4TQ2A

Structure of s-type phycobiliprotein lyase cpes from guillardia theta
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
183
structure length
177
Chain Sequence
PQFEKIEGRMSVEEFFERSVGSWRSLRSSHNIAAQLEEVNSDIDITQVAADDSEFLDICKTYNFEPEKACSSIRMSWEGSSDWDENEVIKGSTVLVLYKDEERKGKLLRSVIPAVGEWTMQEDGTFVLHTFYDRAAAEERIWFATPDLRMRCSIIKTQHGKGVLTASLSTEVRDKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Biosynthesis and Assembly of Cryptophycean Phycobiliproteins.
pubmed doi rcsb
molecule keywords Putative phycoerythrin lyase
molecule tags Lyase
source organism Guillardia theta ccmp2712
total genus 43
structure length 177
sequence length 183
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09367 CpeS CpeS-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4tq2A00
3CWKA 3DTQA 4ORSA 5BVQA 1AB0A 1OPAA 4ORRA 1GKAB 3KFFA 5BVTA 2IFBA 3ZUIA 3UEUA 1LIEA 3P6FA 5HA0A 4YBPA 1BLRA 4Y0SA 1BWYA 4YGZA 5LJKA 5F6ZA 2NNDA 3FA8A 4NYQA 3WBGA 2QM9A 2POAA 1CBIA 1BSQA 1DZKA 2LFOA 4DQ3A 1R0UA 3C77X 3VG6A 4ODDA 1S44A 2OVDA 3PP6A 4OS0A 4HFOA 1TXLA 4TKBA 1LIDA 5B27A 1BJ7A 1EUOA 3APXA 3OJYC 3TGBA 5HCEC 5F6BA 5HTDA 1EPBA 4IB9A 2AT0X 2G78A 4M6SA 3O2YA 4UU3A 1PBOA 3HWGA 1YWCA 1FTPA 1LFOA 1EIOA 1IW2A 4Y0QA 2KT4B 4OS8A 4EEJA 3L4RA 3CR6A 3FR2A 3I0AA 1NP1A 3AKNA 1X8QA 3VG4A 1X71A 2LKKA 3PPTA 4ZCBA 3VG7A 3EBKA 4IMOA 1MUPA 2CM9A 3FA6A 1SY1A 1G85A 1VYGA 4UU2A 1SY3A 1KT6A 1T0VA 4LZUA 5IO5A 4YFQA 2HYSA 4RUNA 5HAEA 2A0AA 1U0XA 1EXSA 1QFTA 2CBRA 1LKEA 2P8GA 4NLJA 4YBUA 2O62A 2OZQA 4TKJA 3ELXA 3FENA 4ARHA 3WVMA 1GX8A 2FWVA 3HK1A 1IFCA 3JSQA 1VPRA 5DPQA 5F58A 3U9PC 2W2BA 2ACPX 5HTEA 2F73A 1A57A 1I4UA 3FR4A 4NNTA 1CBSA 1FE3A 1IFBA 3ELZA 2L9CA 1GT1A 1BM5A 2JN3A 3BU9A 4IB7A 1HBPA 4OMWA 3U03A 1P6PA 1OEEA 4BQUA 2GJ5A 2WEWA 3UEVA 1G5WA 1CBQA 3FR5A 4PSQA 3SAOA 1A3YA 3APUA 1BRPA 4YFRA 5KHPA 1YP6A 1OBQA 1QQSA 1QABE 2WQ9A 3F8AA 1B8EA 3WJFA 1MVGA 4ZGUA 3CBSA 2A2GA 1ZNEA 4N7CA 4OMXA 1KQXA 1D2UA 2CZTA 1LIBA 5D4AA 2FRSA 1BRQA 3FW5A 4AW8A 1E06A 1XKIA 5HCCC 3U0DA 2HZQA 2OFRX 4KIIA 3KQ0A 5LJEA 3P6HA 5FAZA 2EU7X 4IAXA 5KIDA 5LJHA 1LICA 1SXYA 2WWPA 2JU7A 1I05A 3BU1A 2NNQA 4I3DA 1RBPA 4A60A 1AELA 2LB6A 3HWFA 4HPDA 2Q9SA 2OVEA 5D45A 4YCEA 2L67A 4CK4A 1I04A 4QYPA 2GC9A 2K62A 5B29A 5H9NA 1ACDA 1ZRYA 3CQRA 5D8JA 2RCTA 1PEEA 4XMCA 5HZ8A 1MX7A 4LKTA 4QZTA 2HLVA 1T68X 4ZH6A 4K19A 4GH7A 3WJGA 4GKCA 1GT5A 2Q2MA 2AT5X 1UZ2X 4TQ2A 2A3FX 2QO5A 1KZWA 1HQPA 1LPJA 2AT3X 5LKEA 3PH5A 2FS7A 4A1YA 2FS6A 1BEBA 5LJBA 2QOSC 1OEJA 4HPAA 1JJJA 1GKAA 1X89A 3CBCA 4XMHA 4WBKA 3UEXA 3TZSA 2CM4A 2NP1A 1X8UA 4NP1A 4ZH9A 3STKA 2E4JA 5H9AA 4I3CA 2K23A 1JYJA 1U17A 4A1HA 5EDBA 2RD7C 1U18A 5AQ6A 4EDEA 3WJEA 5C0NA 5FFHA 1TOUA 2CBSA 3CQNA 1DFVA 1KGLA 4YCHA 3WJBA 4OS3A 1BSYA 3VG3A 3BSZE 4I9SA 1DZPA 1XCAA 4QGXA 1MDCA 3B2JA 3NPOA 1GT4A 1OBUA 2BLGA 5HA1A 3I17A 5H9KA 1IKJA 3K3LA 1O8VA 3NP1A 4YDBA 5H8TA 1KXOA 5IO6A 5CE4A 3NQ9A 5EEDA 4AZOA 5F7GA 2A13A 1QY0A 3DSZA 4YDAA 1ERXA 2ASNX 4TKHA 1KT3A 3MVFA 2AT6X 3C78X 3B2IA 1LF7A 4LZVA 2AKQA 3FMZA 1DV9A 2KTDA 1IIUA 1JJXA 4A8ZA 1LNMA 3STMX 1EPAA 5EPQA 4ALOA 1ERBA 3PH6A 1PM1X 1E00A 2YG2A 4QYNA 1JV4A 4I3BA 4WFVA 2W2FA 1ZNDA 3P6EA 4YH0A 3QKGA 1ZNHA 4QZUA 1A18A 2FR2A 5F1EA 3O22A 4GNYA 3IFBA 4YKMA 1KOIA 1SXWA 3PECA 4BVMA 5HZ9A 4QAEA 1DF3A 5EZ2A 2PY1A 3P6GA 1G74A 4EFGA 3FW4A 3ZUOA 3Q6LA 4ZHGA 3CMPA 4ORXA 1I06A 1MX8A 2JOZA 1B4MA 3EM0A 1RLBE 4ORYA 1YWDA 1NGLA 2OVAA 3APWA 4NLIA 1HMRA 1TW4A 4R0BA 4ZHCA 3BDRA 1YIVA 4NYRA 4TLJA 3C76X 2HMBA 2ALLX 2MM3A 3APVA 4ZFXA 2R56A 3HWEA 4ES7A 2HZRA 1KQWA 1SY2A 4MVKA 2AMMX 4GE1A 3FEKA 1JYDA 2FLJA 4TNNA 3VG5A 1VYFA 1ZNKA 3GAQA 2WEXA 4ORUA 5HZQA 1GM6A 4XMGA 3RZYA 4AZPA 4D6BA 1YWBA 3P6DA 1SXUA 1H91A 4HPBA 5KICA 1HBQA 4IMNA 4M7MA 4MVIA 1AVGI 4ZR2A 1QWDA 1HMTA 4AZRA 5JR8A 4GNWA 1YWAA 2NNEA 1ADLA 3D95A 1S7DA 5HWZA 2LBAA 1D3SA 3PEDA 5LKFA 1TVQA 2WQAE 3FA7A 3KZAA 4O9SA 1BBPA 4IB6A 2R74A 4BOEA 3D96A 5LJGA 5EDCA 1SY0A 4YFPA 4ZHFA 5BVSA 5L8OA 2LBVA 3T1DA 2GTFX 2AH7X 3BRNA 3P6CA 1E02A 1YUPA 1O1UA 4D6AA 1FENA 2A2UA 2G79A 3EBWA 4GETA 4RUUA 2N93A 1CRBA 1B56A 3AKMA 3HWDA 4I9RA 1QG5A 4YKOA 1UREA 2AL0X 1SXXA 3NR3A 4QGVA 1EALA 1HMSA 2Q4NA 1QY1A 1DZJA 4XMFA 3O19A 5HZ6A 1FELA 5L8NA 4AZMA 1A2DA 2FR3A 4ORWA 1GXAA 2DM5A 2JU8A 1DZMA 1KT4A 2RA6A 3BX7A 4MVLA 3BLGA 2QO6A 4WFUA 2FT9A 3VG2A 5IO7A 1BSOA 4IB8A 3TGAA 1CBRA 2XKLA 5LJCA 5HCDC 3STNA 1N0SA 2G7BA 2WSJA 1G7NA 3WJCA 3TGCA 1B0OA 5L8IA 5K06A 2ANSA 4ZHDA 1CJ5A 4ALBA 1X8NA 1S2PA 1YP7A 3FEPA 5HZ5A 4AYHA 4YMYA 2CZUA 2MJIA 1OBPA 2XSTA 3FIQA 1E5PA 1ICNA 1FEMA 2WR6A 2JU3A 3EYCA 2ACOA 3S26A 3D97A 4GRJA 4Y0PA 3ZQ3A 1L6MA 4AZQA 1T8VA 1Z24A 3KFIA 3BS2A 3F9DA 4Y0RA 1NP4A 3FA9A 1TOWA 4NNSA 5FENA 2Q39A 3JS1A 1QFVA 1ICMA 4HPCA 3NQ3A 1OPBA 2OFMX 5H9LA 3FLLA 2R73A 2L68A 2L5PA 2AT8X 3WXQA 1EIIA 1O1VA 1GGLA 1JBHA 3FELA 3UEWA 3TF6A 1IKEA 3WJDA 4N7DA 4QGWA 5HBSA 3EMMA 1EQDA 4EXZA 4IBAA 3NX1A 2QO4A 3BX8A 1FDQA 2WUTA 1ZNLA 2X45A 3B2LA 1X8OA 3B2HA 2X46A 3BY0A 4YGHA 1GX9A 4LKPA 3KFHA 4AZNA 3RSWA 1KT5A 4XMEA 1X8PA 2W2AA 4XMDA 1JZUA 3KFGA 2HNXA 2Q2PA 1OEKA 2RCQA 2RQ0A 5D48A 3G7XA 1KZXA 1LIFA 1ZNGA 1EW3A 4IAWA 4ZHHA 3MBTA 2FTBA 5DG4A 1ML7A 1HN2A 1DC9A 5EEEA 3NX2A 5LJDA 3NADA 2MO5A 4YGGA 4DQ4A 3IA8A 1SA8A 4ZJ0A 1QY2A 4TJZA 3B2KA 5D47A 1AQBA 1PMPA 1ALBA 1GT3A 1KT7A
chains in the Genus database with same CATH superfamily
3ZZVA 2BT9A 3CWKA 3DTQA 2I5ZO 4ORSA 5BVQA 1AB0A 1OPAA 1Y55X 2OL8O 4ORRA 3RDOA 2LA7A 1GKAB 1LCWA 3KFFA 3VE2A 5BVTA 2IFBA 3ZUIA 1RXKA 3UEUA 1LIEA 4ON1A 3T6FA 3P6FA 5HA0A 2ZAGA 4FBVA 2Z4IA 4YBPA 1BLRA 2HKDA 4Y0SA 3WYPA 2G5LA 3VHMA 1BWYA 4YGZA 4ZGFA 1NC9A 1HXLA 1VWPB 2OL6O 3P02A 4O4OA 5LJKA 2RTNB 5F6ZA 4Z28A 3WZPA 2NNDA 4EKVA 3FA8A 4NYQA 3WBGA 2QM9A 1GX3A 2POAA 1CBIA 1BSQA 2IZJA 1DZKA 2LFOA 4DQ3A 1R0UA 3C77X 1E2TA 4ID2A 4ODDA 3VG6A 1S44A 2OVDA 2C1SA 3PP6A 4OS0A 1VWJB 1Y9LA 4HFOA 4O4XA 1TXLA 4TKBA 1LIDA 5B27A 1BJ7A 1EUOA 3APXA 3OJYC 3TGBA 5HCEC 1IJ8A 5F6BA 4BX7A 4MVEA 5HTDA 1EPBA 3KVNA 4IB9A 2AT0X 2G78A 4M6SA 3SLJA 3O2YA 4UU3A 1PBOA 3HWGA 1YWCA 1SRFA 1FTPA 1LFOA 1EIOA 3NQKA 2BS6A 1IW2A 1OSPO 4Y0QA 2KT4B 3CKGA 5B11O 4OS8A 4EEJA 3L4RA 3CR6A 3FR2A 4QQ1A 1K24A 1NP1A 3AKNA 3I0AA 1X8QA 3VG4A 1X71A 2LKKA 3PPTA 4NW4A 4ZCBA 3VG7A 1EI5A 3EBKA 1MUPA 4IMOA 2CM9A 2RTBB 3FA6A 1SY1A 4CPEA 2RTOB 3NBXX 3P24A 3RDXA 1G85A 1VYGA 4UU2A 1SY3A 5B5FA 1KT6A 1T0VA 1SWTA 4LZUA 3SLOA 5IO5A 3OBLA 4YFQA 2HYSA 4RUNA 2JGSA 4IABA 2UYWA 5HAEA 2A0AA 1U0XA 4Z2VA 1EXSA 1QFTA 1STRB 1LKEA 2CBRA 2X8FA 2P8GA 3WZNA 4NLJA 4YBUA 2O62A 1DF8A 4Y59A 2OZQA 4TKJA 1MM9A 3ELXA 4O4UA 3FENA 4ARHA 1UYNX 3WVMA 1GX8A 1Y9TA 2FWVA 3HK1A 1IFCA 3JSQA 4KC7A 1VPRA 4GDZA 5DPQA 5F58A 4O3YA 3U9PC 2G8CO 1KFFA 1VWIB 2W2BA 2X32A 2OFBA 3H3IA 2ACPX 5HTEA 2F73A 1A57A 1I4UA 3FR4A 2KW1A 2MF6A 4NNTA 2KTSA 1CBSA 1FE3A 1IFBA 4OKAA 1VWNB 1VWAB 3ELZA 3SZHA 2L9CA 1GT1A 1BM5A 2JN3A 2RTIB 3BU9A 4IB7A 3RDUA 1PBYA 1VWRB 1HBPA 1VWGB 4OMWA 3U03A 3SZIA 1P6PA 1OEEA 4BQUA 2GJ5A 2WEWA 1VWFB 3UEVA 1G5WA 1SWQA 4MEEA 1CBQA 1Y0GA 1JQPA 2RTAA 2A5BA 3FR5A 3MM0A 3EW2A 4PSQA 5CSEA 5IRAA 3SAOA 1A3YA 3APUA 3S5VA 3WYQA 1SLEB 4INNA 4O49A 1BRPA 4YFRA 2GTLM 1SWAA 5KHPA 2IZDB 3N91A 1SWDA 1YP6A 1OBQA 1QQSA 4GJVA 2GH7A 4I60A 1QABE 2WQ9A 2AVIA 3F8AA 4FGIB 4QRLA 1B8EA 4U9CA 1MVGA 1KL5A 4KCAA 3WJFA 1HQQA 2BSZA 3CBSA 4ZGUA 2A2GA 3Q34A 4NV8A 1ZNEA 4N7CA 4OMXA 1KQXA 1PTSA 1D2UA 2JMBA 2A8GA 2CZTA 2MHDA 1LIBA 1W5RA 2FRSA 5D4AA 1BRQA 2F09A 3FW5A 1E06A 4U46A 3ZW1A 4AW8A 3ZW2A 1SWBA 5FQ7E 1XKIA 1LCVA 5HCCC 4CDEA 3U0DA 4MISA 2HZQA 2RTDB 2OFRX 1Y52X 3KQ0A 4KIIA 5LJEA 3P6HA 4ML7B 5FAZA 2RTLA 2EU7X 4IAXA 2OYBO 4U8UO 3T2WA 5KIDA 4O3XB 1LICA 5LJHA 1SXYA 2WWPA 1N9YA 2JU7A 1I05A 3BU1A 4CPIA 2NNQA 4ZR2A 4I3DA 1RBPA 1LCZA 4A60A 1AELA 2LB6A 5IXGA 4QNIA 3HWFA 4HPDA 2IZHB 2Q9SA 4C5PA 3RE6A 2OVEA 1SWGA 5D45A 4YCEA 2L67A 4CK4A 1I04A 3VGWA 2OF9A 1RXHA 4GGRA 4QYPA 1WBIA 2GC9A 2RTCB 3V8UA 2UZ2A 1VWDB 2K62A 5B29A 4GGZA 5H9NA 1ACDA 1ZRYA 5CHKA 4GD9A 2QOMA 3CQRA 5D8JA 3S5XA 3VE1A 2IZCB 3F6ZB 2RCTA 5F2BA 2RTMA 1PEEA 4XMCA 4B55A 5HZ8A 1MX7A 4LKTA 4QZTA 2HLVA 1T68X 3WZQA 1SRJA 2FGSA 4ZH6A 4K19A 4GH7A 3WJGA 4GKCA 1GT5A 2Q2MA 2AT5X 1UZ2X 4GU8A 4TQ2A 2A3FX 2QO5A 1LELA 1VWCB 2Y32A 5B5GA 2OY5O 1HQPA 1KZWA 1LPJA 2AT3X 5LKEA 1JJUA 1LDQA 3PH5A 2FS7A 1VWMB 4A1YA 2FS6A 1BEBA 3UAQA 5LJBA 2QOSC 1OEJA 1SWFA 4HPAA 1JJJA 1GKAA 1X89A 1SWRA 3CBCA 4XMHA 4WBKA 3RKGA 3UEXA 4DCBA 2CM4A 3TZSA 2NP1A 1X8UA 4NP1A 4ZH9A 2BC3A 4I95A 3STKA 1N9MA 1VWHB 3FDCA 2E4JA 5H9AA 4I3CA 1LUQA 2K23A 1JYJA 1U17A 4KT5A 4A1HA 5EDBA 3EW1A 2RD7C 1U18A 5AQ6A 4EDEA 3WJEA 5C0NA 5FFHA 1TOUA 2CBSA 3CQNA 1DFVA 4CDDA 1KGLA 2RTPB 4GGTA 4YCHA 4JGLA 3WJBA 1SRGA 1BSYA 4MIRA 4OS3A 3BSZE 3VG3A 3ZI8A 4I9SA 1DZPA 1XCAA 1W6FA 4QGXA 1MDCA 1VWLB 3B2JA 3NPOA 1GT4A 1OBUA 2BLGA 5HA1A 3I17A 5H9KA 1IKJA 3K3LA 1O8VA 3NP1A 4YDBA 5H8TA 1KXOA 5IO6A 5CE4A 3NQ9A 1NQNA 4BX6B 5EEDA 4AZOA 2RTJA 5AEOA 5F7GA 1K3BA 1QY0A 2A13A 3DSZA 1ERXA 1JIWI 2ASNX 4TKHA 4YDAA 1KT3A 3MVFA 2AT6X 2OL7A 2RN4A 3B2IA 1LF7A 1STPA 1N7YA 2AKQA 3C78X 3FMZA 4LZVA 4U8UN 2KTDA 1IIUA 3VHHA 4Z2OA 1DV9A 1JJXA 4A8ZA 1LNMA 5JD2A 3RE5A 3STMX 1EPAA 3RBYA 5EPQA 4IRWA 5B10O 4ALOA 1ERBA 3PH6A 1SMPI 1PM1X 1E00A 2YG2A 4QYNA 1JV4A 4I3BA 4OEMA 1I78A 1HY2A 4WFVA 2W2FA 4CPHB 1ZNDA 1VWOB 3P6EA 4L3RA 4YH0A 3QKGA 1ZNHA 4QZUA 3T2XA 3WOVA 2Z4HA 1A18A 1NBXA 1N43A 4BX5B 2FR2A 5AJBA 3PK2A 1SLDB 5F1EA 1KL3A 3O22A 4GNYA 3IFBA 4KH8A 4YKMA 1KOIA 2QCBA 1SXWA 5FQ6E 2IZAA 3PECA 3ZW0B 2IZBA 4BVMA 4OELA 4Z2PA 5HZ9A 2X56A 1SWJA 3RY1A 4QAEA 4FBRA 1DF3A 5EZ2A 2PY1A 3P6GA 1G74A 4EFGA 1SWUA 3FW4A 3ZUOA 4FBOA 3VPJE 1SWHA 3Q6LA 4ZHGA 4Z27A 4Z6JA 3CMPA 1RSUB 4ORXA 1I06A 1MX8A 2JOZA 1B4MA 3EM0A 1RLBE 4ORYA 1YWDA 1NGLA 2BHVA 2OVAA 3APWA 1HMRA 1TW4A 4NLIA 4R0BA 5B3MO 3SOTA 1NQMA 3SZJA 3BDRA 4ZHCA 2OY8A 1YIVA 4NYRA 4TLJA 4JHQA 3C76X 2HMBA 2ALLX 2MM3A 3APVA 3S60A 4ZFXA 2C4IA 2OF8A 2R56A 2RTRB 3HWEA 3WZOA 4ES7A 2HZRA 1KQWA 1SY2A 4MVKA 2AMMX 4GE1A 3FEKA 1JYDA 2FLJA 4GDAA 4TNNA 3VG5A 2YMSA 1VYFA 1ZNKA 3GAQA 2WEXA 4ORUA 2ZSCA 3EC5A 5HZQA 1GM6A 4XMGA 3RZYA 4AZPA 5IRUA 4D6BA 1RXJA 5CYBA 1YWBA 3P6DA 1SXUA 1H91A 2OY1O 4HPBA 1FJ1E 5KICA 1HBQA 1RAVA 4IMNA 2C1QA 1AVGI 2DJGA 1QWDA 1HMTA 4M7MA 4MVIA 4GNWA 4AZRA 1YWAA 5JR8A 2NNEA 1ADLA 2IZFB 1S7DA 3D95A 5HWZA 2LBAA 1D3SA 4BX7B 3PEDA 2OFAA 1TVQA 2WQAE 3FA7A 3KZAA 5LKFA 4O9SA 1BBPA 4IB6A 5FQ8E 4FQBB 2R74A 4BOEA 1SRIA 3D96A 2VDFA 2X55A 3RDMA 5LJGA 5EDCA 1SY0A 4YFPA 4ZHFA 1SWOA 2IZEB 5BVSA 2LBVA 2BS5A 5L8OA 3HTYA 3T1DA 1SWPA 2GTFX 2AH7X 2CAMA 3BRNA 3P6CA 1E02A 2RTGB 3GE2A 1YUPA 1O1UA 5K67A 4D6AA 5L3YA 1JMZA 1FENA 2FKJA 3D4RA 2A2UA 2G79A 3EBWA 4GETA 4RUUA 2N93A 2X4MA 1CRBA 1B56A 3AKMA 3HWDA 4I9RA 1QG5A 4YKOA 1Y53X 2OY7A 3AEHA 2F01A 4COTA 1UREA 2GTLO 2AL0X 1NDJA 1SXXA 2Y3EA 3NR3A 2X34A 2X8SA 4QGVA 1SLGB 1EALA 1HMSA 2Q4NA 2Y3FA 1QY1A 1DZJA 1SWEA 3HPEA 4ZJ0A 5AJCA 4XMFA 2FHLA 3O19A 4CDFA 5HZ6A 4CPFA 2A5CA 4O3ZA 4GK9A 2RTFB 5K68A 4PJ2A 1FELA 5L8NA 1JMXA 4GUZA 4WHIA 1A2DA 2FR3A 4ORWA 3RY2A 4AZMA 2MWHA 1GXAA 2DM5A 2JU8A 1DZMA 4Y5DA 1KT4A 1STSB 1AVDA 1HXZA 2RA6A 3VU1A 3PDFA 2IZIA 3AUMO 3LHNA 3BX7A 4MVLA 4BJ8A 3BLGA 2QO6A 3HOEA 3LV4A 1MOYA 4WFUA 2FT9A 1VWEB 3VG2A 1BSOA 4O3WA 5IO7A 2QMIA 1VYOA 4IB8A 3TGAA 3OE3A 1CBRA 2XKLA 5LJCA 5HCDC 1KL4A 3STNA 1N0SA 2G7BA 2WSJA 3D9WA 1G7NA 3WJCA 2FKGA 1MEPA 3TGCA 1B0OA 5L8IA 5K06A 3FIDA 2ANSA 4DNEA 4ZHDA 4ALBA 1CJ5A 1X8NA 2RTHB 1RSTB 4BGFA 1S2PA 1YP7A 3FEPA 4JNJA 1MK5A 2M4LA 4AYHA 5HZ5A 4NV7A 4YMYA 2CZUA 2MJIA 1OBPA 2XSTA 3FIQA 1E5PA 4LQZA 1ICNA 1FEMA 2WR6A 2JU3A 2VFBA 3EYCA 4EQAC 2ACOA 3S26A 3D97A 4GRJA 4YVBA 4Y0PA 3ZQ3A 1L6MA 3QQ2A 1VWBB 1T8VA 4AZQA 1Z24A 3KFIA 3BS2A 3F9DA 4Y0RA 1NP4A 2X8TA 3FA9A 1TOWA 4NNSA 4I6SA 3VHIA 5FENA 1SLFB 2Q39A 1SWCA 4CDCA 4JO6A 4U8UM 3JS1A 1QFVA 1ICMA 4HPCA 3RDQA 3NQ3A 1OPBA 2OFMX 1N4JA 2AF5A 3FLLA 5H9LA 3T6LA 2R73A 2L68A 2L5PA 2AT8X 3MG5A 3WXQA 1EIIA 1VWQB 1O1VA 3RWXA 1GGLA 1SREA 4HWMA 1SWLA 4U3QA 3ZW1B 1JBHA 3FELA 3UEWA 3TF6A 1IKEA 3WJDA 1WUBA 4N7DA 5BYPA 4QGWA 5HBSA 2RTEB 1AVEA 2RTKA 3EMMA 1EQDA 4EXZA 3JQOA 4IBAA 3CKFA 3NX1A 3E3CA 3SLTA 2I5VO 2GTLN 2IZKA 2QO4A 1FDQA 2IZLB 3BX8A 4BX6A 2WUTA 3RDSA 1SWKA 1ZNLA 2KD2A 2X45A 2OVSA 3B2LA 1X8OA 2ZAIA 2IZGB 2PI3O 2X46A 3B2HA 4BCSA 1SWNA 3BY0A 4YGHA 1GX9A 4LKPA 3KFHA 4AZNA 2FHNX 3RSWA 1KT5A 4XMEA 4CSBA 1X8PA 2W2AA 4XMDA 4GZVA 1JZUA 3KFGA 2HNXA 1I9HA 3ZWEA 2Q2PA 3X00A 4CV7A 1OEKA 2RCQA 2RQ0A 5D48A 3OD9A 3G7XA 1KZXA 1LIFA 1ZNGA 4O4SA 1EW3A 1VWKB 5IRWA 4GJSA 4IAWA 4ZHHA 2DJFA 2FTBA 3MBTA 5DG4A 1ML7A 4KC8A 4CPHA 1HN2A 1UYOX 4L1NA 5B2AO 1DC9A 5EEEA 3PQUA 2JW1A 3MX7A 4BX5A 1SWSA 3HOLA 3NX2A 5LJDA 4BBOA 2WPUA 3LTWA 3NADA 2RTQB 2MO5A 4YGGA 3ZW0A 3IA8A 1LDOA 1SA8A 4DQ4A 1QY2A 3FYFA 3B2KA 2VFCA 1SRHA 4TJZA 1AQBA 3PQSA 5D47A 1PMPA 1ALBA 1GT3A 1W4TA 1KT7A
chains in the Genus database with same CATH topology
3ZZVA 2BT9A 3CWKA 3DTQA 4ORSA 5BVQA 1AB0A 1OPAA 4ORRA 2LA7A 1GKAB 3KFFA 3VE2A 5BVTA 2IFBA 3ZUIA 3UEUA 1LIEA 4ON1A 3P6FA 5HA0A 2ZAGA 4FBVA 2Z4IA 4YBPA 1BLRA 4Y0SA 1BWYA 4YGZA 4ZGFA 3P02A 4O4OA 5LJKA 5F6ZA 2NNDA 3FA8A 4NYQA 3WBGA 2QM9A 2POAA 1CBIA 1BSQA 1DZKA 2LFOA 4DQ3A 1R0UA 3C77X 4ID2A 4ODDA 3VG6A 1S44A 2OVDA 3PP6A 4OS0A 1Y9LA 4O4XA 4HFOA 1TXLA 4TKBA 1LIDA 5B27A 1BJ7A 1EUOA 3APXA 3OJYC 3TGBA 5HCEC 5F6BA 4MVEA 5HTDA 1EPBA 4IB9A 2AT0X 2G78A 4M6SA 3O2YA 4UU3A 1PBOA 3HWGA 1YWCA 1FTPA 1LFOA 1EIOA 3NQKA 2BS6A 1IW2A 4Y0QA 2KT4B 4OS8A 4EEJA 3L4RA 3CR6A 3FR2A 4QQ1A 3I0AA 1NP1A 3AKNA 1X8QA 3VG4A 1X71A 2LKKA 3PPTA 4NW4A 4ZCBA 3VG7A 1EI5A 3EBKA 1MUPA 4IMOA 2CM9A 3FA6A 1SY1A 3NBXX 3P24A 1G85A 1VYGA 4UU2A 1SY3A 1KT6A 1T0VA 4LZUA 5IO5A 3OBLA 4YFQA 2HYSA 4RUNA 4IABA 5HAEA 2A0AA 1U0XA 1EXSA 1QFTA 2CBRA 1LKEA 2X8FA 2P8GA 4NLJA 4YBUA 2O62A 2OZQA 4TKJA 3ELXA 4O4UA 3FENA 4ARHA 3WVMA 1GX8A 1Y9TA 2FWVA 3HK1A 1IFCA 3JSQA 4KC7A 1VPRA 4GDZA 5DPQA 5F58A 4O3YA 3U9PC 2W2BA 3H3IA 2ACPX 5HTEA 2F73A 1A57A 1I4UA 3FR4A 2KW1A 4NNTA 2KTSA 1CBSA 1FE3A 1IFBA 3ELZA 2L9CA 1GT1A 1BM5A 2JN3A 3BU9A 4IB7A 1HBPA 4OMWA 3U03A 1P6PA 1OEEA 4BQUA 2GJ5A 2WEWA 3UEVA 1G5WA 1CBQA 3FR5A 4PSQA 3SAOA 1A3YA 3APUA 3S5VA 4INNA 4O49A 1BRPA 4YFRA 2GTLM 5KHPA 3N91A 1YP6A 1OBQA 1QQSA 1QABE 2WQ9A 3F8AA 4FGIB 4QRLA 4U9CA 1B8EA 3WJFA 1MVGA 4KCAA 4ZGUA 3CBSA 2A2GA 1ZNEA 4N7CA 4OMXA 1KQXA 1D2UA 2JMBA 2CZTA 2MHDA 1LIBA 5D4AA 2FRSA 1BRQA 2F09A 3FW5A 1E06A 3ZW1A 4AW8A 3ZW2A 5FQ7E 1XKIA 5HCCC 3U0DA 4MISA 2HZQA 2OFRX 4KIIA 3KQ0A 5LJEA 3P6HA 4ML7B 5FAZA 2EU7X 4IAXA 5KIDA 4U8UO 5LJHA 4O3XB 1LICA 1SXYA 2WWPA 2JU7A 1I05A 3BU1A 2NNQA 4I3DA 1RBPA 4A60A 1AELA 2LB6A 4QNIA 3HWFA 4HPDA 2Q9SA 2OVEA 5D45A 4YCEA 2L67A 4CK4A 1I04A 4QYPA 3V8UA 2GC9A 2K62A 5B29A 5H9NA 1ACDA 1ZRYA 3CQRA 5D8JA 3S5XA 3VE1A 3F6ZB 2RCTA 1PEEA 4XMCA 5HZ8A 1MX7A 4LKTA 4QZTA 2HLVA 1T68X 4ZH6A 4K19A 4GH7A 3WJGA 4GKCA 1GT5A 2Q2MA 2AT5X 1UZ2X 4GU8A 4TQ2A 2A3FX 2QO5A 1KZWA 1HQPA 1LPJA 2AT3X 5LKEA 3PH5A 2FS7A 4A1YA 2FS6A 1BEBA 3UAQA 5LJBA 2QOSC 1OEJA 4HPAA 1JJJA 1GKAA 1X89A 3CBCA 4XMHA 4WBKA 3RKGA 3UEXA 3TZSA 2CM4A 2NP1A 1X8UA 4NP1A 4ZH9A 4I95A 3STKA 2E4JA 5H9AA 4I3CA 2K23A 1JYJA 1U17A 4KT5A 4A1HA 5EDBA 2RD7C 1U18A 5AQ6A 4EDEA 3WJEA 5C0NA 5FFHA 1TOUA 2CBSA 3CQNA 1DFVA 1KGLA 4YCHA 4JGLA 3WJBA 4MIRA 1BSYA 4OS3A 3VG3A 3BSZE 3ZI8A 4I9SA 1DZPA 1XCAA 4QGXA 1MDCA 3B2JA 3NPOA 1GT4A 1OBUA 2BLGA 5HA1A 3I17A 5H9KA 1IKJA 3K3LA 1O8VA 3NP1A 4YDBA 5H8TA 1KXOA 5IO6A 5CE4A 3NQ9A 5EEDA 4AZOA 5AEOA 5F7GA 2A13A 1QY0A 3DSZA 4YDAA 1ERXA 1JIWI 2ASNX 4TKHA 1KT3A 3MVFA 2AT6X 3C78X 2RN4A 3B2IA 1LF7A 4LZVA 4U8UN 2AKQA 3FMZA 1DV9A 2KTDA 1IIUA 1JJXA 4A8ZA 1LNMA 3STMX 1EPAA 3RBYA 5EPQA 4ALOA 1ERBA 3PH6A 1SMPI 1PM1X 1E00A 2YG2A 4QYNA 1JV4A 4I3BA 4WFVA 2W2FA 1ZNDA 3P6EA 4L3RA 4YH0A 3WOVA 3QKGA 1ZNHA 4QZUA 2Z4HA 1A18A 2FR2A 5AJBA 5F1EA 3O22A 4GNYA 3IFBA 4KH8A 4YKMA 1KOIA 5FQ6E 1SXWA 3ZW0B 3PECA 4BVMA 5HZ9A 4QAEA 4FBRA 1DF3A 5EZ2A 2PY1A 3P6GA 1G74A 4EFGA 3FW4A 3ZUOA 4FBOA 3VPJE 3Q6LA 4ZHGA 3CMPA 4ORXA 1I06A 1MX8A 2JOZA 1B4MA 3EM0A 1RLBE 4ORYA 1YWDA 1NGLA 2BHVA 2OVAA 3APWA 1HMRA 1TW4A 4NLIA 4R0BA 3SOTA 4ZHCA 3BDRA 1YIVA 4NYRA 4TLJA 3C76X 2HMBA 2ALLX 2MM3A 3APVA 3S60A 4ZFXA 2R56A 3HWEA 4ES7A 2HZRA 1KQWA 1SY2A 4MVKA 2AMMX 4GE1A 3FEKA 1JYDA 2FLJA 4TNNA 3VG5A 2YMSA 1VYFA 1ZNKA 3GAQA 2WEXA 4ORUA 5HZQA 1GM6A 4XMGA 3RZYA 4AZPA 4D6BA 5CYBA 1YWBA 3P6DA 1SXUA 1H91A 4HPBA 5KICA 1HBQA 4IMNA 4M7MA 4MVIA 1AVGI 4ZR2A 1QWDA 1HMTA 4AZRA 5JR8A 4GNWA 1YWAA 2NNEA 1ADLA 3D95A 1S7DA 5HWZA 2LBAA 1D3SA 3PEDA 5LKFA 1TVQA 2WQAE 3FA7A 3KZAA 4O9SA 1BBPA 4IB6A 5FQ8E 4FQBB 2R74A 4BOEA 3D96A 5LJGA 5EDCA 1SY0A 4YFPA 4ZHFA 5BVSA 5L8OA 2LBVA 2BS5A 3HTYA 3T1DA 2GTFX 2AH7X 3BRNA 3P6CA 1E02A 3GE2A 1YUPA 1O1UA 4D6AA 1FENA 3D4RA 2A2UA 2G79A 3EBWA 4GETA 4RUUA 2N93A 1CRBA 1B56A 3AKMA 3HWDA 4I9RA 1QG5A 4YKOA 4COTA 1UREA 2GTLO 2AL0X 1SXXA 3NR3A 2X8SA 4QGVA 1EALA 1HMSA 2Q4NA 1QY1A 1DZJA 5AJCA 4XMFA 3O19A 5HZ6A 4O3ZA 4GK9A 4PJ2A 1FELA 5L8NA 4AZMA 4WHIA 1A2DA 2FR3A 4ORWA 2MWHA 1GXAA 2DM5A 2JU8A 1DZMA 3VU1A 1KT4A 2RA6A 3LHNA 3BX7A 4MVLA 3BLGA 2QO6A 3HOEA 3LV4A 4WFUA 2FT9A 3VG2A 5IO7A 1BSOA 4O3WA 2QMIA 4IB8A 3TGAA 3OE3A 1CBRA 2XKLA 5LJCA 5HCDC 3STNA 1N0SA 2G7BA 2WSJA 1G7NA 3WJCA 3TGCA 1B0OA 5L8IA 5K06A 2ANSA 4ZHDA 1CJ5A 4ALBA 1X8NA 1S2PA 1YP7A 3FEPA 2M4LA 4AYHA 5HZ5A 4YMYA 2CZUA 2MJIA 1OBPA 2XSTA 3FIQA 1E5PA 4LQZA 1ICNA 1FEMA 2WR6A 2JU3A 3EYCA 4EQAC 2ACOA 3S26A 3D97A 4GRJA 4Y0PA 3ZQ3A 1L6MA 4AZQA 1T8VA 1Z24A 3KFIA 3BS2A 3F9DA 4Y0RA 1NP4A 2X8TA 3FA9A 1TOWA 4NNSA 4I6SA 5FENA 2Q39A 4U8UM 3JS1A 1QFVA 1ICMA 4HPCA 3NQ3A 1OPBA 2OFMX 5H9LA 3FLLA 2R73A 2L68A 2L5PA 2AT8X 3WXQA 1EIIA 1O1VA 3RWXA 1GGLA 4HWMA 4U3QA 3ZW1B 1JBHA 3FELA 3UEWA 3TF6A 1IKEA 3WJDA 4N7DA 5BYPA 4QGWA 5HBSA 3EMMA 1EQDA 4EXZA 3JQOA 4IBAA 3NX1A 3E3CA 2GTLN 2QO4A 3BX8A 1FDQA 2WUTA 1ZNLA 2KD2A 2X45A 2OVSA 3B2LA 1X8OA 2ZAIA 3B2HA 2X46A 3BY0A 4YGHA 1GX9A 4LKPA 3KFHA 4AZNA 3RSWA 1KT5A 4XMEA 4CSBA 1X8PA 2W2AA 4XMDA 4GZVA 1JZUA 3KFGA 2HNXA 3ZWEA 2Q2PA 4CV7A 1OEKA 2RCQA 2RQ0A 5D48A 3OD9A 3G7XA 1KZXA 1LIFA 1ZNGA 4O4SA 1EW3A 4IAWA 4ZHHA 3MBTA 2FTBA 5DG4A 1ML7A 4KC8A 1HN2A 4L1NA 1DC9A 5EEEA 3PQUA 2JW1A 3MX7A 3HOLA 3NX2A 5LJDA 3NADA 2MO5A 4YGGA 3ZW0A 3IA8A 1SA8A 4DQ4A 4ZJ0A 1QY2A 3FYFA 3B2KA 4TJZA 5D47A 1AQBA 3PQSA 1PMPA 1ALBA 1GT3A 1KT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWK A;  3DTQ A;  4ORS A;  5BVQ A;  1AB0 A;  1OPA A;  4ORR A;  1GKA B;  3KFF A;  5BVT A;  2IFB A;  3ZUI A;  3UEU A;  1LIE A;  3P6F A;  5HA0 A;  4YBP A;  1BLR A;  4Y0S A;  1BWY A;  4YGZ A;  5LJK A;  5F6Z A;  2NND A;  3FA8 A;  4NYQ A;  3WBG A;  2QM9 A;  2POA A;  1CBI A;  1BSQ A;  1DZK A;  2LFO A;  4DQ3 A;  1R0U A;  3C77 X;  3VG6 A;  4ODD A;  1S44 A;  2OVD A;  3PP6 A;  4OS0 A;  4HFO A;  1TXL A;  4TKB A;  1LID A;  5B27 A;  1BJ7 A;  1EUO A;  3APX A;  3OJY C;  3TGB A;  5HCE C;  5F6B A;  5HTD A;  1EPB A;  4IB9 A;  2AT0 X;  2G78 A;  4M6S A;  3O2Y A;  4UU3 A;  1PBO A;  3HWG A;  1YWC A;  1FTP A;  1LFO A;  1EIO A;  1IW2 A;  4Y0Q A;  2KT4 B;  4OS8 A;  4EEJ A;  3L4R A;  3CR6 A;  3FR2 A;  3I0A A;  1NP1 A;  3AKN A;  1X8Q A;  3VG4 A;  1X71 A;  2LKK A;  3PPT A;  4ZCB A;  3VG7 A;  3EBK A;  4IMO A;  1MUP A;  2CM9 A;  3FA6 A;  1SY1 A;  1G85 A;  1VYG A;  4UU2 A;  1SY3 A;  1KT6 A;  1T0V A;  4LZU A;  5IO5 A;  4YFQ A;  2HYS A;  4RUN A;  5HAE A;  2A0A A;  1U0X A;  1EXS A;  1QFT A;  2CBR A;  1LKE A;  2P8G A;  4NLJ A;  4YBU A;  2O62 A;  2OZQ A;  4TKJ A;  3ELX A;  3FEN A;  4ARH A;  3WVM A;  1GX8 A;  2FWV A;  3HK1 A;  1IFC A;  3JSQ A;  1VPR A;  5DPQ A;  5F58 A;  3U9P C;  2W2B A;  2ACP X;  5HTE A;  2F73 A;  1A57 A;  1I4U A;  3FR4 A;  4NNT A;  1CBS A;  1FE3 A;  1IFB A;  3ELZ A;  2L9C A;  1GT1 A;  1BM5 A;  2JN3 A;  3BU9 A;  4IB7 A;  1HBP A;  4OMW A;  3U03 A;  1P6P A;  1OEE A;  4BQU A;  2GJ5 A;  2WEW A;  3UEV A;  1G5W A;  1CBQ A;  3FR5 A;  4PSQ A;  3SAO A;  1A3Y A;  3APU A;  1BRP A;  4YFR A;  5KHP A;  1YP6 A;  1OBQ A;  1QQS A;  1QAB E;  2WQ9 A;  3F8A A;  1B8E A;  3WJF A;  1MVG A;  4ZGU A;  3CBS A;  2A2G A;  1ZNE A;  4N7C A;  4OMX A;  1KQX A;  1D2U A;  2CZT A;  1LIB A;  5D4A A;  2FRS A;  1BRQ A;  3FW5 A;  4AW8 A;  1E06 A;  1XKI A;  5HCC C;  3U0D A;  2HZQ A;  2OFR X;  4KII A;  3KQ0 A;  5LJE A;  3P6H A;  5FAZ A;  2EU7 X;  4IAX A;  5KID A;  5LJH A;  1LIC A;  1SXY A;  2WWP A;  2JU7 A;  1I05 A;  3BU1 A;  2NNQ A;  4I3D A;  1RBP A;  4A60 A;  1AEL A;  2LB6 A;  3HWF A;  4HPD A;  2Q9S A;  2OVE A;  5D45 A;  4YCE A;  2L67 A;  4CK4 A;  1I04 A;  4QYP A;  2GC9 A;  2K62 A;  5B29 A;  5H9N A;  1ACD A;  1ZRY A;  3CQR A;  5D8J A;  2RCT A;  1PEE A;  4XMC A;  5HZ8 A;  1MX7 A;  4LKT A;  4QZT A;  2HLV A;  1T68 X;  4ZH6 A;  4K19 A;  4GH7 A;  3WJG A;  4GKC A;  1GT5 A;  2Q2M A;  2AT5 X;  1UZ2 X;  4TQ2 A;  2A3F X;  2QO5 A;  1KZW A;  1HQP A;  1LPJ A;  2AT3 X;  5LKE A;  3PH5 A;  2FS7 A;  4A1Y A;  2FS6 A;  1BEB A;  5LJB A;  2QOS C;  1OEJ A;  4HPA A;  1JJJ A;  1GKA A;  1X89 A;  3CBC A;  4XMH A;  4WBK A;  3UEX A;  3TZS A;  2CM4 A;  2NP1 A;  1X8U A;  4NP1 A;  4ZH9 A;  3STK A;  2E4J A;  5H9A A;  4I3C A;  2K23 A;  1JYJ A;  1U17 A;  4A1H A;  5EDB A;  2RD7 C;  1U18 A;  5AQ6 A;  4EDE A;  3WJE A;  5C0N A;  5FFH A;  1TOU A;  2CBS A;  3CQN A;  1DFV A;  1KGL A;  4YCH A;  3WJB A;  4OS3 A;  1BSY A;  3VG3 A;  3BSZ E;  4I9S A;  1DZP A;  1XCA A;  4QGX A;  1MDC A;  3B2J A;  3NPO A;  1GT4 A;  1OBU A;  2BLG A;  5HA1 A;  3I17 A;  5H9K A;  1IKJ A;  3K3L A;  1O8V A;  3NP1 A;  4YDB A;  5H8T A;  1KXO A;  5IO6 A;  5CE4 A;  3NQ9 A;  5EED A;  4AZO A;  5F7G A;  2A13 A;  1QY0 A;  3DSZ A;  4YDA A;  1ERX A;  2ASN X;  4TKH A;  1KT3 A;  3MVF A;  2AT6 X;  3C78 X;  3B2I A;  1LF7 A;  4LZV A;  2AKQ A;  3FMZ A;  1DV9 A;  2KTD A;  1IIU A;  1JJX A;  4A8Z A;  1LNM A;  3STM X;  1EPA A;  5EPQ A;  4ALO A;  1ERB A;  3PH6 A;  1PM1 X;  1E00 A;  2YG2 A;  4QYN A;  1JV4 A;  4I3B A;  4WFV A;  2W2F A;  1ZND A;  3P6E A;  4YH0 A;  3QKG A;  1ZNH A;  4QZU A;  1A18 A;  2FR2 A;  5F1E A;  3O22 A;  4GNY A;  3IFB A;  4YKM A;  1KOI A;  1SXW A;  3PEC A;  4BVM A;  5HZ9 A;  4QAE A;  1DF3 A;  5EZ2 A;  2PY1 A;  3P6G A;  1G74 A;  4EFG A;  3FW4 A;  3ZUO A;  3Q6L A;  4ZHG A;  3CMP A;  4ORX A;  1I06 A;  1MX8 A;  2JOZ A;  1B4M A;  3EM0 A;  1RLB E;  4ORY A;  1YWD A;  1NGL A;  2OVA A;  3APW A;  4NLI A;  1HMR A;  1TW4 A;  4R0B A;  4ZHC A;  3BDR A;  1YIV A;  4NYR A;  4TLJ A;  3C76 X;  2HMB A;  2ALL X;  2MM3 A;  3APV A;  4ZFX A;  2R56 A;  3HWE A;  4ES7 A;  2HZR A;  1KQW A;  1SY2 A;  4MVK A;  2AMM X;  4GE1 A;  3FEK A;  1JYD A;  2FLJ A;  4TNN A;  3VG5 A;  1VYF A;  1ZNK A;  3GAQ A;  2WEX A;  4ORU A;  5HZQ A;  1GM6 A;  4XMG A;  3RZY A;  4AZP A;  4D6B A;  1YWB A;  3P6D A;  1SXU A;  1H91 A;  4HPB A;  5KIC A;  1HBQ A;  4IMN A;  4M7M A;  4MVI A;  1AVG I;  4ZR2 A;  1QWD A;  1HMT A;  4AZR A;  5JR8 A;  4GNW A;  1YWA A;  2NNE A;  1ADL A;  3D95 A;  1S7D A;  5HWZ A;  2LBA A;  1D3S A;  3PED A;  5LKF A;  1TVQ A;  2WQA E;  3FA7 A;  3KZA A;  4O9S A;  1BBP A;  4IB6 A;  2R74 A;  4BOE A;  3D96 A;  5LJG A;  5EDC A;  1SY0 A;  4YFP A;  4ZHF A;  5BVS A;  5L8O A;  2LBV A;  3T1D A;  2GTF X;  2AH7 X;  3BRN A;  3P6C A;  1E02 A;  1YUP A;  1O1U A;  4D6A A;  1FEN A;  2A2U A;  2G79 A;  3EBW A;  4GET A;  4RUU A;  2N93 A;  1CRB A;  1B56 A;  3AKM A;  3HWD A;  4I9R A;  1QG5 A;  4YKO A;  1URE A;  2AL0 X;  1SXX A;  3NR3 A;  4QGV A;  1EAL A;  1HMS A;  2Q4N A;  1QY1 A;  1DZJ A;  4XMF A;  3O19 A;  5HZ6 A;  1FEL A;  5L8N A;  4AZM A;  1A2D A;  2FR3 A;  4ORW A;  1GXA A;  2DM5 A;  2JU8 A;  1DZM A;  1KT4 A;  2RA6 A;  3BX7 A;  4MVL A;  3BLG A;  2QO6 A;  4WFU A;  2FT9 A;  3VG2 A;  5IO7 A;  1BSO A;  4IB8 A;  3TGA A;  1CBR A;  2XKL A;  5LJC A;  5HCD C;  3STN A;  1N0S A;  2G7B A;  2WSJ A;  1G7N A;  3WJC A;  3TGC A;  1B0O A;  5L8I A;  5K06 A;  2ANS A;  4ZHD A;  1CJ5 A;  4ALB A;  1X8N A;  1S2P A;  1YP7 A;  3FEP A;  5HZ5 A;  4AYH A;  4YMY A;  2CZU A;  2MJI A;  1OBP A;  2XST A;  3FIQ A;  1E5P A;  1ICN A;  1FEM A;  2WR6 A;  2JU3 A;  3EYC A;  2ACO A;  3S26 A;  3D97 A;  4GRJ A;  4Y0P A;  3ZQ3 A;  1L6M A;  4AZQ A;  1T8V A;  1Z24 A;  3KFI A;  3BS2 A;  3F9D A;  4Y0R A;  1NP4 A;  3FA9 A;  1TOW A;  4NNS A;  5FEN A;  2Q39 A;  3JS1 A;  1QFV A;  1ICM A;  4HPC A;  3NQ3 A;  1OPB A;  2OFM X;  5H9L A;  3FLL A;  2R73 A;  2L68 A;  2L5P A;  2AT8 X;  3WXQ A;  1EII A;  1O1V A;  1GGL A;  1JBH A;  3FEL A;  3UEW A;  3TF6 A;  1IKE A;  3WJD A;  4N7D A;  4QGW A;  5HBS A;  3EMM A;  1EQD A;  4EXZ A;  4IBA A;  3NX1 A;  2QO4 A;  3BX8 A;  1FDQ A;  2WUT A;  1ZNL A;  2X45 A;  3B2L A;  1X8O A;  3B2H A;  2X46 A;  3BY0 A;  4YGH A;  1GX9 A;  4LKP A;  3KFH A;  4AZN A;  3RSW A;  1KT5 A;  4XME A;  1X8P A;  2W2A A;  4XMD A;  1JZU A;  3KFG A;  2HNX A;  2Q2P A;  1OEK A;  2RCQ A;  2RQ0 A;  5D48 A;  3G7X A;  1KZX A;  1LIF A;  1ZNG A;  1EW3 A;  4IAW A;  4ZHH A;  3MBT A;  2FTB A;  5DG4 A;  1ML7 A;  1HN2 A;  1DC9 A;  5EEE A;  3NX2 A;  5LJD A;  3NAD A;  2MO5 A;  4YGG A;  4DQ4 A;  3IA8 A;  1SA8 A;  4ZJ0 A;  1QY2 A;  4TJZ A;  3B2K A;  5D47 A;  1AQB A;  1PMP A;  1ALB A;  1GT3 A;  1KT7 A; 
#chains in the Genus database with same CATH topology
 3ZZV A;  2BT9 A;  3CWK A;  3DTQ A;  2I5Z O;  4ORS A;  5BVQ A;  1AB0 A;  1OPA A;  1Y55 X;  2OL8 O;  4ORR A;  3RDO A;  2LA7 A;  1GKA B;  1LCW A;  3KFF A;  3VE2 A;  5BVT A;  2IFB A;  3ZUI A;  1RXK A;  3UEU A;  1LIE A;  4ON1 A;  3T6F A;  3P6F A;  5HA0 A;  2ZAG A;  4FBV A;  2Z4I A;  4YBP A;  1BLR A;  2HKD A;  4Y0S A;  3WYP A;  2G5L A;  3VHM A;  1BWY A;  4YGZ A;  4ZGF A;  1NC9 A;  1HXL A;  1VWP B;  2OL6 O;  3P02 A;  4O4O A;  5LJK A;  2RTN B;  5F6Z A;  4Z28 A;  3WZP A;  2NND A;  4EKV A;  3FA8 A;  4NYQ A;  3WBG A;  2QM9 A;  1GX3 A;  2POA A;  1CBI A;  1BSQ A;  2IZJ A;  1DZK A;  2LFO A;  4DQ3 A;  1R0U A;  3C77 X;  1E2T A;  4ID2 A;  4ODD A;  3VG6 A;  1S44 A;  2OVD A;  2C1S A;  3PP6 A;  4OS0 A;  1VWJ B;  1Y9L A;  4HFO A;  4O4X A;  1TXL A;  4TKB A;  1LID A;  5B27 A;  1BJ7 A;  1EUO A;  3APX A;  3OJY C;  3TGB A;  5HCE C;  1IJ8 A;  5F6B A;  4BX7 A;  4MVE A;  5HTD A;  1EPB A;  3KVN A;  4IB9 A;  2AT0 X;  2G78 A;  4M6S A;  3SLJ A;  3O2Y A;  4UU3 A;  1PBO A;  3HWG A;  1YWC A;  1SRF A;  1FTP A;  1LFO A;  1EIO A;  3NQK A;  2BS6 A;  1IW2 A;  1OSP O;  4Y0Q A;  2KT4 B;  3CKG A;  5B11 O;  4OS8 A;  4EEJ A;  3L4R A;  3CR6 A;  3FR2 A;  4QQ1 A;  1K24 A;  1NP1 A;  3AKN A;  3I0A A;  1X8Q A;  3VG4 A;  1X71 A;  2LKK A;  3PPT A;  4NW4 A;  4ZCB A;  3VG7 A;  1EI5 A;  3EBK A;  1MUP A;  4IMO A;  2CM9 A;  2RTB B;  3FA6 A;  1SY1 A;  4CPE A;  2RTO B;  3NBX X;  3P24 A;  3RDX A;  1G85 A;  1VYG A;  4UU2 A;  1SY3 A;  5B5F A;  1KT6 A;  1T0V A;  1SWT A;  4LZU A;  3SLO A;  5IO5 A;  3OBL A;  4YFQ A;  2HYS A;  4RUN A;  2JGS A;  4IAB A;  2UYW A;  5HAE A;  2A0A A;  1U0X A;  4Z2V A;  1EXS A;  1QFT A;  1STR B;  1LKE A;  2CBR A;  2X8F A;  2P8G A;  3WZN A;  4NLJ A;  4YBU A;  2O62 A;  1DF8 A;  4Y59 A;  2OZQ A;  4TKJ A;  1MM9 A;  3ELX A;  4O4U A;  3FEN A;  4ARH A;  1UYN X;  3WVM A;  1GX8 A;  1Y9T A;  2FWV A;  3HK1 A;  1IFC A;  3JSQ A;  4KC7 A;  1VPR A;  4GDZ A;  5DPQ A;  5F58 A;  4O3Y A;  3U9P C;  2G8C O;  1KFF A;  1VWI B;  2W2B A;  2X32 A;  2OFB A;  3H3I A;  2ACP X;  5HTE A;  2F73 A;  1A57 A;  1I4U A;  3FR4 A;  2KW1 A;  2MF6 A;  4NNT A;  2KTS A;  1CBS A;  1FE3 A;  1IFB A;  4OKA A;  1VWN B;  1VWA B;  3ELZ A;  3SZH A;  2L9C A;  1GT1 A;  1BM5 A;  2JN3 A;  2RTI B;  3BU9 A;  4IB7 A;  3RDU A;  1PBY A;  1VWR B;  1HBP A;  1VWG B;  4OMW A;  3U03 A;  3SZI A;  1P6P A;  1OEE A;  4BQU A;  2GJ5 A;  2WEW A;  1VWF B;  3UEV A;  1G5W A;  1SWQ A;  4MEE A;  1CBQ A;  1Y0G A;  1JQP A;  2RTA A;  2A5B A;  3FR5 A;  3MM0 A;  3EW2 A;  4PSQ A;  5CSE A;  5IRA A;  3SAO A;  1A3Y A;  3APU A;  3S5V A;  3WYQ A;  1SLE B;  4INN A;  4O49 A;  1BRP A;  4YFR A;  2GTL M;  1SWA A;  5KHP A;  2IZD B;  3N91 A;  1SWD A;  1YP6 A;  1OBQ A;  1QQS A;  4GJV A;  2GH7 A;  4I60 A;  1QAB E;  2WQ9 A;  2AVI A;  3F8A A;  4FGI B;  4QRL A;  1B8E A;  4U9C A;  1MVG A;  1KL5 A;  4KCA A;  3WJF A;  1HQQ A;  2BSZ A;  3CBS A;  4ZGU A;  2A2G A;  3Q34 A;  4NV8 A;  1ZNE A;  4N7C A;  4OMX A;  1KQX A;  1PTS A;  1D2U A;  2JMB A;  2A8G A;  2CZT A;  2MHD A;  1LIB A;  1W5R A;  2FRS A;  5D4A A;  1BRQ A;  2F09 A;  3FW5 A;  1E06 A;  4U46 A;  3ZW1 A;  4AW8 A;  3ZW2 A;  1SWB A;  5FQ7 E;  1XKI A;  1LCV A;  5HCC C;  4CDE A;  3U0D A;  4MIS A;  2HZQ A;  2RTD B;  2OFR X;  1Y52 X;  3KQ0 A;  4KII A;  5LJE A;  3P6H A;  4ML7 B;  5FAZ A;  2RTL A;  2EU7 X;  4IAX A;  2OYB O;  4U8U O;  3T2W A;  5KID A;  4O3X B;  1LIC A;  5LJH A;  1SXY A;  2WWP A;  1N9Y A;  2JU7 A;  1I05 A;  3BU1 A;  4CPI A;  2NNQ A;  4ZR2 A;  4I3D A;  1RBP A;  1LCZ A;  4A60 A;  1AEL A;  2LB6 A;  5IXG A;  4QNI A;  3HWF A;  4HPD A;  2IZH B;  2Q9S A;  4C5P A;  3RE6 A;  2OVE A;  1SWG A;  5D45 A;  4YCE A;  2L67 A;  4CK4 A;  1I04 A;  3VGW A;  2OF9 A;  1RXH A;  4GGR A;  4QYP A;  1WBI A;  2GC9 A;  2RTC B;  3V8U A;  2UZ2 A;  1VWD B;  2K62 A;  5B29 A;  4GGZ A;  5H9N A;  1ACD A;  1ZRY A;  5CHK A;  4GD9 A;  2QOM A;  3CQR A;  5D8J A;  3S5X A;  3VE1 A;  2IZC B;  3F6Z B;  2RCT A;  5F2B A;  2RTM A;  1PEE A;  4XMC A;  4B55 A;  5HZ8 A;  1MX7 A;  4LKT A;  4QZT A;  2HLV A;  1T68 X;  3WZQ A;  1SRJ A;  2FGS A;  4ZH6 A;  4K19 A;  4GH7 A;  3WJG A;  4GKC A;  1GT5 A;  2Q2M A;  2AT5 X;  1UZ2 X;  4GU8 A;  4TQ2 A;  2A3F X;  2QO5 A;  1LEL A;  1VWC B;  2Y32 A;  5B5G A;  2OY5 O;  1HQP A;  1KZW A;  1LPJ A;  2AT3 X;  5LKE A;  1JJU A;  1LDQ A;  3PH5 A;  2FS7 A;  1VWM B;  4A1Y A;  2FS6 A;  1BEB A;  3UAQ A;  5LJB A;  2QOS C;  1OEJ A;  1SWF A;  4HPA A;  1JJJ A;  1GKA A;  1X89 A;  1SWR A;  3CBC A;  4XMH A;  4WBK A;  3RKG A;  3UEX A;  4DCB A;  2CM4 A;  3TZS A;  2NP1 A;  1X8U A;  4NP1 A;  4ZH9 A;  2BC3 A;  4I95 A;  3STK A;  1N9M A;  1VWH B;  3FDC A;  2E4J A;  5H9A A;  4I3C A;  1LUQ A;  2K23 A;  1JYJ A;  1U17 A;  4KT5 A;  4A1H A;  5EDB A;  3EW1 A;  2RD7 C;  1U18 A;  5AQ6 A;  4EDE A;  3WJE A;  5C0N A;  5FFH A;  1TOU A;  2CBS A;  3CQN A;  1DFV A;  4CDD A;  1KGL A;  2RTP B;  4GGT A;  4YCH A;  4JGL A;  3WJB A;  1SRG A;  1BSY A;  4MIR A;  4OS3 A;  3BSZ E;  3VG3 A;  3ZI8 A;  4I9S A;  1DZP A;  1XCA A;  1W6F A;  4QGX A;  1MDC A;  1VWL B;  3B2J A;  3NPO A;  1GT4 A;  1OBU A;  2BLG A;  5HA1 A;  3I17 A;  5H9K A;  1IKJ A;  3K3L A;  1O8V A;  3NP1 A;  4YDB A;  5H8T A;  1KXO A;  5IO6 A;  5CE4 A;  3NQ9 A;  1NQN A;  4BX6 B;  5EED A;  4AZO A;  2RTJ A;  5AEO A;  5F7G A;  1K3B A;  1QY0 A;  2A13 A;  3DSZ A;  1ERX A;  1JIW I;  2ASN X;  4TKH A;  4YDA A;  1KT3 A;  3MVF A;  2AT6 X;  2OL7 A;  2RN4 A;  3B2I A;  1LF7 A;  1STP A;  1N7Y A;  2AKQ A;  3C78 X;  3FMZ A;  4LZV A;  4U8U N;  2KTD A;  1IIU A;  3VHH A;  4Z2O A;  1DV9 A;  1JJX A;  4A8Z A;  1LNM A;  5JD2 A;  3RE5 A;  3STM X;  1EPA A;  3RBY A;  5EPQ A;  4IRW A;  5B10 O;  4ALO A;  1ERB A;  3PH6 A;  1SMP I;  1PM1 X;  1E00 A;  2YG2 A;  4QYN A;  1JV4 A;  4I3B A;  4OEM A;  1I78 A;  1HY2 A;  4WFV A;  2W2F A;  4CPH B;  1ZND A;  1VWO B;  3P6E A;  4L3R A;  4YH0 A;  3QKG A;  1ZNH A;  4QZU A;  3T2X A;  3WOV A;  2Z4H A;  1A18 A;  1NBX A;  1N43 A;  4BX5 B;  2FR2 A;  5AJB A;  3PK2 A;  1SLD B;  5F1E A;  1KL3 A;  3O22 A;  4GNY A;  3IFB A;  4KH8 A;  4YKM A;  1KOI A;  2QCB A;  1SXW A;  5FQ6 E;  2IZA A;  3PEC A;  3ZW0 B;  2IZB A;  4BVM A;  4OEL A;  4Z2P A;  5HZ9 A;  2X56 A;  1SWJ A;  3RY1 A;  4QAE A;  4FBR A;  1DF3 A;  5EZ2 A;  2PY1 A;  3P6G A;  1G74 A;  4EFG A;  1SWU A;  3FW4 A;  3ZUO A;  4FBO A;  3VPJ E;  1SWH A;  3Q6L A;  4ZHG A;  4Z27 A;  4Z6J A;  3CMP A;  1RSU B;  4ORX A;  1I06 A;  1MX8 A;  2JOZ A;  1B4M A;  3EM0 A;  1RLB E;  4ORY A;  1YWD A;  1NGL A;  2BHV A;  2OVA A;  3APW A;  1HMR A;  1TW4 A;  4NLI A;  4R0B A;  5B3M O;  3SOT A;  1NQM A;  3SZJ A;  3BDR A;  4ZHC A;  2OY8 A;  1YIV A;  4NYR A;  4TLJ A;  4JHQ A;  3C76 X;  2HMB A;  2ALL X;  2MM3 A;  3APV A;  3S60 A;  4ZFX A;  2C4I A;  2OF8 A;  2R56 A;  2RTR B;  3HWE A;  3WZO A;  4ES7 A;  2HZR A;  1KQW A;  1SY2 A;  4MVK A;  2AMM X;  4GE1 A;  3FEK A;  1JYD A;  2FLJ A;  4GDA A;  4TNN A;  3VG5 A;  2YMS A;  1VYF A;  1ZNK A;  3GAQ A;  2WEX A;  4ORU A;  2ZSC A;  3EC5 A;  5HZQ A;  1GM6 A;  4XMG A;  3RZY A;  4AZP A;  5IRU A;  4D6B A;  1RXJ A;  5CYB A;  1YWB A;  3P6D A;  1SXU A;  1H91 A;  2OY1 O;  4HPB A;  1FJ1 E;  5KIC A;  1HBQ A;  1RAV A;  4IMN A;  2C1Q A;  1AVG I;  2DJG A;  1QWD A;  1HMT A;  4M7M A;  4MVI A;  4GNW A;  4AZR A;  1YWA A;  5JR8 A;  2NNE A;  1ADL A;  2IZF B;  1S7D A;  3D95 A;  5HWZ A;  2LBA A;  1D3S A;  4BX7 B;  3PED A;  2OFA A;  1TVQ A;  2WQA E;  3FA7 A;  3KZA A;  5LKF A;  4O9S A;  1BBP A;  4IB6 A;  5FQ8 E;  4FQB B;  2R74 A;  4BOE A;  1SRI A;  3D96 A;  2VDF A;  2X55 A;  3RDM A;  5LJG A;  5EDC A;  1SY0 A;  4YFP A;  4ZHF A;  1SWO A;  2IZE B;  5BVS A;  2LBV A;  2BS5 A;  5L8O A;  3HTY A;  3T1D A;  1SWP A;  2GTF X;  2AH7 X;  2CAM A;  3BRN A;  3P6C A;  1E02 A;  2RTG B;  3GE2 A;  1YUP A;  1O1U A;  5K67 A;  4D6A A;  5L3Y A;  1JMZ A;  1FEN A;  2FKJ A;  3D4R A;  2A2U A;  2G79 A;  3EBW A;  4GET A;  4RUU A;  2N93 A;  2X4M A;  1CRB A;  1B56 A;  3AKM A;  3HWD A;  4I9R A;  1QG5 A;  4YKO A;  1Y53 X;  2OY7 A;  3AEH A;  2F01 A;  4COT A;  1URE A;  2GTL O;  2AL0 X;  1NDJ A;  1SXX A;  2Y3E A;  3NR3 A;  2X34 A;  2X8S A;  4QGV A;  1SLG B;  1EAL A;  1HMS A;  2Q4N A;  2Y3F A;  1QY1 A;  1DZJ A;  1SWE A;  3HPE A;  4ZJ0 A;  5AJC A;  4XMF A;  2FHL A;  3O19 A;  4CDF A;  5HZ6 A;  4CPF A;  2A5C A;  4O3Z A;  4GK9 A;  2RTF B;  5K68 A;  4PJ2 A;  1FEL A;  5L8N A;  1JMX A;  4GUZ A;  4WHI A;  1A2D A;  2FR3 A;  4ORW A;  3RY2 A;  4AZM A;  2MWH A;  1GXA A;  2DM5 A;  2JU8 A;  1DZM A;  4Y5D A;  1KT4 A;  1STS B;  1AVD A;  1HXZ A;  2RA6 A;  3VU1 A;  3PDF A;  2IZI A;  3AUM O;  3LHN A;  3BX7 A;  4MVL A;  4BJ8 A;  3BLG A;  2QO6 A;  3HOE A;  3LV4 A;  1MOY A;  4WFU A;  2FT9 A;  1VWE B;  3VG2 A;  1BSO A;  4O3W A;  5IO7 A;  2QMI A;  1VYO A;  4IB8 A;  3TGA A;  3OE3 A;  1CBR A;  2XKL A;  5LJC A;  5HCD C;  1KL4 A;  3STN A;  1N0S A;  2G7B A;  2WSJ A;  3D9W A;  1G7N A;  3WJC A;  2FKG A;  1MEP A;  3TGC A;  1B0O A;  5L8I A;  5K06 A;  3FID A;  2ANS A;  4DNE A;  4ZHD A;  4ALB A;  1CJ5 A;  1X8N A;  2RTH B;  1RST B;  4BGF A;  1S2P A;  1YP7 A;  3FEP A;  4JNJ A;  1MK5 A;  2M4L A;  4AYH A;  5HZ5 A;  4NV7 A;  4YMY A;  2CZU A;  2MJI A;  1OBP A;  2XST A;  3FIQ A;  1E5P A;  4LQZ A;  1ICN A;  1FEM A;  2WR6 A;  2JU3 A;  2VFB A;  3EYC A;  4EQA C;  2ACO A;  3S26 A;  3D97 A;  4GRJ A;  4YVB A;  4Y0P A;  3ZQ3 A;  1L6M A;  3QQ2 A;  1VWB B;  1T8V A;  4AZQ A;  1Z24 A;  3KFI A;  3BS2 A;  3F9D A;  4Y0R A;  1NP4 A;  2X8T A;  3FA9 A;  1TOW A;  4NNS A;  4I6S A;  3VHI A;  5FEN A;  1SLF B;  2Q39 A;  1SWC A;  4CDC A;  4JO6 A;  4U8U M;  3JS1 A;  1QFV A;  1ICM A;  4HPC A;  3RDQ A;  3NQ3 A;  1OPB A;  2OFM X;  1N4J A;  2AF5 A;  3FLL A;  5H9L A;  3T6L A;  2R73 A;  2L68 A;  2L5P A;  2AT8 X;  3MG5 A;  3WXQ A;  1EII A;  1VWQ B;  1O1V A;  3RWX A;  1GGL A;  1SRE A;  4HWM A;  1SWL A;  4U3Q A;  3ZW1 B;  1JBH A;  3FEL A;  3UEW A;  3TF6 A;  1IKE A;  3WJD A;  1WUB A;  4N7D A;  5BYP A;  4QGW A;  5HBS A;  2RTE B;  1AVE A;  2RTK A;  3EMM A;  1EQD A;  4EXZ A;  3JQO A;  4IBA A;  3CKF A;  3NX1 A;  3E3C A;  3SLT A;  2I5V O;  2GTL N;  2IZK A;  2QO4 A;  1FDQ A;  2IZL B;  3BX8 A;  4BX6 A;  2WUT A;  3RDS A;  1SWK A;  1ZNL A;  2KD2 A;  2X45 A;  2OVS A;  3B2L A;  1X8O A;  2ZAI A;  2IZG B;  2PI3 O;  2X46 A;  3B2H A;  4BCS A;  1SWN A;  3BY0 A;  4YGH A;  1GX9 A;  4LKP A;  3KFH A;  4AZN A;  2FHN X;  3RSW A;  1KT5 A;  4XME A;  4CSB A;  1X8P A;  2W2A A;  4XMD A;  4GZV A;  1JZU A;  3KFG A;  2HNX A;  1I9H A;  3ZWE A;  2Q2P A;  3X00 A;  4CV7 A;  1OEK A;  2RCQ A;  2RQ0 A;  5D48 A;  3OD9 A;  3G7X A;  1KZX A;  1LIF A;  1ZNG A;  4O4S A;  1EW3 A;  1VWK B;  5IRW A;  4GJS A;  4IAW A;  4ZHH A;  2DJF A;  2FTB A;  3MBT A;  5DG4 A;  1ML7 A;  4KC8 A;  4CPH A;  1HN2 A;  1UYO X;  4L1N A;  5B2A O;  1DC9 A;  5EEE A;  3PQU A;  2JW1 A;  3MX7 A;  4BX5 A;  1SWS A;  3HOL A;  3NX2 A;  5LJD A;  4BBO A;  2WPU A;  3LTW A;  3NAD A;  2RTQ B;  2MO5 A;  4YGG A;  3ZW0 A;  3IA8 A;  1LDO A;  1SA8 A;  4DQ4 A;  1QY2 A;  3FYF A;  3B2K A;  2VFC A;  1SRH A;  4TJZ A;  1AQB A;  3PQS A;  5D47 A;  1PMP A;  1ALB A;  1GT3 A;  1W4T A;  1KT7 A; 
#chains in the Genus database with same CATH homology
 3ZZV A;  2BT9 A;  3CWK A;  3DTQ A;  4ORS A;  5BVQ A;  1AB0 A;  1OPA A;  4ORR A;  2LA7 A;  1GKA B;  3KFF A;  3VE2 A;  5BVT A;  2IFB A;  3ZUI A;  3UEU A;  1LIE A;  4ON1 A;  3P6F A;  5HA0 A;  2ZAG A;  4FBV A;  2Z4I A;  4YBP A;  1BLR A;  4Y0S A;  1BWY A;  4YGZ A;  4ZGF A;  3P02 A;  4O4O A;  5LJK A;  5F6Z A;  2NND A;  3FA8 A;  4NYQ A;  3WBG A;  2QM9 A;  2POA A;  1CBI A;  1BSQ A;  1DZK A;  2LFO A;  4DQ3 A;  1R0U A;  3C77 X;  4ID2 A;  4ODD A;  3VG6 A;  1S44 A;  2OVD A;  3PP6 A;  4OS0 A;  1Y9L A;  4O4X A;  4HFO A;  1TXL A;  4TKB A;  1LID A;  5B27 A;  1BJ7 A;  1EUO A;  3APX A;  3OJY C;  3TGB A;  5HCE C;  5F6B A;  4MVE A;  5HTD A;  1EPB A;  4IB9 A;  2AT0 X;  2G78 A;  4M6S A;  3O2Y A;  4UU3 A;  1PBO A;  3HWG A;  1YWC A;  1FTP A;  1LFO A;  1EIO A;  3NQK A;  2BS6 A;  1IW2 A;  4Y0Q A;  2KT4 B;  4OS8 A;  4EEJ A;  3L4R A;  3CR6 A;  3FR2 A;  4QQ1 A;  3I0A A;  1NP1 A;  3AKN A;  1X8Q A;  3VG4 A;  1X71 A;  2LKK A;  3PPT A;  4NW4 A;  4ZCB A;  3VG7 A;  1EI5 A;  3EBK A;  1MUP A;  4IMO A;  2CM9 A;  3FA6 A;  1SY1 A;  3NBX X;  3P24 A;  1G85 A;  1VYG A;  4UU2 A;  1SY3 A;  1KT6 A;  1T0V A;  4LZU A;  5IO5 A;  3OBL A;  4YFQ A;  2HYS A;  4RUN A;  4IAB A;  5HAE A;  2A0A A;  1U0X A;  1EXS A;  1QFT A;  2CBR A;  1LKE A;  2X8F A;  2P8G A;  4NLJ A;  4YBU A;  2O62 A;  2OZQ A;  4TKJ A;  3ELX A;  4O4U A;  3FEN A;  4ARH A;  3WVM A;  1GX8 A;  1Y9T A;  2FWV A;  3HK1 A;  1IFC A;  3JSQ A;  4KC7 A;  1VPR A;  4GDZ A;  5DPQ A;  5F58 A;  4O3Y A;  3U9P C;  2W2B A;  3H3I A;  2ACP X;  5HTE A;  2F73 A;  1A57 A;  1I4U A;  3FR4 A;  2KW1 A;  4NNT A;  2KTS A;  1CBS A;  1FE3 A;  1IFB A;  3ELZ A;  2L9C A;  1GT1 A;  1BM5 A;  2JN3 A;  3BU9 A;  4IB7 A;  1HBP A;  4OMW A;  3U03 A;  1P6P A;  1OEE A;  4BQU A;  2GJ5 A;  2WEW A;  3UEV A;  1G5W A;  1CBQ A;  3FR5 A;  4PSQ A;  3SAO A;  1A3Y A;  3APU A;  3S5V A;  4INN A;  4O49 A;  1BRP A;  4YFR A;  2GTL M;  5KHP A;  3N91 A;  1YP6 A;  1OBQ A;  1QQS A;  1QAB E;  2WQ9 A;  3F8A A;  4FGI B;  4QRL A;  4U9C A;  1B8E A;  3WJF A;  1MVG A;  4KCA A;  4ZGU A;  3CBS A;  2A2G A;  1ZNE A;  4N7C A;  4OMX A;  1KQX A;  1D2U A;  2JMB A;  2CZT A;  2MHD A;  1LIB A;  5D4A A;  2FRS A;  1BRQ A;  2F09 A;  3FW5 A;  1E06 A;  3ZW1 A;  4AW8 A;  3ZW2 A;  5FQ7 E;  1XKI A;  5HCC C;  3U0D A;  4MIS A;  2HZQ A;  2OFR X;  4KII A;  3KQ0 A;  5LJE A;  3P6H A;  4ML7 B;  5FAZ A;  2EU7 X;  4IAX A;  5KID A;  4U8U O;  5LJH A;  4O3X B;  1LIC A;  1SXY A;  2WWP A;  2JU7 A;  1I05 A;  3BU1 A;  2NNQ A;  4I3D A;  1RBP A;  4A60 A;  1AEL A;  2LB6 A;  4QNI A;  3HWF A;  4HPD A;  2Q9S A;  2OVE A;  5D45 A;  4YCE A;  2L67 A;  4CK4 A;  1I04 A;  4QYP A;  3V8U A;  2GC9 A;  2K62 A;  5B29 A;  5H9N A;  1ACD A;  1ZRY A;  3CQR A;  5D8J A;  3S5X A;  3VE1 A;  3F6Z B;  2RCT A;  1PEE A;  4XMC A;  5HZ8 A;  1MX7 A;  4LKT A;  4QZT A;  2HLV A;  1T68 X;  4ZH6 A;  4K19 A;  4GH7 A;  3WJG A;  4GKC A;  1GT5 A;  2Q2M A;  2AT5 X;  1UZ2 X;  4GU8 A;  4TQ2 A;  2A3F X;  2QO5 A;  1KZW A;  1HQP A;  1LPJ A;  2AT3 X;  5LKE A;  3PH5 A;  2FS7 A;  4A1Y A;  2FS6 A;  1BEB A;  3UAQ A;  5LJB A;  2QOS C;  1OEJ A;  4HPA A;  1JJJ A;  1GKA A;  1X89 A;  3CBC A;  4XMH A;  4WBK A;  3RKG A;  3UEX A;  3TZS A;  2CM4 A;  2NP1 A;  1X8U A;  4NP1 A;  4ZH9 A;  4I95 A;  3STK A;  2E4J A;  5H9A A;  4I3C A;  2K23 A;  1JYJ A;  1U17 A;  4KT5 A;  4A1H A;  5EDB A;  2RD7 C;  1U18 A;  5AQ6 A;  4EDE A;  3WJE A;  5C0N A;  5FFH A;  1TOU A;  2CBS A;  3CQN A;  1DFV A;  1KGL A;  4YCH A;  4JGL A;  3WJB A;  4MIR A;  1BSY A;  4OS3 A;  3VG3 A;  3BSZ E;  3ZI8 A;  4I9S A;  1DZP A;  1XCA A;  4QGX A;  1MDC A;  3B2J A;  3NPO A;  1GT4 A;  1OBU A;  2BLG A;  5HA1 A;  3I17 A;  5H9K A;  1IKJ A;  3K3L A;  1O8V A;  3NP1 A;  4YDB A;  5H8T A;  1KXO A;  5IO6 A;  5CE4 A;  3NQ9 A;  5EED A;  4AZO A;  5AEO A;  5F7G A;  2A13 A;  1QY0 A;  3DSZ A;  4YDA A;  1ERX A;  1JIW I;  2ASN X;  4TKH A;  1KT3 A;  3MVF A;  2AT6 X;  3C78 X;  2RN4 A;  3B2I A;  1LF7 A;  4LZV A;  4U8U N;  2AKQ A;  3FMZ A;  1DV9 A;  2KTD A;  1IIU A;  1JJX A;  4A8Z A;  1LNM A;  3STM X;  1EPA A;  3RBY A;  5EPQ A;  4ALO A;  1ERB A;  3PH6 A;  1SMP I;  1PM1 X;  1E00 A;  2YG2 A;  4QYN A;  1JV4 A;  4I3B A;  4WFV A;  2W2F A;  1ZND A;  3P6E A;  4L3R A;  4YH0 A;  3WOV A;  3QKG A;  1ZNH A;  4QZU A;  2Z4H A;  1A18 A;  2FR2 A;  5AJB A;  5F1E A;  3O22 A;  4GNY A;  3IFB A;  4KH8 A;  4YKM A;  1KOI A;  5FQ6 E;  1SXW A;  3ZW0 B;  3PEC A;  4BVM A;  5HZ9 A;  4QAE A;  4FBR A;  1DF3 A;  5EZ2 A;  2PY1 A;  3P6G A;  1G74 A;  4EFG A;  3FW4 A;  3ZUO A;  4FBO A;  3VPJ E;  3Q6L A;  4ZHG A;  3CMP A;  4ORX A;  1I06 A;  1MX8 A;  2JOZ A;  1B4M A;  3EM0 A;  1RLB E;  4ORY A;  1YWD A;  1NGL A;  2BHV A;  2OVA A;  3APW A;  1HMR A;  1TW4 A;  4NLI A;  4R0B A;  3SOT A;  4ZHC A;  3BDR A;  1YIV A;  4NYR A;  4TLJ A;  3C76 X;  2HMB A;  2ALL X;  2MM3 A;  3APV A;  3S60 A;  4ZFX A;  2R56 A;  3HWE A;  4ES7 A;  2HZR A;  1KQW A;  1SY2 A;  4MVK A;  2AMM X;  4GE1 A;  3FEK A;  1JYD A;  2FLJ A;  4TNN A;  3VG5 A;  2YMS A;  1VYF A;  1ZNK A;  3GAQ A;  2WEX A;  4ORU A;  5HZQ A;  1GM6 A;  4XMG A;  3RZY A;  4AZP A;  4D6B A;  5CYB A;  1YWB A;  3P6D A;  1SXU A;  1H91 A;  4HPB A;  5KIC A;  1HBQ A;  4IMN A;  4M7M A;  4MVI A;  1AVG I;  4ZR2 A;  1QWD A;  1HMT A;  4AZR A;  5JR8 A;  4GNW A;  1YWA A;  2NNE A;  1ADL A;  3D95 A;  1S7D A;  5HWZ A;  2LBA A;  1D3S A;  3PED A;  5LKF A;  1TVQ A;  2WQA E;  3FA7 A;  3KZA A;  4O9S A;  1BBP A;  4IB6 A;  5FQ8 E;  4FQB B;  2R74 A;  4BOE A;  3D96 A;  5LJG A;  5EDC A;  1SY0 A;  4YFP A;  4ZHF A;  5BVS A;  5L8O A;  2LBV A;  2BS5 A;  3HTY A;  3T1D A;  2GTF X;  2AH7 X;  3BRN A;  3P6C A;  1E02 A;  3GE2 A;  1YUP A;  1O1U A;  4D6A A;  1FEN A;  3D4R A;  2A2U A;  2G79 A;  3EBW A;  4GET A;  4RUU A;  2N93 A;  1CRB A;  1B56 A;  3AKM A;  3HWD A;  4I9R A;  1QG5 A;  4YKO A;  4COT A;  1URE A;  2GTL O;  2AL0 X;  1SXX A;  3NR3 A;  2X8S A;  4QGV A;  1EAL A;  1HMS A;  2Q4N A;  1QY1 A;  1DZJ A;  5AJC A;  4XMF A;  3O19 A;  5HZ6 A;  4O3Z A;  4GK9 A;  4PJ2 A;  1FEL A;  5L8N A;  4AZM A;  4WHI A;  1A2D A;  2FR3 A;  4ORW A;  2MWH A;  1GXA A;  2DM5 A;  2JU8 A;  1DZM A;  3VU1 A;  1KT4 A;  2RA6 A;  3LHN A;  3BX7 A;  4MVL A;  3BLG A;  2QO6 A;  3HOE A;  3LV4 A;  4WFU A;  2FT9 A;  3VG2 A;  5IO7 A;  1BSO A;  4O3W A;  2QMI A;  4IB8 A;  3TGA A;  3OE3 A;  1CBR A;  2XKL A;  5LJC A;  5HCD C;  3STN A;  1N0S A;  2G7B A;  2WSJ A;  1G7N A;  3WJC A;  3TGC A;  1B0O A;  5L8I A;  5K06 A;  2ANS A;  4ZHD A;  1CJ5 A;  4ALB A;  1X8N A;  1S2P A;  1YP7 A;  3FEP A;  2M4L A;  4AYH A;  5HZ5 A;  4YMY A;  2CZU A;  2MJI A;  1OBP A;  2XST A;  3FIQ A;  1E5P A;  4LQZ A;  1ICN A;  1FEM A;  2WR6 A;  2JU3 A;  3EYC A;  4EQA C;  2ACO A;  3S26 A;  3D97 A;  4GRJ A;  4Y0P A;  3ZQ3 A;  1L6M A;  4AZQ A;  1T8V A;  1Z24 A;  3KFI A;  3BS2 A;  3F9D A;  4Y0R A;  1NP4 A;  2X8T A;  3FA9 A;  1TOW A;  4NNS A;  4I6S A;  5FEN A;  2Q39 A;  4U8U M;  3JS1 A;  1QFV A;  1ICM A;  4HPC A;  3NQ3 A;  1OPB A;  2OFM X;  5H9L A;  3FLL A;  2R73 A;  2L68 A;  2L5P A;  2AT8 X;  3WXQ A;  1EII A;  1O1V A;  3RWX A;  1GGL A;  4HWM A;  4U3Q A;  3ZW1 B;  1JBH A;  3FEL A;  3UEW A;  3TF6 A;  1IKE A;  3WJD A;  4N7D A;  5BYP A;  4QGW A;  5HBS A;  3EMM A;  1EQD A;  4EXZ A;  3JQO A;  4IBA A;  3NX1 A;  3E3C A;  2GTL N;  2QO4 A;  3BX8 A;  1FDQ A;  2WUT A;  1ZNL A;  2KD2 A;  2X45 A;  2OVS A;  3B2L A;  1X8O A;  2ZAI A;  3B2H A;  2X46 A;  3BY0 A;  4YGH A;  1GX9 A;  4LKP A;  3KFH A;  4AZN A;  3RSW A;  1KT5 A;  4XME A;  4CSB A;  1X8P A;  2W2A A;  4XMD A;  4GZV A;  1JZU A;  3KFG A;  2HNX A;  3ZWE A;  2Q2P A;  4CV7 A;  1OEK A;  2RCQ A;  2RQ0 A;  5D48 A;  3OD9 A;  3G7X A;  1KZX A;  1LIF A;  1ZNG A;  4O4S A;  1EW3 A;  4IAW A;  4ZHH A;  3MBT A;  2FTB A;  5DG4 A;  1ML7 A;  4KC8 A;  1HN2 A;  4L1N A;  1DC9 A;  5EEE A;  3PQU A;  2JW1 A;  3MX7 A;  3HOL A;  3NX2 A;  5LJD A;  3NAD A;  2MO5 A;  4YGG A;  3ZW0 A;  3IA8 A;  1SA8 A;  4DQ4 A;  4ZJ0 A;  1QY2 A;  3FYF A;  3B2K A;  4TJZ A;  5D47 A;  1AQB A;  3PQS A;  1PMP A;  1ALB A;  1GT3 A;  1KT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...