4TPYA

High throughput screening using acoustic droplet ejection to combine protein crystals and chemical libraries on crystallization plates at high density
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title High throughput screening using acoustic droplet ejection to combine protein crystals and chemical libraries on crystallization plates at high density.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4tpyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4tpyA02
1EP5A 5CHAC 3LC3A 4INKA 1O39A 2F9OA 3SUEA 1UTPA 1AFEH 2IJOB 3TK9A 1TGTA 4LK4A 1TOCB 1GJAB 5EQQA 2ZHQH 2SNWA 5DP3A 1NO9H 2A2QH 2WINI 3GY7A 1RRKA 1O2RA 1TFXA 1HAGE 1O2QA 1V2OT 1S84A 2PHBA 1RJXB 1KLTA 1D3QB 4CBOA 1L0ZA 4MVNA 1MKWK 1NY22 1O2LA 2GDDA 2QF0A 2PUXB 4Y79A 1ANBA 4TPIZ 1SVPA 5AHGH 3QGNB 4AFZA 1QY6A 3NCLA 4IGDA 2ODYB 2OLGA 5F8ZA 4GVUA 2ZU5A 4AFUA 2AGEX 4DT7B 2TPIZ 1SGCA 3GDUA 1AB9B 1K1IA 1ESAA 1YM0A 1G9IE 3T28A 5G4BA 2FI3E 1C5MD 2A7JA 1TGBA 2BDBA 2ZC9H 1PQ8A 3L6PA 3R0FA 4INLA 3L3TA 1WQSA 1MTVA 5T6FA 1C1WH 1O3DA 2GT8A 2XBYA 2XCFA 3MOCA 1A4WH 3HKJB 4MNYA 1Y3WA 2SGAA 2VWLA 3RLWH 5GDSH 5EOKA 1GHXH 1P0SH 1UK4A 3RXRA 2AIQA 5J4SA 3D49H 4MNWA 2IN2A 1GDQA 1THRH 2YNBA 4Y76A 5HGGA 1GJCB 1C5PA 2VB0A 6ESTA 1NFUA 5SGAE 2GX4A 2Z3EA 5GCHG 1SOZA 2GZ9A 1G37A 1XM1A 1D6WA 4I8KA 4X6PA 3ATWA 3SGQE 1RD3B 2ZZUH 2PTNA 1J9CH 1Q2WA 1HDTH 3SU0A 1IQFA 2FXRA 1J16A 1C5VA 1UTLM 3BTTE 5DG6A 3SNCA 3A85A 1TNKA 2YNAA 1TMTH 3G01A 2ESTE 4FU7A 4ZROA 2P93A 1MTNC 8GCHF 1QBNA 3NPSA 3A7YA 4X2XA 3ZZ5A 3ATLA 5JPMH 1INCA 1ANCA 1RGQA 1E38B 2H5DA 2UWPA 2NU1E 1C2DA 1L1JA 2FS9A 1O36A 1YPHC 1N8OB 4AG2A 1NU7B 3DHKH 4YLUA 3VEQB 1FUJA 2FYQA 4X2WA 1C5ZB 4U2WA 3IITA 4Q7XA 4ABJA 2C3SA 5FBEA 1PFXC 5I46H 2P95A 1HAVB 3QZQA 3T26A 1VGCC 1IHTH 1WQVH 2SFAA 1OWIA 2SGFE 2ZPRA 6CHAC 3BTFE 2J9NA 1BOQA 5GIBA 4IBLH 1C4U2 5K0HA 4DCDA 3RXSA 2BMGB 1SFIA 4D7FA 1K1JA 1ZMNA 1WCZA 2ZDKA 1V2LT 3SO3A 2FEQH 2OCVB 3TIUA 2BQ7B 1O3CA 1J17T 4JZ1A 4NIYA 5EPYA 1BBRH 2BM2A 2W7SA 1KLJH 2P16A 3CENA 5JYIA 1GMHF 4THNH 1RXPA 2CMYA 1HAPH 3D65E 4FUEA 3MH4A 2B8OH 3BTEE 2BLWA 3BG4B 5C67A 4UFEH 3P8GA 3FP6E 1KIGH 1C5SA 2ODQA 3HGPA 4X6NA 1Z1IA 1E35B 1YBWA 3ZZCA 1CHOF 2ZU1A 1VCPA 2VNTA 2FO9A 4WH6A 5B6OA 2BY5X 3SU4A 1HLTH 2P8OB 3Q3KA 1SGFA 3ZZBA 4FVBA 2F9UA 4MPWA 1ABJH 3LDXH 1CT0E 2WUCA 3MNXA 3SU5A 2ZHEH 3MH5A 1LPKB 4XSKU 1DUAA 3UNRA 4U30A 2VWNA 2ZFPH 4CRCA 1NM6A 2J94A 3A81A 1QQ4A 4AORA 4MG3A 1YPEH 2Z9GA 4D9QA 1ZZZA 1QFKH 2FZZA 2VIPA 4Y8XA 2A4RA 4AN7A 3M5OA 1Z6EA 1JRTA 1DUEA 1QHRB 1HRTH 1LKAA 1UHBB 1MBMA 1C1PA 1GHBF 2J92A 3A8DA 2ODPA 1RTFB 1VZQH 1GHAF 4JYUH 7GCHF 1GG6C 4K2YA 2ZQ2A 1GDNA 1Y5BT 1GI1A 4TPYA 4X1SU 1EZQA 4R0IA 4ESTE 3BEIB 3PM3A 4ABBA 1O33A 4FU8A 3RXGA 1CA0C 1OWKA 1DLEA 2O8UA 2ZI2H 4CBNA 1O3JA 2PKSB 3GY6A 3IWMA 3R3GB 3S7KB 3BTKE 1LVMA 1OYQA 4A7IB 1MQ5A 1EJMA 2HNTE 1BZXE 1GMCF 1NS3A 2ZHDA 1ARBA 2D2DA 1E36B 1YLDA 1O3FA 1BQYA 1GBHA 1QIXB 4KTCA 1O2GH 1BBRK 1MMJN 1ZHRA 2ZTYA 3SOSA 2ANMH 1O5AB 1OWHA 3E16B 1FQ3A 1O34A 2Z3DA 4Q2KA 1QL8A 1GMHG 4Q80A 3T5FH 1FN8A 4BAQB 3A7XA 3LU9B 1G2LA 2JH0D 3SNEA 2V3HH 1VR1H 2HWLB 4Y71A 1L2EA 1OXGA 1HIAB 1XX9A 1BHXB 3O8RA 1K1MA 1SGIB 2TBSA 1CHOG 3M3TA 1O2VA 4ZXXH 1TYNA 1KXCA 5A0CA 1AI8H 4BXSA 1QBVH 1SGPE 2PSXA 1HFDA 1SC8U 4Y7AA 3RXLA 1ZHMA 2PGBB 1C5OH 1EZUC 2QF3A 1W10U 5T6DA 2J2UA 1H1BA 2FIRH 2AMQA 5JBTA 4YESB 1O2MA 1HJAC 3E3TA 3I29A 2UUJB 5LPEA 1CGIE 2A0QB 2ZDNA 2PR3A 1DY8A 1EAWA 3DD2H 2FI4E 3BV9B 2BZ6H 2ZFRH 1XUKA 4Y7BA 1NROH 5DJ7A 3PTNA 5JB9S 2QA9E 3W94A 2GD4B 4I31A 1P05A 1GHBG 1TOMH 2B0FA 4Y0YE 3T27A 5JBAS 1KDQA 4K1TA 3SV9A 2ZNKH 2NU3E 2ZGCA 1XKBC 5IYTA 2K1QA 2EA3A 1C5NH 3RMOH 4ABGA 5DK1A 1C4V2 4WH8A 4XDEA 1FY1A 2FOBA 1IOEA 5C3NA 3SV2H 2BLQA 1HNEE 4KP0A 2AMPA 1W12U 2V0BA 2HALA 1D4PB 1FNIA 3RM0H 1UJ1A 2XXLA 5L6NH 3PO1B 8ESTE 1O3EA 4IN1A 2OQ5A 1K2I1 1GMCG 2C90B 2M5TA 1JBUH 2ZGBH 1L4ZA 4ZKNU 1O37A 3ZZ9A 1C9TA 3ZZ6A 2XCNA 2STAE 1Z8IB 1M9UA 5A8YA 1ZSLA 3NK8A 3O8BA 3BIVH 1P3CA 1H9LB 3ZZ7A 3GCHB 1PQAA 5EG4A 2CF9H 1HV7A 1B0EA 2Z9IA 1O3OA 4WMEA 2BVRH 3VGCC 3RDZA 2WYGA 2FOCA 1CT2E 1P06A 3W95A 3RU4D 2QAAA 1C5XB 1YPLH 1ELFA 3BTQE 1EPTB 1AGJA 1TPPA 4NIVA 2P94A 3RU4T 3MHWU 1GBBA 1O32A 3FANA 4BOHA 4YOGA 4IC5A 1P03A 1EQ9A 2W7UA 3K65B 2BX3A 1BJUA 1H8IH 3RXMA 2AMDA 4TWYA 2O8WA 1N1LA 3SJKA 1MU8B 4DVAU 2FOGA 1AVXA 3LT3A 3PB1E 1D3PB 4JYVH 3LGTA 3BTWE 5E0JA 1TAWA 4NZLA 1NRQH 3RXJA 3ZVEA 9ESTA 1W0YH 3T25A 1ELVA 1ID5H 3LJOA 3UOUA 4KTSA 3H7OA 4AFQA 3MU4A 4MNVA 4XFQA 3C1KA 2ZIQH 2ALPA 4D9RA 2FI5E 1PPFE 3KIDU 2RDLA 1SGFG 3GYLB 4HGCA 4BXWA 3M36A 2Z94A 1W7XH 2AEIH 2O9QA 1BHXF 3SQHE 1AMHA 3BTHE 2VVCA 3TJNA 4GUXA 1YPHE 4K1SA 3SJ9A 5ABWA 2GVFA 4NG9H 4MQAA 3E1XB 3RP2A 4VGCC 4ZHAA 4DURA 2VJ1A 3PMHB 2CHAC 2VIDA 1P01A 2LNCA 5E0GA 1P2NA 4I33A 5FCRA 1F2SE 2R0KA 1CBWC 1UTOA 1ZRKA 2KAIA 2NU0E 1OP0A 3RXEA 3Q00A 5C1UA 2GCHF 1UVSH 1TPAE 1O5EH 1H9HE 4K8BA 2BD3A 5CMXH 1FJSA 3FZDA 1UVOA 2OQUA 4MPVA 1FMGA 2ZU2A 5FX6A 3MYWA 1BRBE 2HPQH 1SBWA 3AW0A 3SN8A 3RUOA 3KGPA 1VJAU 3RXHA 1ZJKA 1ZTKA 3E90B 2BXTH 1GDUA 1OP8A 2ZCLP 3V13A 1EAUA 1C1RA 3SU2A 1OYTH 1WAYB 1DE7H 1LCYA 3GOVB 3RC5A 3O8DA 3E6PH 2O8LA 4MPXA 1A0JA 1BB0B 2Y80A 2ZGHA 3WY8A 3AASA 4NZQA 1LHCH 1GBIA 2C8ZB 3DUXH 4JZFH 3GY8A 1E37B 1NN6A 2FYRA 5EXMA 1YCPM 8LPRA 5ESTE 3MTYA 1LPGB 2PWXA 1BMMH 1PPGE 4B75A 1F5LA 5FBIA 3SJ8A 1IQEA 1FPCH 1H8DH 1S82A 5HM2A 3V0XA 2FLBH 2DE9A 2B5TB 1A46H 1KLIH 1FZZA 2QCYA 2GZ7A 1VJ9U 1O2HA 3U8RH 2FPZA 1W3CA 2QY0B 1FLEE 4FUBA 1NFXA 2ZFTA 3EQ0H 2JETB 3DA9B 4YT6H 2Z9JA 1ZHPA 3PV4A 2GMTB 1H9IE 4ISIH 1Y3XA 1CVWH 3ZZ8A 2PLXA 5GCHF 3P17H 4AB8A 3AAUA 5FCKA 1TA2A 1OS8A 3TJVA 5EW2H 1TPSA 1XUIA 1P09A 2RG3A 5E2OA 3STIA 3EA9A 4R8TB 1EX3A 2F91A 3EA7A 2Y81A 3RXTA 1GCTB 7LPRA 5DGJA 3SHCH 2GCTB 1B5GH 3FAOA 2IPHA 3LIWA 3ODDA 1ACBE 1O3BA 1K22H 3E8LA 4ASHA 1MAXA 2FODA 3P92A 4H42U 3KCGH 1ELTA 3LGVA 4UDWH 2GCHG 4DGJA 1T32A 1MAYA 3SUDA 4ABIA 2BYAX 2NWNA 1OWDA 1BMNH 1KXAA 2WPKS 2H2ZA 3JZ1B 2W26A 1GJ8B 3V12A 2AIPA 1DWDH 3QTOH 2WPJS 3DFLA 1UTJA 2ULLA 1TMUH 3AW1A 3P8FA 3CP7A 1O3LA 1AHTH 1PPHE 2V6NA 4X8TH 1JIMA 4O03A 2G4UA 4I32A 2ZFFH 1Z8RA 1EASA 1QRWA 4Y8ZA 5HMAA 5TCAA 1V2JT 4UEHH 3UPEA 2WUBA 4WXIA 1QGFA 3MU8A 1EATA 2RA0A 3I77A 4UFDH 1AB9C 4WMFA 2ZFQH 1JIRA 1TRYA 2FTLE 1TRNA 1P9SA 1A2CH 1O2WA 1SPJA 4DIIH 1BBRE 1LVBA 2W3KA 3U1IB 1ZJDA 3LPRA 3GCOA 1SGEE 3LH1A 3NKKA 1NESE 2XBWA 3M37A 1LPZB 1X7AC 4GSOA 1GBJA 2R2WU 2ZECA 1BA8B 1GHVH 2D8WA 1C4Y2 3SV7A 2FMJA 4K69A 3QLPH 1V2VT 4ZAEA 2ZU3A 1FIWA 5FX5A 1C5WB 1NU9A 2OXSA 1A5HA 1C5RA 3TK5A 2VGCB 3EA8A 4CH2B 3FP7E 3Q3YA 1C2HA 2JH5D 1GBFA 3M61U 1VITF 5K7RA 2BHGA 3F9FA 3TGKE 1N6XA 1RIWB 2VVUA 1Z8JB 1HJ9A 3RXVA 3HPTB 3BEUA 3LGWA 1YYY1 1ZPZA 1GGDB 2EC9H 2HVXA 5JB8S 1MH0A 3JZ2B 2HNTF 2Z9LA 5LPFA 1EB1H 3QUMP 3SQEE 1LO6A 4ABHA 1AWFH 1B0FA 1QB1A 2W5EA 3F9HA 4J1YA 2WPLS 1C1MA 3K2UA 4HTCH 2AGGX 2QIQA 1CGJE 1K21H 2RA3A 1SR5C 2OP9A 2VU8E 4U32A 3URDA 1V6DA 4UD9H 1ZSJA 4Y11E 4CRBA 5F03A 1GCDA 1QTFA 3BTGE 1ELGA 1KSNA 3MH7A 3RXKA 3SV8A 1N8OC 2ZEBA 2BD8A 3GICB 3M3VA 1P2QA 2WPIS 1O5CB 4GHTA 3TLOA 8KME2 2FX6A 1S5SA 1DWBH 1L1NA 3SU6A 3M35A 4H6SB 4CH8B 4X1RU 2EEKA 3MO9A 4B74A 4CRDA 4FUGA 5GXPA 5J4QA 2Y5HA 1GBLA 1Y3VA 1FONA 1KXFA 1TPOA 3BSQA 1DSTA 2Y6TA 4WWYA 5C5OA 1SMFE 1Y59T 5LPRA 6LPRA 2QXIA 2PV9B 3OY5U 5C20A 2VWOA 3QGJA 2H9TH 3UFAA 4LXBH 1HAYB 4CHAB 2B9LA 5IDKA 2BY9X 3F9EA 2FX4A 3RC6A 1TBZH 4ABFA 2DUCA 1HAVA 2A45B 1OWJA 3T29A 1K1NA 3BG4C 4KGAA 4ABEA 2C4FH 2GTBA 3STJA 3LC5A 5L2ZH 1A3BH 3SU1A 4OGXA 1Y3YA 4GLYA 1BCUH 2Y5FA 1W8BH 5ESBA 2UWOA 1SQAA 3H7TA 3F1SB 2P8OC 3QWCH 1Z8GA 4CRGA 1Y5UT 3QTVH 3BIUH 1FIZA 3K6ZA 3SGBE 3SORA 2F9NA 1VITG 3GCNA 1KTSB 4DW2U 1FV9A 4RSPA 3ZV8A 2AS9A 4FU9A 4AFSA 2C93B 3LGYA 2R3YA 1B7XB 1GJ5H 1ZRBA 3F68H 2ZGXH 4NGAH 3P8OA 3P95A 2BDCA 1P04A 4DJZB 2EI7A 1C2EA 4O97A 3ITIA 2CGAA 1TX8A 3L33A 3S7HB 1V3XA 1HAZB 1O3KA 1DICA 2XNIA 3OY6U 4K60A 5JBBS 2ZCKP 3M7TA 4LZ4B 4K5ZA 1G3CA 1P57B 1GI5A 3A86A 1O2OA 3A8CA 3A87A 1F0UA 4BNRA 4WY3A 2DE8A 1SGRE 2XC4A 1EP6A 1ELCA 2H9EH 1K1LA 1QB6A 3A88A 2GZ8A 1BTUA 1XUGA 1GJ4H 4X8VH 1C9PA 1WOFA 2FOEA 2A2XH 3LOXA 4WF8A 1MTWA 1TNGA 3UR6A 3P70B 2O8MA 1ZTJA 1S85A 2VIQA 3PTBA 2PKSC 3PWBA 4YOIA 4OS5A 1MKXK 2BY7X 1O3IA 1EUFA 1GBTA 3PROA 3ZVFA 1W13U 4U01A 2GT7A 2A5IA 2QXJA 3BTDE 2BDIA 1UHBA 3OX7U 1C1OA 5FXLA 1ELDE 1V2WT 2HRVA 1O5DH 1THPB 4ZH8A 1C2LA 1DT2A 4NFEA 4ZKOU 1A0HB 1D9IA 1O2PA 4NFFA 1HBTH 5C5NA 2BDGA 1AE8H 1V2ST 3A80A 4MDSA 1TE0A 1YP9A 3U98H 5A8XA 3EYDA 4JZDH 1AN1E 4GHQA 4WXVA 1GI2A 4DG4A 1GI3A 3RXPA 3U8TH 5CE1A 1ZTLA 4A1VA 3OYPA 2XBVA 1KTTB 1O2JA 4IW4E 1S0QA 4OS7A 1W14U 3VPKA 1C1UH 4OS2A 5AFZH 3GY2A 2BDAA 3KF2A 1FY3A 2Q6DA 1NPMA 5AF9H 1O5BB 2PUQH 1TGNA 3HKIB 1HYLA 2OD3B 1BUIA 1DXPA 3K6YA 1LHGH 2NU2E 3BEFB 4OS6A 5A0AE 1DFPA 1HIAA 2YOLA 1F7ZA 1DWEH 2TGDA 2Z3CA 2PKAB 4A6LA 3A89A 1C2GA 2Q1JA 4GPGA 1GI4A 3NZIA 2STBE 2A5KA 3RC4A 1O2IA 1ELAA 2BB4A 3A82A 3GCTG 3N7OA 4YLQH 1AFQB 3TPIZ 4XBDA 3EDXB 4AZ2B 2G52A 1QRZA 3ZZAA 1UVPA 1P11E 3TJOA 5ETXA 5DP9A 3OTJE 3EE0B 1ETTH 2SNVA 1AZ8A 1AIXH 3ATKA 5LH8A 1TALA 1K9OE 3PO1C 3FVFB 1JMOH 1MCVA 1NT1A 3K9XB 2R0LA 1ELBA 1T8NA 2QGRA 1OX1A 5AFYH 1ZR0A 2A7HA 2BX4A 1C1SA 2BDHA 2ZTZA 1A7SA 1YKTA 2A1DB 1LVOA 2G55A 1O3AA 3HGNA 1UVUH 3GCHC 1TLDA 3D62A 1MUEB 3QO6A 1TGSZ 1BMLA 1C1QA 3BTME 2FS8A 4HI3A 1HPGA 3RXUA 3TITA 1FY5A 2ZDMA 3RLYH 1GI7B 1EPTC 2A4QA 3A7WA 1SB1H 3SZNA 6GCHG 4WVPE 1QR3E 2BLVA 1C2IA 3EAJA 3M7QA 1TBRH 1XVOA 1RFNA 2TIOA 2BVXH 3S9CA 1ANEA 3RXCA 3MH6A 5DP4A 1KXDA 1BMAA 4RN6A 4AGJA 1OOKB 2ZKSA 2P3FH 1V2PT 2VVVA 4JK6A 1O3MA 4YZUA 1SGDE 1F92A 2FDAA 4CR9A 3RM2H 3SW2B 1GJ9B 2BOKA 1ZPCA 3Q3XA 1WTGH 1QJ7B 1MTUA 4ABAA 4GAWA 3S9AA 2BY6X 1E34B 1TB6H 3ELAH 1EPTA 2XC5A 2FESH 3VB6A 3UOPA 2BOHB 1HXEH 4NSVA 2D26C 1EOJA 2CF8H 1WUNH 5L2YH 3P8NA 4I8HA 1TABE 2OC7A 3TGJE 3ZV9A 1CHGA 4XE4A 2W3IA 5GJ4B 3SNAA 2A5AA 2J34A 2BLOA 1PPEE 1FPHH 1C2KA 1GVZA 3GY5A 4ISLA 4X2VA 2F9BH 2HGTH 1EXFA 1OPHB 2XTTB 1IQNA 1DWCH 1A3EH 1A1RA 3U9AH 2OBOA 2BDYA 2G5NA 4BAHB 1C1TA 1T8MA 1A5GH 1G2MA 1MQ6A 1QB9A 4FUHA 3RMNH 3VB3A 2GV7A 4E7RG 1QURH 2Q6GA 1TWXB 1QNJA 1AO5A 2AYWA 3TNSA 1JWTA 1G3EA 3P6ZB 1TONA 4A5TS 3O8CA 4ABDA 1W7GH 5A2MH 2ZPQA 4SGBE 5JDUB 1GBAA 3KQCA 1EAXA 1UTKA 2A4OA 1UCYH 4NA8A 1NRPH 5F8TA 2H6MA 3VB5A 2OBQA 1GPZA 3VXFH 2AH4X 1GI8B 1QJ1B 4HFPB 1IQLA 1F5KU 1MZAA 1THSH 2ANKH 4UFFH 1P2IA 1ZMLA 1F0SA 3M7UA 1WYKA 1AKSB 2A7CA 1DVAH 1YPJH 1BTYA 1QBOA 2JETC 3RXIA 2Y5GA 1LMWB 4K8YA 2GMTC 1TX6A 1O3NA 1EJNA 1F0TA 1O3HA 1XMNB 3TJUA 2BTCE 1O5GH 5PTPA 1IQJA 1MBQA 4I8LA 2QN5T 3U69H 1P2OA 1KXBA 1YCPK 4TWWA 4Q7YA 1IQMA 3NWUA 1HJ8A 2A32A 4I8JA 4LOYH 1GCTC 2NU4E 1OKXA 2WPMS 2XW9A 2ILNA 4BANB 2GCTC 1BRAA 3E0NB 1FY4A 2Z7FE 1O2XA 1HAXB 2XC0A 3HK6B 4K1EA 1UTMA 1NRNH 5E8EH 4YOJA 4KTUA 3RU4E 1RTKA 2QYIA 3KHVA 4OGYA 3A7TA 4IS5A 1QL7A 3MU1A 4O3TA 1GI0A 2A31A 1YPGH 4YM9A 1BITA 2ZHFH 4D7GA 4ISHH 1TMBH 3U1JB 5CHAB 2AFQB 1ANDA 3OU0A 2FTMA 2H1UA 3ENSB 1T8LA 1BJVA 4NA9H 1BTWA 5FPSA 2OC1A 1QL9A 1ZYOA 2BQ6B 1GL0E 5BRRE 4GCHG 3SBKA 1W2KH 4IN2A 1OP2A 2UUYA 1S81A 1ZGVA 4UONA 1IHSH 1G3DA 3QK1A 1XKAC 3PYHA 4NWKA 1Y8TA 1GJBB 3MI4A 4AX9H 1GJ6A 3TU7H 1UCYK 4FUCA 2SGDE 1IQGA 3GISB 3E91A 1C5YB 2BD9A 3CS7A 1C1VH 1FY8E 1GBCA 1PPBH 3LGIA 1HCGA 9LPRA 1DOJA 5HM9A 1KYNA 1XUHA 1G36A 1NTPA 1T4UH 3SI3H 4B2CA 4BAKB 1A5IA 1PJPA 1RS0A 7ESTE 1P8VC 2AERH 1SGYE 3ZZ3A 4WJG2 1ZSKA 3PMJA 4WMDA 1O31A 4B71A 2VGCC 4A1XA 1GMDF 4NSYA 2CJIA 1L1GA 5EQRA 1K28D 1AUJA 1TNLA 1C5QA 1NFWA 3A8AA 4SGAE 1J14A 3C27B 4YTAA 2ANYA 1RIWC 1CA8B 1O2KA 4K3JA 4X1PU 1F5RA 4RKJB 3HATH 1P12E 4B1TA 1GGDC 2OINA 5C1XA 2OC0A 5FHTA 3F9GA 4NIXA 3RXBA 5E2PA 1C2FA 1GI9B 1ESTA 4Y0ZE 1GBDA 4IC6A 4NWLA 1G3BA 1TA6A 4X6MA 2ALVA 5T3HA 3PMAB 1Z7KA 1BTZA 2VH6A 3KQDA 3MU5A 2GV6A 5C1YA 2H9HA 2UWLA 1MD8A 1LVYA 1C5TA 1O3PB 4ISOA 1ZLRA 1ZMJA 3KN2A 3LKWA 1MTNB 1V2RT 2IOTA 4X8UH 4X8SH 4UFGH 3BN9A 1O30A 1A61H 3A83A 2VIWA 1EZSC 1ZGIA 1AWHB 1ZPBA 1CGHA 2EI8A 1KXEA 1P10A 1WSSH 1BDAA 5EODA 2J38A 1YC0A 2JKHA 3LGUA 2PFEA 1G32B 2ZHWH 3GDSA 1HB0B 1IQHA 4Y6DA 1MKXH 3MMGA 1HAIH 2G81E 3PLBA 5DP7A 1HUTH 2F9VA 1VGCB 1C5UA 3PLKA 1ORFA 1PPCE 1V2MT 1IQIA 1PYTD 1HAHH 6CHAB 1ESBA 1XXDA 4DOQA 2Z9KA 2ANWA 4E05H 2Q6FA 5TCCA 1GHWH 1ZOMA 4CHAC 1CU1A 5F6MA 4HZHA 1TBQH 1EB2A 3M3SA 3ODFA 1FAKH 1GHZA 1EJAA 3RMLH 1AQ7A 1GBKA 1QQUA 2ZDLA 2BD4A 1ARCA 1YPKH 1NZQH 4BAMB 1FN6A 3KQEA 4Y8YA 2ASUB 1YPMH 4ZKRU 3HK3B 1MZDA 5EPNA 4I7YH 1V2KT 2TGAA 3LJJA 2OUAA 4AG1A 3D23A 1Z1JA 4YT7H 1SHHB 3UQOA 2F3CE 3S69A 4NA7A 1TNHA 2XWBI 1JRSA 2P3UB 1WTHD 1P02A 1T4VH 5DP8A 3ZYDA 1GMDG 4AOQA 4ZXYH 1Y3UA 5DP5A 3UWIA 4ZKSU 1AVWA 3QX5H 2ZA5A 1XXFA 3SV6A 2FOHA 1J8AA 1UMAH 5EXLA 2ZCHP 3A84A 1T31A 5A8ZA 2OC8A 2RCEA 3ZZ4A 1C2MA 2ZU4A 1Z71A 2WV5A 1LHDH 2WPHS 2ZF0H 2GKVE 2R3UA 2VINA 1BRUP 1F0RA 4MTBA 3FFGA 1UK3A 3B23B 1O2TA 3GCTF 1O2YA 2ZG0H 1AVGH 4J2YB 3SJOA 2BQWB 4FVDA 1C2JA 2HPPH 8GCHG 3SUFA 5EU8A 4A1TA 1WV7H 3V3MA 1LKBA 3MO6A 2P59A 1DXWA 2XYAA 1Z6JH 1GI6A 1SLVB 1JXPA 2WV4A 4B2BA 3U8OH 3IG6B 1AZZA 1GG6B 1DM4B 1YGCH 1TQ0B 3SUGA 2FOMB 1H4WA 1EOLA 4NIWA 1O2ZA 2R9PA 1SGQE 2D1JA 3SHAH 1CA0B 3FP8E 5BPEA 3GY4A 2VIOA 1D3DB 5FPYA 3B8JA 1SSXA 2C8YB 1C1NA 4BTTB 3MWIU 2C8WB 2R2MB 1BIOA 3ZVCA 1E0FD 1V2QT 3KEEA 5T6GA 4DIHH 5EGMA 1YF4A 1YLCA 4BTUB 1V2NT 1SGNE 4AYVB 2SGEE 4FUJA 6GCHF 4Z6AH 1XUJA 2ZDVH 1ABIH 1AU8A 2QXHA 2FP7B 2OTVA 4CREA 1LHFH 3UNSA 1DANH 1QRXA 3LH3A 3LONA 1P2MA 3PMBB 3URCA 3UIRA 3TH3H 1S6HA 4ZUHA 5TJXA 5GWZA 1J15A 2PTCE 4CR5A 2HOBA 3DT0H 2EI6A 1O35A 2FOAA 4JZEH 2JH6D 3S0NA 5DKMA 1BTXA 2THFB 1P3EA 2I6QA 1O0DH 2Z6BD 2XWAA 1L4DA 1D6RA 3DFJA 1LQEA 3B9FH 1WU1A 3ZVGA 4H6TA 1O38A 1KDQB 3TVJB 2Y7ZA 1TGCA 3BG8A 1O2NA 2QC2A 3H5CB 3KL6A 3OSYA 4F49A 2PW8H 4D8NA 1GVLA 1FAXA 3M5MA 3A7ZA 7KMEH 3UREA 3RXQA 1HJAB 1DITH 2ZQ1A 2XRCA 1S0RA 3T62A 3FZZA 1AFQC 3Q77A 5HXFA 3UUZA 4IMQA 2I6SA 5F8XA 3BF6H 4XBBA 1S83A 2G5VA 3SNBA 4JZIA 1DLKB 4FUFA 3AAVA 4D76A 4MLFB 1ETSH 1NRRH 2XBXA 2BVSH 3S9BA 3F6UH 3MO3A 1SLWB 1WBGB 5I25A 2GDEH 1FI8A 1SHYA 3MU0A 1GHAG 2QXGA 2TGPZ 4Y10E 7GCHG 4MPUA 1VITH 5DP6A 2PKAA 2SGQE 1SOTA 4NCYA 3UNQA 2ZTXA 3MFJA 4JCNA 1CQQA 1P9UA 2BXUH 3RMMH 3UQVA 3A7VA 1IAUA 2J4IA 3MNCA 2ZWLH 3KQBA 1BTPA 1NC6A 2G00A 4OS1A 3SNDA 5DPAA 4B2AA 4YO9A 3ATMA 1NFYA 1VCQA 1EZXC 2B7DH 1K1OA 2UUKB 3UY9A 4TYDA 3TGIE 2ZGJA 1AD8H 2PGQB 2BY8X 1ELEE 4A92A 1TRMA 2G4TA 2TGTA 2CV3A 3GDVA 1EKBB 1O2SA 1Q3XA 3SJIA 4IMZA 5DO4H 5L30H 1DS2E 4B76A 1U6QA 3VB4A 1NRSH 3PLPA 3UR9A 3VGCB 4ZHLU 4INHA 1UCYE 1PQ5A 2FOFA 1DX5M 3T2NA 3ZVBA 2C8XB 1S6FA 3TH2H 1IQKA 3SGAE 2HLCA 4CRAA 1PPZA 4FUDA 1PQ7A 1Q31A 3TK6A 4KELA 1CE5A 4FXGH 1GJDB 2P3TB 1N6YA 3NUMA 2ZPSA 5EXNA 1D3TB 1GHYH 5FAHA 4AYYB 2G51A 1A0LA 4Q7ZA 5EQSA 4E06H 1GJ7B 1JOUB 2AGIX 2H5CA 5GPIB 4TY6A 1ETRH 1G30B 2BD2A 1BTHH 2QV1A 2Y82A 2KAIB 3GYMA 1T8OA 3UTUH 2VH0A 1YCPH 1KY9A 1VCWA 1SL3A 5JBCS 4DY7B 1TQ7B 1OSSA 2FLRH 4B73A 4JYTA 3NXPA 4X2YA 3V7TA 1SLUB 4CRFA 1XUFA 1GWAA 3GY3A 5FPTA 2FWWA 1LHEH 3TH4H 1EAIA 1TIOA 1QJ6B 1SGTA 1HXFH 1SQOA 5E0HA 1SFQB 4RKOB 4UE7H 1O3GA 4ISNA 3E0PB 1HGTH 3TNTA 4BAOB 4VGCB 4XBCA 1GL1A 1SQTA 1O2UA 1W0ZU 4X1QU 4JMYA 2CHAB 2V35A 1CSOE 4ZMAH 4QT8C 3Q76A 4H4FA 1CBWB 1UVTH 4O3UA 2CXVA 1MCTA 1XVMA 3VXEH 1LQDB 2F83A 4TY7A 1Y5AT 4GCHF 1CT4E 1C5LH 2SGPE 3AVZA 1QA0A 2ZO3H 5LGOA 3ESTA 3RXOA 4OS4A 1P2KA 3ATIA 3MNBA 3RXDA 4O9VA 4Z0KA 1K1PA 1UTQA 2O8TA 1DSUA 5AVDA 1RTLA 1BT7A 4F4OC 2PSYA 3VB7A 1MKWH 1GBMA 1AY6H 1DPOA 5H4IB 2GP9B 1TX7A 4X0WU 1FDPA 1QA7A 1O5FH 4FUIA 3CS0A 2G8TA 4XOJA 1LDTT 1UK2A 5A09A 2HNTC 3QN7A 4JK5A 3UWJH 2A4GA 2ZFSA 3QZRA 5C2ZA 4AGKA 2CN0H 1CO7E 2FM2A 1TNIA 1V2TT 4BTIB 4X6OA 1GVKB 2LPRA 3QDZB 4MNXA 3M5LA 3SI4H 3A8BA 2VIVA 2UUFB 1W11U 4KKDA 5A0BA 3I78A 4ZHMU 1QCPA 2ZDAH 1P2JA 1AE5A 2J95A 5HYOA 4E7NA 2ZP0H 4M7GA 1HAOH 3RXFA 3RXAA 1TNJA 3ZVDA 1LTOA 1DY9A 3ZYEA 2TRMA 3EGKH 2BD5A 3PWCA 2GGVB 1BRCE 2Y7XA 4I8GA 4X1NU 2F9PA 3M5NA 1SLXB 3VFEA 2VWMA 4AB9A 1MU6B 1FXYA 1UO6A 3ZZDA 2WYJA 1AKSA 4LZ1H 1DDJA 1MTSA 1MD7A 1SI5H 1OWEA 1AUTC 2BD7A 1PYTC 3SU3A 2BZAA 3MNSA 1V2UT 1GBEA 3ZVAA 1SG8B 3KNXA 1T7CA 2V3OH 1UTNA 4PROA 5EW1H
chains in the Genus database with same CATH superfamily
1EP5A 5CHAC 3LC3A 4INKA 1O39A 2F9OA 5IK2D 3SUEA 1UTPA 1AFEH 2IJOB 3TK9A 1TGTA 4LK4A 1TOCB 1GJAB 4OM9A 5EQQA 2ZHQH 2SNWA 5DP3A 1NO9H 2A2QH 2WINI 3GY7A 1RRKA 1O2RA 1TFXA 1HAGE 1O2QA 1V2OT 1S84A 2PHBA 1RJXB 1KLTA 1D3QB 4CBOA 1L0ZA 4MVNA 1MKWK 1NY22 1O2LA 2GDDA 2QF0A 2PUXB 4Y79A 2AHME 1ANBA 4TPIZ 1SVPA 5AHGH 3QGNB 4AFZA 1QY6A 3NCLA 4IGDA 2ODYB 2OLGA 5F8ZA 4GVUA 2ZU5A 4AFUA 2AGEX 4DT7B 2TPIZ 1SGCA 3GDUA 1AB9B 1K1IA 1ESAA 1YM0A 1G9IE 3T28A 5G4BA 2FI3E 1C5MD 2A7JA 1TGBA 2BDBA 2ZC9H 1PQ8A 2EY4C 3L6PA 3R0FA 4INLA 3L3TA 1WQSA 1MTVA 5T6FA 1C1WH 1O3DA 2GT8A 2XBYA 2XCFA 3MOCA 1A4WH 3HKJB 4MNYA 1Y3WA 2SGAA 2VWLA 3RLWH 5GDSH 2WSSD 5EOKA 1GHXH 1P0SH 1UK4A 3RXRA 2AIQA 5J4SA 3D49H 4MNWA 2IN2A 1GDQA 1THRH 2YNBA 4Y76A 5HGGA 1GJCB 2EQNA 1C5PA 2VB0A 6ESTA 1NFUA 5SGAE 2GX4A 2Z3EA 2LELA 5GCHG 1SOZA 2GZ9A 5C94A 1G37A 1XM1A 1D6WA 4I8KA 4X6PA 3ATWA 4M9FA 3SGQE 1RD3B 2ZZUH 2PTNA 1J9CH 1Q2WA 1HDTH 3OEED 3SU0A 1IQFA 2FXRA 1J16A 1C5VA 1UTLM 3BTTE 5DG6A 3SNCA 3A85A 1TNKA 2YNAA 1TMTH 3G01A 2ESTE 4FU7A 4ZROA 2P93A 1MTNC 8GCHF 1QBNA 3NPSA 3A7YA 4X2XA 3KQ5A 3ZZ5A 3ATLA 5JPMH 1INCA 1ANCA 1RGQA 1E38B 2H5DA 2UWPA 2NU1E 1C2DA 1L1JA 2FS9A 1O36A 1YPHC 1N8OB 4AG2A 1NU7B 3DHKH 4YLUA 3VEQB 1FUJA 2FYQA 4X2WA 1C5ZB 4U2WA 3IITA 4Q7XA 4ABJA 2C3SA 5FBEA 1PFXC 5I46H 2P95A 1HAVB 3QZQA 3T26A 1VGCC 1IHTH 1WQVH 2SFAA 1OWIA 2SGFE 2ZPRA 6CHAC 3BTFE 2J9NA 1BOQA 5GIBA 4IBLH 1C4U2 5K0HA 4DCDA 3RXSA 2BMGB 1SFIA 4D7FA 1NBMD 1K1JA 1ZMNA 1WCZA 2ZDKA 1V2LT 4TSFD 2FEQH 3SO3A 2OCVB 3TIUA 2BQ7B 1O3CA 1J17T 4JZ1A 4NIYA 5EPYA 1BBRH 2BM2A 2W7SA 1KLJH 2P16A 3CENA 5EJZA 5JYIA 1GMHF 4THNH 1RXPA 2CMYA 1HAPH 3D65E 4FUEA 3MH4A 2B8OH 3BTEE 2BLWA 3BG4B 5C67A 4UFEH 3P8GA 3FP6E 1KIGH 1C5SA 2ODQA 3HGPA 4X6NA 1Z1IA 1UW7A 1E35B 1YBWA 3ZZCA 1CHOF 2ZU1A 1VCPA 2VNTA 2FO9A 4WH6A 5B6OA 2BY5X 4HG6A 3SU4A 1HLTH 2P8OB 3Q3KA 1SGFA 3N7EA 3ZZBA 4FVBA 2F9UA 4MPWA 1ABJH 3LDXH 3FKSD 1CT0E 1H8ED 2WUCA 3MNXA 3SU5A 2ZHEH 3MH5A 1LPKB 4XSKU 1DUAA 3UNRA 4U30A 2VWNA 2ZFPH 4CRCA 1NM6A 2J94A 3A81A 1QQ4A 4AORA 3F0PA 4MG3A 1YPEH 2Z9GA 4D9QA 1ZZZA 1QFKH 2FZZA 2VIPA 4Y8XA 2A4RA 4AN7A 3M5OA 1Z6EA 4TT3D 1JRTA 1DUEA 2CK3D 1QHRB 1HRTH 1LKAA 1UHBB 1MBMA 1C1PA 1GHBF 2J92A 3A8DA 2ODPA 1RTFB 1VZQH 1GHAF 4JYUH 7GCHF 1GG6C 1W0JD 4K2YA 2ZQ2A 1GDNA 1Y5BT 1GI1A 4TPYA 4X1SU 1EZQA 4R0IA 4ESTE 3BEIB 3PM3A 4ABBA 1O33A 4FU8A 3RXGA 1CA0C 1OWKA 1DLEA 2O8UA 2ZI2H 4CBNA 1O3JA 2PKSB 3GY6A 3IWMA 3R3GB 3S7KB 3BTKE 1LVMA 1OYQA 4A7IB 1MQ5A 1EJMA 2HNTE 1BZXE 1GMCF 1NS3A 2ZHDA 1ARBA 2D2DA 3PV2A 2GJGA 1E36B 1YLDA 1O3FA 1BQYA 1GBHA 1QIXB 4KTCA 1O2GH 1BBRK 1MMJN 2VBCA 1ZHRA 2ZTYA 3SOSA 2ANMH 1O5AB 1OWHA 3E16B 1FQ3A 1O34A 3SYJA 2Z3DA 4Q2KA 1QL8A 1GMHG 4Q80A 3T5FH 1FN8A 4BAQB 3A7XA 3LU9B 1G2LA 2JH0D 3SNEA 2V3HH 1VR1H 2HWLB 5KECA 4Y71A 1L2EA 1OXGA 1HIAB 1XX9A 3KYGA 3F2GA 1BHXB 3O8RA 1K1MA 1SGIB 2TBSA 1CHOG 3M3TA 1O2VA 4ZXXH 1TYNA 1KXCA 5A0CA 1AI8H 4BXSA 1QBVH 1SGPE 2PSXA 1HFDA 1SC8U 4Y7AA 3RXLA 1ZHMA 2PGBB 1C5OH 1EZUC 2QF3A 1W10U 5T6DA 2J2UA 1H1BA 2FIRH 2AMQA 5JBTA 4YESB 1O2MA 1HJAC 3E3TA 3I29A 3N7DA 2UUJB 5LPEA 1CGIE 2A0QB 2ZDNA 2PR3A 1DY8A 1EAWA 3DD2H 2FI4E 3BV9B 2BZ6H 2HLDD 2ZFRH 1XUKA 4Y7BA 1NROH 5DJ7A 3PTNA 5JB9S 3DSOA 2QA9E 3W94A 2GD4B 4I31A 1P05A 1GHBG 1TOMH 2B0FA 1H8HD 4Y0YE 3T27A 4ACBA 5JBAS 1KDQA 4K1TA 3SV9A 2ZNKH 2NU3E 2ZGCA 1XKBC 5IYTA 2K1QA 2EA3A 1C5NH 3RMOH 4ABGA 5DK1A 1C4V2 4WH8A 4XDEA 1FY1A 2FOBA 1IOEA 5C3NA 3SV2H 2BLQA 1HNEE 2W6JD 4KP0A 2AMPA 1W12U 2V0BA 2HALA 1D4PB 1FNIA 3RM0H 1UJ1A 2XXLA 5L6NH 3PO1B 8ESTE 1O3EA 4IN1A 2OQ5A 1K2I1 1GMCG 2C90B 2M5TA 4ZCNA 1JBUH 2ZGBH 3F2FA 1L4ZA 4ZKNU 1O37A 3ZZ9A 1C9TA 3ZZ6A 2XCNA 2STAE 1Z8IB 1M9UA 5A8YA 2JIZD 1ZSLA 3NK8A 3O8BA 3N99A 3BIVH 1P3CA 1H9LB 3ZZ7A 3GCHB 1PQAA 5EG4A 2CF9H 1FX0B 1HV7A 1B0EA 2Z9IA 2KCPA 1O3OA 4WMEA 2BVRH 3VGCC 3RDZA 3ZIAD 2WYGA 2FOCA 1CT2E 1P06A 3W95A 3RU4D 2QAAA 1C5XB 1YPLH 1ELFA 3BTQE 1EPTB 1AGJA 1TPPA 4NIVA 2P94A 3RU4T 3MHWU 1GBBA 1O32A 3FANA 4BOHA 4YOGA 4IC5A 1P03A 1EQ9A 2W7UA 3K65B 2BX3A 1BJUA 1H8IH 3RXMA 2AMDA 4TWYA 2O8WA 1N1LA 3SJKA 1MU8B 4DVAU 2FOGA 1AVXA 3LT3A 5HIYA 1W0KD 3PB1E 1D3PB 4JYVH 3LGTA 3BTWE 5E0JA 1TAWA 4NZLA 1NRQH 3RXJA 3ZVEA 9ESTA 1W0YH 3T25A 1ELVA 1ID5H 3LJOA 3UOUA 4KTSA 3H7OA 4AFQA 3MU4A 4MNVA 4XFQA 3C1KA 2ZIQH 2ALPA 4D9RA 2FI5E 1PPFE 3EE7A 3KIDU 2RDLA 1SGFG 3GYLB 4HGCA 4BXWA 3M36A 2Z94A 1W7XH 2AEIH 2O9QA 1BHXF 3SQHE 1AMHA 3BTHE 2VVCA 3TJNA 4GUXA 1YPHE 2L6OA 4K1SA 3SJ9A 5B6LA 5ABWA 2GVFA 4NG9H 4MQAA 3E1XB 3RP2A 4VGCC 4ZHAA 4DURA 2VJ1A 3PMHB 2CHAC 2VIDA 1P01A 2LNCA 5E0GA 1P2NA 4I33A 5FCRA 1F2SE 2R0KA 1COWD 1CBWC 1UTOA 1ZRKA 2KAIA 2NU0E 1OP0A 3RXEA 3Q00A 5C1UA 2GCHF 1UVSH 1TPAE 1O5EH 1H9HE 4K8BA 2BD3A 5CMXH 1FJSA 3FZDA 1UVOA 2OQUA 4MPVA 1FMGA 2ZU2A 5FX6A 3MYWA 1BRBE 2HPQH 1SBWA 3AW0A 3SN8A 3RUOA 3KGPA 1VJAU 3RXHA 1ZJKA 1ZTKA 2JJ2D 3E90B 2BXTH 1GDUA 1OP8A 2ZCLP 3V13A 1EAUA 1C1RA 3SU2A 1OYTH 1WAYB 1DE7H 1LCYA 3GOVB 3RC5A 3O8DA 3E6PH 2O8LA 4MPXA 1A0JA 1BB0B 2Y80A 2ZGHA 3WY8A 3AASA 4NZQA 1LHCH 1GBIA 2C8ZB 3DUXH 4JZFH 3GY8A 1E37B 1NN6A 2FYRA 5EXMA 1YCPM 8LPRA 5ESTE 3MTYA 1LPGB 2PWXA 1BMMH 1PPGE 4B75A 1F5LA 5FBIA 3SJ8A 1IQEA 1FPCH 1H8DH 1S82A 5HM2A 3V0XA 2FLBH 2DE9A 2B5TB 1A46H 1KLIH 1FZZA 2QCYA 2GZ7A 1VJ9U 1O2HA 3U8RH 2FPZA 1W3CA 2QY0B 1FLEE 4FUBA 1NFXA 2ZFTA 3EQ0H 2JETB 3DA9B 4YT6H 2Z9JA 1QZ8A 1ZHPA 3PV4A 2GMTB 1H9IE 4ISIH 1Y3XA 1CVWH 3ZZ8A 2PLXA 5GCHF 3P17H 4AB8A 2IJD1 3AAUA 5FCKA 1TA2A 1OS8A 3TJVA 5EW2H 1TPSA 1XUIA 1P09A 2RG3A 5E2OA 3STIA 3DSPA 3EA9A 4YXWD 5C17A 4R8TB 1EX3A 2F91A 3EA7A 2Y81A 3RXTA 1GCTB 7LPRA 5DGJA 3SHCH 2GCTB 1B5GH 3FAOA 2IPHA 3LIWA 3ODDA 1ACBE 1O3BA 1K22H 3E8LA 4ASHA 1MAXA 2FODA 3P92A 4H42U 3KCGH 1ELTA 3LGVA 4UDWH 2V3MA 2GCHG 4DGJA 1T32A 1MAYA 3SUDA 5C0TA 4ABIA 2BYAX 2NWNA 1OWDA 1BMNH 1KXAA 2WPKS 2H2ZA 3JZ1B 2W26A 1GJ8B 3V12A 2AIPA 1DWDH 3QTOH 2WPJS 3DFLA 4P00A 1UTJA 2ULLA 1TMUH 3AW1A 3P8FA 3CP7A 1O3LA 5DSFA 1AHTH 1PPHE 2V6NA 4X8TH 1JIMA 4O03A 2G4UA 4I32A 1E79D 2ZFFH 1Z8RA 1EASA 1QRWA 4Y8ZA 5HMAA 5TCAA 1V2JT 4UEHH 3UPEA 2WUBA 4WXIA 4AC9A 1QGFA 2KX4A 3MU8A 1EATA 2RA0A 3I77A 4UFDH 1AB9C 4WMFA 2ZFQH 1JIRA 1TRYA 2FTLE 1TRNA 1P9SA 1A2CH 1O2WA 1SPJA 4DIIH 1BBRE 3OTPA 1LVBA 2W3KA 3U1IB 1ZJDA 3LPRA 3GCOA 1SGEE 3LH1A 3NKKA 1NESE 2XBWA 3M37A 1LPZB 1X7AC 4GSOA 1GBJA 2R2WU 2ZECA 1BA8B 1GHVH 2D8WA 1C4Y2 3SV7A 2KCAA 5CHBA 2FMJA 4K69A 3QLPH 1V2VT 4ZAEA 2ZU3A 1FIWA 3CNRA 5FX5A 1C5WB 1NU9A 2OXSA 1A5HA 1C5RA 3TK5A 2VGCB 3EA8A 4CH2B 3FP7E 5EJ1A 3Q3YA 1C2HA 2JH5D 1GBFA 3M61U 1VITF 5K7RA 2BHGA 3F9FA 3TGKE 1N6XA 1RIWB 2VVUA 1Z8JB 1HJ9A 3RXVA 3HPTB 3BEUA 3LGWA 1YYY1 1ZPZA 1GGDB 2EC9H 2HVXA 5JB8S 1MH0A 3JZ2B 2HNTF 2Z9LA 5LPFA 1EB1H 3QUMP 3SQEE 1LO6A 4ABHA 1AWFH 1B0FA 1QB1A 2W5EA 3F9HA 4J1YA 2WPLS 1C1MA 3K2UA 2J5UA 2AGGX 2QIQA 4HTCH 1CGJE 1K21H 2RA3A 1SR5C 2OP9A 2VU8E 4U32A 3URDA 1V6DA 4UD9H 1ZSJA 4Y11E 4CRBA 5F03A 1GCDA 1QTFA 3BTGE 1ELGA 1KSNA 3MH7A 3RXKA 3SV8A 1N8OC 2ZEBA 2BD8A 3GICB 3M3VA 1P2QA 2WPIS 1O5CB 4GHTA 3TLOA 8KME2 2FX6A 1S5SA 1DWBH 1L1NA 3SU6A 3M35A 4H6SB 4CH8B 3PRDA 4X1RU 2EEKA 3MO9A 4B74A 4CRDA 4FUGA 5GXPA 5J4QA 2Y5HA 1GBLA 5HKKD 1Y3VA 1FONA 1KXFA 1TPOA 3BSQA 1DSTA 2Y6TA 4WWYA 5C5OA 1SMFE 1Y59T 5LPRA 6LPRA 2QXIA 2PV9B 3OY5U 5C20A 2VWOA 3QGJA 2H9TH 3UFAA 4LXBH 3GS9A 1HAYB 4CHAB 2B9LA 5IDKA 2BY9X 3F9EA 2FX4A 3RC6A 1TBZH 4ABFA 2DUCA 1HAVA 2A45B 1OWJA 3T29A 3DCLA 1K1NA 3BG4C 4KGAA 4ABEA 2C4FH 2GTBA 3STJA 3LC5A 5L2ZH 1EFRD 1A3BH 3SU1A 4OGXA 1Y3YA 4GLYA 1BCUH 2Y5FA 1W8BH 5ESBA 2UWOA 1SQAA 3H7TA 2L74A 3F1SB 4ASUD 2P8OC 1BMFD 1Z8GA 3QWCH 4CRGA 1Y5UT 3QTVH 3BIUH 1FIZA 3K6ZA 3SGBE 3SORA 2F9NA 1VITG 3GCNA 1KTSB 4DW2U 1FV9A 4RSPA 2XOKD 3ZV8A 2AS9A 4FU9A 2JDID 4AFSA 2C93B 3LGYA 2R3YA 1B7XB 1GJ5H 1ZRBA 3F68H 2ZGXH 4NGAH 3P8OA 3P95A 2BDCA 1P04A 4DJZB 2EI7A 1C2EA 4O97A 3ITIA 2CGAA 1TX8A 3L33A 3S7HB 1V3XA 1HAZB 1O3KA 1DICA 2XNIA 3OY6U 4K60A 5JBBS 2ZCKP 3M7TA 4LZ4B 4K5ZA 1G3CA 1P57B 1GI5A 3A86A 1O2OA 3A8CA 3A87A 1F0UA 4BNRA 4WY3A 2DE8A 1SGRE 2XC4A 1EP6A 1ELCA 2H9EH 1K1LA 1QB6A 3A88A 2GZ8A 1BTUA 1XUGA 1GJ4H 4X8VH 1C9PA 1WOFA 2FOEA 2A2XH 3LOXA 4WF8A 1MTWA 1TNGA 3UR6A 3P70B 2O8MA 1ZTJA 1S85A 2VIQA 3PTBA 2PKSC 3PWBA 4YOIA 4OS5A 1MKXK 2BY7X 1O3IA 1EUFA 1GBTA 3PROA 3ZVFA 1W13U 4U01A 4Q63A 2GT7A 2A5IA 2QXJA 3BTDE 2BDIA 1UHBA 3OX7U 1C1OA 5FXLA 1ELDE 1V2WT 2HRVA 1O5DH 1THPB 4ZH8A 3WW7A 1C2LA 1DT2A 4NFEA 4ZKOU 1A0HB 1D9IA 1O2PA 4NFFA 1HBTH 5C5NA 2BDGA 1AE8H 1V2ST 3A80A 4MDSA 1TE0A 3PRBA 2KFWA 1YP9A 4FETA 3U98H 5A8XA 3EYDA 2WZQA 4JZDH 1AN1E 4GHQA 4WXVA 2YMSB 1GI2A 4DG4A 1GI3A 3RXPA 3U8TH 5CE1A 1ZTLA 4A1VA 3OYPA 2QF4A 2XBVA 1KTTB 1O2JA 4IW4E 1S0QA 4OS7A 1W14U 1YWUA 3VPKA 1C1UH 4OS2A 5AFZH 3GY2A 2BDAA 3KF2A 1FY3A 2Q6DA 1NPMA 5AF9H 1O5BB 2PUQH 1TGNA 3HKIB 1HYLA 2OD3B 1BUIA 1DXPA 3K6YA 1LHGH 2NU2E 3BEFB 4OS6A 5A0AE 1DFPA 1HIAA 2YOLA 1F7ZA 1DWEH 2TGDA 2Z3CA 1NBME 2PKAB 4A6LA 3A89A 1C2GA 2Q1JA 4GPGA 1GI4A 3NZIA 2STBE 2A5KA 3RC4A 2J98B 1O2IA 1ELAA 2BB4A 3A82A 3GCTG 3N7OA 4YLQH 1AFQB 3TPIZ 3SZEA 5EIYA 4XBDA 3EDXB 4AZ2B 2G52A 5T1VA 1QRZA 3ZZAA 1UVPA 1P11E 3TJOA 5ETXA 5DP9A 3OTJE 3EE0B 1ETTH 2SNVA 1AZ8A 1AIXH 3ATKA 5LH8A 1TALA 1K9OE 3PO1C 3FVFB 1JMOH 1MCVA 1NT1A 3K9XB 2R0LA 1ELBA 1T8NA 2QGRA 1OX1A 5AFYH 1ZR0A 2A7HA 2BX4A 1C1SA 2BDHA 2ZTZA 1A7SA 1E1RD 1YKTA 2A1DB 1LVOA 2G55A 1O3AA 3HGNA 5GNDA 1UVUH 3GCHC 1TLDA 3D62A 1MUEB 3QO6A 1TGSZ 1BMLA 1C1QA 3BTME 2FS8A 4HI3A 1HPGA 3RXUA 3TITA 1FY5A 2ZDMA 3RLYH 5CDFE 1GI7B 1EPTC 2A4QA 3A7WA 1SB1H 3SZNA 6GCHG 4WVPE 1QR3E 2BLVA 3OAAD 1C2IA 3EAJA 3M7QA 1TBRH 4XRNA 1XVOA 1RFNA 2TIOA 2BVXH 3S9CA 1ANEA 3RXCA 3MH6A 5DP4A 5KGOA 1KXDA 1BMAA 4RN6A 4AGJA 1OOKB 2ZKSA 2P3FH 1V2PT 2VVVA 4JK6A 1O3MA 4YZUA 3WWFA 2KR7A 1SGDE 1F92A 2FDAA 4CR9A 3RM2H 3SW2B 1GJ9B 2BOKA 1ZPCA 3Q3XA 1WTGH 1VKYA 1QJ7B 1MTUA 4ABAA 4GAWA 3S9AA 2BY6X 1E34B 1TB6H 3ELAH 1EPTA 2XC5A 2FESH 3VB6A 3UOPA 2YMSD 2BOHB 1HXEH 4NSVA 2D26C 1EOJA 2CF8H 1WUNH 5L2YH 3P8NA 4I8HA 1TABE 2OC7A 3TGJE 3ZV9A 1CHGA 4XE4A 2W3IA 5GJ4B 3SNAA 2A5AA 2J34A 2BLOA 1PPEE 1FPHH 1C2KA 1GVZA 3GY5A 4ISLA 4X2VA 2F9BH 2HGTH 1MABB 1EXFA 1OPHB 2XTTB 1IQNA 1DWCH 1A3EH 1A1RA 3U9AH 2OBOA 2BDYA 2G5NA 4BAHB 1C1TA 1T8MA 1A5GH 1G2MA 1MQ6A 1QB9A 4FUHA 3RMNH 3VB3A 2GV7A 4E7RG 1QURH 2Q6GA 1TWXB 1QNJA 1AO5A 2AYWA 3TNSA 1KMHB 1JWTA 1G3EA 3P6ZB 1TONA 4A5TS 3O8CA 4ABDA 1W7GH 4RT1A 5A2MH 2ZPQA 4SGBE 5JDUB 1GBAA 3KQCA 1EAXA 3H09A 1UTKA 2A4OA 1UCYH 4NA8A 1NRPH 5F8TA 2H6MA 3VB5A 2OBQA 1GPZA 3VXFH 2AH4X 1GI8B 1QJ1B 4HFPB 1IQLA 1F5KU 1MZAA 1THSH 2ANKH 4UFFH 1P2IA 1ZMLA 1F0SA 3M7UA 1WYKA 1AKSB 2RFKC 2A7CA 1K0HA 1DVAH 1YPJH 1BTYA 1QBOA 2JETC 3RXIA 1E1QD 3UB0A 2Y5GA 1LMWB 4K8YA 3AK5A 2GMTC 1TX6A 1O3NA 1EJNA 1F0TA 1O3HA 1XMNB 3TJUA 2BTCE 1O5GH 5PTPA 1IQJA 1MBQA 4I8LA 2QN5T 3U69H 1P2OA 1KXBA 1YCPK 4TWWA 4Q7YA 1IQMA 5DN6D 3NWUA 1HJ8A 2PP6A 2W6ID 2A32A 4I8JA 4LOYH 1GCTC 2NU4E 1OKXA 2WPMS 2XW9A 2ILNA 4BANB 2GCTC 1BRAA 3E0NB 1FY4A 2Z7FE 1O2XA 1HAXB 2XC0A 3HK6B 4K1EA 1UTMA 1NRNH 5E8EH 1SKYE 4YOJA 4KTUA 3RU4E 3OEHD 1RTKA 2QYIA 3KHVA 4OGYA 3A7TA 4IS5A 1QL7A 3MU1A 4O3TA 1GI0A 2A31A 1YPGH 4YM9A 1BITA 2ZHFH 4D7GA 4ISHH 1TMBH 2K0QA 3U1JB 5CHAB 2AFQB 3OE7D 1ANDA 3OU0A 3W1EA 2FTMA 2H1UA 3ENSB 1T8LA 1BJVA 4NA9H 1BTWA 5FPSA 2OC1A 1QL9A 1ZYOA 2BQ6B 1GL0E 5BRRE 4GCHG 3SBKA 1W2KH 4IN2A 1OP2A 2UUYA 1S81A 1ZGVA 4UONA 1IHSH 1G3DA 3QK1A 1XKAC 3PYHA 4NWKA 1Y8TA 1GJBB 3MI4A 4AX9H 1GJ6A 3TU7H 1UCYK 4FUCA 2SGDE 3NRLA 1IQGA 3GISB 3E91A 1C5YB 4F55A 2BD9A 3FN8A 3CS7A 1C1VH 1FY8E 1GBCA 1PPBH 3LGIA 1HCGA 2KCOA 4DT4A 9LPRA 1DOJA 2F4LA 5HM9A 1KYNA 1S6LA 1XUHA 4B6EA 1G36A 1NTPA 3FOAA 5F53A 1T4UH 3SI3H 4B2CA 4BAKB 1A5IA 1PJPA 1RS0A 7ESTE 5KEDA 1P8VC 2AERH 1SGYE 4F48B 3DSGA 3ZZ3A 4WJG2 1ZSKA 3PMJA 4WMDA 1O31A 4B71A 2VGCC 4A1XA 1GMDF 4NSYA 2CJIA 1L1GA 5EQRA 1K28D 1AUJA 1TNLA 1C5QA 1NFWA 3A8AA 4SGAE 1J14A 3C27B 4YTAA 2ANYA 1RIWC 1CA8B 1O2KA 4K3JA 4X1PU 1F5RA 2QF5A 4RKJB 3HATH 1P12E 4B1TA 1GGDC 2OINA 5C1XA 2OC0A 5FHTA 1SQRA 3F9GA 4NIXA 3RXBA 5E2PA 1C2FA 1GI9B 1ESTA 4Y0ZE 1GBDA 4IC6A 4NWLA 1G3BA 1TA6A 4X6MA 2ALVA 5T3HA 3PMAB 1Z7KA 1BTZA 2VH6A 3KQDA 3MU5A 2GV6A 5C1YA 2H9HA 2UWLA 1MD8A 1LVYA 1C5TA 1O3PB 4ISOA 1ZLRA 1ZMJA 3KN2A 3LKWA 1MTNB 1V2RT 2IOTA 4X8UH 4X8SH 4UFGH 3BN9A 1O30A 1A61H 3A83A 2VIWA 1EZSC 1ZGIA 1AWHB 1ZPBA 1CGHA 2EI8A 1KXEA 1P10A 1WSSH 1BDAA 5EODA 2J38A 1YC0A 2JKHA 3LGUA 2PFEA 1G32B 2ZHWH 3GDSA 1HB0B 1IQHA 4Y6DA 1MKXH 3MMGA 1HAIH 2G81E 3PLBA 5DP7A 1HUTH 2F9VA 1VGCB 1C5UA 3F2HA 1ORFA 1PPCE 3PLKA 1V2MT 1IQIA 1PYTD 1HAHH 6CHAB 1ESBA 1XXDA 1YLNA 4DOQA 2Z9KA 2ANWA 3VG8A 4E05H 2Q6FA 5TCCA 1GHWH 1ZOMA 4CHAC 1CU1A 5F6MA 4HZHA 1TBQH 2F43B 1EB2A 3M3SA 3ODFA 1FAKH 1GHZA 1EJAA 3RMLH 1AQ7A 1GBKA 1QQUA 2ZDLA 2BD4A 1ARCA 1YPKH 1NZQH 2IPQX 4BAMB 1FN6A 3KQEA 4Y8YA 4I86A 2ASUB 1YPMH 4ZKRU 3HK3B 1MZDA 5EPNA 4I7YH 1V2KT 2TGAA 3LJJA 2OUAA 4AG1A 3D23A 4B6FA 1Z1JA 2QE7D 4YT7H 1SHHB 3UQOA 2F3CE 3S69A 4NA7A 1TNHA 2XWBI 1JRSA 2P3UB 1WTHD 1P02A 1T4VH 5DP8A 3ZYDA 1GMDG 2KCYA 4AOQA 4ZXYH 1Y3UA 5DP5A 3UWIA 4ZKSU 1AVWA 2WV9A 2ZA5A 3QX5H 1XXFA 3SV6A 2FOHA 1J8AA 1UMAH 5EXLA 2KZ4A 2ZCHP 1T31A 3A84A 5A8ZA 2OC8A 2K8IA 2RCEA 3ZZ4A 2WHXA 1C2MA 2ZU4A 1Z71A 2WV5A 1LHDH 2WPHS 2ZF0H 2GKVE 2R3UA 2VINA 1BRUP 1F0RA 4MTBA 3FFGA 1UK3A 3B23B 1O2TA 3GCTF 1O2YA 2ZG0H 1AVGH 4J2YB 3SJOA 2BQWB 4FVDA 1C2JA 2HPPH 8GCHG 3SUFA 5EU8A 4A1TA 1WV7H 3V3MA 1LKBA 3MO6A 2P59A 5FL7D 1DXWA 2XYAA 1Z6JH 1GI6A 1SLVB 1JXPA 2WV4A 4B2BA 3U8OH 3IG6B 1AZZA 1GG6B 1DM4B 1YGCH 1TQ0B 3SUGA 2FOMB 3OFND 1H4WA 1EOLA 4NIWA 1O2ZA 2R9PA 1SGQE 3PV5A 2D1JA 3SHAH 1CA0B 3FP8E 5BPEA 3GY4A 2VIOA 1D3DB 5FPYA 3B8JA 1SSXA 2C8YB 1C1NA 4BTTB 3MWIU 2C8WB 2R2MB 1BIOA 3ZVCA 1E0FD 1V2QT 3KEEA 5T6GA 4DIHH 5EGMA 1YF4A 1YLCA 4BTUB 5EJLA 1V2NT 1SGNE 4AYVB 2WPDD 2SGEE 4FUJA 6GCHF 4Z6AH 1XUJA 2ZDVH 1ABIH 1AU8A 2YMSC 2QXHA 2FP7B 2OTVA 4CREA 1LHFH 3UNSA 1DANH 5C0UA 1QRXA 3F0OA 1WDIA 3U28C 3LH3A 3LONA 1P2MA 3PMBB 3FO8D 3URCA 3UIRA 3TH3H 1S6HA 4ZUHA 5TJXA 5GWZA 1J15A 2PTCE 4CR5A 2HOBA 3DT0H 2EI6A 1O35A 2FOAA 4JZEH 2JH6D 3S0NA 2V7QD 5DKMA 1BTXA 2THFB 1P3EA 2I6QA 3KYFA 1O0DH 5HIZA 2Z6BD 2XWAA 1L4DA 1D6RA 3DFJA 1LQEA 3B9FH 1WU1A 3ZVGA 4H6TA 4P02A 1O38A 1KDQB 4XD7D 3TVJB 2Y7ZA 1TGCA 3BG8A 1O2NA 2QC2A 3H5CB 3KL6A 3OSYA 4F49A 2PW8H 4D8NA 1GVLA 1FAXA 3M5MA 3A7ZA 7KMEH 3UREA 3F3BA 3RXQA 1HJAB 1DITH 2ZQ1A 2XRCA 1S0RA 3T62A 3FZZA 1AFQC 3Q77A 5HXFA 3UUZA 4IMQA 2I6SA 5F8XA 3BF6H 4XBBA 1S83A 2G5VA 3SNBA 4JZIA 1DLKB 4FUFA 3AAVA 4D76A 4MLFB 1ETSH 1NRRH 2XBXA 2BVSH 3S9BA 3F6UH 3MO3A 1SLWB 1WBGB 5I25A 2GDEH 1FI8A 1SHYA 1OHHD 3MU0A 1GHAG 2QXGA 2TGPZ 4Y10E 7GCHG 4MPUA 1VITH 5DP6A 2PKAA 2SGQE 1SOTA 4NCYA 3UNQA 2ZTXA 3MFJA 4JCNA 1CQQA 1P9UA 2BXUH 3RMMH 3UQVA 3A7VA 1IAUA 2J98A 2J4IA 3MNCA 1YY3A 2ZWLH 3KQBA 1BTPA 1NC6A 2G00A 4OS1A 3SNDA 5DPAA 4B2AA 4YO9A 2M2AA 3ATMA 1NFYA 1VCQA 1EZXC 2B7DH 1K1OA 2UUKB 3UY9A 4TYDA 3TGIE 2ZGJA 1AD8H 2PGQB 2BY8X 1ELEE 4A92A 1TRMA 2G4TA 2TGTA 2CV3A 3GDVA 1EKBB 1O2SA 1Q3XA 3SJIA 4IMZA 5DO4H 5L30H 1DS2E 4B76A 1U6QA 3VB4A 1NRSH 3PLPA 3UR9A 3VGCB 4ZHLU 4INHA 1UCYE 1PQ5A 2FOFA 1DX5M 3T2NA 3ZVBA 2C8XB 1S6FA 3TH2H 1IQKA 3SGAE 2HLCA 4CRAA 1PPZA 4RI0A 4FUDA 1PQ7A 1Q31A 3TK6A 4KELA 1CE5A 2LP6A 4FXGH 1GJDB 2P3TB 1N6YA 3NUMA 2ZPSA 5EXNA 1D3TB 1GHYH 5FAHA 4AYYB 2G51A 1A0LA 4Q7ZA 5EQSA 4E06H 1GJ7B 1JOUB 2AGIX 2H5CA 5GPIB 4TY6A 1ETRH 1G30B 2BD2A 1BTHH 2QV1A 2Y82A 2KAIB 3GYMA 1T8OA 3UTUH 2VH0A 1YCPH 1KY9A 1VCWA 1SL3A 5JBCS 4DY7B 1TQ7B 1OSSA 2FLRH 4B73A 4JYTA 3NXPA 4X2YA 3V7TA 1SLUB 4CRFA 1XUFA 1GWAA 3GY3A 5FPTA 2FWWA 1LHEH 3TH4H 1EAIA 2KM0A 1TIOA 1QJ6B 1SGTA 1HXFH 3WWBA 1SQOA 5E0HA 1SFQB 4RKOB 4UE7H 1O3GA 4ISNA 3E0PB 1HGTH 3TNTA 4BAOB 4VGCB 4XBCA 1GL1A 1SQTA 1O2UA 1W0ZU 4X1QU 2OK5A 4JMYA 2CHAB 4Z1MD 2V35A 1CSOE 4ZMAH 4QT8C 3Q76A 4H4FA 1CBWB 1UVTH 4O3UA 2CXVA 1MCTA 2J97A 1XVMA 3VXEH 1LQDB 2F83A 4TY7A 1Y5AT 4GCHF 1CT4E 1C5LH 2SGPE 3AVZA 1QA0A 2ZO3H 5LGOA 3ESTA 3RXOA 3MQKC 4Q4LA 4OS4A 1P2KA 3ATIA 3MNBA 3RXDA 4O9VA 4Z0KA 1K1PA 1UTQA 2O8TA 1DSUA 5AVDA 1RTLA 1BT7A 4F4OC 2PSYA 3VB7A 1MKWH 1GBMA 1AY6H 1DPOA 5H4IB 2GP9B 1WXRA 1TX7A 4X0WU 1FDPA 1QA7A 1O5FH 4FUIA 3CS0A 2G8TA 4XOJA 1LDTT 1UK2A 5A09A 2HNTC 3QN7A 4JK5A 3UWJH 2A4GA 2ZFSA 3QZRA 5C2ZA 4AGKA 2CN0H 1CO7E 2FM2A 2HVYB 1TNIA 1V2TT 4BTIB 4X6OA 1GVKB 2LPRA 3QDZB 4MNXA 3M5LA 3SI4H 3A8BA 2VIVA 4FOUC 2UUFB 1W11U 4KKDA 5A0BA 3I78A 4ZHMU 1QCPA 2ZDAH 1P2JA 1AE5A 2XNDD 2J95A 5HYOA 4E7NA 2ZP0H 4M7GA 1HAOH 3RXFA 3RXAA 1TNJA 3ZVDA 1LTOA 1DY9A 2RDEA 3ZYEA 2TRMA 3EGKH 2BD5A 3PWCA 2GGVB 1BRCE 2Y7XA 3UAIC 4I8GA 4X1NU 4ACAA 2F9PA 3M5NA 1SLXB 4RT0A 3VFEA 2VWMA 4AB9A 1MU6B 1FXYA 1UO6A 3ZZDA 2WYJA 1AKSA 4LZ1H 1DDJA 1MTSA 1MD7A 1SI5H 1OWEA 1AUTC 2BD7A 1PYTC 2JJ1D 3SU3A 2BZAA 3MNSA 1V2UT 1GBEA 3ZVAA 1SG8B 3KNXA 1T7CA 2V3OH 1UTNA 4PROA 5EW1H
chains in the Genus database with same CATH topology
1EP5A 5CHAC 3LC3A 4INKA 1O39A 2F9OA 3SUEA 1UTPA 1AFEH 2IJOB 3TK9A 1TGTA 4LK4A 1TOCB 1GJAB 5EQQA 2ZHQH 2SNWA 5DP3A 1NO9H 2A2QH 2WINI 3GY7A 1RRKA 1O2RA 1TFXA 1HAGE 1O2QA 1V2OT 1S84A 2PHBA 1RJXB 1KLTA 1D3QB 4CBOA 1L0ZA 4MVNA 1MKWK 1NY22 1O2LA 2GDDA 2QF0A 2PUXB 4Y79A 1ANBA 4TPIZ 1SVPA 5AHGH 3QGNB 4AFZA 1QY6A 3NCLA 4IGDA 2ODYB 2OLGA 5F8ZA 4GVUA 2ZU5A 4AFUA 2AGEX 4DT7B 2TPIZ 1SGCA 3GDUA 1AB9B 1K1IA 1ESAA 1YM0A 1G9IE 3T28A 5G4BA 2FI3E 1C5MD 2A7JA 1TGBA 2BDBA 2ZC9H 1PQ8A 3L6PA 3R0FA 4INLA 3L3TA 1WQSA 1MTVA 5T6FA 1C1WH 1O3DA 2GT8A 2XBYA 2XCFA 3MOCA 1A4WH 3HKJB 4MNYA 1Y3WA 2SGAA 2VWLA 3RLWH 5GDSH 5EOKA 1GHXH 1P0SH 1UK4A 3RXRA 2AIQA 5J4SA 3D49H 4MNWA 2IN2A 1GDQA 1THRH 2YNBA 4Y76A 5HGGA 1GJCB 1C5PA 2VB0A 6ESTA 1NFUA 5SGAE 2GX4A 2Z3EA 5GCHG 1SOZA 2GZ9A 1G37A 1XM1A 1D6WA 4I8KA 4X6PA 3ATWA 3SGQE 1RD3B 2ZZUH 2PTNA 1J9CH 1Q2WA 1HDTH 3SU0A 1IQFA 2FXRA 1J16A 1C5VA 1UTLM 3BTTE 5DG6A 3SNCA 3A85A 1TNKA 2YNAA 1TMTH 3G01A 2ESTE 4FU7A 4ZROA 2P93A 1MTNC 8GCHF 1QBNA 3NPSA 3A7YA 4X2XA 3ZZ5A 3ATLA 5JPMH 1INCA 1ANCA 1RGQA 1E38B 2H5DA 2UWPA 2NU1E 1C2DA 1L1JA 2FS9A 1O36A 1YPHC 1N8OB 4AG2A 1NU7B 3DHKH 4YLUA 3VEQB 1FUJA 2FYQA 4X2WA 1C5ZB 4U2WA 3IITA 4Q7XA 4ABJA 2C3SA 5FBEA 1PFXC 5I46H 2P95A 1HAVB 3QZQA 3T26A 1VGCC 1IHTH 1WQVH 2SFAA 1OWIA 2SGFE 2ZPRA 6CHAC 3BTFE 2J9NA 1BOQA 5GIBA 4IBLH 1C4U2 5K0HA 4DCDA 3RXSA 2BMGB 1SFIA 4D7FA 1K1JA 1ZMNA 1WCZA 2ZDKA 1V2LT 3SO3A 2FEQH 2OCVB 3TIUA 2BQ7B 1O3CA 1J17T 4JZ1A 4NIYA 5EPYA 1BBRH 2BM2A 2W7SA 1KLJH 2P16A 3CENA 5JYIA 1GMHF 4THNH 1RXPA 2CMYA 1HAPH 3D65E 4FUEA 3MH4A 2B8OH 3BTEE 2BLWA 3BG4B 5C67A 4UFEH 3P8GA 3FP6E 1KIGH 1C5SA 2ODQA 3HGPA 4X6NA 1Z1IA 1E35B 1YBWA 3ZZCA 1CHOF 2ZU1A 1VCPA 2VNTA 2FO9A 4WH6A 5B6OA 2BY5X 3SU4A 1HLTH 2P8OB 3Q3KA 1SGFA 3ZZBA 4FVBA 2F9UA 4MPWA 1ABJH 3LDXH 1CT0E 2WUCA 3MNXA 3SU5A 2ZHEH 3MH5A 1LPKB 4XSKU 1DUAA 3UNRA 4U30A 2VWNA 2ZFPH 4CRCA 1NM6A 2J94A 3A81A 1QQ4A 4AORA 4MG3A 1YPEH 2Z9GA 4D9QA 1ZZZA 1QFKH 2FZZA 2VIPA 4Y8XA 2A4RA 4AN7A 3M5OA 1Z6EA 1JRTA 1DUEA 1QHRB 1HRTH 1LKAA 1UHBB 1MBMA 1C1PA 1GHBF 2J92A 3A8DA 2ODPA 1RTFB 1VZQH 1GHAF 4JYUH 7GCHF 1GG6C 4K2YA 2ZQ2A 1GDNA 1Y5BT 1GI1A 4TPYA 4X1SU 1EZQA 4R0IA 4ESTE 3BEIB 3PM3A 4ABBA 1O33A 4FU8A 3RXGA 1CA0C 1OWKA 1DLEA 2O8UA 2ZI2H 4CBNA 1O3JA 2PKSB 3GY6A 3IWMA 3R3GB 3S7KB 3BTKE 1LVMA 1OYQA 4A7IB 1MQ5A 1EJMA 2HNTE 1BZXE 1GMCF 1NS3A 2ZHDA 1ARBA 2D2DA 1E36B 1YLDA 1O3FA 1BQYA 1GBHA 1QIXB 4KTCA 1O2GH 1BBRK 1MMJN 1ZHRA 2ZTYA 3SOSA 2ANMH 1O5AB 1OWHA 3E16B 1FQ3A 1O34A 2Z3DA 4Q2KA 1QL8A 1GMHG 4Q80A 3T5FH 1FN8A 4BAQB 3A7XA 3LU9B 1G2LA 2JH0D 3SNEA 2V3HH 1VR1H 2HWLB 4Y71A 1L2EA 1OXGA 1HIAB 1XX9A 1BHXB 3O8RA 1K1MA 1SGIB 2TBSA 1CHOG 3M3TA 1O2VA 4ZXXH 1TYNA 1KXCA 5A0CA 1AI8H 4BXSA 1QBVH 1SGPE 2PSXA 1HFDA 1SC8U 4Y7AA 3RXLA 1ZHMA 2PGBB 1C5OH 1EZUC 2QF3A 1W10U 5T6DA 2J2UA 1H1BA 2FIRH 2AMQA 5JBTA 4YESB 1O2MA 1HJAC 3E3TA 3I29A 2UUJB 5LPEA 1CGIE 2A0QB 2ZDNA 2PR3A 1DY8A 1EAWA 3DD2H 2FI4E 3BV9B 2BZ6H 2ZFRH 1XUKA 4Y7BA 1NROH 5DJ7A 3PTNA 5JB9S 2QA9E 3W94A 2GD4B 4I31A 1P05A 1GHBG 1TOMH 2B0FA 4Y0YE 3T27A 5JBAS 1KDQA 4K1TA 3SV9A 2ZNKH 2NU3E 2ZGCA 1XKBC 5IYTA 2K1QA 2EA3A 1C5NH 3RMOH 4ABGA 5DK1A 1C4V2 4WH8A 4XDEA 1FY1A 2FOBA 1IOEA 5C3NA 3SV2H 2BLQA 1HNEE 4KP0A 2AMPA 1W12U 2V0BA 2HALA 1D4PB 1FNIA 3RM0H 1UJ1A 2XXLA 5L6NH 3PO1B 8ESTE 1O3EA 4IN1A 2OQ5A 1K2I1 1GMCG 2C90B 2M5TA 1JBUH 2ZGBH 1L4ZA 4ZKNU 1O37A 3ZZ9A 1C9TA 3ZZ6A 2XCNA 2STAE 1Z8IB 1M9UA 5A8YA 1ZSLA 3NK8A 3O8BA 3BIVH 1P3CA 1H9LB 3ZZ7A 3GCHB 1PQAA 5EG4A 2CF9H 1HV7A 1B0EA 2Z9IA 1O3OA 4WMEA 2BVRH 3VGCC 3RDZA 2WYGA 2FOCA 1CT2E 1P06A 3W95A 3RU4D 2QAAA 1C5XB 1YPLH 1ELFA 3BTQE 1EPTB 1AGJA 1TPPA 4NIVA 2P94A 3RU4T 3MHWU 1GBBA 1O32A 3FANA 4BOHA 4YOGA 4IC5A 1P03A 1EQ9A 2W7UA 3K65B 2BX3A 1BJUA 1H8IH 3RXMA 2AMDA 4TWYA 2O8WA 1N1LA 3SJKA 1MU8B 4DVAU 2FOGA 1AVXA 3LT3A 3PB1E 1D3PB 4JYVH 3LGTA 3BTWE 5E0JA 1TAWA 4NZLA 1NRQH 3RXJA 3ZVEA 9ESTA 1W0YH 3T25A 1ELVA 1ID5H 3LJOA 3UOUA 4KTSA 3H7OA 4AFQA 3MU4A 4MNVA 4XFQA 3C1KA 2ZIQH 2ALPA 4D9RA 2FI5E 1PPFE 3KIDU 2RDLA 1SGFG 3GYLB 4HGCA 4BXWA 3M36A 2Z94A 1W7XH 2AEIH 2O9QA 1BHXF 3SQHE 1AMHA 3BTHE 2VVCA 3TJNA 4GUXA 1YPHE 4K1SA 3SJ9A 5ABWA 2GVFA 4NG9H 4MQAA 3E1XB 3RP2A 4VGCC 4ZHAA 4DURA 2VJ1A 3PMHB 2CHAC 2VIDA 1P01A 2LNCA 5E0GA 1P2NA 4I33A 5FCRA 1F2SE 2R0KA 1CBWC 1UTOA 1ZRKA 2KAIA 2NU0E 1OP0A 3RXEA 3Q00A 5C1UA 2GCHF 1UVSH 1TPAE 1O5EH 1H9HE 4K8BA 2BD3A 5CMXH 1FJSA 3FZDA 1UVOA 2OQUA 4MPVA 1FMGA 2ZU2A 5FX6A 3MYWA 1BRBE 2HPQH 1SBWA 3AW0A 3SN8A 3RUOA 3KGPA 1VJAU 3RXHA 1ZJKA 1ZTKA 3E90B 2BXTH 1GDUA 1OP8A 2ZCLP 3V13A 1EAUA 1C1RA 3SU2A 1OYTH 1WAYB 1DE7H 1LCYA 3GOVB 3RC5A 3O8DA 3E6PH 2O8LA 4MPXA 1A0JA 1BB0B 2Y80A 2ZGHA 3WY8A 3AASA 4NZQA 1LHCH 1GBIA 2C8ZB 3DUXH 4JZFH 3GY8A 1E37B 1NN6A 2FYRA 5EXMA 1YCPM 8LPRA 5ESTE 3MTYA 1LPGB 2PWXA 1BMMH 1PPGE 4B75A 1F5LA 5FBIA 3SJ8A 1IQEA 1FPCH 1H8DH 1S82A 5HM2A 3V0XA 2FLBH 2DE9A 2B5TB 1A46H 1KLIH 1FZZA 2QCYA 2GZ7A 1VJ9U 1O2HA 3U8RH 2FPZA 1W3CA 2QY0B 1FLEE 4FUBA 1NFXA 2ZFTA 3EQ0H 2JETB 3DA9B 4YT6H 2Z9JA 1ZHPA 3PV4A 2GMTB 1H9IE 4ISIH 1Y3XA 1CVWH 3ZZ8A 2PLXA 5GCHF 3P17H 4AB8A 3AAUA 5FCKA 1TA2A 1OS8A 3TJVA 5EW2H 1TPSA 1XUIA 1P09A 2RG3A 5E2OA 3STIA 3EA9A 4R8TB 1EX3A 2F91A 3EA7A 2Y81A 3RXTA 1GCTB 7LPRA 5DGJA 3SHCH 2GCTB 1B5GH 3FAOA 2IPHA 3LIWA 3ODDA 1ACBE 1O3BA 1K22H 3E8LA 4ASHA 1MAXA 2FODA 3P92A 4H42U 3KCGH 1ELTA 3LGVA 4UDWH 2GCHG 4DGJA 1T32A 1MAYA 3SUDA 4ABIA 2BYAX 2NWNA 1OWDA 1BMNH 1KXAA 2WPKS 2H2ZA 3JZ1B 2W26A 1GJ8B 3V12A 2AIPA 1DWDH 3QTOH 2WPJS 3DFLA 1UTJA 2ULLA 1TMUH 3AW1A 3P8FA 3CP7A 1O3LA 1AHTH 1PPHE 2V6NA 4X8TH 1JIMA 4O03A 2G4UA 4I32A 2ZFFH 1Z8RA 1EASA 1QRWA 4Y8ZA 5HMAA 5TCAA 1V2JT 4UEHH 3UPEA 2WUBA 4WXIA 1QGFA 3MU8A 1EATA 2RA0A 3I77A 4UFDH 1AB9C 4WMFA 2ZFQH 1JIRA 1TRYA 2FTLE 1TRNA 1P9SA 1A2CH 1O2WA 1SPJA 4DIIH 1BBRE 1LVBA 2W3KA 3U1IB 1ZJDA 3LPRA 3GCOA 1SGEE 3LH1A 3NKKA 1NESE 2XBWA 3M37A 1LPZB 1X7AC 4GSOA 1GBJA 2R2WU 2ZECA 1BA8B 1GHVH 2D8WA 1C4Y2 3SV7A 2FMJA 4K69A 3QLPH 1V2VT 4ZAEA 2ZU3A 1FIWA 5FX5A 1C5WB 1NU9A 2OXSA 1A5HA 1C5RA 3TK5A 2VGCB 3EA8A 4CH2B 3FP7E 3Q3YA 1C2HA 2JH5D 1GBFA 3M61U 1VITF 5K7RA 2BHGA 3F9FA 3TGKE 1N6XA 1RIWB 2VVUA 1Z8JB 1HJ9A 3RXVA 3HPTB 3BEUA 3LGWA 1YYY1 1ZPZA 1GGDB 2EC9H 2HVXA 5JB8S 1MH0A 3JZ2B 2HNTF 2Z9LA 5LPFA 1EB1H 3QUMP 3SQEE 1LO6A 4ABHA 1AWFH 1B0FA 1QB1A 2W5EA 3F9HA 4J1YA 2WPLS 1C1MA 3K2UA 4HTCH 2AGGX 2QIQA 1CGJE 1K21H 2RA3A 1SR5C 2OP9A 2VU8E 4U32A 3URDA 1V6DA 4UD9H 1ZSJA 4Y11E 4CRBA 5F03A 1GCDA 1QTFA 3BTGE 1ELGA 1KSNA 3MH7A 3RXKA 3SV8A 1N8OC 2ZEBA 2BD8A 3GICB 3M3VA 1P2QA 2WPIS 1O5CB 4GHTA 3TLOA 8KME2 2FX6A 1S5SA 1DWBH 1L1NA 3SU6A 3M35A 4H6SB 4CH8B 4X1RU 2EEKA 3MO9A 4B74A 4CRDA 4FUGA 5GXPA 5J4QA 2Y5HA 1GBLA 1Y3VA 1FONA 1KXFA 1TPOA 3BSQA 1DSTA 2Y6TA 4WWYA 5C5OA 1SMFE 1Y59T 5LPRA 6LPRA 2QXIA 2PV9B 3OY5U 5C20A 2VWOA 3QGJA 2H9TH 3UFAA 4LXBH 1HAYB 4CHAB 2B9LA 5IDKA 2BY9X 3F9EA 2FX4A 3RC6A 1TBZH 4ABFA 2DUCA 1HAVA 2A45B 1OWJA 3T29A 1K1NA 3BG4C 4KGAA 4ABEA 2C4FH 2GTBA 3STJA 3LC5A 5L2ZH 1A3BH 3SU1A 4OGXA 1Y3YA 4GLYA 1BCUH 2Y5FA 1W8BH 5ESBA 2UWOA 1SQAA 3H7TA 3F1SB 2P8OC 3QWCH 1Z8GA 4CRGA 1Y5UT 3QTVH 3BIUH 1FIZA 3K6ZA 3SGBE 3SORA 2F9NA 1VITG 3GCNA 1KTSB 4DW2U 1FV9A 4RSPA 3ZV8A 2AS9A 4FU9A 4AFSA 2C93B 3LGYA 2R3YA 1B7XB 1GJ5H 1ZRBA 3F68H 2ZGXH 4NGAH 3P8OA 3P95A 2BDCA 1P04A 4DJZB 2EI7A 1C2EA 4O97A 3ITIA 2CGAA 1TX8A 3L33A 3S7HB 1V3XA 1HAZB 1O3KA 1DICA 2XNIA 3OY6U 4K60A 5JBBS 2ZCKP 3M7TA 4LZ4B 4K5ZA 1G3CA 1P57B 1GI5A 3A86A 1O2OA 3A8CA 3A87A 1F0UA 4BNRA 4WY3A 2DE8A 1SGRE 2XC4A 1EP6A 1ELCA 2H9EH 1K1LA 1QB6A 3A88A 2GZ8A 1BTUA 1XUGA 1GJ4H 4X8VH 1C9PA 1WOFA 2FOEA 2A2XH 3LOXA 4WF8A 1MTWA 1TNGA 3UR6A 3P70B 2O8MA 1ZTJA 1S85A 2VIQA 3PTBA 2PKSC 3PWBA 4YOIA 4OS5A 1MKXK 2BY7X 1O3IA 1EUFA 1GBTA 3PROA 3ZVFA 1W13U 4U01A 2GT7A 2A5IA 2QXJA 3BTDE 2BDIA 1UHBA 3OX7U 1C1OA 5FXLA 1ELDE 1V2WT 2HRVA 1O5DH 1THPB 4ZH8A 1C2LA 1DT2A 4NFEA 4ZKOU 1A0HB 1D9IA 1O2PA 4NFFA 1HBTH 5C5NA 2BDGA 1AE8H 1V2ST 3A80A 4MDSA 1TE0A 1YP9A 3U98H 5A8XA