1TZHB 1WLHA 3CVHL 2W9EH 4NKOB 2BNQD 1TVHB 5DD0L 2B1AL 3EO1A 1T89A 2PCPA 3NFPB 3N0PB 1V3JA 3DWTA 4TSAH 4DKEL 5BZDA 4YDKH 4S1DD 3HHRB 4Z78A 3SQOH 2YUVA 3QEQB 1JJUA 3SGDI 2GI7A 1I85A 2D7QA 2G2RA 2UUDH 1Q38A 2EE6A 5IWLA 5GRVK 1CTOA 1PLGH 1T04B 1T80A 4WIQA 3B2UC 4O2FA 1CLZL 1WZKA 4YFLI 3TZVC 4B53A 1J1OL 4OIIL 3WXWH 2APTA 4K94H 4Y5YB 4PS4L 4L8DB 2PUQT 4DVRL 4JQXA 1F4XH 4KVCL 4ZYKB 1Z3GH 1QRND 3NTCL 4WUKH 1QSEB 4HBCH 2J88H 4TVPL 4Z7VE 5D1ZB 1OSPH 4XNUL 1YQ2A 2C4FT 3G04A 4YHKL 1JNLL 5DJXB 4HH9A 1FZOA 4YK4B 43CAB 1JGVH 1CF8L 3UTTD 4NM4L 4EBQL 1YEGL 2F58H 5ADOH 3BVNA 1MWAB 4RFOL 1J7VR 2R39A 3TJEL 3JWOC 4HJGB 2VLRD 3ARBC 3NCFB 4YHPA 4OJFL 4M9PA 1C8PA 1FSKC 3SDDD 3UZQA 1YY8B 2F19H 3GMMB 5F1KC 4JZNB 4QXWA 3WIHH 1H3XA 3IDUA 2IPUK 3FL7A 1FYTE 1Q9KA 2P5WA 3V0VB 3MLSL 3GBNH 4RISL 3HI6H 4WFEE 5DLMH 1IGCH 1L0QA 4P3CH 3VXMD 3RVUC 4PJ8A 2ZPKL 3TNMB 1K8IA 4ZS6D 4IOIB 3RTQC 5IFAH 4MA1C 1ZT4B 4IS6B 2EYRB 5DHYA 3QNXB 2AGJL 2B4CH 1PKQB 4JO4L 1XGRB 3OL2A 5DD1L 4PJFA 1QPPA 4K3JH 3QAZC 2PTTA 2FCBA 3MRQA 2DM3A 4BKLA 1YPZA 3C5ZA 3DUSB 2WINA 3I9GL 3QXWA 3KDMB 1QSED 5IG7B 1KN2H 3L3DA 4LLAA 2BK8A 2C3VA 2GITA 4JHWH 1WQVT 1MCEA 1IRAY 3L3GA 2A74A 3ES6A 4DFIA 4FFVC 4ODVH 4G8EB 2DF3A 2DQIH 4MAUL 3CU7A 3GHBL 4FZEL 1XF2A 4I18B 1KIUA 5C1MB 1GOFA 4CU7A 2VKWA 3VH8B 1FFOA 4HS8H 2ERJB 15C8L 1MCRA 1ZWIA 5I9QC 4EIGB 3IFLH 5DFVD 4WTWA 1E6JH 3ZE2E 1DJSA 5CIPH 1YNKL 1B2WH 2WWMC 2HFGH 4OFDA 3M07A 3GSUB 4ZAKA 2VLKA 3L3HB 4F3FB 2GJ6A 3KXFA 3G9AB 2BOCA 1YDPA 4X6CF 1QVOA 3WFEH 4M7JH 3P11H 5D7JA 5FUCE 4IMKC 2UWEF 1HILB 4N0YL 4BH7B 4NKMA 5DHXB 4NKIH 5L2JB 4ZS7L 1EFXD 1KC5H 2VISA 3ZE1E 1OAUH 1JGDB 1MY5A 1CN4A 1IGTA 1H5BA 2YPVL 4WFHD 3FFCE 1YZZA 3FB6B 3IDIA 4MAYB 4MQXD 1CGXA 1B6UA 3WIFB 5K59F 2X9YA 4ODXA 3RBGA 2ZP0T 3B3IB 4I3SH 4ZUWB 1KCVH 5I8KH 2CRZA 1FDLH 5FB8A 1B0RB 1A5FH 4CDGC 4KVNH 1JFQH 3KYKL 5ACZA 2AEPL 3PV6A 4OLUH 4P59H 5LCVL 3PGDB 1FE8H 4M6OL 1I8MA 4LSVL 5I8EB 4PJBE 32C2B 3GMPB 1GAFH 2Y23A 4KAQH 3C5SB 5GGVL 3ZTNH 1NC4A 3PWNA 2HVKB 2FHBA 4NQXB 2QSTA 4DKFL 2VZ1A 3BKYH 3HCVB 4J8RA 5KBNC 1I3RB 1A14H 1NBQA 5C0GB 2KH2B 1INQB 1BQHG 2P7TA 3B83A 2KKQA 4OF6A 1AD0B 1A9BB 3TM6A 3FAXA 4IRZH 4P46C 1HNFA 1UG9A 4F7MB 4JPWL 5EZLB 5F7EL 3LAFA 2ZUTA 5I2IA 4JRYB 4HCRL 4S1SL 3C60C 2GTWB 1NBZA 3ZKMC 1U3ZA 4WTZA 5E00B 4X7TB 3UZEA 3EZ8A 1C7TA 3TESA 3FOLB 1CFBA 1HOCB 5DQDH 5IHZB 2BNQA 2RFXB 4LAQH 3UBXB 2JCCF 3QUMA 2I60H 2V2XB 1NQBA 4MA8H 3CFIC 3MNVA 1HXMA 2GSIA 3VJ6A 1VSCA 3AMKA 3Q6GL 3T09A 5JPMB 2OYPA 4JZOA 3TPUB 5CGTA 3JV4A 1HXYA 1V3MA 5SV3A 1AGEB 4DW2H 1FGNL 3ARRA 4MAYD 4FG6D 3ZSTA 4M7ZB 1AQKL 5F7LB 3EUUA 3EGSA 2NY0C 4OM1H 1AXSA 2C5DC 4JFED 1JF1B 4OKVB 1OM3L 1OPGL 4I0PB 1F2QA 1JPTH 4ZQKA 3GIVA 4JO2H 1QRNA 1SBBA 4KRPD 1FFNB 1FJ1A 3DURA 5E2WL 1NMBL 5D93B 2IQ9L 1BQUA 1HSAB 2Z8SA 3N1FC 3S6CA 1GZQB 1RIHH 4DN3H 4UINH 4LHUG 4OLYH 3O6MH 3LSOA 5JR1L 3RRQA 3UTTA 1MQKH 4EQ2A 5HYFA 3MFGB 4JVUA 4TSBH 4FNLH 5TFSL 2VLRA 2YMXL 1QLRB 4QYOA 3FB8A 4GOSA 5LXGH 1I3GH 3BD5A 5J13C 3EFDL 3JWDL 4JRYD 4WW1A 2FJFB 4P99A 3SDDA 1KB5B 5FO9B 2XKNB 5A16A 4GAYB 4QF1B 3O2WH 4R8WH 4Y19E 6CGTA 1AJ7L 1CIUA 3E6FA 4CU6A 2C9AA 2J8UA 3D9AH 3KPNB 4EDXA 4X6EB 2ICWA 2APWA 4K3DL 3KPLA 1OAQH 5E2UL 1IQDB 1ZANH 2H32B 4H26B 2C26A 4NKOA 1G9MH 1TVHA 4CW1B 2XZQH 4NQEE 4PJ5B 3NFPA 5T3XH 2NY4C 4R4FL 3BQUB 2NW2B 4FABH 3DUHA 1HWGB 2NX5B 3TBTB 5DFWH 1U8MB 4MLSA 3BYYA 3VXMA 3PP3K 3QEHA 4OZ4B 3UTQB 5CUSL 3QEQA 5ISZE 4XB8A 1S7SB 1HHKB 3K81A 3ARGC 3LN9A 4Y4FB 5FYJH 2DBJA 1T04A 5D6DC 5CSZB 4HT1H 1VA9A 1MHPL 5E9DE 3ULSB 1FLTX 1F4AA 3O4LE 4HGWB 4M48H 5J3HD 3EOTH 4XNMB 4OCWH 4Y5YA 1VKXB 4UT7H 4XNZC 4I0PD 4LCIH 4KJPD 4DQOH 4G6AD 3UTZB 4MD0B 3GJFH 1QSEA 5D1ZA 1WVZA 1LVEA 3SBWA 2BCKB 1U8NB 3WKML 1QEWB 4N1HB 5IVZA 1FNGB 5SWSB 1NL0H 1UM6H 5L2KD 3M17B 3FB5B 3LH2H 4HJGA 5AZ2L 4AENB 3WN5C 5DJ8B 2B1HH 2NZIA 4O4YL 4KFZC 1BD2B 3GMMA 2E6JA 3EW3B 2XOTA 3NFNB 4JZNA 5D7KE 2JJSA 3KLHC 5GS0C 1PG7H 3V0VA 4U1SB 4F15C 1XGQB 1XIWC 2X4TB 4G6KH 2HT4C 2NZ9C 2WBKA 2NX5D 1LP9B 4KTEL 1X3DA 2Z0BA 5JW5B 3MODL 5GGRA 1V8HA 3TNMA 3V8CA 5IR1B 3SJVD 4Q9BA 1ZT4A 1YUHB 1FGVL 4IS6A 1E4JA 2EYRA 3QNXA 5FM8A 1PKQA 5D9SA 3ULVH 3OR6B 5F6IB 1XGRA 2EDRA 2MKWA 5CFHA 4RRPG 1Z9MA 3RDTD 1N6QH 1I1AB 3UO1L 2Z8WC 1DBAH 4ELMA 4M6AA 1SBSH 2WBJD 3DUSA 3VXSB 2VERN 2FLBT 1QSFB 3KDMA 5IG7A 5DT1H 4U7KA 4DOHE 3T0BA 5CEZD 5L8LB 3QDGE 1Q0XH 4G6ML 1KYOK 5F7KC 2YRZA 3ARED 3P2TA 5SWSD 4G8EA 3TBVB 1AE6H 4PRHB 1PJ9A 3CK0L 2XQBH 3MLWH 3PWPE 4I18A 3VWKC 4LLQB 2DI8A 4MX7B 2OK0L 3FO9A 2FX8H 3VH8A 4JM2B 4YHIB 5FUZH 4L3ED 5F9WC 2LTQB 2NY6C 3WYRA 4DFHA 5JHLH 3OJVC 1JI1A 2DM2A 3GSUA 1BJ1H 3MUJA 1A7OL 1EHLL 4F3FA 4NT6B 2R0LH 4KJQD 3LKSB 5C08E 2Q76B 3SKJL 5IVXE 4NZUH 1HILA 4BH7A 3U79A 4LHJB 5L2JA 4F9PC 5AD0B 1JGDA 3FZUD 1GRWA 3THML 1NDGB 4KJYA 3VXOB 1MWAL 4MAYA 2A6KB 5E99L 5BXFB 4X4MA 3WIFA 1F3JB 3M45A 1BZ9B 1P9MA 3B3IA 1NCWH 3FO2B 3QXDA 1B0RA 2EDTA 3QUYB 1HWHB 3CMOH 4R0LB 3VXSD 3LV3A 1T1XB 3W2DL 1QSFD 1XCTB 3RWEB 1SJXA 3LH2L 2RBLA 3PGDA 2YUWA 5TPWL 3OAZK 1MI5B 5JPNB 1XF3B 2YD5A 3GMPA 4ORZC 3T4YB 1ZE3C 3C5SA 2DKSA 4X7DC 3GBMH 1DQMH 2DQTL 1MUJB 2HVKA 4NQXA 1QR4A 1GGBL 3HCVA 1I3RA 2E7MA 5C0GA 4B7LA 1UXWB 1INQA 3CLFH 5ESVA 4AEIH 2P24B 4KKBD 4X6CE 4Y8DC 1AD0A 3G5XB 1YEIL 2UWEE 3ROOB 5GGTH 4F7MA 2YXMA 5FHBL 5EZLA 4G7VH 3PP3H 5F8RC 4RWHA 1T2QH 4JM2D 4JRYA 5HXMA 1EUTA 3O3UN 2GTWA 4U1LB 1A6TB 4F8TA 2BNUB 5E00A 4X7TA 3CSBA 1A6UH 3B43A 2AJXH 3FOLA 4RGNB 1HOCA 5IHZA 1LNUA 2RFXA 5LG1A 2IAMB 5LGJB 1UACH 4OIAA 3UBXA 5GGVY 3MUHL 2ZNXA 2V2XA 4Z8FL 2B5IB 4U0RC 1OAYL 5FYKE 2DTML 4GS7C 4K2UL 4NC2B 1KN4H 3A6BH 2D7OA 2Q8BL 3FHAA 4QWWC 4URTB 4KHXL 4WI4A 5JPMA 1JUFB 1AGEA 3LN4B 4JFPB 1BWMA 2XPGB 1KSRA 5TF1H 5C2BL 3DMMB 4APQB 4FQQB 4F9LA 4Q6IB 4JY4A 4HS3A 2R9HD 2VOTA 4XWOD 3QUYD 1Q0XL 43C9B 1HQ4B 1JF1A 2C3GA 1HK6A 3ZKXB 4OKVA 1BF8A 2X1PA 1SEBB 4HPYL 4C83B 4I0PA 4Y7MA 3EIFA 1G9NC 4NGHH 4XHQA 4OB5H 1KJ3H 3WUZA 5H35B 1FFNA 2PR4H 4ZFOA 3JTTB 1MI5D 3IDNB 1SJHB 1HSAA 5GS1B 1GZQA 2AJVH 4F7EB 4WI5A 1BAFH 4TULH 4L29B 5AG9A 2HVJB 3KVQA 2LFGA 3EJZD 4HC1H 1QBBA 3MV11 2JCCE 3L3JB 4AMKL 1QLRA 4XI5C 3OX8A 2HLFD 3DI3B 2BJML 3AY4A 4PJXB 3N06B 2FJFA 1KB5A 5FO9A 1VPOL 2XKNA 4UT6L 4XP6H 2FJHB 2QHRH 4KK6D 4QF1A 5DC0A 4U1GC 2DDQL 1ZTXH 2YKLH 4PRID 3PQYE 3KPNA 4I0CC 2OP4H 5AYUL 1E4WL 3TVMC 1IQDA 1K3IA 1AGCB 2H32A 2Y36H 4H26A 3C8HA 5HI3C 4CW1A 5DC9B 4PJ5A 5IK3B 1PZ5B 2NW2A 3DYOA 4MWFB 1S78D 1ZA3B 5T1DH 5I19L 3E3QC 1K5NB 2NX5A 3RAJL 3TBTA 1JHLH 1P84J 3OR7B 5DI8A 4G6JH 4OZ4A 3UTQA 1UYWH 5D5MB 5IBTH 4WEUD 1OTUC 1WCBB 1RURH 1S7SA 1HHKA 1J0IA 4YHYB 4NWUL 1M7DB 4JFXB 3DMMD 4KI5C 4NJAH 5GHWH 4APQD 5F88B 2IG2L 1QFUL 3ULSA 2IAND 2EIZB 1NC2D 4XNMA 4GKNB 2VQ1B 4YFEA 1S7XB 1I4FA 3SE9L 3UTZA 4MD0A 3S37H 3ESUF 5L6YL 4G9FB 5DS8A 1OTSD 4P4KC 2BCKA 2A0LD 1U8NA 3OKKB 2EDFA 1QEWA 4P2OD 3TLRA 1FNGA 3PE9A 5SWSA 4LIQH 2EEBA 3ARXA 4V1DB 3M17A 4GXUM 3FB5A 3V4VH 3FTGB 3FCTB 3VGAC 4FQCL 2XN9B 4AENA 1OW0A 4LHUB 5DJ8A 2FH6A 5D6CB 4P2RB 4J23A 2CMRH 3MOBL 2OJZL 3HE6C 4X83A 5HHME 2YPKB 3V2AR 1J5OH 1PD6A 2A2QT 1JZ6A 3ECBB 4GXVH 5IVNA 4X0KB 4LNVA 1UKQA 4U1SA 1A4KB 3LS4H 5MERB 1PGRB 5I1EL 1BECA 1XGQA 4N8PA 2X4TA 1JYWA 4UTAL 4I3RH 3SKUD 3O6KL 3IJSB 3IU3B 3HC3H 4G6FD 1LP9A 2P1YA 4MA7H 4YUEL 5T3ZL 1BFVH 1FVDB 4Y4KB 2DJSA 5IR1A 4XCNB 3HPLB 1ZKAA 4ODSH 3MYJB 4MDIB 4WI9A 3B5TA 4P2YA 4IRSB 5J1TC 4KMQA 5FYLD 1Z9LA 3OR6A 4PGEB 3QDJB 3BZ4B 1TQBB 4PJAB 3QCTH 4PY7B 5DURB 3VFOB 1AGBB 4N90D 4D9QD 3VXSA 4OCXL 4GAJH 2AXJA 3B6SA 1YJDL 3BH9B 1QSFA 3E6HB 2W92A 5DJ0B 5DWUL 4G9FD 4K71B 3OGOE 4N8VG 4AJ0A 2E9IA 1SMAA 4ONHB 3NA9L 4LASL 3U2SB 3TBVA 4PRHA 4HKJB 2H3NB 2IH3B 4V1DD 5CKGA 1U95B 3OKOB 2HWZL 3S3SA 5DTFB 5BV7H 5DA4A 2XN9D 4NQCE 3DO3A 5GZOC 4P2RD 4MX7A 4LOUD 1FFRA 2DQJH 2Y36L 4JM2A 4K9EC 1RJCA 3SKOA 5DVMA 4F37K 2W9LA 5FA3B 4I77H 5TE4L 1UYWL 4FZ8L 3MV9E 1RVFL 1J0ZA 3RY4A 4EUPH 2ZCHL 2Q76A 2R8SH 3ZKQD 4FQHB 4OF5A 4MVBD 3GO1L 5M7QA 4YHLH 4X80H 2X4UB 4RDQG 1NBVH 5AD0A 3GSOB 3BGMB 3FQTB 3FHQA 1NDGA 2EH8H 4OUUB 2MKLC 4JY5L 3RQ3A 1NCAH 2EC9T 1QFPA 4IRSD 5DD5H 5E2TL 3ZTJG 5BXFA 3SDCB 1F3JA 4RGOH 3VGFA 4XPGH 1BZ9A 4ERSL 3V8OA 2DI9A 1HEZB 4M5YL 3FO2A 4FTVE 2OBGA 1LO3L 3TN0B 4OM0L 1AXIB 3H9HB 3QUYA 2VC2L 4K8RL 3U9PH 4R0LA 1QZ1A 4OLZL 1T1XA 5A2FA 4LSPL 2D4FA 3QIUB 1XCTA 1JMXA 3RWEA 3GKWL 3SGKC 1ZT7B 2A38A 5EO9B 1URLA 5JO5B 3HMXA 2EC8A 1IEHA 1MI5A 5JPNA 2R2CA 4LSQH 3KPTA 4OQTH 2DIAA 1QKZH 1NJ9B 1MUJA 1U8HB 3S97C 3WNOA 4UT9H 2F53B 1Q8MA 4OGXL 2GUOA 5CMAA 1UXWA 5JHDD 4KTDH 2BC4B 2P24A 3HC4L 1G6RH 2PXYB 4M3JA 4WHCA 3ROOA 1F2XK 1T5WB 5HD8C 1TITA 3S5LB 4UDTB 5IESH 2IJ0C 3QHFL 2O5YH 4OF7A 1BPVA 4GUPB 3HI5L 4K94C 2V6HA 1BREA 1G0YR 3IDMB 4U1LA 4V2BA 1A6TA 1VEPA 3E0GA 2BNUA 3RPKA 2ZCKL 3QO0B 3SE3A 1A6VL 3T08A 5DJZB 2VJXA 3MA9L 1N6UA 5ID1B 5JIHA 2ZUXA 4KZEH 3VW3L 2IAMA 5LGJA 2P42B 2BDNH 1MFAH 4GKZB 5HPMA 4UIMB 3P9WB 1N0XL 2E9BA 3MTRA 3IXTB 3E3QE 2P43B 2LABA 1LO4H 2CK2A 2VDKH 1CLYL 4M5ZL 1JUFA 1YECH 4WI2A 2CDFB 1N5YH 1IILE 4JFPA 2XPGA 1QHPA 4PPTA 3SDCD 1X4YA 2ZUQC 5K9JH 3DMMA 4APQA 1MFEL 2JK5B 2UZIH 4FQQA 4Q6IA 1JBJA 4FQJL 1TNNA 5FKPB 1NC2A 4M1GH 43C9A 4U3CA 3U0TA 4K3GA 2CR6A 4UTBL 3RNKB 1SEBA 1FH5L 2DLEA 4C83A 2Z93B 3QIUD 2AI0H 1QFWH 3W82A 2G75B 5H35A 5J89A 3WXVL 3JTTA 4Q6YA 3UJTH 1QLFB 3IDNA 1GC1H 1SJHA 2XTJB 1ZXQA 5GS1A 3DX9B 4NQTA 4F7EA 3BJLA 4P2OA 3BZEB 1FQ9C 2CRMA 2F53D 2AEQH 3NPSB 4I0KA 4L29A 1M7IB 4CU8A 1I8LA 2CKBA 4NHCH 2PXYD 2OX5A 2D0FA 3L3JA 1YY9C 3PXHA 4IM8A 3U0PB 1JWSA 1LK3L 1Z5LB 4Y2OA 1WFUA 1M6OB 1EZVX 5CP3H 2HJLA 4JFFE 4PRBB 1C16B 4P9ML 3PWLA 3WO4C 3ZMRA 1PEWA 4NP4H 3BP6B 5KSBB 5DFTA 3QI9D 3GK8H 2W65B 2GK2A 4BJLA 1XF5B 2VDLH 1I9JL 4MA3B 1X5YA 2C4XA 3OXRB 1BZ7A 4L4VB 4M62L 1PZ5A 5B3JF 2AJUH 1W2KT 2WLZA 4MWFA 2FLRT 4M43H 3X3GH 1K5NA 1OY3B 4F58L 2B0SL 5I66B 1MIML 3OR7A 5KSVB 3W39B 4FQLH 1RHHA 5I1IH 5E2JA 5D5MA 1RU9H 5E8DL 1WCBA 3MGAA 3U9PL 5KW9L 4FP8L 3SOBH 4LSRH 1A4JB 5FCUL 1TJHH 3UX9B 4P23C 3QDHA 4WCYH 1M7DA 4JFXA 5EOQH 1IEAA 4MNQD 4WO4D 4A6YB 4WI3A 4O02H 5F88A 3RWCB 5C8JB 2EIZA 4QHKJ 3CSYA 3NH7H 3FO0L 3ZYZA 1HQRB 2NY3D 2OI9B 4POYA 4RA0C 4GKNA 4ZTPH 2VQ1A 4TNWK 5IGXL 1FNLA 5I73C 3I3BA 5BZWB 1A7RL 1NFDF 1S7XA 1CQYA 2ZG1A 4NRZB 4WNQB 4R7DB 4KTDL 3P0VL 4OBRA 4EEEA 1MEXH 4G9FA 5TE7H 3A67L 4GMSL 2XTJD 1A7BA 3RY6C 5TE6L 4JKKA 1K4DB 5LJYH 1VERA 3DXAB 4BFGA 3OKKA 3VD5A 3DX8B 4X5XB 2NR6D 1S7WB 2XWJA 3U30C 4V1DA 4HAFA 2C3XA 1LE9A 1Z6JT 3FTGA 3EYVB 3FCTA 2MTPA 4HUMB 1KPRB 2XN9A 4YHOH 4JDTH 3RWDB 5D6CA 3P0YH 5SV4A 4P2RA 1MREL 1R0AH 4PP1C 2YPKA 4NQDE 2Y5TB 3O3AB 4AEHL 5LQBL 3ECBA 5T1LB 2CGRH 2FBOJ 3MREB 3L5XL 5INCA 1IC7H 2J6EA 4XXDB 4C4KT 3H9SE 1EMTH 4X0KA 1HN1A 3VFTB 1A4KA 5MERA 1WWWX 4L4VD 1KCUH 2VDQL 3DSFL 4KUCD 4PRPD 5T1KB 4BH8B 3IJSA 3CSPA 1KCSH 4KKLD 5EU4B 3IU3A 4RFEB 4IHOB 2YRPA 1I7TB 3Q5YA 4V2CB 4ZPTB 4Z7WF 1U91B 4Y4KA 2FD6L 4H88L 1WAAA 4XCNA 4O9HH 3HPLA 3MYJA 4MDIA 5EDXA 4HUUB 4IRSA 5F7HA 3DX7A 2BVEA 5ESAB 4H0HB 4U05A 4JPKH 1F3DH 3R1GH 1SMOA 1MCPL 4GBXB 4P49A 4PGEA 2XA3A 4KUZL 3QDJA 2LAGB 4O5LH 2Y06H 3BZ4A 2N7AA 1MCHA 4PY7A 2KL6A 1AGBA 2QQQA 2MJWA 3ULUL 4M7LH 1U8IB 1NCCH 3IAQA 1D5IL 1IGFH 3VXRE 3E6HA 4JFDE 1JZ2A 4N0UE 2D7TH 2R29L 1HIMH 1ND0B 3QXTA 4RFNC 1ROWA 2N7BA 3CXHK 1JN6B 3DXAD 3QCVL 4XHJC 3WNPA 2FL5A 4LLVA 5HDQH 3D48R 4ONHA 3U2SA 2O5ZL 1N0LA 3DVNB 1FIGH 2IMMA 3UYRH 3TA3C 4HKJA 5SWZD 2H3NA 1U95A 5JHDA 4R7NA 1MRDH 4W4NA 4OCNC 4ZXBB 4XMPL 4QY8B 3GSXB 4HWBL 1PEZA 2AK1L 3F62A 4JDVB 4POUB 4DK6A 5IP4A 5FM5M 5E95B 2R1YB 3QB7C 3GI8L 5IOPB 3NOIA 3MJ7B 3RZWA 5FA3A 5EC1B 3MJ9A 1SQ2N 1H3PH 1BVLB 3V5DA 5DJDB 5J7CC 3QWRD 2XXCB 4P3DB 4Z7VB 4UV4L 5J1AA 1NFKA 1I9RH 4HF5L 2VXVH 1GGUA 4FQHA 1BEYH 4JJ5B 5EU6B 1F8TH 4CVXB 2X4UA 4H20H 1RUKH 3GSOA 1ZEAL 3BGMA 3FQTA 5E5UB 2BVYA 1MLCA 2A83B 3U4BL 4C4KO 4D0BB 3LKQA 5BW7C 3VFPB 3SDCA 4UZGA 4GBXD 1KEMH 1FNSH 1OARH 2LQRA 1HEZA 2Q8AL 2X4RA 1LEIB 3FQRB 1T0NB 4LLUB 4BZYA 3FQNB 3TN0A 3H9HA 1P7KB 3MUY1 1FYTB 4UNTA 1G9MC 1CI5A 4O2EB 4JQVC 3QIUA 4NNXB 1WFTA 5F9OL 5CD5C 3AMLA 1ZT7A 3QDMD 1DBKH 4OSUH 4PJEF 5EO9A 5JO5A 1NCNA 3RI5K 3WCYA 3QIWC 1UWEL 1MJ7L 2DQHH 1AH1A 1NJ9A 2X5PA 5GXBB 2F53A 3OPZH 1UB6A 1YC7A 2BC4A 2PXYA 4ZXBD 5ERWB 3JTSB 4LKCB 1IJ9A 3S5LA 3F7VB 5C07D 3VU2A 2VMFA 4GUPA 2LVCA 1YEFH 2WUBL 4GT7A 3IDMA 1GXEA 3HFML 2P49B 1ADQA 3QISA 3QI9A 4X4XB 4JGUA 5HPOA 3QO0A 3QUMH 2V5YA 2VZSA 3I75A 5DJZA 2R0WH 4MXQD 5ID1A 5C71A 1XR8A 3CIQA 1N4XH 3QUXC 2E7LA 4GKZA 5MHSD 4YR6B 5EU6D 5HGDB 4TRPL 5J6HB 3IXTA 4K3HA 1OGAB 4ZSOB 1U3JA 1L7TH 3QG7H 4J3SA 1Q9OB 2HRLA 3GGWB 2LVEA 5DUBA 3WLWD 3I85A 3O45B 4W4OA 1KTLB 5LBSH 3INUH 3WKNA 2F54D 4LPYA 5JMOC 1CXEA 5HYJD 3HAEG 2JK5A 4IDJH 2VB5A 4JEGB 1KEGH 4JO3L 3IAGC 5FKPA 3T77B 1UGNA 3RX5A 1JHTB 5DMGD 1FYTD 4XPAH 4QRRE 2GCYB 5TQ0H 1RFDL 4GAGL 1EO5A 4R4BB 2Z93A 5I1GH 3WFBH 1E4XH 2BSTB 2G75A 3MJ9L 1T66C 5EH1A 4NN6C 1BF2A 3S4SB 1EHAA 3RZCB 3E2HB 1LGVA 5A2KH 3H42L 3FQXB 3D18B 2YRLA 3DX9A 1RIVH 2BERA 4ODTH 4WU7A 2V5TA 2JB5H 1XT5A 3MLZH 1Z9SA 3B8YA 3CDGB 3BZEA 1FAIL 4JHAL 1GCFA 1M7IA 5CWSB 4JO1L 5EUOF 1EVTC 5C0AD 1A02N 3FFCB 5JW4Q 2AXFB 4HXBL 3RVXD 4ENEC 4RA3A 2NXZC 3U0PA 1Z5LA 1M6OA 5EG6C 1IFHL 4PRBA 2UVEA 1C16A 2EDLA 1A7NH 1I9RL 1KJ2B 3SCMB 4DTGH 4BFEA 5ICZB 3BP6A 3S36X 3PGFH 5TDPB 1W72B 2DLIA 2W65A 4JHBA 1WZ1L 4ZFZB 2XZCH 2COQA 4MA3A 4GSDH 4TTDD 4L4TE 3OXRA 4L4VA 1U8OB 1IT9L 1N6VA 2OR8A 4XXCA 4MJ6B 4PJBB 4PRPA 5D7LB 1SY6H 5J06A 1WTLA 5I66A 3RU8L 5KSVA 1OGAD 4RMSA 5AYQA 1QFWI 1CK0H 2YA2A 5KS9F 4WUUE 1NGPH 1GIGH 1TENA 1HKFA 1UXSB 4ONFH 3T2OA 3B5HA 1J88A 3UMTA 1GGCH 3RWCA 2GW5A 5C8JA 3S36H 3ARDB 4FRWA 4G5ZH 4JKWA 1HQRA 4DN4L 5IMMA 5GRYA 1T20B 2X70B 1VFOA 4AZ8A 1Q9LB 4NRZA 1A3QA 4R7DA 4QTIH 5FFLA 3MRRB 1CICC 4D0DB 5I1DA 1E0OB 5DRNB 4RGMC 1K4DA 3DXAA 3DV4B 4TSCH 4YXKH 2Z31D 1P4BL 4GKOA 3PP4H 3DX8A 2XNAB 4X5XA 1S7WA 1F4WL 2VDMH 3BT2L 5B3JE 3EYVA 1KPRA 5F7NC 4DK3A 3RWDA 1CVRA 5EA0L 4X7FC 4Q9QL 2Y5TA 3O3AA 3AVEA 5LVEA 3SCMD 4OZGB 3UJIL 5T1LA 3F58H 3TZVB 3MREA 3AM8A 3VXPB 2RCSL 3VGEA 3MC0A 4PGCB 4XXDA 1D9KD 4FFWC 1RHFA 3ZDYF 5D4QA 1I8IA 4PJ7A 3NGBC 3QWRA 3MRGA 3CX5K 2EC9U 4G8IA 5C7XH 4BH8A 2ATKB 5D7LD 5EU4A 2EO1A 2XRAH 4IHOA 1NFDE 1I7TA 3MA7A 1EX0A 3SE8L 4GRWF 1D5XB 1DBBH 1AO7D 1ODAA 5L0QC 4ZPTA 5I76B 3GSNL 5I1CH 1U91A 3VDCA 4NHUB 1A6WL 2BZDA 5E94B 2NW3B 2CUMA 4Q9RH 4LSUH 4HUUA 1FP5A 2CJUL 4LVEA 4XRCB 3BUTA 5ESAA 3TP4A 3ARBB 4GBXA 3BKMH 3ARDD 1FSKB 1DE4B 1DQDH 1XGUB 4EI5B 3QXUA 3STLB 1AKJB 5GZND 3RJDA 3T0AA 1PVHA 3QHZH 1A1NB 3AS0A 5KVFL 4L3CB 1U8IA 4EJ1C 4P3WA 2UY7A 4U3HA 1T7YA 4NQEB 3UPAA 5T3XE 4HHAA 5KVEH 1ULVA 5IMKB 1JN6A 4JG0L 2NXYC 5HHOE 5FO7B 3TFKC 5ISZB 1QFWM 3VDBA 2GY7B 5E1HB 1QBLL 4ZXBA 2PN5A 3RTQB 4MA1B 1CBVL 5FYJE 2VZ3A 5DUPH 2A73B 3BSZL 3GSXA 2AK4B 2P8PB 1HKLH 3RIFF 5E9DB 3CCHB 3TF7C 4JDVA 1CE6B 4Z7WE 3HNTL 3B2UD 3O4LB 4BQBA 2WV3A 2R1YA 1T5XB 4A6YL 2JELL 3QEGH 3UJJH 2QR0B 3LKPB 5IOPA 1RZKL 3QAZB 1JZ5A 1S9KC 1NMAH 5EC1A 1BVLA 5DJDA 2QADC 4P3DA 1RZGB 4Z7VA 5SX5K 2GIYA 3IDXL 1CFNB 4F80A 3BWAB 3O0RL 2LAAA 5DR5H 4DZ8B 5EU6A 4JJ5A 4LAJH 4RMRA 1MH5B 4NPYB 1YJDC 4EOWL 4CVXA 4HS6B 1YNLH 5SWQB 3BOVA 1HHIB 1J12A 2D0HA 5D70H 4D0BA 3HG1D 4LSSL 5EBLB 3VFPA 4JFYB 5IEHB 2F54A 1T1ZB 5HYJA 1W8OA 4OV5B 4JQIL 1RUMH 1LEIA 4Y5VC 5CGYC 3FQRA 4LLUA 1ZT1B 3SKNB 3FQNA 4EI5D 5I9QB 1MHEB 2JTDA 1JGUH 2AQ2A 4KK9C 2NLJB 5FKAB 3REWA 1FYTA 2R56L 4HMDA 4YJZL 1Q1JL 5IW1B 4O2EA 3NABL 1EO8L 4NNXA 4WI7A 2G9HB 1FNHA 3LD8C 5AAWA 2R0ZL 4R90H 2WK2A 3T0ED 3MMEA 2HT2C 3SGJC 1L0YA 4YHZH 2KPNA 4P2QD 4LL9A 4PR5B 3QBTB 1NAKL 5A40E 3JTSA 1LILA 1A3LH 4O58L 1O7SA 2C7UB 3RTQD 3CFCL 4LKCA 4DGVL 5FOJA 4PY8J 1JWUB 2AK4D 3F7VA 3MV01 5IW6B 5F1OB 1I1FB 2APFA 1PSKL 1DBBL 4X4XA 1NEZG 2D31B 4PD4J 1DBMH 4XPFL 3DNKA 4J3XA 2PO6C 4Q0XL 1JI2A 1X5FA 1GPOH 4QO1A 3FKUS 5F6HI 4L4JA 4K8RC 3RKDC 1HHGA 2UZYB 4YR6A 3QDGB 1FIEA 2H2PD 4NO3B 3MNWA 5HGDA 3DLQR 5ABDE 5MP6H 5I8OL 2BVUA 1HINH 5HDLA 4YWGH 1OGAA 3FFDB 4ZSOA 1P4LA 4HIJB 5BS0E 5I1JH 1Q9OA 4PJEE 1MAKA 3PWPB 3GGWA 4XPTL 4HGMA 5DK2B 3O45A 3OKYA 3V7MA 2Q1EA 1DQJB 4P46B 4Z95L 3UP1A 4P4RB 1S9WA 1T7WA 1JHTA 1O7VA 3JBG7 3C60B 1NCBL 2GCYA 5KOVC 1U8PB 3QP3A 1LDPL 2BSTA 3GI9H 2F5BH 3OAYK 4MDJB 5C08B 3S4SA 4OCSL 2WWKO 5DJCB 1J1PH 3RZCA 3ALPA 3FQXA 3D18A 4MJ4A 5DJ6B 3CDGA 5EORL 2DI7A 3BN9C 5DF0A 3QPQD 4XNXL 3C5JB 4NZRL 5CWSA 3UAJD 4ONGH 2E3VA 2NY2C 3FFCA 3UROR 5BQ7B 4LVOC 2AXFA 1MJUL 2NY5H 4JFZH 3N1GC 2J3SA 1UA6L 1K3ZA 5CJXC 1FNAA 4X6FB 5A3IC 1KJ2A 4KY1H 1KOAA 1R3IH 4KDTA 3SCMA 4LARH 2AXGB 4IBLT 1IAMA 4JKPL 2H32H 5ICZA 2NY0B 1W72A 5BRZB 1EEQA 1KBGL 2P5EE 5C0RL 1IBGH 5HGHA 3U4AA 4JCMA 2NY7L 1D9KA 1MCOL 2E8YA 1C7SA 3I2CH 3GDBA 4E9LA 3AS2A 2AEWA 3FT3B 4XC1L 2NQCA 5FHAL 4MJ6A 4PJBA 2PYEE 3RVWC 5BOPA 3QDGD 5D7LA 1XZ0B 3FN0L 3KLAB 1YEKL 2MQ3A 2PTUA 5C0NC 1AO7A 1CIDA 1E4XI 4OGZA 4Y2DD 3PWPD 2XIDA 4P9HH 2VXSH 4X6CB 1J10A 7FABL 1TQCC 1UXSA 2APBA 2RGSA 2UWEB 2AJSH 5JW3H 5E7FA 4NDMB 5GJSH 4IMLB 1ED3B 3K2UL 5T33L 3NVQA 3BN3B 1RMFL 4L9LC 5EUOE 5J13B 3ARDA 3OKLB 3C60D 1BFSA 3ZKMD 1T20A 1DSFH 2VITB 2C1OB 2X70A 3MJGX 4OCMC 1Q9LA 5CINH 4ALAL 5CEZH 3DV6A 1TJGH 3ULUF 1QYGH 2ICWI 3MRRA 4D0DA 1G7HB 2DJ4A 4BQ9A 3SY0B 5DRNA 5C08D 1BHGA 5A1AA 2EDEA 4G3YL 1WBZA 4DGIH 3DV4A 4CKVX 3RL2B 2XNAA 2XQYG 5F89B 5SX5H 5I18H 4UQ2B 3ZHDA 1SVZA 5F44A 3ILQD 3V7AG 1P2CB 4KKCC 3LY6A 5IFHH 5MI0C 3ARGB 4XCEB 1ZVSB 3GMNB 4M6ML 4NQVB 4DAGH 1GPOL 4JRXE 4QRPD 4HJJL 4NNPH 1NLBL 4OZGA 5KS9E 1RIUH 3TZVA 3VXPA 5BRZD 4MJIB 4PG2C 4NO0D 3ZE0F 3D3VB 5J57B 4UILL 5J1SC 2P44B 4KTYA 4XNZB 2F5AH 5HYSB 4ZTOH 2A6JB 1OTTD 2VUOA 5TQ2L 1Q9WB 2XG4A 3LKRB 5DRXB 2V17H 3O2DL 3MJ8B 1D5XA 5KSAC 3K8LA 5I76A 2Q86B 3CU1A 4NHUA 3ILPB 2ZJSL 5E94A 1XAUA 3BDBA 2NW3A 3FN9A 2JCCB 5ESQB 1S7RB 3HG1A 5KVDL 1E4KC 4YZFF 1FPTH 3QFJE 4W6WB 4XRCA 25C8L 4HJ0C 3K8MA 3WN5B 3TH2T 1DQLH 3O6FC 3EOAB 1G0XA 1KIRB 3MCLL 4KKAC 3H9YA 1DE4A 2N1KA 1UZ6F 3PQYB 4EI5A 5F1NB 4N9OB 3STLA 1AI1H 3P9LB 1IGMH 4F37F 1QSVA 1A1NA 2DQUH 4XVTH 2FO1A 3SDAC 4L3CA 1SM3L 2HLAB 2A9MH 5EB9A 1F4HA 5F3BA 1RUPH 5L7XH 1SYSB 1WWCA 4F15B 1XIWB 2MCPL 1B4JH 1M1SA 4FFYH 3T0EA 2R0KL 3TV3H 1Y18B 4YE4L 3ZDYE 1OCWH 1KPVB 4OD1L 4M03A 2DIJA 3GIZH 5FO7A 5ISZA 3VRJB 4P2QA 2GKIA 2V2WB 4GH7B 2VSDA 4KHTH 3RTQA 4FFZL 5DMYA 1W0WB 1FBIH 2A73A 4JREC 2OZ4L 2AK4A 4GRWE 1S3KH 5JDJA 2P8PA 3QWOB 5HHXL 2Q87A 3TYGH 5E9DA 3CCHA 2VLJB 1CE6A 3O4LA 3U7YH 4F57L 4OT1L 1T5XA 2QR0A 3LKPA 4MJID 4FQ2H 2Y4SA 2D7PA 3CLEL 3D3VD 1EDQA 3U1SL 4MD4A 1EUUA 3P4MB 1PYWB 3TO4C 1RD6A 5CLWA 5IF0A 4Z76B 1GC1C 1RZGA 2B39A 4RNRA 2HMIC 4OCYL 3DHJA 1JL8A 1RY7B 5AG8A 2OCFD 3QRGH 1JNNL 4MB4A 1CFNA 4PJFF 3BWAA 4DZ8A 2RB8A 3PWVB 4I2XB 3ULUC 1MH5A 4NPYA 1WC7B 5B39G 1KB9J 1QUNA 4NZTH 4XGZB 4HS6A 1YPZF 3OAYH 4LIQE 5F8QC 5SWQA 4X7EC 5ILTH 1HHIA 5D1QC 3VMNA 3GJEB 5EBLA 4JFYA 3VWKB 5DUML 5IEHA 3GUTB 1T1ZA 2CDEB 4OV5A 2D2OA 3Q48A 4R9HA 1DVFD 3SKNA 1ZT1A 3VDAA 4J3WA 3EFFB 1TZGL 1YEEL 1CFVL 1MHEA 2ADIB 1IAIL 2EDXA 5F9WB 5FKAA 2NY6B 3VXUE 3HMXH 2VXUL 3KLHD 4D9RD 3X13B 1FL3B 3GRWA 3UTPE 2G9HA 4TUKL 1EO7A 4RAVB 3WD5H 2IQAB 2AV7B 2FX7H 3BP4A 2Q6WB 3B9DA 4PGJA 2HT4D 2EXWD 2WMPA 1TCRB 5KTEL 1WT5A 4UBDD 3CX2A 4OTXH 1XF4B 4PR5A 4UOJA 1RZIB 5I30L 3BUYB 5E4EC 4XCFL 2C7UA 1MCWM 4WWKD 5FM4A 4JQXC 1JWUA 3IAPA 1ZLSH 2VLJD 5IW6A 2ESVD 1DFBH 2F9BT 1RJYB 4M93C 3KS0H 5EWIH 1NANH 4FQ1L 1L6ZA 1YMME 3DRQB 3LRSB 1J1XL 1UEMA 4MSWB 4K7PL 2D31A 4MYWB 1YQVL 4FQIL 2I27N 4BK5A 2BP3A 3IU4H 4X9FA 3O2VL 1A64A 2FATL 1NAML 2VL4A 4WFFD 5C0CD 2I5YL 1WICA 3V0AC 2DLTA 3JSSA 3QDGA 4NO3A 4TOYL 1A1MB 4KRLB 1BM3L 2HJFB 3HLAB 4MGXA 2W38A 1S7UB 3QXVA 4YX2H 3FFDA 1YEJH 4ESKA 4HIJA 3PWPA 2DQUL 5J8OA 5DK2A 4NQCB 3VWKD 1INEH 2A9ML 2DWEB 5HHQA 2NPLX 1DQJA 2AJYL 1G1CA 3DROB 4OD3L 4P4RA 4JR9L 5JZ7C 3RA7H 1NLDH 3C60A 2NY6D 3RVTC 2YN3A 4TUOB 2IBZX 1U8PA 2WIIB 3OHXB 3MV9B 4M1DH 3WSQH 1PAMA 5H2BB 5C08A 4MS8D 5CZVH 5DJCA 4PV8B 2CKBH 1AC6A 5KVGL 2FX9H 1F58H 1AP2B 1KCKA 4UNUA 4YHMH 4U0RB 3F8UB 4GS7B 4KXZH 2OL3B 2YK1H 3H2WA 1YMHB 3QNZB 4OIBA 5BQ7A 4LCYB 1G7JB 1DUYA 4X9HA 1P69B 2KQMA 1JE6A 1QA9B 5GSRB 3RX7A 4X6FA 4FTVB 3QNYB 4YGAB 3I6LD 5AWNL 1X9QA 2AXGA 1C5BL 1NEUA 1EK3A 4TNWF 5BRZA 3BIKB 2X4NB 4I3GA 2EDHA 1XGYH 4CUCA 3FRPA 1T7ZA 4HW6A 2DS4A 3RFZC 1E6OH 3MACH 2X1QA 2RIKA 3CH8A 4PUBH 3UTSB 3X11B 4Z77B 3L95B 4PP2B 1QTYT 3E8UL 1XZ0A 2VAJA 1MJ8L 5DJYB 3KLAA 3QXAA 5ITFB 4YC2C 3V6OC 1P4IH 3MLTA 2BVTA 2AQ1A 5FYLH 5F9DC 3VFWB 5CJ5A 3VGHA 4X6CA 1MRFH 1R5VA 2BFVL 3EYSH 2FO4B 5B38A 1KTKE 2UWEA 5J11C 5IEKB 4TPRL 4KMLB 4ZAKC 4NDMA 4IMLA 1MAMH 1ED3A 2CIKB 4KDWA 1WFNA 3C2SA 3HS0A 3OKLA 5HYIA 1ZHKB 3WHE1 4U1GB 3ARZA 2D0GA 2C1OA 2VITA 5CJBA 1OF2B 3MV9D 5F3HB 1CGSL 4XNQB 3TVMB 1G1YA 3LPWA 4Z7NF 3O8XD 2ADFH 1OAKL 4OF8A 1X5ZA 4GQ9L 2FRGP 2QBWA 4LRNH 4Y1AD 1KIQB 3BFOA 5I6XB 2EDNA 4QRSB 3BE1H 5F89A 5EWIL 3WL9B 4LEXL 4UQ2A 4AIOA 4QWWD 1KCRH 3P77B 5EOCL 1U3HC 1P2CA 1LD9A 4XCEA 3GMNA 1ZVSA 2ID5A 1RPQA 3C8KB 3K74B 4NQVA 4TVSa 2J6EH 4FTVD 4OFPA 1UWGH 5GRJH 5D6DA 3A6CH 4JN2B 5CZKA 1N7MH 5FK9B 3LQAH 4EDWH 4MJIA 5GGUB 1YN6B 5IQ7H 4BFIB 3D3VA 3U0WH 1BJ8A 2M1KA 5HYSA 3UTSD 5AZEH 1YC8A 2D9CA 1Q9WA 2IFFH 2IPTH 2DAVA 3HUJF 3LKRA 3QCUH 5DRXA 5EBWB 1T1YB 4ELKB 4P4KB 4EKXA 2Q86A 4JFHD 3ULUE 3ILPA 1A1OB 5IBUG 5ESQA 5E4IA 1UCBL 1S7RA 3HC0B 3V9FA 3VGAB 2NNAA 3WN5A 4XI5D 3MBEB 5I74C 4YHNB 5EIIB 3EOAA 5D72H 3HE6B 3MRLB 1DVFA 5BVJB 1F4YH 1ITBB 2E8ZA 2Z8VC 3GEWB 2HJKB 3PQYA 3HMWL 5F1NA 3P9LA 3VXNB 1H0DA 4G43B 4NM8H 5GRUH 2IPUG 2HKFH 5IM7B 1YYML 5C09E 2BRRH 1PKOA 2HLAA 4S1DC 1U8KB 1IGJB 3HZKA 3K4DA 4YAQB 2DWDB 3H0TA 3KR3H 1SYSA 5KJRH 5I1KH 1CGTA 1N64H 1S5HB 1FO0H 1VESA 5C6TH 3DUUA 3ZE0E 1UWXK 2OSLB 2B2XH 1Y18A 1LWRA 3X3FH 1KPVA 4P5TC 4IEFB 5MEQB 2OXHA 4OZFH 1C5DB 4PTTB 3LIZL 4WFGE 3IJYB 3VRJA 1IKFL 1CL7L 1OAXL 5FAAA 2V2WA 2VDNL 4JPVH 3ZDZF 1W0WA 4WRLA 4WWKA 2MNUA 2A9NH 2BSSB 3QWOA 1QLEH 4HFWB 4PJDF 4Q2ZB 4RCAA 3D39E 4U6VH 2VLJA 2YD7A 2ESVA 2HKHH 4KI5D 1T03H 4KZDH 5IW3A 1JHKH 5L9DH 5CBAB 4HIXL 1Q72H 3PIQB 4YZFE 4XP5H 2YEZB 2CO6B 5F7FA 3P4MA 3W0WE 1S9VB 3EJJX 4Z76A 4QNPF 2ZOKB 1UZ6E 2IEPA 3RI5F 2YA1A 4U1HB 2YPLE 3PWVA 4I2XA 1ZGLM 4P4KD 2CDGB 1WITA 4ELMF 2H6PB 1RUQL 2KDGA 5HJ3B 2D7MA 5FYKL 5BVPL 4F2MB 3LZFL 5JXAH 5IB1A 3GJEA 1QOKA 2FBJH 3VWKA 4X6BA 1FLRL 3SGDH 4ZFGH 5LWYL 1NCDL 3MBED 3MCG1 3GUTA 4NQDB 4YXHL 3C8DA 2CDEA 2ARJA 2MPAL 2A1WH 1KFAL 3O41B 2DYPB 3WJLA 2ADIA 2ADGA 3GM0A 1CXIA 3MPCA 4MQ7B 3H9SB 4J1UB 5HY9B 4AL8H 1UM5H 1FL3A 3BESR 2PKDA 3V52L 2NMSA 3KAAA 1QBMH 1U93A 4RAVA 2EDOA 2IQAA 1RZKC 2AV7A 2Q6WA 4WW2F 3T1FB 4LGRB 4S1QH 4P2CG 3MYZA 4YDVA 1FRGL 1TCRA 1FAKT 4LCWD 2VN7A 4PJ9D 4R26L 4N1CA 1XF4A 1RZIA 3MROA 2AS5M 1GHFH 4TVPD 5C0BD 3BUYA 4OLVH 4PJFE 2R4RH 3MQIA 1ADQH 1V7ML 4Z0BL 1IAIM 5DMJB 1YPZE 8FABB 1J8HB 1FFQA 1IGIH 5MEOB 2ENYA 3KPRD 3DRQA 4LQFL 3LRSA 4MSWA 1DDHB 3R0MA 2W9DL 5ETUA 5DD3H 4LK4A 5TJWK 1WIUA 3V4UL 3VXRB 4JB9L 1TMCB 1CE1H 4JFDB 5GS0L 3X14B 4S2SB 3JV6B 4O00A 4MQSB 5J6GB 3H3PH 1V7NL 4L9DA 4HWZA 1UQSA 1A1MA 2AABL 1U58B 3QZWB 5ITBH 3HLAA 2E27L 5CJOL 1S7UA 1MFDH 1AR1D 4U1IB 2BNRD 4M6NH 2EXYD 5DFVC 4RQQB 3S3JA 3V6OE 4U6XB 3AAZB 3L7EB 4NQCA 3MBXL 4XAKD 2E7CA 5C9KA 3EYUH 2YZ1A 4U0QB 3DROA 5DO2D 1VB9A 1A7PL 1FO0L 4WHYG 4NCC2 1VACB 2VLKE 1MFBL 1F00I 3FT4B 3KXFE 1OGTB 2A77L 4KKNA 4BZ2L 3C6SB 4TUOA 3K4AA 1TETH 2WIIA 3OHXA 3MV9A 4G8FB 3ZSSA 1ETZB 3AS1A 4JPVL 1CDJA 5EZIH 3U7WL 2DLHA 5H2BA 4NN5C 1NANI 4PV8A 3K2MC 3KPSE 4H1LB 4Y1AA 4MQXC 1MCBA 1T2XA 2LE9A 3DGCR 3OQ3B 4N5UA 3MV7E 1MFCH 2NY1C 2OL3A 5GRZA 5JNYB 3QNZA 2F8OA 2ZNWA 3BZDA 4J3OC 2V2TA 2VDPH 1BGXH 1G7JA 1QA9A 5GSRA 3ZHKA 3MRHB 5GGQH 1J8HD 2ZUQB 4FTVA 3MZTA 3FQUB 4LPVA 4RDQF 4L5FL 2DQCL 1YYLH 2X4NA 3RIAF 3BAEL 1BOGB 2VR4A 2R1WB 5IB5B 3U6RB 35C8H 4QXUH 5DGQA 1K6QL 5A2LH 2B8OT 3UTSA 3X11A 3KHQA 4I18C 4Z77A 3L95A 4FHBD 3ARVA 3WFDH 4OCLC 3BX7C 5ITFA 5IB3B 2ERJC 3QUKB 4G7YL 1A7QL 4ACPA 1EGJA 2PTVA 4WW2C 3VFWA 4YDLC 2FO4A 3MV8E 5IEKA 1UWXH 2X4PB 4JZJC 1PZUB 3MLXH 2XICA 5GPRA 2CIKA 12E8H 1NSNL 3ZYIA 4KXZI 3ALWA 5FUOL 4NZJA 3F6LA 2HFFB 4YIQB 2HA1A 3WO4B 3HNVH 2BNQE 1DBJL 1TLKA 4QT5B 1I3VA 2ZKHL 2ZUVA 5ALCL 3MRJA 1OF2A 5F3HA 4OD2B 4FXLA 1JGLL 1H8NA 3FRUB 4MHHI 3LPGA 1KIQA 3BH8B 4R3SB 1U42A 4N8CL 1BP3B 4QRSA 1P9MC 1RZ7H 3WL9A 2QKIB