4TPIZ

The refined 2.2-angstroms (0.22-nm) x-ray crystal structure of the ternary complex formed by bovine trypsinogen, valine-valine and the arg15 analogue of bovine pancreatic trypsin inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title The refined 2.2-A (0.22-nm) X-ray crystal structure of the ternary complex formed by bovine trypsinogen, valine-valine and the Arg15 analogue of bovine pancreatic trypsin inhibitor
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1985-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4tpiZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4tpiZ02
1HJ9A 2C4FH 4CBOA 4GSOA 3EAJA 5EXNA 4NSYA 1B0FA 1DITH 1FMGA 1PQ5A 1TNJA 3RU4D 4K3JA 1D3QB 4ZUHA 1QL8A 3AAVA 1DUAA 1N6XA 3RXMA 3T29A 1EZUC 2Y7XA 1CE5A 1G36A 1P05A 1SMFE 1W0YH 2XC4A 4Q7ZA 1H8IH 3TJNA 1GBHA 3P8NA 1GI2A 3LGVA 1WU1A 2ZFQH 5ETXA 1K9OE 5EQQA 1W8BH 1DVAH 2OP9A 2OXSA 1P9SA 4ZHLU 2PHBA 1H4WA 2Z7FE 3PMJA 3UNQA 3MU0A 4X1PU 2PUQH 1SQOA 5GWZA 2A2XH 2W7SA 3ODFA 3EA8A 1BTYA 1EZXC 1E35B 2BDBA 4BXSA 4A7IB 3MYWA 1BCUH 8LPRA 5PTPA 2V3OH 1SVPA 3RXOA 2ZGBH 2ZKSA 3STIA 3A8CA 1DPOA 3RU4T 1TQ0B 1NN6A 4ZXYH 1WBGB 3SUDA 3PLPA 3MTYA 3QLPH 5K7RA 1LHEH 2FTLE 1QFKH 3U69H 1TMBH 3RXFA 1GBAA 2BHGA 2BDAA 1CHOF 1L4DA 2OUAA 3V0XA 1W11U 1H9HE 4WVPE 1SPJA 5J4SA 3UQOA 1GDNA 5ABWA 3T5FH 5EPNA 1UHBB 2UUKB 3UREA 3TH4H 1UCYE 1S5SA 1XUFA 2ZO3H 6CHAB 2D8WA 1AVGH 2ZWLH 5LPRA 2J9NA 3FANA 2QXGA 1MTUA 3M61U 4AN7A 1SLUB 1A3EH 1BUIA 4D7FA 2ZU1A 1UTQA 1GI7B 5HXFA 1ELDE 4Q80A 1KXCA 1DANH 3GCTG 1Z8GA 2ALVA 5F03A 1MBMA 2AMQA 8ESTE 1QB9A 2XCFA 4DT7B 1V2LT 1IQMA 2EA3A 3ZVBA 3EE0B 4X6PA 2BQ6B 1QJ6B 1ZHPA 3P92A 2FP7B 3URDA 5JB8S 1TX6A 1XX9A 3MH5A 4H6TA 4JZ1A 1JWTA 1QBNA 1O5CB 3MWIU 4DVAU 1M9UA 4GPGA 2O8MA 1GJ5H 1SGIB 3ZZ9A 3RXDA 1HJAC 5C1XA 5E0JA 1ZJKA 3NZIA 4OS2A 5C3NA 4ABAA 5E2PA 1HDTH 1Y5UT 2XNIA 3IITA 1NRSH 4O3TA 1SQTA 2C8WB 3H7OA 1ELCA 2AYWA 2B5TB 2FOEA 1BTPA 1BQYA 1O39A 2A4GA 1FXYA 1GHZA 2Z6BD 1FIZA 3A8DA 5T6DA 1YPEH 3SI3H 1JBUH 2HVXA 3QTVH 5LPEA 2H9TH 3FFGA 2FOMB 2G8TA 1MKWK 5A0BA 2XBVA 4BTUB 3RMOH 4JYTA 2G00A 2PLXA 4ZROA 1QGFA 4X1QU 1EAIA 1CA0C 2FS8A 4YO9A 2Z9IA 1QA7A 1C1WH 4BAMB 1F7ZA 1VCWA 3RUOA 3SV6A 4ABFA 1A2CH 4WMEA 1GDQA 2SGFE 2R9PA 4ABJA 3JZ1B 2PV9B 3M7TA 1S6FA 5C5OA 2V0BA 4HFPB 1AUJA 1A0JA 1BZXE 2ZCHP 1HJ8A 3MH7A 3BTEE 2ZTYA 2ULLA 1MAXA 4K2YA 1FJSA 2FOFA 2O8TA 1Y8TA 4AFSA 4JZDH 1O30A 1MZAA 2BD5A 3GCHB 1SGCA 3SV2H 2ZGCA 1P9UA 5DP9A 1BTWA 3KQDA 3MHWU 3PMBB 1W0ZU 4TY7A 1EQ9A 4I7YH 1C1NA 1HFDA 1K28D 3RM0H 2ZHWH 1Z1IA 2JKHA 1S81A 3FZZA 4NFFA 2PTNA 3MO6A 1ELFA 3SUGA 2AGIX 1QTFA 3MNXA 1O3BA 1E37B 3PYHA 3L3TA 1E0FD 2TGTA 1LMWB 1P57B 2ZDNA 3SO3A 1C5VA 1FY1A 1C5LH 2HPQH 1QRXA 3PTBA 4AFQA 1ZGIA 1YP9A 1YGCH 5BRRE 1CGJE 2OC0A 3LGYA 4B73A 1C1OA 1BRCE 2CN0H 1SHHB 3BIUH 2RA0A 3M7QA 1WSSH 1GJDB 1QRWA 5E0HA 3M3TA 1YPGH 2Y6TA 2IPHA 2OD3B 2BD3A 1ID5H 1NFXA 1GGDC 1CA8B 3P95A 4CRCA 4O97A 2P59A 1H8DH 1UMAH 3GDUA 1D3DB 2WPMS 3UIRA 4Y7BA 1K1OA 1OSSA 3Q3KA 5GDSH 3QDZB 3E0NB 1G2MA 4UDWH 4ZHMU 1GWAA 1O2LA 1LQEA 2G5NA 3UWJH 3GCTF 2ZFSA 1GL1A 2G81E 1SGTA 3Q3YA 1ZMLA 4ABGA 3BTDE 1FONA 3G01A 5CHAB 4TWYA 2Y5HA 1RJXB 5DKMA 3EA7A 2PKAA 2TPIZ 2GCTC 2Y81A 5DJ7A 4X1NU 5TCAA 2G52A 2FTMA 2R0LA 2DE8A 2C3SA 3DHKH 3A7YA 2P16A 3SI4H 1IQGA 3VFEA 5CE1A 3A80A 3NCLA 1BMMH 2FYRA 4FVDA 1J14A 1HAGE 1WAYB 1VCPA 1GI9B 1GVKB 4GCHG 1GJBB 2HNTF 2OC1A 2QC2A 4MQAA 1A5HA 1AGJA 3RXBA 1EATA 1D3PB 4UFEH 1ZLRA 1H9LB 2ODYB 2C93B 1W14U 1NROH 5I46H 4Y11E 3RLYH 1CT4E 1UCYH 1Y5BT 2P3TB 2OINA 3OY5U 4DG4A 1NS3A 1SOTA 1DM4B 1UTMA 2OLGA 4GLYA 1S84A 2BOKA 3WY8A 4FUFA 1O3OA 1HAVB 3AVZA 1B7XB 1EKBB 3SJ8A 3LGIA 1KXDA 2ILNA 1O5AB 1TAWA 4CR5A 5GIBA 2Z3CA 1FY3A 1YBWA 2XCNA 4IC5A 2VIDA 1O3CA 1FPHH 3QX5H 1DUEA 1BMAA 4YM9A 3BF6H 5JDUB 4OGXA 4BAQB 4ABIA 2SGQE 2GZ7A 4I8HA 4UFFH 1KDQB 4GVUA 1ESBA 5F8TA 1IQEA 1AFQB 3AASA 2QV1A 4AFUA 3OSYA 4BTTB 5DG6A 2FYQA 4IN1A 3P6ZB 1BRBE 5EPYA 1EB1H 2WUCA 3RXVA 5DO4H 1C1UH 2H1UA 3L33A 1IQJA 2JETC 1UK4A 3GCNA 4FUCA 1HIAB 2FLBH 1TQ7B 3D23A 7ESTE 1XVMA 4RN6A 4CH8B 2PFEA 1G30B 3RXKA 4D9RA 3QO6A 1GBJA 3LJOA 1Q3XA 1SGEE 3GCOA 1DFPA 1C2GA 3P8GA 1D4PB 2H5DA 4LZ4B 3S9BA 5FPSA 3T25A 4D8NA 1GMCG 2TGDA 1T8LA 5AHGH 5A8ZA 1TNLA 1C1RA 3F6UH 4NIVA 1SHYA 1E38B 3D62A 4XSKU 1ZHMA 4FXGH 1V2JT 3LU9B 7GCHG 1QCPA 4I8GA 3TK9A 5JBCS 1F5KU 3RC5A 3NWUA 2ODPA 1EJNA 1P06A 1XUHA 1F5RA 2R2WU 2LPRA 4YOIA 4X2YA 2O8LA 1DSUA 1TGTA 5C5NA 1DWEH 4SGBE 4B75A 2BVSH 1KYNA 5F6MA 1EPTC 1BB0B 2W3KA 5ESBA 4NWLA 1BA8B 2P95A 1RTKA 2H2ZA 3C27B 4AG2A 2FDAA 2Z9KA 2W7UA 1GG6B 1JOUB 5E8EH 3SU2A 2CHAC 4BAHB 1PFXC 1ZSKA 1O2YA 3SGAE 3UWIA 1LPZB 1ACBE 1GBTA 1V2KT 3TJOA 4AORA 2CF9H 1MCTA 3VGCC 1YPJH 4JZFH 2XC0A 4B1TA 1C9PA 2C8ZB 2CF8H 1PQAA 2BX3A 1KTTB 2P93A 2ZHEH 1GBMA 1TGNA 3FP6E 4UFGH 1ETTH 4AYYB 1THSH 1ABIH 5FX5A 1CBWB 3OX7U 1BHXF 1C2DA 1P12E 4KTCA 1LO6A 4CRFA 4BAOB 1V2QT 3V7TA 4U01A 3UNRA 3H5CB 1S6HA 1L4ZA 1GJCB 1MTNC 5LPFA 1YLDA 4AG1A 1TB6H 3SUEA 1V2UT 2UWLA 3FZDA 1E34B 2FX4A 1HAYB 1P11E 5AVDA 3W94A 4BXWA 2O9QA 1GJ7B 2CXVA 4B2BA 1NRPH 2KAIB 4Y8YA 1LHCH 3S7KB 4F4OC 2YNBA 1GI1A 3A83A 2C8XB 2ZFFH 4YLUA 1CQQA 3SOSA 1AZ8A 1TE0A 3O8CA 1JIRA 2NU2E 4E7RG 2EI8A 1P04A 1CT2E 1P0SH 3NK8A 1SGPE 1TGBA 3SHCH 1O2KA 5GCHG 4DGJA 1GBEA 5JBTA 2JETB 1KXAA 2ZFTA 4HGCA 1F0SA 2G55A 1UTLM 1CU1A 2Z3DA 4MVNA 2ZP0H 1UJ1A 2C90B 3D49H 2Y5GA 1GVLA 3T26A 2UWOA 3ENSB 1NY22 1Y3UA 4JMYA 4VGCC 1A1RA 1V2NT 1EX3A 1W7GH 2AFQB 2B9LA 2FMJA 3ZV8A 3ZZCA 1O2MA 1O5BB 2ANWA 1OP0A 1OWJA 1C5ZB 1QNJA 1ZHRA 1O2UA 1N6YA 1XUJA 3ZZ3A 1G3CA 1MBQA 3BV9B 1K1IA 4TPYA 3LC3A 2OQUA 3RXCA 1C1TA 4FU8A 1SB1H 5DP5A 3M5NA 1MQ6A 1MD7A 1MD8A 1ARBA 1O33A 1S0RA 3ATMA 5EXLA 1AKSB 1GCDA 3BEIB 6CHAC 1WV7H 1MTWA 4WMDA 2BXUH 1TLDA 1GMCF 2VIOA 3TH2H 3KIDU 2A0QB 2VH0A 1VJ9U 2J92A 2WV4A 7GCHF 2BLVA 2FXRA 2ZEBA 1C5SA 3S69A 3RM2H 3SQEE 3FVFB 1NU9A 3GY7A 2WUBA 4R0IA 3HK6B 2FI3E 5HGGA 2BQ7B 2GP9B 3TPIZ 1Q31A 2V35A 1KXBA 3A8AA 1AB9B 3S0NA 1AVXA 1C5WB 1ELVA 1SC8U 2BDGA 2W5EA 3KEEA 2XBXA 4ASHA 1C4Y2 4XOJA 1C2IA 1PQ8A 4PROA 2NU0E 2OTVA 1GBBA 5G4BA 1GBDA 2QN5T 1XKBC 2V6NA 8GCHG 5L2YH 2PTCE 2GKVE 4FUDA 2ZQ1A 1ELGA 4CH2B 2M5TA 2Q6FA 2ZU3A 2BB4A 2VVUA 2Q6DA 2Y80A 2ZECA 4DIHH 1BMLA 1BRUP 4OS5A 1DS2E 2CV3A 6GCHG 2WPLS 4DOQA 1WOFA 1RXPA 3VB6A 1KLTA 1EAXA 1IAUA 1THRH 2ZNKH 3HK3B 4E05H 1O2VA 3RMLH 2VWMA 1FZZA 1TPAE 4M7GA 5K0HA 4ESTE 4X8SH 1TA2A 1YPLH 2ZF0H 4VGCB 5L30H 1GBIA 1RRKA 2BDIA 4YTAA 1OYTH 1QL9A 4NSVA 3TVJB 4CHAC 2R0KA 1K2I1 1B0EA 3PV4A 1GBCA 3NPSA 5A09A 1DE7H 5TCCA 1OWHA 4MTBA 4ISIH 1NRNH 1O2ZA 2F3CE 1F0RA 5GCHF 1IQFA 1UVPA 4K1TA 4CRGA 4THNH 2QA9E 3GCHC 3SNDA 1ANDA 1V2OT 4UE7H 3O8DA 2W26A 2J95A 1DSTA 1NO9H 3A8BA 1ELBA 1OWKA 1TMTH 2RA3A 4Y8ZA 5FXLA 4O03A 4AX9H 2FOAA 4XFQA 2VVCA 1C4V2 4ZXXH 1BTZA 1UK2A 5A8XA 1CO7E 2EI6A 2PR3A 2QAAA 3SNAA 5HM2A 3VXEH 3UFAA 1F0TA 3M3VA 4ZKNU 4YT6H 2VGCB 1J16A 1RD3B 3ZZ6A 3W95A 4JK5A 5EODA 2ZCLP 3R3GB 1ESTA 1BBRH 2BD2A 4KTSA 1GHXH 4IN2A 1QRZA 4AB9A 3V3MA 1GHBG 2BD8A 4I33A 4X1RU 1XUIA 5B6OA 1TPPA 2ZPRA 3I78A 4IS5A 3OTJE 3LOXA 3E3TA 4K8BA 1A3BH 1V2RT 1BTUA 1ELTA 2FS9A 1OKXA 3M5MA 3MU8A 2WYGA 2FOHA 2SGDE 2XYAA 3RLWH 3LH3A 1V2VT 3SORA 1THPB 2QIQA 4UFDH 3UTUH 1FPCH 2ZQ2A 4ZKRU 1GHVH 4OS1A 1F92A 1QB1A 1V2MT 4FUHA 1KLIH 4HTCH 3K2UA 1LDTT 1GVZA 1Y3XA 4OGYA 1ZSJA 1MMJN 5CHAC 1CSOE 1GMDG 3BTTE 1KXEA 3QZRA 3A89A 3NXPA 1P2IA 4BNRA 5EG4A 1QURH 1T7CA 3UY9A 3TGIE 3ZVDA 2BMGB 3MNSA 3A84A 1OS8A 1D9IA 2TRMA 2HLCA 3DT0H 4MG3A 3VB7A 1C1PA 2Y82A 4CHAB 8GCHF 1XKAC 3ZZDA 4NIYA 3RXQA 2R2MB 1ZR0A 4Q7YA 1XVOA 2BVXH 1LHDH 1EOLA 4Y79A 1J8AA 1TX8A 2H9HA 2ANYA 3KHVA 1GHAG 1JRSA 4NA9H 3MNBA 4ZAEA 1G3DA 1FY5A 6GCHF 2W3IA 4ISOA 3BG8A 4AOQA 4CBNA 4IMQA 1A61H 1NFUA 2EEKA 1PPBH 5FCKA 1HRTH 3TK5A 1GI0A 1V2WT 3ZV9A 1ZTLA 1ZPBA 2ZDKA 3EA9A 4AGKA 4R8TB 5A0AE 1YF4A 4RSPA 1Z8IB 3SU3A 2ESTE 1O3HA 1TBZH 1OWEA 3ZZ7A 1EPTA 5DPAA 4LZ1H 1IHSH 3DA9B 1YPMH 1AFEH 4I8JA 4A5TS 2F9UA 1AFQC 1TPOA 2ZU5A 1DWDH 4MLFB 1VCQA 2XWBI 5FCRA 3A7TA 4YOGA 4MPUA 3SU6A 1C5YB 1OWIA 3F68H 3KQEA 3BEUA 2ANKH 1ETSH 2ZU2A 2FOCA 2HOBA 1C5PA 1V2PT 3LJJA 5JYIA 2A45B 2ANMH 3M5LA 4UONA 1H1BA 2BZAA 1ZYOA 2AIPA 1G32B 3F1SB 1UVUH 2QF0A 1ZMNA 3DD2H 1C9TA 1WYKA 2FWWA 1UTKA 2XBWA 2OC8A 2VIPA 2NU4E 3ZZ5A 1VGCC 4NZLA 3SU4A 4CRDA 2PGBB 1NTPA 1C2MA 1NC6A 3Q00A 3SW2B 1QBOA 3ZVEA 2ZG0H 1C1SA 2OBQA 1UTPA 9ESTA 1HCGA 3A7WA 5GPIB 2OBOA 4YESB 1HNEE 3SU5A 2ZFRH 2ZIQH 4J1YA 4MNVA 4A1XA 3NUMA 2A1DB 4Y71A 1GHBF 2ODQA 4X6OA 2GMTB 2DUCA 3PLBA 3SGBE 4IC6A 1FY4A 1GCTB 3F9HA 3QWCH 3UUZA 2VWOA 1MUEB 1YCPM 2WYJA 1GG6C 3C1KA 2HRVA 1GJ6A 2BLQA 1FLEE 3EDXB 1O34A 1C2EA 3UNSA 1P2MA 1P09A 1GJ9B 5ESTE 1J9CH 3MU5A 4A92A 2FPZA 2NWNA 3S9CA 3E90B 3Q77A 2AS9A 3SQHE 2ZCKP 1BOQA 1JIMA 1CBWC 1ETRH 2AEIH 5EW2H 4MNWA 2ZPQA 4SGAE 4DCDA 1ZGVA 1GMDF 1MKXH 1MTVA 1O2IA 1UTJA 2Z9JA 1C1QA 2O8UA 3TK6A 4QT8C 2SNWA 1RTFB 1KLJH 1J17T 4LOYH 2BTCE 1PPGE 1QA0A 3QGNB 2PKSB 1O37A 3M37A 1NFYA 4CRAA 5AFZH 1O2QA 3LT3A 1GJ4H 3TH3H 4FU7A 2AMPA 1O5EH 4H42U 1EB2A 4NFEA 4O3UA 1DX5M 3RMNH 2A5IA 3RC4A 3QN7A 1WTGH 4AB8A 4AZ2B 4OS4A 1A0HB 5HM9A 3MU1A 3B9FH 4KELA 1GHAF 4B2AA 1O2HA 3TNSA 1GI8B 1BTXA 3SGQE 3B23B 4X8VH 1O2TA 1UO6A 4K69A 4U2WA 1JXPA 1S82A 2AGEX 4Y7AA 1OOKB 1TALA 4NWKA 3SBKA 4XE4A 4I32A 1SFIA 5FPYA 3O8RA 2J94A 1P3CA 1W12U 4YT7H 1P10A 1T8NA 2BY8X 1DICA 1DLKB 2QXIA 2AMDA 4Y6DA 1VGCB 1T8MA 3ATWA 5JBBS 1SQAA 3LGUA 2XC5A 2FOBA 1C5QA 1EXFA 4GHQA 1BMNH 7KMEH 4I8LA 4AFZA 3KF2A 3HPTB 3ATLA 2SNVA 2D2DA 5L6NH 3ZZ8A 1QJ7B 3SZNA 1L0ZA 5JBAS 3P70B 4X8UH 4MNXA 4X6MA 3DUXH 3RXEA 1XXFA 3SN8A 2GVFA 1HUTH 1OPHB 4JCNA 2VIVA 3A7VA 5EQSA 3ZYEA 4WF8A 2G4UA 3QZQA 3LGTA 2STBE 1PYTC 3SNBA 2BLOA 1ESAA 4B2CA 1P2OA 2CMYA 1PPFE 4TY6A 1GL0E 4E06H 3QK1A 3SU0A 5EU8A 1ORFA 2F83A 1W2KH 2G51A 4JYVH 4MPWA 1MAYA 2NU1E 2GGVB 1K1NA 1O3GA 2UUFB 2Y5FA 3KGPA 3ZVCA 3SV8A 1BIOA 1AD8H 1AB9C 3A7ZA 1QBVH 1S0QA 2GZ9A 3E6PH 1YCPK 5FPTA 4NA8A 2AGGX 1O3DA 1A4WH 2FOGA 3EGKH 1TWXB 4DW2U 4GHTA 1AZZA 1LKAA 1N1LA 1WQVH 2GTBA 1K1PA 1IQNA 1GMHG 1ANBA 1TGCA 1ANEA 3BTQE 3O8BA 1O2GH 4IW4E 5LGOA 1RIWB 2A4QA 3KN2A 1G2LA 1FV9A 4MNYA 2HPPH 4DY7B 1AE8H 1O3FA 2HALA 2FX6A 4Q2KA 4TPIZ 1YC0A 1OWDA 4MPXA 1ZTKA 4YZUA 4U32A 4FUEA 2QYIA 1Z8JB 2BY5X 1AHTH 4H6SB 4B74A 2C8YB 1HAHH 2R3UA 4BTIB 3BTHE 2AH4X 2DE9A 1S85A 4JZIA 4F49A 2Q1JA 1JRTA 4I31A 2AERH 2EC9H 2F9BH 2F9VA 2BY9X 4K5ZA 2TGPZ 1IQHA 3T27A 2BDHA 1PJPA 1GI5A 3EYDA 4NZQA 5E0GA 5EQRA 1P2JA 1FN6A 3MMGA 1IQLA 4GAWA 1TOCB 2VIQA 1TNGA 4CRBA 2XTTB 1O5DH 3CS7A 3PO1B 1LVOA 1C5RA 2K1QA 3MH4A 3ODDA 3E16B 1HAXB 2ZDMA 3RXGA 4DIIH 4WXIA 3GYLB 1UVOA 1GI4A 2J2UA 3P8FA 1C2LA 2Z94A 4ISLA 3A88A 2YNAA 5FBEA 3ZVAA 2VGCC 2SGPE 2VU8E 1GBKA 5GJ4B 9LPRA 2P94A 2ZU4A 4ABHA 1YPKH 3M7UA 1OYQA 1Z8RA 1K21H 3U9AH 3SV9A 2Z3EA 3PLKA 2D1JA 3TNTA 5JB9S 3OYPA 2PSXA 2FEQH 2GT8A 1F5LA 3TITA 1NFWA 5HMAA 3ZVFA 4X8TH 1Y5AT 3STJA 2TGAA 4ZHAA 1BJVA 5C1UA 1O3EA 2WV5A 3P8OA 3RXSA 1DOJA 1AO5A 1O31A 1O3MA 1DDJA 1O2OA 5GXPA 2CJIA 4J2YB 4KP0A 1W13U 4NCYA 3S7HB 2Z9GA 3R0FA 5EGMA 1T31A 1GBLA 3KQBA 4K1EA 1GI6A 1WUNH 1HAVA 1MH0A 3UR6A 1G9IE 1DLEA 1KIGH 1Z6JH 2OC7A 1NZQH 1TPSA 2P8OB 2A5KA 5HYOA 2VH6A 3T62A 3LIWA 3RU4E 2BM2A 1WQSA 8KME2 1MTSA 1MU8B 4O9VA 1O2WA 4Z0KA 4DURA 4DJZB 1KDQA 1K1JA 1GBFA 1O5GH 1CVWH 4OS6A 2BD4A 3PWCA 1PPCE 2A7JA 2A2QH 3RC6A 3MNCA 1ZTJA 3E91A 3UR9A 3K9XB 7LPRA 1Y3VA 5FBIA 1RS0A 3MO9A 3NKKA 2PKAB 1TNKA 3HATH 1P03A 2GV6A 1HIAA 3PB1E 2ZGXH 3I29A 5A0CA 2ZGJA 3UOUA 2A32A 2HGTH 4WJG2 1S83A 3VEQB 4WY3A 1EASA 1GMHF 2F9PA 3CP7A 3E1XB 1AY6H 1C2HA 4B71A 1HBTH 3SU1A 2J4IA 2ZDAH 1NT1A 1G3BA 2VWNA 1FNIA 2LNCA 3P17H 4Z6AH 2GCHF 1IHTH 2GZ8A 4WXVA 5J4QA 1GHWH 1QIXB 1T4VH 2HWLB 1FAKH 3MI4A 1TA6A 4K60A 1VITF 3VB3A 4A6LA 4ZH8A 2V3HH 4AGJA 2BXTH 2A7CA 3UQVA 5DP3A 1ELAA 5A8YA 1O36A 1TNIA 4ZMAH 5LH8A 1O2PA 3B8JA 1HAZB 1SGFG 2FESH 3LH1A 1F0UA 4FU9A 4BAKB 1AN1E 3SNEA 2QGRA 2EI7A 1V3XA 1INCA 1ZRKA 4IMZA 1QL7A 3LC5A 4UD9H 5C67A 3A7XA 4MPVA 2VINA 3FP8E 1SL3A 2WPJS 3VXFH 2BD9A 1O3JA 2JH6D 2FODA 1O3PB 1NU7B 2UUYA 3URCA 1BBRK 1C5OH 2VNTA 4B76A 1ANCA 1HXEH 3MU4A 2BX4A 4K8YA 1HLTH 1DY8A 3ZZAA 3HKJB 5H4IB 4BANB 4ABBA 3HKIB 1VZQH 4E7NA 2JH5D 1ZPCA 4UEHH 6LPRA 4CR9A 2H6MA 2PW8H 1A0LA 1Y59T 1DXWA 4U30A 3V12A 3FAOA 3BTME 1OP8A 1AWHB 4KKDA 1BDAA 2WPKS 2BOHB 3PMAB 2RG3A 1LVBA 5A2MH 1ABJH 1TRNA 3BN9A 3BTWE 1XXDA 2FI5E 2KAIA 1O3AA 1A46H 2QY0B 5L2ZH 1P2KA 3RXHA 1P8VC 4X2VA 1SSXA 1BITA 2GMTC 1YPHE 1GCTC 2F9NA 4LK4A 4X6NA 1SGNE 1NM6A 3RDZA 4WWYA 4RKJB 1YPHC 3MFJA 1AMHA 3SJ9A 3LGWA 1LHGH 1P3EA 1WTHD 1P2NA 3PMHB 3A85A 1TFXA 4FUBA 3U8OH 5F8XA 1SOZA 1MKWH 1PPEE 1QQUA 1FDPA 5BPEA 2QXHA 1BT7A 3RXAA 1HV7A 1IQKA 3SUFA 1KY9A 1Y3YA 4I8KA 2B0FA 1Z7KA 3LKWA 1C2FA 4ABDA 1TIOA 3Q3XA 1NPMA 3M36A 1W7XH 1C2JA 3IG6B 4ISHH 1PPZA 1SGRE 2ZI2H 4WMFA 5FX6A 1QB6A 2BY6X 1DWBH 3ATKA 1X7AC 1GPZA 1BRAA 3SNCA 1CGHA 1BHXB 2PKSC 2TBSA 5EXMA 1SR5C 3CENA 1AKSA 1LCYA 1YKTA 1EZQA 3SHAH 1P02A 4D7GA 2IOTA 2BY7X 3CS0A 3VB5A 4XBCA 4HZHA 3OU0A 3U1JB 5IDKA 2GD4B 3BTGE 4D9QA 3ZYDA 4JZEH 5DGJA 2YOLA 1TNHA 1C2KA 2BQWB 3U98H 3TGJE 1G37A 1MQ5A 2GV7A 3BIVH 3SV7A 2VB0A 1Z1JA 1EUFA 2XW9A 1QY6A 3LPRA 2BDYA 2XRCA 2H9EH 2ZTXA 2QCYA 1SGQE 2THFB 3RXPA 4D76A 1AUTC 1T32A 2FIRH 4Y0YE 1B5GH 2I6QA 3UPEA 4XDEA 1K1MA 1HGTH 1UVTH 1OX1A 1IQIA 3V13A 1TGSZ 1SGFA 1RGQA 2G4TA 2I6SA 3AW1A 1OP2A 1UVSH 2SFAA 4FUGA 2RCEA 3A87A 1ZRBA 4ABEA 2CGAA 1FUJA 1K22H 2Z9LA 5FAHA 3GDVA 1AI8H 1D6WA 1LTOA 1V2TT 2P3UB 1HAIH 4Y76A 4MDSA 1HJAB 3BEFB 3M35A 2GX4A 2IN2A 1SG8B 1FN8A 3QTOH 2JH0D 1L2EA 4FUJA 1O2XA 4KTUA 1A7SA 3FP7E 2TIOA 3KNXA 2A7HA 1AIXH 1GHYH 3E0PB 1KSNA 3ESTA 1QHRB 2GDDA 3RXUA 4A1VA 3K6YA 3K6ZA 1LKBA 2GT7A 1L1GA 2H5CA 1TYNA 3OY6U 1L1JA 1DY9A 5DP6A 3SJOA 3ZZBA 1LPKB 3KQCA 1DWCH 4INHA 1VR1H 1UCYK 4OS7A 2ZTZA 1H9IE 4TWWA 1ZMJA 5E2OA 1CA0B 3RMMH 1EOJA 4Q7XA 2B7DH 3TIUA 1MKXK 1C5NH 1O3IA 3GY6A 4RKOB 1SBWA 1EAWA 3JZ2B 2NU3E 5T6FA 1O3NA 3TU7H 2A5AA 3F9FA 4ZKOU 1NESE 2IJOB 1QJ1B 3TJUA 3ATIA 1MCVA 3H7TA 3TGKE 1HB0B 1BTHH 1QQ4A 2F9OA 1YM0A 1UHBA 1DXPA 3U1IB 1SLVB 4XBBA 3M5OA 1RIWC 5CMXH 1CGIE 2WPHS 2D26C 3GYMA 3HGNA 5C1YA 3ZVGA 1Z71A 1G3EA 3L6PA 1YLCA 1P01A 4WH8A 1ZSLA 2A31A 5AFYH 1TRMA 3HGPA 1YYY1 1GI3A 5AF9H 1O2RA 2SGAA 4JK6A 4INKA 1P2QA 5T6GA 5DP7A 4ZKSU 1UK3A 3KCGH 3BSQA 2P3FH 2B8OH 1FIWA 2J38A 3AAUA 1FY8E 2R3YA 2VWLA 1L1NA 1V6DA 1OXGA 1GJAB 2Y7ZA 4H4FA 2ZDLA 4XBDA 1TMUH 3M3SA 3RXRA 3T2NA 3TLOA 1VJAU 3EQ0H 1TBQH 4JYUH 4WH6A 3RP2A 3RXIA 1HYLA 1O3LA 1CHGA 5FHTA 3UOPA 3QGJA 1RTLA 1IOEA 2G5VA 1T4UH 5I25A 1GGDB 5EW1H 4NIXA 3A86A 2F91A 3ZZ4A 5C20A 3PO1C 3LDXH 1ZOMA 3GICB 1LVMA 4CREA 4K1SA 2ALPA 1K1LA 1TRYA 4AYVB 1HXFH 2ZFPH 3RXJA 1XMNB 1V2ST 1MZDA 1C5MD 1Q2WA 3LONA 3F9GA 2PUXB 1PYTD 1ZPZA 1SGDE 1O2JA 1AQ7A 1EP6A 4IBLH 2Q6GA 3E8LA 1A5IA 3SJIA 4GUXA 5JPMH 3ELAH 2ZGHA 2GCTB 1AWFH 2ASUB 4FUIA 1SFQB 2XWAA 2FM2A 3DFJA 4X2XA 3BG4C 1ARCA 1PPHE 1O2NA 3S9AA 5C2ZA 1LVYA 1SLXB 1W10U 2VIWA 5IYTA 2RDLA 4BOHA 4Y0ZE 1D6RA 4TYDA 3GOVB 4LXBH 3F9EA 3PTNA 3GDSA 4X0WU 2BLWA 1KXFA 1C5UA 1QR3E 2J34A 1SI5H 5EOKA 1NRQH 1N8OC 2ZHFH 2VJ1A 2A4RA 1C1MA 1O38A 1FAXA 1AU8A 4YLQH 2ZPSA 1ELEE 1NRRH 4HI3A 3SJKA 1YCPH 3GY2A 1SGYE 2P8OC 3PM3A 3PROA 2FLRH 1BBRE 4X2WA 2ZA5A 3KL6A 1JMOH 3QUMP 1XM1A 5TJXA 2GCHG 1UTNA 5T3HA 1VITG 4KGAA 3VB4A 3GY3A 3ITIA 3I77A 1RFNA 1HAOH 2XXLA 1BJUA 1VITH 2ZHQH 3K65B 2BDCA 1EZSC 4GCHF 3IWMA 1ZZZA 1FI8A 4YOJA 5DP8A 3GISB 4Y8XA 2ZC9H 1CT0E 2A4OA 1MU6B 2PSYA 1HAPH 1CHOG 4NIWA 1A5GH 2FI4E 4NGAH 2HNTE 1E36B 1LHFH 1J15A 3GY8A 2SGEE 4FVBA 1PQ7A 1F2SE 2WPIS 1FQ3A 4ISNA 1TONA 2QF3A 2PGQB 2HNTC 1O3KA 3A82A 1D3TB 1LPGB 3T28A 3PWBA 3RXLA 3GY4A 1C5TA 1Z6EA 3D65E 3BTFE 1O35A 2UUJB 1ZJDA 3MO3A 1O2SA 3A81A 2STAE 6ESTA 1T8OA 2OQ5A 2FO9A 1O0DH 3N7OA 3GY5A 3AW0A 1WCZA 1O5FH 3VPKA 1TBRH 4A1TA 1W3CA 1XUKA 3DFLA 2ZHDA 2AIQA 2OCVB 1AVWA 4NG9H 4Y10E 2ZDVH 1EPTB 1EAUA 3U8TH 3BTKE 1TOMH 4X1SU 4INLA 3TJVA 4IGDA 1GJ8B 1EJAA 3MH6A 1TX7A 2FZZA 2CHAB 2ZZUH 1KTSB 3BG4B 1TABE 1LQDB 1XUGA 5DK1A 1GDUA 1DT2A 1Y3WA 3MOCA 5F8ZA 3VGCB 1EJMA 4NA7A 1O32A 1HPGA 2GDEH 1C5XB 2BVRH 5DP4A 1C4U2 5SGAE 1N8OB 1AE5A 3Q76A 2PWXA 2BZ6H 1UTOA 3RXTA 1U6QA 2VVVA 1EP5A 2BD7A 1SLWB 2XBYA 3U8RH 2BYAX 2O8WA 1MTNB 2WINI 2QXJA 2UWPA 1C1VH
chains in the Genus database with same CATH superfamily
1HJ9A 2C4FH 4CBOA 4GSOA 3EAJA 5EXNA 4NSYA 4Z1MD 1B0FA 1DITH 1FMGA 1PQ5A 1TNJA 3RU4D 4K3JA 1D3QB 4ZUHA 1QL8A 3AAVA 1DUAA 1N6XA 3RXMA 3T29A 1EZUC 2Y7XA 1CE5A 1G36A 1P05A 1SMFE 1W0YH 2KM0A 2XC4A 4Q7ZA 1H8IH 3TJNA 1GBHA 3P8NA 1GI2A 3LGVA 1WU1A 2M2AA 2ZFQH 5ETXA 1K9OE 5EQQA 3DSOA 1W8BH 1DVAH 2OP9A 2OXSA 1P9SA 4ZHLU 2WV9A 2PHBA 1H4WA 2Z7FE 3PMJA 3UNQA 4M9FA 3MU0A 4X1PU 2PUQH 1SQOA 5GWZA 2A2XH 2W7SA 3ODFA 3EA8A 1BTYA 1EZXC 1E35B 2BDBA 4BXSA 4A7IB 3MYWA 1BCUH 8LPRA 5PTPA 2V3OH 1SVPA 3RXOA 2ZGBH 2ZKSA 3STIA 3A8CA 1DPOA 3RU4T 1TQ0B 1NN6A 4ZXYH 1VKYA 1WBGB 3SUDA 3PLPA 3MTYA 3QLPH 5K7RA 1LHEH 2FTLE 1QFKH 3U69H 1TMBH 3OE7D 3RXFA 1GBAA 2BHGA 2BDAA 1CHOF 1L4DA 2OUAA 3V0XA 2OK5A 1W11U 1H9HE 4WVPE 1SPJA 5J4SA 3UQOA 1GDNA 5ABWA 3KQ5A 3T5FH 5EPNA 1UHBB 2UUKB 3UREA 3TH4H 1UCYE 1S5SA 1XUFA 2ZO3H 3KYFA 6CHAB 2D8WA 1AVGH 2ZWLH 5LPRA 2J9NA 3FANA 2J97A 2QXGA 1MTUA 3M61U 4AN7A 1SLUB 1A3EH 1BUIA 4D7FA 2ZU1A 1UTQA 1GI7B 5HXFA 2J98A 1ELDE 4Q80A 4ZCNA 1KXCA 1DANH 3GCTG 1Z8GA 2ALVA 5F03A 1MBMA 2AMQA 8ESTE 1QB9A 2XCFA 4DT7B 1V2LT 1IQMA 2EA3A 3ZVBA 3EE0B 4X6PA 2BQ6B 1QJ6B 1ZHPA 3P92A 2FP7B 3URDA 5JB8S 1TX6A 1XX9A 3MH5A 4H6TA 4JZ1A 1JWTA 1QBNA 1O5CB 3MWIU 4DVAU 1M9UA 4GPGA 2O8MA 1GJ5H 1SGIB 2RDEA 3ZZ9A 3RXDA 1HJAC 5C1XA 5E0JA 1ZJKA 3NZIA 4OS2A 5C3NA 4ABAA 5E2PA 1HDTH 1Y5UT 2XNIA 4AC9A 3IITA 1NRSH 4O3TA 1SQTA 2C8WB 3H7OA 1ELCA 5HIZA 2LP6A 2AYWA 2B5TB 2FOEA 1BTPA 1BQYA 1O39A 2A4GA 1FXYA 1GHZA 2Z6BD 1FIZA 3A8DA 5T6DA 1YPEH 3SI3H 1JBUH 2HVXA 3QTVH 5LPEA 2H9TH 3FFGA 2FOMB 2G8TA 1MKWK 3SYJA 5A0BA 2XBVA 4BTUB 3RMOH 4JYTA 2G00A 2PLXA 3W1EA 4ZROA 1QGFA 4X1QU 1EAIA 1CA0C 2FS8A 4YO9A 2Z9IA 1QA7A 1C1WH 4BAMB 1F7ZA 1VCWA 3FO8D 3RUOA 3SV6A 4ABFA 1A2CH 1W0JD 1GDQA 2SGFE 2R9PA 4WMEA 3JZ1B 4ABJA 2PV9B 4FOUC 3M7TA 1S6FA 5C5OA 2V0BA 4HFPB 1AUJA 2XNDD 1A0JA 1BZXE 2L6OA 1MABB 2ZCHP 1HJ8A 3MH7A 3BTEE 2ZTYA 2ULLA 1MAXA 4K2YA 1FJSA 2FOFA 2O8TA 1Y8TA 4AFSA 4JZDH 1O30A 1MZAA 2BD5A 3GCHB 1SGCA 3SV2H 5B6LA 2ZGCA 3F0OA 1P9UA 5DP9A 1BTWA 3KQDA 3MHWU 3PMBB 1W0ZU 4TY7A 1EQ9A 4I7YH 1C1NA 1HFDA 1K28D 3RM0H 2ZHWH 1Z1IA 2JKHA 2EY4C 1S81A 3FZZA 4NFFA 2PTNA 3MO6A 1ELFA 3SUGA 2AGIX 1QTFA 3MNXA 1O3BA 1E37B 3PYHA 3L3TA 1E0FD 2TGTA 1LMWB 1P57B 2ZDNA 3SO3A 1C5VA 1FY1A 1C5LH 2HPQH 1QRXA 3PTBA 4AFQA 1ZGIA 1YP9A 1YGCH 5BRRE 1CGJE 2OC0A 3LGYA 2KCPA 4B73A 1C1OA 1BRCE 2CN0H 1SHHB 3BIUH 2RA0A 4B6FA 3M7QA 1WSSH 1GJDB 2WSSD 1QRWA 5E0HA 3M3TA 1YPGH 2V7QD 2Y6TA 2IPHA 2OD3B 2BD3A 1ID5H 1NFXA 1GGDC 1CA8B 3P95A 4CRCA 4O97A 2P59A 1H8DH 1UMAH 3GDUA 1D3DB 4TSFD 2WPMS 3UIRA 4Y7BA 1K1OA 1OSSA 3Q3KA 5GDSH 3QDZB 3EE7A 3E0NB 1G2MA 4UDWH 4ZHMU 1GWAA 2IPQX 1O2LA 1LQEA 2G5NA 3UWJH 3GCTF 2ZFSA 1GL1A 2KFWA 2G81E 1SGTA 3Q3YA 2JDID 1ZMLA 4ABGA 3BTDE 1FONA 3G01A 5CHAB 4TWYA 2Y5HA 1RJXB 5DKMA 3EA7A 2PKAA 2TPIZ 2GCTC 2Y81A 3FOAA 5DJ7A 4X1NU 5TCAA 2G52A 2FTMA 2R0LA 2DE8A 2C3SA 3DHKH 3A7YA 2P16A 3SI4H 1IQGA 3VFEA 5CE1A 3A80A 3NCLA 1BMMH 2FYRA 4ACAA 4FVDA 1J14A 1HAGE 1WAYB 1VCPA 2AHME 1GI9B 1GVKB 4GCHG 1GJBB 2HNTF 2OC1A 2QC2A 4MQAA 1A5HA 1AGJA 3RXBA 1EATA 1D3PB 4UFEH 1ZLRA 2EQNA 1H9LB 1W14U 2C93B 2ODYB 1NROH 5I46H 4Y11E 3RLYH 1CT4E 1UCYH 1Y5BT 2KCOA 2OINA 2P3TB 3OY5U 4DG4A 1NS3A 1SOTA 1DM4B 1UTMA 2OLGA 4GLYA 1S84A 3PV5A 2BOKA 3WY8A 3OEED 4FUFA 2YMSB 1O3OA 1HAVB 3AVZA 1B7XB 1EKBB 3SJ8A 3LGIA 1KXDA 2ILNA 2JJ2D 2QE7D 1O5AB 1TAWA 4CR5A 5GIBA 2Z3CA 1FY3A 1YBWA 2XCNA 4IC5A 2VIDA 1O3CA 1FPHH 3QX5H 1DUEA 1BMAA 4YM9A 3BF6H 5JDUB 4OGXA 4BAQB 4ABIA 2SGQE 2GZ7A 4I8HA 4UFFH 1KDQB 4GVUA 1ESBA 5F8TA 1IQEA 1AFQB 3AASA 2QV1A 4AFUA 3OSYA 4BTTB 5DG6A 2FYQA 4IN1A 3P6ZB 1BRBE 5EPYA 1EB1H 2WUCA 3RXVA 5DO4H 1C1UH 2H1UA 3L33A 1IQJA 2JETC 1UK4A 3GCNA 4FUCA 1HIAB 2FLBH 1TQ7B 3D23A 7ESTE 1XVMA 4RN6A 4CH8B 2PFEA 1G30B 3RXKA 4D9RA 3QO6A 1GBJA 3LJOA 1Q3XA 1SGEE 3GCOA 1DFPA 1C2GA 3P8GA 1D4PB 2H5DA 4LZ4B 3S9BA 5FPSA 3T25A 4D8NA 1GMCG 2TGDA 1T8LA 5AHGH 5A8ZA 1TNLA 1C1RA 3F6UH 4NIVA 1SHYA 1E38B 3D62A 4XSKU 1ZHMA 4FXGH 1V2JT 3LU9B 7GCHG 1QCPA 1SKYE 3H09A 4I8GA 3TK9A 5JBCS 1F5KU 3RC5A 3NWUA 1E1QD 2ODPA 1EJNA 1P06A 1XUHA 1F5RA 2R2WU 2LPRA 4YOIA 4X2YA 2O8LA 1DSUA 1TGTA 5C5NA 1DWEH 4SGBE 4B75A 2BVSH 1KYNA 5F6MA 1EPTC 1BB0B 2W3KA 5ESBA 4NWLA 1BA8B 2P95A 1RTKA 2H2ZA 3C27B 4AG2A 2FDAA 2Z9KA 2W7UA 1GG6B 1JOUB 5E8EH 3SU2A 2CHAC 4BAHB 1PFXC 1ZSKA 1O2YA 3SGAE 3UWIA 1OHHD 1LPZB 1ACBE 1GBTA 1V2KT 3TJOA 4AORA 2CF9H 2QF5A 1MCTA 3VGCC 1YPJH 4JZFH 2XC0A 4B1TA 1C9PA 2C8ZB 2CF8H 1PQAA 2BX3A 1KTTB 2P93A 2ZHEH 1GBMA 1TGNA 3FP6E 4UFGH 1ETTH 4AYYB 1THSH 1ABIH 5FX5A 1CBWB 3OAAD 3OX7U 1BHXF 1C2DA 1P12E 4KTCA 1LO6A 4CRFA 4BAOB 1V2QT 3V7TA 4U01A 3UNRA 3H5CB 1S6HA 3UB0A 1L4ZA 1GJCB 1MTNC 5LPFA 1YLDA 4AG1A 5IK2D 1TB6H 3SUEA 1V2UT 2UWLA 3FZDA 1E34B 2FX4A 1HAYB 1P11E 5AVDA 3W94A 4BXWA 2O9QA 1GJ7B 2CXVA 4B2BA 1NRPH 2KAIB 4Y8YA 1LHCH 3S7KB 4F4OC 2YNBA 1GI1A 3A83A 2C8XB 2ZFFH 4YLUA 1CQQA 3SOSA 1AZ8A 1TE0A 3O8CA 1JIRA 2NU2E 4E7RG 2EI8A 1P04A 1CT2E 1P0SH 3NK8A 1SGPE 1TGBA 3SHCH 1O2KA 5GCHG 4DGJA 1GBEA 5JBTA 2JETB 1KXAA 2ZFTA 4HGCA 1F0SA 2G55A 1UTLM 1CU1A 2Z3DA 4MVNA 2ZP0H 1UJ1A 2C90B 3D49H 2Y5GA 1GVLA 3T26A 2UWOA 3ENSB 1NY22 1Y3UA 4JMYA 4VGCC 1A1RA 1V2NT 1EX3A 1W7GH 2AFQB 2B9LA 2FMJA 3ZV8A 3ZZCA 1O2MA 1O5BB 2ANWA 1OP0A 1OWJA 1C5ZB 1QNJA 1ZHRA 1O2UA 1N6YA 1XUJA 3ZZ3A 1G3CA 1MBQA 3BV9B 1K1IA 4TPYA 3LC3A 2OQUA 3RXCA 1C1TA 4FU8A 1SB1H 5DP5A 3M5NA 1MQ6A 1MD7A 1MD8A 1ARBA 3WWFA 1O33A 1S0RA 3ATMA 5EXLA 1AKSB 1GCDA 3BEIB 3FKSD 6CHAC 1WV7H 1MTWA 4WMDA 2BXUH 1TLDA 1FX0B 1GMCF 2VIOA 5HIYA 3TH2H 3KIDU 2XOKD 2A0QB 2VH0A 1VJ9U 2J92A 2WV4A 7GCHF 2BLVA 2FXRA 2ZEBA 1C5SA 3S69A 3RM2H 3SQEE 3FVFB 1NU9A 3GY7A 2WUBA 4R0IA 3HK6B 2FI3E 5HGGA 2BQ7B 2GP9B 3TPIZ 1Q31A 2V35A 1KXBA 3A8AA 1AB9B 3S0NA 1AVXA 1C5WB 1ELVA 1SC8U 2BDGA 2W5EA 3KEEA 2XBXA 4ASHA 1C4Y2 4XOJA 1C2IA 5C17A 1PQ8A 4PROA 2NU0E 2OTVA 1EFRD 1GBBA 5G4BA 1GBDA 2QN5T 1XKBC 2V6NA 8GCHG 5L2YH 2PTCE 2GKVE 4FUDA 2ZQ1A 1ELGA 4CH2B 2M5TA 2Q6FA 2ZU3A 2BB4A 2VVUA 2Q6DA 2Y80A 2ZECA 4DIHH 5KEDA 2HVYB 1BMLA 1BRUP 4OS5A 1DS2E 2CV3A 6GCHG 2WPLS 2LELA 1COWD 4DOQA 1WOFA 1RXPA 1S6LA 3VB6A 1KLTA 1EAXA 1IAUA 1THRH 2ZNKH 3HK3B 4E05H 1O2VA 3RMLH 2VWMA 1FZZA 1TPAE 4M7GA 5K0HA 4ESTE 4X8SH 1TA2A 1YPLH 2ZF0H 4VGCB 5L30H 1GBIA 1RRKA 2BDIA 4YTAA 1OYTH 1QL9A 4NSVA 3TVJB 4CHAC 2R0KA 1K2I1 1B0EA 3PV4A 1GBCA 3NPSA 5A09A 1DE7H 5TCCA 1OWHA 4MTBA 4ISIH 1NRNH 1O2ZA 3OEHD 4ASUD 2F3CE 1F0RA 5GCHF 1IQFA 1UVPA 4K1TA 1QZ8A 4CRGA 4THNH 2QA9E 3GCHC 4RI0A 3SNDA 1ANDA 1V2OT 4UE7H 3O8DA 2W26A 2J95A 1DSTA 1NO9H 3A8BA 1ELBA 1OWKA 1TMTH 2RA3A 4Y8ZA 5FXLA 4O03A 4AX9H 2FOAA 4XFQA 2VVCA 1C4V2 1SQRA 4ZXXH 1BTZA 1UK2A 5A8XA 1CO7E 2EI6A 2PR3A 2QAAA 3SNAA 5HM2A 3VXEH 3UFAA 1F0TA 3M3VA 3NRLA 4ZKNU 4YT6H 2VGCB 1J16A 1RD3B 3ZZ6A 3W95A 4JK5A 5EODA 2ZCLP 3R3GB 4RT0A 1ESTA 1BBRH 2BD2A 4KTSA 1GHXH 4IN2A 1QRZA 4AB9A 3V3MA 1GHBG 2BD8A 4I33A 4X1RU 1XUIA 5B6OA 1TPPA 2ZPRA 3I78A 4XRNA 4IS5A 3OTJE 3LOXA 3E3TA 4K8BA 4Q63A 1A3BH 1V2RT 1BTUA 1ELTA 2FS9A 1OKXA 3M5MA 3MU8A 2WYGA 2FOHA 2SGDE 2XYAA 3RLWH 3LH3A 1V2VT 3SORA 1THPB 2QIQA 4UFDH 3UTUH 1FPCH 2ZQ2A 4ZKRU 1GHVH 4OS1A 1F92A 1QB1A 1V2MT 4FUHA 1KLIH 3U28C 4HTCH 3K2UA 1LDTT 1GVZA 1Y3XA 4OGYA 1ZSJA 1MMJN 5CHAC 1CSOE 1GMDG 3BTTE 1KXEA 3QZRA 3A89A 3NXPA 2K8IA 1P2IA 4BNRA 5EG4A 1QURH 1T7CA 3UY9A 3TGIE 3ZVDA 2BMGB 3MNSA 4F48B 3A84A 1OS8A 1D9IA 2TRMA 1BMFD 2HLCA 3DT0H 4MG3A 3VB7A 1C1PA 2Y82A 4CHAB 8GCHF 1XKAC 3ZZDA 4NIYA 3RXQA 2R2MB 1ZR0A 4Q7YA 3F0PA 1XVOA 2BVXH 1LHDH 1EOLA 4Y79A 1J8AA 1TX8A 2H9HA 2ANYA 3KHVA 1GHAG 1JRSA 4NA9H 3MNBA 4ZAEA 1G3DA 1FY5A 6GCHF 2W3IA 4ISOA 3BG8A 4AOQA 4CBNA 2YMSC 4IMQA 1A61H 1NFUA 2EEKA 1PPBH 2YMSD 5FCKA 1HRTH 3TK5A 1GI0A 1H8HD 1V2WT 3ZV9A 1ZTLA 1ZPBA 2ZDKA 3EA9A 4AGKA 4R8TB 1W0KD 1YF4A 5A0AE 4RSPA 1Z8IB 3SU3A 2ESTE 1O3HA 1TBZH 1OWEA 3ZZ7A 1EPTA 4TT3D 5DPAA 4LZ1H 1IHSH 3DA9B 1YPMH 1AFEH 4I8JA 4A5TS 2F9UA 1AFQC 1TPOA 2ZU5A 1DWDH 4MLFB 1VCQA 2XWBI 5FCRA 3A7TA 4YOGA 4MPUA 3SU6A 1C5YB 1OWIA 3F68H 3KQEA 3BEUA 2ANKH 1ETSH 2ZU2A 2FOCA 2HOBA 1C5PA 1V2PT 1YWUA 3LJJA 5JYIA 2A45B 2ANMH 3M5LA 4UONA 2L74A 1H1BA 2BZAA 1ZYOA 2AIPA 5DSFA 1G32B 3F1SB 1UVUH 2QF0A 1ZMNA 3DD2H 1C9TA 1WYKA 1NBME 2FWWA 1UTKA 2XBWA 2OC8A 2VIPA 2NU4E 3ZZ5A 1VGCC 4NZLA 3SU4A 3ZIAD 4CRDA 2PGBB 1NTPA 1C2MA 1NC6A 3Q00A 3SW2B 1QBOA 3ZVEA 2ZG0H 1C1SA 2OBQA 1UTPA 9ESTA 1HCGA 3A7WA 5GPIB 2OBOA 4YESB 1HNEE 3SU5A 2ZFRH 2ZIQH 4ACBA 4J1YA 4MNVA 4A1XA 3NUMA 2A1DB 4Y71A 1GHBF 2ODQA 4X6OA 2GMTB 2DUCA 3PLBA 3SGBE 4IC6A 1FY4A 1GCTB 3F9HA 3QWCH 3UUZA 2VWOA 1MUEB 1YCPM 2WYJA 1GG6C 2QF4A 3C1KA 2HRVA 1GJ6A 2BLQA 1FLEE 3EDXB 1O34A 1C2EA 3UNSA 1P2MA 1P09A 1GJ9B 5ESTE 1J9CH 3MU5A 4A92A 2FPZA 3DSPA 2NWNA 3S9CA 3E90B 3Q77A 2AS9A 3SQHE 2ZCKP 1BOQA 1JIMA 1CBWC 3AK5A 1ETRH 2AEIH 5EW2H 4MNWA 2ZPQA 4SGAE 4DCDA 1ZGVA 3PRDA 1GMDF 1MKXH 1MTVA 1O2IA 1UTJA 2Z9JA 1C1QA 4I86A 2O8UA 3TK6A 4QT8C 2SNWA 1RTFB 1KLJH 1J17T 4LOYH 2BTCE 1PPGE 2WZQA 1QA0A 3QGNB 2PKSB 1O37A 3M37A 1NFYA 4CRAA 5AFZH 1O2QA 3LT3A 1GJ4H 3TH3H 4FU7A 2AMPA 1O5EH 4H42U 2K0QA 1EB2A 5KECA 4NFEA 4O3UA 1DX5M 3RMNH 2A5IA 3RC4A 3QN7A 1WTGH 4AB8A 4AZ2B 4OS4A 1A0HB 5HM9A 3MU1A 3B9FH 4KELA 1GHAF 2W6ID 4B2AA 1O2HA 3TNSA 1GI8B 1BTXA 3SGQE 2WHXA 3B23B 4X8VH 1O2TA 1UO6A 4K69A 4U2WA 1JXPA 1S82A 2AGEX 4Y7AA 1OOKB 1TALA 4NWKA 3SBKA 4XE4A 4I32A 1SFIA 5FPYA 3O8RA 2J94A 1P3CA 1W12U 4YT7H 1P10A 1T8NA 2BY8X 1DICA 1DLKB 2QXIA 2AMDA 4Y6DA 1VGCB 1T8MA 3ATWA 5JBBS 1SQAA 3LGUA 2XC5A 2FOBA 4OM9A 1C5QA 1EXFA 4GHQA 1BMNH 7KMEH 4I8LA 1YY3A 4AFZA 3KF2A 3HPTB 3ATLA 2SNVA 2D2DA 5L6NH 3ZZ8A 4Q4LA 1QJ7B 3SZNA 1L0ZA 5JBAS 3P70B 4X8UH 4MNXA 4X6MA 3DUXH 1KMHB 3RXEA 1XXFA 3SN8A 2GVFA 1HUTH 2KX4A 1OPHB 4JCNA 2VIVA 3A7VA 5EQSA 3ZYEA 4WF8A 2G4UA 3QZQA 3LGTA 2STBE 1PYTC 3FN8A 3SNBA 2BLOA 1ESAA 4B2CA 1P2OA 2CMYA 1PPFE 4TY6A 1GL0E 4E06H 3QK1A 3SU0A 5HKKD 5EU8A 1ORFA 2F83A 1W2KH 2G51A 4JYVH 4HG6A 4MPWA 1MAYA 2NU1E 2GGVB 1K1NA 1O3GA 2UUFB 2J98B 2Y5FA 3KGPA 3ZVCA 3SV8A 1BIOA 1AD8H 1AB9C 3A7ZA 1QBVH 1S0QA 2GZ9A 3E6PH 1YCPK 5FPTA 4NA8A 2AGGX 1O3DA 1A4WH 2FOGA 3EGKH 2KCAA 1TWXB 4DW2U 4GHTA 1AZZA 1LKAA 2PP6A 1N1LA 1WQVH 2GTBA 1K1PA 1IQNA 1GMHG 1ANBA 1TGCA 1ANEA 3F2HA 3BTQE 3O8BA 1O2GH 4IW4E 5LGOA 1RIWB 2A4QA 3KN2A 1G2LA 1FV9A 4MNYA 2HPPH 4DY7B 1AE8H 1O3FA 2HALA 2FX6A 4Q2KA 4TPIZ 1YC0A 5GNDA 1OWDA 4MPXA 1ZTKA 4YZUA 4U32A 4FUEA 2QYIA 1Z8JB 2BY5X 1AHTH 4H6SB 4B74A 2C8YB 1HAHH 2R3UA 4BTIB 3BTHE 2AH4X 2DE9A 1S85A 3DCLA 4JZIA 4F49A 2Q1JA 1JRTA 4I31A 5F53A 2AERH 2EC9H 2F9BH 2F9VA 2BY9X 4K5ZA 2TGPZ 1IQHA 3T27A 2BDHA 1PJPA 1GI5A 3EYDA 4NZQA 5E0GA 5EQRA 1P2JA 1FN6A 3MMGA 1IQLA 4GAWA 1TOCB 2VIQA 1TNGA 4CRBA 2XTTB 1O5DH 3CS7A 3PO1B 1LVOA 1C5RA 2K1QA 3MH4A 3ODDA 3E16B 1HAXB 2ZDMA 3RXGA 4DIIH 4WXIA 3GYLB 1UVOA 1GI4A 2J2UA 3P8FA 1C2LA 2Z94A 4ISLA 3A88A 2YNAA 5FBEA 3ZVAA 2VGCC 2SGPE 2VU8E 1GBKA 5GJ4B 9LPRA 2P94A 2ZU4A 4ABHA 1YPKH 3M7UA 1OYQA 1Z8RA 1K21H 3U9AH 3SV9A 2Z3EA 3PLKA 2D1JA 3TNTA 5JB9S 3OYPA 2PSXA 2FEQH 2GT8A 1F5LA 3TITA 1NFWA 5HMAA 3ZVFA 4X8TH 1Y5AT 3STJA 2TGAA 4ZHAA 1BJVA 5C1UA 1O3EA 2WV5A 3P8OA 3RXSA 1DOJA 1AO5A 1O31A 1O3MA 5KGOA 1DDJA 1O2OA 3GS9A 5GXPA 2CJIA 4J2YB 4KP0A 1W13U 4NCYA 3S7HB 2KCYA 2Z9GA 3R0FA 5EGMA 1T31A 1GBLA 3KQBA 4K1EA 1GI6A 1WUNH 1HAVA 1MH0A 3UR6A 1G9IE 1DLEA 1KIGH 1Z6JH 2OC7A 1NZQH 1TPSA 2P8OB 2A5KA 5HYOA 2VH6A 3T62A 1UW7A 3LIWA 3RU4E 3PV2A 2BM2A 1WQSA 8KME2 1MTSA 1MU8B 4O9VA 1O2WA 4Z0KA 4DURA 4DJZB 1KDQA 1K1JA 1GBFA 1O5GH 1CVWH 4OS6A 2BD4A 3PWCA 1PPCE 2A7JA 2A2QH 3RC6A 3MNCA 1ZTJA 3E91A 3UR9A 3K9XB 7LPRA 1Y3VA 5FBIA 1RS0A 3MO9A 3NKKA 2PKAB 1TNKA 3HATH 1P03A 5C0TA 2GV6A 1HIAA 5DN6D 3PB1E 2ZGXH 3OFND 3I29A 5A0CA 2ZGJA 3UOUA 2A32A 2HGTH 4WJG2 1S83A 3VEQB 4WY3A 1EASA 1GMHF 2F9PA 5EJ1A 3CP7A 3E1XB 1AY6H 1C2HA 4B71A 1HBTH 3SU1A 2J4IA 2ZDAH 1NT1A 1G3BA 2VWNA 1FNIA 2LNCA 3P17H 4Z6AH 2GCHF 1IHTH 2GZ8A 4WXVA 5J4QA 1GHWH 1QIXB 4RT1A 1T4VH 2HWLB 1FAKH 2KR7A 1TA6A 3MI4A 1VITF 4K60A 3VB3A 4A6LA 2F43B 4ZH8A 2V3HH 4AGJA 2BXTH 2A7CA 3UQVA 5DP3A 1ELAA 5A8YA 3F2FA 1O36A 1TNIA 4ZMAH 5LH8A 1O2PA 3B8JA 1HAZB 1SGFG 4DT4A 2FESH 3LH1A 1F0UA 4FU9A 4BAKB 3F2GA 1AN1E 3SNEA 2QGRA 2EI7A 1V3XA 1INCA 1ZRKA 4IMZA 1QL7A 3LC5A 4UD9H 5C67A 3A7XA 4MPVA 2VINA 3FP8E 1SL3A 2WPJS 3VXFH 2BD9A 1O3JA 2JH6D 2FODA 1O3PB 1NU7B 2UUYA 3URCA 1BBRK 1C5OH 2VNTA 4B76A 1ANCA 1HXEH 3MU4A 2BX4A 4K8YA 1HLTH 1DY8A 3ZZAA 3HKJB 5H4IB 4BANB 4ABBA 3CNRA 3HKIB 1VZQH 4E7NA 2JH5D 1ZPCA 4UEHH 6LPRA 4CR9A 2H6MA 4P02A 2PW8H 1A0LA 1Y59T 1DXWA 4U30A 3V12A 3FAOA 3BTME 1OP8A 1AWHB 4KKDA 1BDAA 2WPKS 2BOHB 3PMAB 2RG3A 1LVBA 5A2MH 1ABJH 1TRNA 3BN9A 3BTWE 1XXDA 2FI5E 2KAIA 1O3AA 1A46H 3N7DA 2QY0B 5L2ZH 1P2KA 3RXHA 1P8VC 4X2VA 1SSXA 1BITA 2GMTC 1YPHE 3DSGA 2HLDD 1GCTC 2F9NA 4LK4A 4X6NA 1SGNE 1NM6A 3RDZA 4WWYA 4RKJB 1YPHC 3MFJA 1AMHA 3SJ9A 3LGWA 1LHGH 1P3EA 1WTHD 1P2NA 3PMHB 3A85A 1TFXA 4FUBA 3U8OH 5F8XA 1SOZA 1MKWH 1PPEE 1QQUA 1FDPA 5BPEA 2QXHA 1BT7A 3RXAA 1HV7A 1IQKA 3SUFA 1KY9A 1Y3YA 3UAIC 4I8KA 2B0FA 1Z7KA 3LKWA 1C2FA 4ABDA 1TIOA 3Q3XA 1NPMA 3M36A 1W7XH 1C2JA 3IG6B 4ISHH 1PPZA 1SGRE 2ZI2H 4WMFA 5FX6A 1QB6A 2BY6X 2WPDD 1DWBH 3ATKA 1X7AC 1GPZA 1BRAA 3SNCA 1CGHA 1BHXB 2PKSC 2TBSA 5EXMA 1SR5C 3CENA 1AKSA 1LCYA 1YKTA 1EZQA 3SHAH 1P02A 4D7GA 2IOTA 2BY7X 3CS0A 3VB5A 4XBCA 4HZHA 3OU0A 3U1JB 5IDKA 2GD4B 3BTGE 4D9QA 3ZYDA 4JZEH 5DGJA 2YOLA 1TNHA 1C2KA 2BQWB 3U98H 3TGJE 1G37A 1MQ5A 5CHBA 2GV7A 3BIVH 3SV7A 2VB0A 2F4LA 1Z1JA 1EUFA 2XW9A 1QY6A 3LPRA 2BDYA 2XRCA 2H9EH 2ZTXA 2QCYA 1SGQE 2THFB 3RXPA 4D76A 1AUTC 1T32A 2FIRH 4Y0YE 1B5GH 2I6QA 3UPEA 4XDEA 1K1MA 1HGTH 1UVTH 1OX1A 1IQIA 3N99A 3V13A 1TGSZ 1SGFA 1RGQA 2G4TA 2I6SA 3AW1A 1OP2A 1UVSH 2SFAA 4FUGA 1NBMD 2RCEA 3A87A 1ZRBA 4ABEA 5T1VA 2CGAA 1FUJA 1K22H 2Z9LA 5FAHA 3GDVA 1AI8H 1D6WA 1LTOA 1V2TT 2P3UB 1HAIH 4Y76A 4MDSA 1HJAB 3BEFB 3M35A 2GX4A 2IN2A 1SG8B 1FN8A 3QTOH 2JH0D 1L2EA 4FUJA 1O2XA 4KTUA 1A7SA 3FP7E 2TIOA 3KNXA 3F3BA 2JJ1D 2A7HA 1AIXH 1GHYH 3E0PB 1KSNA 3VG8A 3ESTA 1QHRB 2GDDA 3RXUA 4A1VA 3K6YA 3K6ZA 1LKBA 2GT7A 1L1GA 2H5CA 1TYNA 3OY6U 1L1JA 1DY9A 5DP6A 3SJOA 3ZZBA 1LPKB 3KQCA 5FL7D 1DWCH 4INHA 1VR1H 1UCYK 4OS7A 2ZTZA 1H9IE 4TWWA 1ZMJA 5E2OA 1CA0B 5C0UA 3RMMH 1EOJA 4Q7XA 2B7DH 3TIUA 1MKXK 1C5NH 1O3IA 3GY6A 4RKOB 1SBWA 1EAWA 4YXWD 3JZ2B 5CDFE 2NU3E 5T6FA 3WWBA 1O3NA 3TU7H 2A5AA 3F9FA 4ZKOU 1NESE 2IJOB 1QJ1B 3TJUA 3ATIA 1MCVA 3H7TA 3TGKE 1HB0B 1BTHH 1QQ4A 2F9OA 1YM0A 1UHBA 1DXPA 3U1IB 1SLVB 4XBBA 3M5OA 1RIWC 5CMXH 1CGIE 2WPHS 2D26C 3GYMA 3HGNA 5C1YA 3ZVGA 1Z71A 1G3EA 3L6PA 1YLCA 1P01A 4WH8A 1ZSLA 2A31A 5AFYH 1TRMA 3HGPA 1YYY1 2CK3D 1GI3A 5AF9H 1O2RA 2SGAA 4JK6A 4INKA 1P2QA 5T6GA 5EJLA 5DP7A 4ZKSU 1UK3A 3KCGH 3BSQA 2P3FH 2B8OH 1FIWA 2J38A 3AAUA 1FY8E 2R3YA 2VWLA 1L1NA 1V6DA 1OXGA 1GJAB 2Y7ZA 4H4FA 2ZDLA 4XBDA 1TMUH 3M3SA 3RXRA 3T2NA 3TLOA 1VJAU 3EQ0H 1TBQH 4JYUH 4WH6A 3RP2A 3RXIA 1HYLA 1O3LA 1CHGA 5FHTA 3UOPA 4F55A 3QGJA 1RTLA 1IOEA 2G5VA 1T4UH 5I25A 1GGDB 2GJGA 5EW1H 4NIXA 3A86A 2F91A 3ZZ4A 5C20A 3PO1C 3LDXH 1ZOMA 3GICB 1LVMA 3OTPA 4CREA 4K1SA 2ALPA 1K1LA 1TRYA 4AYVB 1HXFH 2ZFPH 3RXJA 1YLNA 1XMNB 1V2ST 1MZDA 1C5MD 1Q2WA 3LONA 3F9GA 2PUXB 1PYTD 1ZPZA 1SGDE 1O2JA 1AQ7A 5C94A 1EP6A 4IBLH 2Q6GA 3E8LA 1A5IA 3SJIA 4GUXA 4FETA 2W6JD 5JPMH 3ELAH 2ZGHA 2GCTB 1AWFH 2ASUB 4FUIA 1K0HA 1SFQB 2XWAA 2FM2A 3DFJA 4X2XA 3BG4C 5EJZA 1ARCA 1PPHE 1O2NA 3S9AA 5C2ZA 1LVYA 1SLXB 1W10U 2VIWA 5IYTA 2RDLA 4BOHA 4Y0ZE 3WW7A 1D6RA 4TYDA 3GOVB 4LXBH 3F9EA 3PTNA 3KYGA 3GDSA 4X0WU 2BLWA 1KXFA 1C5UA 1QR3E 2J34A 1SI5H 5EOKA 1NRQH 1N8OC 2ZHFH 2VJ1A 2A4RA 1C1MA 1O38A 1FAXA 1AU8A 4YLQH 2ZPSA 1ELEE 1NRRH 4HI3A 3SJKA 1YCPH 3GY2A 4B6EA 1SGYE 2P8OC 3PM3A 3PROA 2FLRH 1BBRE 4X2WA 2ZA5A 3KL6A 1JMOH 3QUMP 1XM1A 5TJXA 4XD7D 2GCHG 1UTNA 5T3HA 1VITG 2KZ4A 4KGAA 3VB4A 3GY3A 3ITIA 3I77A 1RFNA 1HAOH 2XXLA 1BJUA 1VITH 2ZHQH 3K65B 2BDCA 1EZSC 4GCHF 3MQKC 3IWMA 1ZZZA 1FI8A 4YOJA 5DP8A 3GISB 4Y8XA 2JIZD 2ZC9H 1CT0E 2A4OA 1MU6B 2PSYA 1HAPH 1CHOG 4NIWA 1A5GH 2FI4E 1WDIA 4NGAH 1E79D 1H8ED 2HNTE 1E36B 1LHFH 1J15A 3GY8A 2SGEE 4FVBA 2RFKC 1PQ7A 1F2SE 2WPIS 2V3MA 1FQ3A 4ISNA 1TONA 2QF3A 4P00A 2PGQB 2HNTC 1O3KA 3A82A 1D3TB 1LPGB 3T28A 3PWBA 3RXLA 3SZEA 3GY4A 1C5TA 1WXRA 1Z6EA 3D65E 3BTFE 1O35A 2UUJB 1ZJDA 3MO3A 1O2SA 3A81A 2STAE 6ESTA 1T8OA 2J5UA 2OQ5A 2FO9A 1O0DH 3N7OA 3GY5A 3AW0A 1WCZA 1O5FH 3VPKA 1TBRH 4A1TA 1W3CA 1XUKA 3DFLA 2ZHDA 2AIQA 2OCVB 1AVWA 4NG9H 4Y10E 2ZDVH 1EPTB 1EAUA 3U8TH 3BTKE 1TOMH 4X1SU 4INLA 3TJVA 4IGDA 1GJ8B 1EJAA 3MH6A 1TX7A 2FZZA 2CHAB 2ZZUH 1KTSB 3BG4B 1TABE 1LQDB 1XUGA 5DK1A 1GDUA 1DT2A 1Y3WA 3MOCA 5F8ZA 3VGCB 1EJMA 4NA7A 1O32A 1HPGA 2GDEH 1C5XB 2BVRH 5EIYA 5DP4A 1C4U2 5SGAE 2VBCA 3PRBA 1E1RD 1N8OB 1AE5A 3Q76A 2PWXA 2BZ6H 1UTOA 3N7EA 3RXTA 1U6QA 2VVVA 1EP5A 2BD7A 1SLWB 2XBYA 3U8RH 2BYAX 2IJD1 2O8WA 1MTNB 2WINI 2QXJA 2UWPA 1C1VH
chains in the Genus database with same CATH topology
1HJ9A 2C4FH 4CBOA 4GSOA 3EAJA 5EXNA 4NSYA 1B0FA 1DITH 1FMGA 1PQ5A 1TNJA 3RU4D 4K3JA 1D3QB 4ZUHA 1QL8A 3AAVA 1DUAA 1N6XA 3RXMA 3T29A 1EZUC 2Y7XA 1CE5A 1G36A 1P05A 1SMFE 1W0YH 2XC4A 4Q7ZA 1H8IH 3TJNA 1GBHA 3P8NA 1GI2A 3LGVA 1WU1A 2ZFQH 5ETXA 1K9OE 5EQQA 1W8BH 1DVAH 2OP9A 2OXSA 1P9SA 4ZHLU 2PHBA 1H4WA 2Z7FE 3PMJA 3UNQA 3MU0A 4X1PU 2PUQH 1SQOA 5GWZA 2A2XH 2W7SA 3ODFA 3EA8A 1BTYA 1EZXC 1E35B 2BDBA 4BXSA 4A7IB 3MYWA 1BCUH 8LPRA 5PTPA 2V3OH 1SVPA 3RXOA 2ZGBH 2ZKSA 3STIA 3A8CA 1DPOA 3RU4T 1TQ0B 1NN6A 4ZXYH 1WBGB 3SUDA 3PLPA 3MTYA 3QLPH 5K7RA 1LHEH 2FTLE 1QFKH 3U69H 1TMBH 3RXFA 1GBAA 2BHGA 2BDAA 1CHOF 1L4DA 2OUAA 3V0XA 1W11U 1H9HE 4WVPE 1SPJA 5J4SA 3UQOA 1GDNA 5ABWA 3T5FH 5EPNA 1UHBB 2UUKB 3UREA 3TH4H 1UCYE 1S5SA 1XUFA 2ZO3H 6CHAB 2D8WA 1AVGH 2ZWLH 5LPRA 2J9NA 3FANA 2QXGA 1MTUA 3M61U 4AN7A 1SLUB 1A3EH 1BUIA 4D7FA 2ZU1A 1UTQA 1GI7B 5HXFA 1ELDE 4Q80A 1KXCA 1DANH 3GCTG 1Z8GA 2ALVA 5F03A 1MBMA 2AMQA 8ESTE 1QB9A 2XCFA 4DT7B 1V2LT 1IQMA 2EA3A 3ZVBA 3EE0B 4X6PA 2BQ6B 1QJ6B 1ZHPA 3P92A 2FP7B 3URDA 5JB8S 1TX6A 1XX9A 3MH5A 4H6TA 4JZ1A 1JWTA 1QBNA 1O5CB 3MWIU 4DVAU 1M9UA 4GPGA 2O8MA 1GJ5H 1SGIB 3ZZ9A 3RXDA 1HJAC 5C1XA 5E0JA 1ZJKA 3NZIA 4OS2A 5C3NA 4ABAA 5E2PA 1HDTH 1Y5UT 2XNIA 3IITA 1NRSH 4O3TA 1SQTA 2C8WB 3H7OA 1ELCA 2AYWA 2B5TB 2FOEA 1BTPA 1BQYA 1O39A 2A4GA 1FXYA 1GHZA 2Z6BD 1FIZA 3A8DA 5T6DA 1YPEH 3SI3H 1JBUH 2HVXA 3QTVH 5LPEA 2H9TH 3FFGA 2FOMB 2G8TA 1MKWK 5A0BA 2XBVA 4BTUB 3RMOH 4JYTA 2G00A 2PLXA 4ZROA 1QGFA 4X1QU 1EAIA 1CA0C 2FS8A 4YO9A 2Z9IA 1QA7A 1C1WH 4BAMB 1F7ZA 1VCWA 3RUOA 3SV6A 4ABFA 1A2CH 4WMEA 1GDQA 2SGFE 2R9PA 4ABJA 3JZ1B 2PV9B 3M7TA 1S6FA 5C5OA 2V0BA 4HFPB 1AUJA 1A0JA 1BZXE 2ZCHP 1HJ8A 3MH7A 3BTEE 2ZTYA 2ULLA 1MAXA 4K2YA 1FJSA 2FOFA 2O8TA 1Y8TA 4AFSA 4JZDH 1O30A 1MZAA 2BD5A 3GCHB 1SGCA 3SV2H 2ZGCA 1P9UA 5DP9A 1BTWA 3KQDA 3MHWU 3PMBB 1W0ZU 4TY7A 1EQ9A 4I7YH 1C1NA 1HFDA 1K28D 3RM0H 2ZHWH 1Z1IA 2JKHA 1S81A 3FZZA 4NFFA 2PTNA 3MO6A 1ELFA 3SUGA 2AGIX 1QTFA 3MNXA 1O3BA 1E37B 3PYHA 3L3TA 1E0FD 2TGTA 1LMWB 1P57B 2ZDNA 3SO3A 1C5VA 1FY1A 1C5LH 2HPQH 1QRXA 3PTBA 4AFQA 1ZGIA 1YP9A 1YGCH 5BRRE 1CGJE 2OC0A 3LGYA 4B73A 1C1OA 1BRCE 2CN0H 1SHHB 3BIUH 2RA0A 3M7QA 1WSSH 1GJDB 1QRWA 5E0HA 3M3TA 1YPGH 2Y6TA 2IPHA 2OD3B 2BD3A 1ID5H 1NFXA 1GGDC 1CA8B 3P95A 4CRCA 4O97A 2P59A 1H8DH 1UMAH 3GDUA 1D3DB 2WPMS 3UIRA 4Y7BA 1K1OA 1OSSA 3Q3KA 5GDSH 3QDZB 3E0NB 1G2MA 4UDWH 4ZHMU 1GWAA 1O2LA 1LQEA 2G5NA 3UWJH 3GCTF 2ZFSA 1GL1A 2G81E 1SGTA 3Q3YA 1ZMLA 4ABGA 3BTDE 1FONA 3G01A 5CHAB 4TWYA 2Y5HA 1RJXB 5DKMA 3EA7A 2PKAA 2TPIZ 2GCTC 2Y81A 5DJ7A 4X1NU 5TCAA 2G52A 2FTMA 2R0LA 2DE8A 2C3SA 3DHKH 3A7YA 2P16A 3SI4H 1IQGA 3VFEA 5CE1A 3A80A 3NCLA 1BMMH 2FYRA 4FVDA 1J14A 1HAGE 1WAYB 1VCPA 1GI9B 1GVKB 4GCHG 1GJBB 2HNTF 2OC1A 2QC2A 4MQAA 1A5HA 1AGJA 3RXBA 1EATA 1D3PB 4UFEH 1ZLRA 1H9LB 2ODYB 2C93B 1W14U 1NROH 5I46H 4Y11E 3RLYH 1CT4E 1UCYH 1Y5BT 2P3TB 2OINA 3OY5U 4DG4A 1NS3A 1SOTA 1DM4B 1UTMA 2OLGA 4GLYA 1S84A 2BOKA 3WY8A 4FUFA 1O3OA 1HAVB 3AVZA 1B7XB 1EKBB 3SJ8A 3LGIA 1KXDA 2ILNA 1O5AB 1TAWA 4CR5A 5GIBA 2Z3CA 1FY3A 1YBWA 2XCNA 4IC5A 2VIDA 1O3CA 1FPHH 3QX5H 1DUEA 1BMAA 4YM9A 3BF6H 5JDUB 4OGXA 4BAQB 4ABIA 2SGQE 2GZ7A 4I8HA 4UFFH 1KDQB 4GVUA 1ESBA 5F8TA 1IQEA 1AFQB 3AASA 2QV1A 4AFUA 3OSYA 4BTTB 5DG6A 2FYQA 4IN1A 3P6ZB 1BRBE 5EPYA 1EB1H 2WUCA 3RXVA 5DO4H 1C1UH 2H1UA 3L33A 1IQJA 2JETC 1UK4A 3GCNA 4FUCA 1HIAB 2FLBH 1TQ7B 3D23A 7ESTE 1XVMA 4RN6A 4CH8B 2PFEA 1G30B 3RXKA 4D9RA 3QO6A 1GBJA 3LJOA 1Q3XA 1SGEE 3GCOA 1DFPA 1C2GA 3P8GA 1D4PB 2H5DA 4LZ4B 3S9BA 5FPSA 3T25A 4D8NA 1GMCG 2TGDA 1T8LA 5AHGH 5A8ZA 1TNLA 1C1RA 3F6UH 4NIVA 1SHYA 1E38B 3D62A 4XSKU 1ZHMA 4FXGH 1V2JT 3LU9B 7GCHG 1QCPA 4I8GA 3TK9A 5JBCS 1F5KU 3RC5A 3NWUA 2ODPA 1EJNA 1P06A 1XUHA 1F5RA 2R2WU 2LPRA 4YOIA 4X2YA 2O8LA 1DSUA 1TGTA 5C5NA 1DWEH 4SGBE 4B75A 2BVSH 1KYNA 5F6MA 1EPTC 1BB0B 2W3KA 5ESBA 4NWLA 1BA8B 2P95A 1RTKA 2H2ZA 3C27B 4AG2A 2FDAA 2Z9KA 2W7UA 1GG6B 1JOUB 5E8EH 3SU2A 2CHAC 4BAHB 1PFXC 1ZSKA 1O2YA 3SGAE 3UWIA 1LPZB 1ACBE 1GBTA 1V2KT 3TJOA 4AORA 2CF9H 1MCTA 3VGCC 1YPJH 4JZFH 2XC0A 4B1TA 1C9PA 2C8ZB 2CF8H 1PQAA 2BX3A 1KTTB 2P93A 2ZHEH 1GBMA 1TGNA 3FP6E 4UFGH 1ETTH 4AYYB 1THSH 1ABIH 5FX5A 1CBWB 3OX7U 1BHXF 1C2DA 1P12E 4KTCA 1LO6A 4CRFA 4BAOB 1V2QT 3V7TA 4U01A 3UNRA 3H5CB 1S6HA 1L4ZA 1GJCB 1MTNC 5LPFA 1YLDA 4AG1A 1TB6H 3SUEA 1V2UT 2UWLA 3FZDA 1E34B 2FX4A 1HAYB 1P11E 5AVDA 3W94A 4BXWA 2O9QA 1GJ7B 2CXVA 4B2BA 1NRPH 2KAIB 4Y8YA 1LHCH 3S7KB 4F4OC 2YNBA 1GI1A 3A83A 2C8XB 2ZFFH 4YLUA 1CQQA 3SOSA 1AZ8A 1TE0A 3O8CA 1JIRA 2NU2E 4E7RG 2EI8A 1P04A 1CT2E 1P0SH 3NK8A 1SGPE 1TGBA 3SHCH 1O2KA 5GCHG 4DGJA 1GBEA 5JBTA 2JETB 1KXAA 2ZFTA 4HGCA 1F0SA 2G55A 1UTLM 1CU1A 2Z3DA 4MVNA 2ZP0H 1UJ1A 2C90B 3D49H 2Y5GA 1GVLA 3T26A 2UWOA 3ENSB 1NY22 1Y3UA 4JMYA 4VGCC 1A1RA 1V2NT 1EX3A 1W7GH 2AFQB 2B9LA 2FMJA 3ZV8A 3ZZCA 1O2MA 1O5BB 2ANWA 1OP0A 1OWJA 1C5ZB 1QNJA 1ZHRA 1O2UA 1N6YA 1XUJA 3ZZ3A 1G3CA 1MBQA 3BV9B 1K1IA 4TPYA 3LC3A 2OQUA 3RXCA 1C1TA 4FU8A 1SB1H 5DP5A 3M5NA 1MQ6A 1MD7A 1MD8A 1ARBA 1O33A 1S0RA 3ATMA 5EXLA 1AKSB 1GCDA 3BEIB 6CHAC 1WV7H 1MTWA 4WMDA 2BXUH 1TLDA 1GMCF 2VIOA 3TH2H 3KIDU 2A0QB 2VH0A 1VJ9U 2J92A 2WV4A 7GCHF 2BLVA 2FXRA 2ZEBA 1C5SA 3S69A 3RM2H 3SQEE 3FVFB 1NU9A 3GY7A 2WUBA 4R0IA 3HK6B 2FI3E 5HGGA 2BQ7B 2GP9B 3TPIZ 1Q31A 2V35A 1KXBA 3A8AA 1AB9B 3S0NA 1AVXA 1C5WB 1ELVA 1SC8U 2BDGA 2W5EA 3KEEA 2XBXA 4ASHA 1C4Y2 4XOJA 1C2IA 1PQ8A 4PROA 2NU0E 2OTVA 1GBBA 5G4BA 1GBDA 2QN5T 1XKBC 2V6NA 8GCHG 5L2YH 2PTCE 2GKVE 4FUDA 2ZQ1A 1ELGA 4CH2B 2M5TA 2Q6FA 2ZU3A 2BB4A 2VVUA 2Q6DA 2Y80A 2ZECA 4DIHH 1BMLA 1BRUP 4OS5A 1DS2E 2CV3A 6GCHG 2WPLS 4DOQA 1WOFA 1RXPA 3VB6A 1KLTA 1EAXA 1IAUA 1THRH 2ZNKH 3HK3B 4E05H 1O2VA 3RMLH 2VWMA 1FZZA 1TPAE 4M7GA 5K0HA 4ESTE 4X8SH 1TA2A 1YPLH 2ZF0H 4VGCB 5L30H 1GBIA 1RRKA 2BDIA 4YTAA 1OYTH 1QL9A 4NSVA 3TVJB 4CHAC 2R0KA 1K2I1 1B0EA 3PV4A 1GBCA 3NPSA 5A09A 1DE7H 5TCCA 1OWHA 4MTBA 4ISIH 1NRNH 1O2ZA 2F3CE 1F0RA 5GCHF 1IQFA 1UVPA 4K1TA 4CRGA 4THNH 2QA9E 3GCHC 3SNDA 1ANDA 1V2OT 4UE7H 3O8DA 2W26A 2J95A 1DSTA 1NO9H 3A8BA 1ELBA 1OWKA 1TMTH 2RA3A 4Y8ZA 5FXLA 4O03A 4AX9H 2FOAA 4XFQA 2VVCA 1C4V2 4ZXXH 1BTZA 1UK2A 5A8XA 1CO7E 2EI6A 2PR3A 2QAAA 3SNAA 5HM2A 3VXEH 3UFAA 1F0TA 3M3VA 4ZKNU 4YT6H 2VGCB 1J16A 1RD3B 3ZZ6A 3W95A 4JK5A 5EODA 2ZCLP 3R3GB 1ESTA 1BBRH 2BD2A 4KTSA 1GHXH 4IN2A 1QRZA 4AB9A 3V3MA 1GHBG 2BD8A 4I33A 4X1RU 1XUIA 5B6OA 1TPPA 2ZPRA 3I78A 4IS5A 3OTJE 3LOXA 3E3TA 4K8BA 1A3BH 1V2RT 1BTUA 1ELTA 2FS9A 1OKXA 3M5MA 3MU8A 2WYGA 2FOHA 2SGDE 2XYAA 3RLWH 3LH3A 1V2VT 3SORA 1THPB 2QIQA 4UFDH 3UTUH 1FPCH 2ZQ2A 4ZKRU 1GHVH 4OS1A 1F92A 1QB1A 1V2MT 4FUHA 1KLIH 4HTCH 3K2UA 1LDTT 1GVZA 1Y3XA 4OGYA 1ZSJA 1MMJN 5CHAC 1CSOE 1GMDG 3BTTE 1KXEA 3QZRA 3A89A 3NXPA 1P2IA 4BNRA 5EG4A 1QURH 1T7CA 3UY9A 3TGIE 3ZVDA 2BMGB 3MNSA 3A84A 1OS8A 1D9IA 2TRMA 2HLCA 3DT0H 4MG3A 3VB7A 1C1PA 2Y82A 4CHAB 8GCHF 1XKAC 3ZZDA 4NIYA 3RXQA 2R2MB 1ZR0A 4Q7YA 1XVOA 2BVXH 1LHDH 1EOLA 4Y79A 1J8AA 1TX8A 2H9HA 2ANYA 3KHVA 1GHAG 1JRSA 4NA9H 3MNBA 4ZAEA 1G3DA 1FY5A 6GCHF 2W3IA 4ISOA 3BG8A 4AOQA 4CBNA 4IMQA 1A61H 1NFUA 2EEKA 1PPBH 5FCKA 1HRTH 3TK5A 1GI0A 1V2WT 3ZV9A 1ZTLA 1ZPBA 2ZDKA 3EA9A 4AGKA 4R8TB 5A0AE 1YF4A 4RSPA 1Z8IB 3SU3A 2ESTE 1O3HA 1TBZH 1OWEA 3ZZ7A 1EPTA 5DPAA 4LZ1H 1IHSH 3DA9B 1YPMH 1AFEH 4I8JA 4A5TS 2F9UA 1AFQC 1TPOA 2ZU5A 1DWDH 4MLFB 1VCQA 2XWBI 5FCRA 3A7TA 4YOGA 4MPUA 3SU6A 1C5YB 1OWIA 3F68H 3KQEA 3BEUA 2ANKH 1ETSH 2ZU2A 2FOCA 2HOBA 1C5PA 1V2PT 3LJJA 5JYIA 2A45B 2ANMH 3M5LA 4UONA 1H1BA 2BZAA 1ZYOA 2AIPA 1G32B 3F1SB 1UVUH 2QF0A 1ZMNA 3DD2H 1C9TA 1WYKA 2FWWA 1UTKA 2XBWA 2OC8A 2VIPA 2NU4E 3ZZ5A 1VGCC 4NZLA 3SU4A 4CRDA 2PGBB 1NTPA 1C2MA 1NC6A 3Q00A 3SW2B 1QBOA 3ZVEA 2ZG0H 1C1SA 2OBQA 1UTPA 9ESTA 1HCGA 3A7WA 5GPIB 2OBOA 4YESB 1HNEE 3SU5A 2ZFRH 2ZIQH 4J1YA 4MNVA 4A1XA 3NUMA 2A1DB 4Y71A 1GHBF 2ODQA 4X6OA 2GMTB 2DUCA 3PLBA 3SGBE 4IC6A 1FY4A 1GCTB 3F9HA 3QWCH 3UUZA 2VWOA 1MUEB 1YCPM 2WYJA 1GG6C 3C1KA 2HRVA 1GJ6A 2BLQA