4TPHA

Selectivity mechanism of a bacterial homologue of the human drug peptide transporters pept1 and pept2
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
485
structure length
453
Chain Sequence
b'VSKTHSFMTVSLIELWERFGYYGMQALIVYFMVQRLGFDDSRANLVWSACAALIYVSPAIGGWVGDKILGTKRTMLLGAGILSVGYALMTVPTENTWFMFSALGVIVVGNGLFKPNAGNLVRKIYESKIDSAFTIYYMAVNVGSTFSMLLTPWIKDYVNAQYGNEFGWHAAFAVCCVGILVGLGNYALMHKSLANYGSEPDTRPVNKKSLAIVLALAALSVVASAIILEYEDVARVFVYAAGVAVLGIFFHLERAGLIAALILTVQTVFFFIFYQQMSTSLALFALRNVDWDFQVFGTHLWTWSPAQFQALNPIWIMVLSPVLAWIAAKFALGFAVVAIGFFIYGFAGQFAVNGKTSSWVMIWGYASYSLGELLVSGLGLAMIARMMGAYFVASGISQYLGGVVANFASVPQDLVDPLQTLPVYTNLFNKLGVAAVVCTIIALAVLPLMRRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton:oligopeptide symporter POT family
publication title Selectivity mechanism of a bacterial homolog of the human drug-peptide transporters PepT1 and PepT2.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Membrane protein
total genus 187
structure length 453
sequence length 485
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00854 PTR2 POT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4tphA00
4OAAA 4XNJA 2XUTA 4IKWA 4YB9D 4JA3A 4IKXA 4YBQA 4IKVA 5D58A 4IU8A 4TPJA 4IU9A 1PW4A 4OH3A 4ZWBA 3O7QA 4U4WA 3WDOA 4U4TA 5EQGA 4ZYRA 5GXBA 4GC0A 4JR9A 5A2NA 4ZW9A 4IKYA 4W6VA 2Y5YA 5EQHA 4XNIA 4PYPA 1PV7A 4TPHA 4IKZA 3O7PA 4JREA 4D2BA 4GBZA 4LDSA 4QIQA 5D59A 5EQIA 4GBYA 1PV6A 4LEPA 2CFPA 4Q65A 4D2DA 4APSA 4J05A 4UVMA 5C65A 2CFQA 4ZWCA 5D6KA 4TPGA 4U4VA 5A2OA 2V8NA 4D2CA
chains in the Genus database with same CATH superfamily
1BCNA 3Q1SI 4EXPA 2B8ZA 4CNIC 5C44D 4NEMA 5C3ED 1HIJA 1KF9A 4IKZA 1M4AA 3OG6A 1M49A 1A22A 4LEPA 4RS1A 3HOYD 2CFPA 1ITLA 1IJZA 3S9DA 2D9QA 4YB9D 4IKVA 1SCFA 4BBRD 1V7MV 1HWGA 1HZIA 4ZW9A 5IP9D 1Y1WD 3HOVD 1V7NV 3DGCL 2Q7NB 3NCEA 4UVMA 2CFQA 3L5WI 5TS9A 3G6DA 1HULA 2V8NA 2B8YA 3G9VB 3HOZD 1BGCA 4EXNA 1EXZA 1F45B 1GA3A 4ZWBA 1M48A 1RFBA 4W6VA 2Z3QA 3BPNA 2GMFA 5L6YC 3L5XA 4PS4A 5D6KA 1Y14A 4A3FD 4NI7A 3EJJA 1EMRA 4OAAA 5IYCD 2VUMD 4O9HA 3INKC 4YQXA 2CYKA 3BPLA 1CSGA 4BY7D 1Z7CA 1AU1A 4X51A 3NCBA 1D9CA 1PV7A 4Z5RD 4WRLB 4YPGC 3D48P 1INRA 2JA8D 2HYMB 3QAZA 2L3OA 1BBNA 4OH3A 3D85C 3O7QA 3PO3D 2XQBA 3I4ND 2B8XA 3NCFA 4O6KA 1CN4C 3H0GD 1LK3A 2O27A 3QB1A 5KNHI 4DKCA 4U4VA 1LKIA 5GXBA 1AXIA 3D87A 4NI9A 5IYBD 1GNCA 2OQPA 4IKXA 3PO2D 5IP7D 3WDOA 4U4TA 1M47A 4GS7A 4YUEC 4TPHA 1ILKA 3O7PA 4QIQA 3DLQI 1RHGA 3AYHA 4ZF7A 1BUYA 1Y6KL 3QWRB 1HUWA 3IRHA 4BY1D 4TPJA 4IU9A 3DUHC 4A3KD 3HHCA 1IL6A 2JA5D 1ITIA 4IKYA 1WCMD 5D28B 5D22A 3TGXB 4LDSA 4NN7A 1PGRA 3HOWD 4J4LC 2B90A 3DI3A 3UEZE 1CD9A 3MZGA 4DKEA 4XNJA 3UF2A 4JA3A 1BP3A 4DOHA 5EQGA 5C4XD 1D9GA 2Y5YA 5EQHA 4PYPA 1CNT1 1PVHB 1M4CA 4A3CD 5EQIA 1RW5A 1ITFA 4MHLA 1VLKA 2B91A 4LRLA 4BBSD 4A3ED 2KZ1A 1JLIA 1FYHA 3H3VE 1LQSL 4A93D 3NPZA 2O26A 1PW6A 3VA2A 2Z3RA 3UX9A 4NEJA 4GBZA 5D59A 1I1RB 4ZWCA 1A7MA 4DKFA 1ALUA 5C7XA 1N1FA 4YBQA 2C35A 1M4RA 3SE4B 4I77Z 1PY2A 3B5KA 4XNIA 3HMXB 1PV6A 4APSA 1IRLA 4J05A 1EVSA 2Q14A 4TPGA 3QB7A 2XUTA 3HOXD 4A3JD 2ILKA 4IU8A 1FG9A 1ITMA 1J7VL 1QVNA 5FUCA 3LB6A 5D72A 1EKUA 5IYDD 1B5LA 4A3GD 5C65A 3OG4A 2PSMA 1Y6NL 4A3MD 3DI2A 2E9WC 1CYLA 1AX8A 3HHRA 5D70A 4U4WA 5A2NA 3BESL 4A3BD 1WU3I 3SE3B 5LQBA 4YDYI 1ETEA 5FLMD 5A2OA 1BGDA 3QT2C 3EW3A 1PW4A 1Y6ML 4NN6A 2L3YA 1F6FA 3BPOA 4A3LD 4NKQC 4A3DD 3OQ3A 4Q65A 1RCBA 3PIWA 2Q98A 2R7ZD 3LB6B 1EERA 5FHXA 1Z92A 5E4EA 3HOUD 3PIVA 5D58A 1YKBA 2B63D 1Y1VD 3N0PA 1IARA 2B8UA 2O6IA 4D2BA 3WCYI 1HWHA 1M4BA 4IKWA 2INTA 3N06A 5D71A 2B5IA 1HGUA 2LMSA 2ERJD 4GC0A 4JR9A 3UF5A 2R93D 4GBYA 4NN5A 4ZS7A 1HIKA 1BGEA 3FKID 4DKDA 2LAGA 3NCCA 4FA8E 4ZYRA 2IL6A 4A3ID 1IK0A 2H24A 4BXXD 2R92D 1NBPA 4JREA 2D48A 2JA6D 4D2DA 4GRWA 3I4MD 2JA7D 1P9MB 4D2CA
chains in the Genus database with same CATH topology
4OAAA 4XNJA 2XUTA 4IKWA 4YB9D 4JA3A 4IKXA 4YBQA 4IKVA 5D58A 4IU8A 4TPJA 4IU9A 1PW4A 4OH3A 4ZWBA 3O7QA 4U4WA 3WDOA 4U4TA 5EQGA 4ZYRA 5GXBA 4GC0A 4JR9A 5A2NA 4ZW9A 4IKYA 4W6VA 2Y5YA 5EQHA 4XNIA 4PYPA 1PV7A 4TPHA 4IKZA 3O7PA 4JREA 4D2BA 4GBZA 4LDSA 4QIQA 5D59A 5EQIA 4GBYA 1PV6A 4LEPA 2CFPA 4Q65A 4D2DA 4APSA 4J05A 4UVMA 5C65A 2CFQA 4ZWCA 5D6KA 4TPGA 4U4VA 5A2OA 2V8NA 4D2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAA A;  4XNJ A;  2XUT A;  4IKW A;  4YB9 D;  4JA3 A;  4IKX A;  4YBQ A;  4IKV A;  5D58 A;  4IU8 A;  4TPJ A;  4IU9 A;  1PW4 A;  4OH3 A;  4ZWB A;  3O7Q A;  4U4W A;  3WDO A;  4U4T A;  5EQG A;  4ZYR A;  5GXB A;  4GC0 A;  4JR9 A;  5A2N A;  4ZW9 A;  4IKY A;  4W6V A;  2Y5Y A;  5EQH A;  4XNI A;  4PYP A;  1PV7 A;  4TPH A;  4IKZ A;  3O7P A;  4JRE A;  4D2B A;  4GBZ A;  4LDS A;  4QIQ A;  5D59 A;  5EQI A;  4GBY A;  1PV6 A;  4LEP A;  2CFP A;  4Q65 A;  4D2D A;  4APS A;  4J05 A;  4UVM A;  5C65 A;  2CFQ A;  4ZWC A;  5D6K A;  4TPG A;  4U4V A;  5A2O A;  2V8N A;  4D2C A; 
#chains in the Genus database with same CATH topology
 1BCN A;  3Q1S I;  4EXP A;  2B8Z A;  4CNI C;  5C44 D;  4NEM A;  5C3E D;  1HIJ A;  1KF9 A;  4IKZ A;  1M4A A;  3OG6 A;  1M49 A;  1A22 A;  4LEP A;  4RS1 A;  3HOY D;  2CFP A;  1ITL A;  1IJZ A;  3S9D A;  2D9Q A;  4YB9 D;  4IKV A;  1SCF A;  4BBR D;  1V7M V;  1HWG A;  1HZI A;  4ZW9 A;  5IP9 D;  1Y1W D;  3HOV D;  1V7N V;  3DGC L;  2Q7N B;  3NCE A;  4UVM A;  2CFQ A;  3L5W I;  5TS9 A;  3G6D A;  1HUL A;  2V8N A;  2B8Y A;  3G9V B;  3HOZ D;  1BGC A;  4EXN A;  1EXZ A;  1F45 B;  1GA3 A;  4ZWB A;  1M48 A;  1RFB A;  4W6V A;  2Z3Q A;  3BPN A;  2GMF A;  5L6Y C;  3L5X A;  4PS4 A;  5D6K A;  1Y14 A;  4A3F D;  4NI7 A;  3EJJ A;  1EMR A;  4OAA A;  5IYC D;  2VUM D;  4O9H A;  3INK C;  4YQX A;  2CYK A;  3BPL A;  1CSG A;  4BY7 D;  1Z7C A;  1AU1 A;  4X51 A;  3NCB A;  1D9C A;  1PV7 A;  4Z5R D;  4WRL B;  4YPG C;  3D48 P;  1INR A;  2JA8 D;  2HYM B;  3QAZ A;  2L3O A;  1BBN A;  4OH3 A;  3D85 C;  3O7Q A;  3PO3 D;  2XQB A;  3I4N D;  2B8X A;  3NCF A;  4O6K A;  1CN4 C;  3H0G D;  1LK3 A;  2O27 A;  3QB1 A;  5KNH I;  4DKC A;  4U4V A;  1LKI A;  5GXB A;  1AXI A;  3D87 A;  4NI9 A;  5IYB D;  1GNC A;  2OQP A;  4IKX A;  3PO2 D;  5IP7 D;  3WDO A;  4U4T A;  1M47 A;  4GS7 A;  4YUE C;  4TPH A;  1ILK A;  3O7P A;  4QIQ A;  3DLQ I;  1RHG A;  3AYH A;  4ZF7 A;  1BUY A;  1Y6K L;  3QWR B;  1HUW A;  3IRH A;  4BY1 D;  4TPJ A;  4IU9 A;  3DUH C;  4A3K D;  3HHC A;  1IL6 A;  2JA5 D;  1ITI A;  4IKY A;  1WCM D;  5D28 B;  5D22 A;  3TGX B;  4LDS A;  4NN7 A;  1PGR A;  3HOW D;  4J4L C;  2B90 A;  3DI3 A;  3UEZ E;  1CD9 A;  3MZG A;  4DKE A;  4XNJ A;  3UF2 A;  4JA3 A;  1BP3 A;  4DOH A;  5EQG A;  5C4X D;  1D9G A;  2Y5Y A;  5EQH A;  4PYP A;  1CNT 1;  1PVH B;  1M4C A;  4A3C D;  5EQI A;  1RW5 A;  1ITF A;  4MHL A;  1VLK A;  2B91 A;  4LRL A;  4BBS D;  4A3E D;  2KZ1 A;  1JLI A;  1FYH A;  3H3V E;  1LQS L;  4A93 D;  3NPZ A;  2O26 A;  1PW6 A;  3VA2 A;  2Z3R A;  3UX9 A;  4NEJ A;  4GBZ A;  5D59 A;  1I1R B;  4ZWC A;  1A7M A;  4DKF A;  1ALU A;  5C7X A;  1N1F A;  4YBQ A;  2C35 A;  1M4R A;  3SE4 B;  4I77 Z;  1PY2 A;  3B5K A;  4XNI A;  3HMX B;  1PV6 A;  4APS A;  1IRL A;  4J05 A;  1EVS A;  2Q14 A;  4TPG A;  3QB7 A;  2XUT A;  3HOX D;  4A3J D;  2ILK A;  4IU8 A;  1FG9 A;  1ITM A;  1J7V L;  1QVN A;  5FUC A;  3LB6 A;  5D72 A;  1EKU A;  5IYD D;  1B5L A;  4A3G D;  5C65 A;  3OG4 A;  2PSM A;  1Y6N L;  4A3M D;  3DI2 A;  2E9W C;  1CYL A;  1AX8 A;  3HHR A;  5D70 A;  4U4W A;  5A2N A;  3BES L;  4A3B D;  1WU3 I;  3SE3 B;  5LQB A;  4YDY I;  1ETE A;  5FLM D;  5A2O A;  1BGD A;  3QT2 C;  3EW3 A;  1PW4 A;  1Y6M L;  4NN6 A;  2L3Y A;  1F6F A;  3BPO A;  4A3L D;  4NKQ C;  4A3D D;  3OQ3 A;  4Q65 A;  1RCB A;  3PIW A;  2Q98 A;  2R7Z D;  3LB6 B;  1EER A;  5FHX A;  1Z92 A;  5E4E A;  3HOU D;  3PIV A;  5D58 A;  1YKB A;  2B63 D;  1Y1V D;  3N0P A;  1IAR A;  2B8U A;  2O6I A;  4D2B A;  3WCY I;  1HWH A;  1M4B A;  4IKW A;  2INT A;  3N06 A;  5D71 A;  2B5I A;  1HGU A;  2LMS A;  2ERJ D;  4GC0 A;  4JR9 A;  3UF5 A;  2R93 D;  4GBY A;  4NN5 A;  4ZS7 A;  1HIK A;  1BGE A;  3FKI D;  4DKD A;  2LAG A;  3NCC A;  4FA8 E;  4ZYR A;  2IL6 A;  4A3I D;  1IK0 A;  2H24 A;  4BXX D;  2R92 D;  1NBP A;  4JRE A;  2D48 A;  2JA6 D;  4D2D A;  4GRW A;  3I4M D;  2JA7 D;  1P9M B;  4D2C A; 
#chains in the Genus database with same CATH homology
 4OAA A;  4XNJ A;  2XUT A;  4IKW A;  4YB9 D;  4JA3 A;  4IKX A;  4YBQ A;  4IKV A;  5D58 A;  4IU8 A;  4TPJ A;  4IU9 A;  1PW4 A;  4OH3 A;  4ZWB A;  3O7Q A;  4U4W A;  3WDO A;  4U4T A;  5EQG A;  4ZYR A;  5GXB A;  4GC0 A;  4JR9 A;  5A2N A;  4ZW9 A;  4IKY A;  4W6V A;  2Y5Y A;  5EQH A;  4XNI A;  4PYP A;  1PV7 A;  4TPH A;  4IKZ A;  3O7P A;  4JRE A;  4D2B A;  4GBZ A;  4LDS A;  4QIQ A;  5D59 A;  5EQI A;  4GBY A;  1PV6 A;  4LEP A;  2CFP A;  4Q65 A;  4D2D A;  4APS A;  4J05 A;  4UVM A;  5C65 A;  2CFQ A;  4ZWC A;  5D6K A;  4TPG A;  4U4V A;  5A2O A;  2V8N A;  4D2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...