4TQAA

Crystal structure of a gdp-bound g13d oncogenic mutant of human gtpase kras
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
GMTEYKLVVVGAGDVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Analysis of Common Cancer-Associated KRAS Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 58
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tqaA00
4F93B 1XEXA 4X8HA 2W6JA 3CRVA 3VU9A 3U44A 3RRZA 1KIMA 2F1RA 2B8WA 2OEPA 2X2EA 2GXQA 3CWQA 5FOWA 3GP8A 4LUCA 3R9WA 1XMVA 4BLOA 3EARA 3GEHA 4HLDA 4TYPA 3KDSE 4NU0A 1GKYA 1E2QA 3W6OA 2HT6A 1X8KA 2CHQA 1KI7A 1G5PA 3NHBA 1Z0DA 4D4MA 4DSUA 3I3SR 3FMPB 2XOKA 4QFMA 2DB3A 5AJXA 4NONA 3ZGXA 3W6NA 1YZGA 1Q0UA 2ZJZA 2NQ2C 3QIAA 3PUZA 4HLCA 2GILA 1G291 1VYTA 2WAXA 1A1VA 4HZUA 1N6NA 3AQ4A 4XTCS 5F2EA 1NG1A 3HU3A 3TAHA 1WDTA 5JJKA 2WOJA 1PJRA 5BQ5A 1J99A 3D6TB 2ZITA 2F3TA 4HAYA 3NIBA 2JAQA 2GDJA 1RRCA 1Z83A 4MKFA 3R8FA 5DGXA 1DELA 1T0HB 2J5XA 3BH6A 3AKCA 2BBTA 3T1OA 3H1TA 4AKGA 4B3FX 5DE3A 4EAQA 2AK2A 2ZVPX 1NMYA 1U99A 1UFQA 4G1UC 4RCYA 5IDVA 1A4RA 1U94A 1JB1A 1N25A 2CL6X 4OQXA 4IKEA 2MSDB 3ND8A 4PPFA 5L8VA 1KAOA 3GFOA 1P62B 3L82B 2AN9A 3M4YA 4MRNA 4PAQA 4MA4A 3BH0A 3L8ZA 3EWAA 4JVMA 2PLFA 1G8PA 4M9SA 2QPTA 3AP1A 2V7QD 1AZTA 4HAZA 2FMXA 3SS8A 821PA 5C4GB 4BEBA 2PEZA 1YR8A 2WV9A 4JJKA 4L15A 3CRRA 5BW8A 5D3MA 3U4QB 3U7FB 1VG0B 3PUVA 3IO3A 3SE0A 2HUPA 3BB4A 4YC7A 5EP4A 1OXTA 2HEIA 4MUBA 1G8FA 2QGNA 1XRJA 3VR5A 2FFQA 1K5GA 4W5HA 3DMDA 3QOFA 4AYTA 3QKRB 2WJYA 4Z51A 1R2QA 4CIDA 4NZYA 2G83A 3BB1A 1U0LA 3HJNA 1Z29A 3GLHA 4FWTA 2GK7A 2Q21A 1MV5A 1Q12A 1OXSC 4BASA 2JIZA 3LX5A 4JYBA 5L3SA 1YR7A 1NLZA 2X8AA 1R0ZA 2QT1A 4DCSA 1IXZA 3Q72A 4DLYA 1HV8A 4XOIA 4ASUD 2ZJBA 1U8AA 4M53A 1O3YA 3Q3JB 2FJUA 3FTQA 4ZDIA 3D31A 4O2RA 4B3BA 1W5SA 2J45A 3PJRA 1AZSC 2KI5A 2ZRGA 4XWOA 1QHXA 2FOLA 1IJEA 2HCJB 2WM9B 1KJZA 1Q1QA 3ZVMA 2GJKA 3PFIA 4BLRA 2I1QA 2P6NA 2ZSAA 221PA 2IL1A 2HF8A 1AN0A 2QT0A 1Z0FA 1AS3A 2O8CA 3A1SA 3GFPA 5J4HA 1JI0A 4QBIA 4PAMA 2KSQA 3UKDA 1CU1A 4B3XA 1KY3A 2Z83A 4ZKDA 4AYWA 2OM2A 4KSCA 4WOPA 3TRFA 1LVGA 4C0QC 4CEIB 5KSPA 5EQTA 1I4LD 1ZU4A 3P32A 1P60A 3TAUA 2REOA 3CPEA 3FYHA 2CBZA 3QPUA 1SZPA 1XP8A 4YDHB 1Q1BA 3WNBA 1XJ0A 1DAEA 3RLFA 1JJ7A 1B23P 1RRFA 3PCRB 3QEJA 2DR3A 1VECA 3FMFA 4KBGA 4QJ5A 2ZYVX 3ASYA 4Q48A 3VX3A 5DI3A 1GRQA 2XZOA 4BFSA 4DEYA 4R98A 2BMEA 1SULA 4XTRA 3CNOA 1E2HA 2BJWA 721PA 3I72A 2FDCA 2WJVA 4DWJA 1OH7A 4GDFA 1XD2A 5EE0A 4FWIB 2CHGA 4MRRA 1YKSA 5GADl 2MSCB 1OT3A 4UXIA 4KFRA 4U02A 1ESMA 1VYUA 3OEHA 4IFBA 2NPIA 2BHRA 4R7ZA 4P33A 1XMJA 3QY0A 5EP1A 2QMUA 4ZPXA 2VSXA 2OUKA 3QKSA 4OHZA 1GUAA 4E5UA 5CYOA 4Q7MB 4FMBB 2P65A 1G7CA 4RD1A 5GVSA 3QF4A 4QHYA 3ASZA 1YZTA 5FI0B 4BRWA 3FFAA 4DHEA 2PEYA 2O8EB 4ARZB 4L5BA 4NL4H 4KHZA 4DIEA 4EDHA 3GD7A 2BMFA 2GF0A 3U3MA 1OFHA 5B58C 2YV5A 4AG5A 2ZU6A 4F7WA 2XXAA 3LW8A 4B2LA 4AURA 4EFLA 5CM9C 1HA3A 3T5DA 4D81A 2ZXUA 3KUDA 4AWXA 2QMEA 3B13B 2EWWA 4TYNA 1MOZA 3CX8A 4LY6A 3BOSA 4QM6A 4B44A 1G5RA 2GJ8A 1N6HA 2N1BA 4XVQA 2LKCA 4B74A 4A92A 2N46A 4D4LA 3FKSD 4RD6A 2VHUA 2FFHA 2R6GA 4PC3A 1OH8A 2QE7A 4FMDB 1AIPA 2QQEA 1R0YA 1GNRA 4IHQA 1XTKA 1ZD8A 4POAA 4GOKA 4ITRC 4IOLA 5TB5A 5HR5A 2GCPA 4V0OA 4IDNA 4IEIA 5CB6A 2Z43A 2P3SA 2P2LA 2HJGA 3EZ9A 2J7KA 4TMKA 5J47A 5FH9A 4BEJA 5FOVA 4LJ4A 4UJ3A 4A15A 3A58B 3OE7D 4PC1A 1GOTA 3DZDA 2QAGC 1ZYUA 3Q7PA 3GLFB 4PC6A 4F91B 2ZQ5A 5EXPA 1Q3TA 1G6HA 1E2GA 2IS2A 1TU3A 2REBA 3RANA 2O8DB 2PL3A 3LNCA 3OZXA 2FN4A 4LPKA 3TGPA 4WIAA 1G6OA 1ZW6A 1KI8A 3B1WA 3BWDD 3EC2A 5DIFA 3DKPA 5CIWA 3RS4A 4IOKA 3NTUA 2ZJOA 3KTAA 2I1VB 1NI3A 4BLTA 1UJ2A 4DLWA 4I1OA 2FZ4A 5FBQB 1ZD1A 3AF3A 4KODA 1CXZA 4Q1FA 2CCJA 5JWHA 1Q21A 1S3GA 3T1VA 5GJBA 2FU5C 2ZYUX 4LCBA 4DSTA 4N0EA 5KDOA 3U60B 3FDIA 2JJ1D 1OHHD 1QHIA 2EFHB 1E99A 1WF3A 4DDUA 3CKLA 1SVIA 1Z22A 1R0WA 2H5EA 3TVDA 2ZJAA 4HAXA 2IYWA 3FOZA 4LJ5A 1OB2A 3MJHA 3GLIA 5E95A 4PXAA 1NF3A 2QG6A 3RVBA 1EG7A 1NN5A 4PHTA 3RS5A 1YZLA 1FNNA 1H8ED 1A2BA 4XWKA 3WYAA 3AF1A 1DTSA 1ZVQA 2H57A 5L3RA 4LRWA 3VQTA 1G17A 2F43B 5E4FA 4ZCLA 2ORIA 4FMCB 3PXGA 1CJVC 1HEIA 2FPMA 1E4VA 1Q1EA 3LXRA 2VHTA 5C1BA 4ZI2A 1UAAA 2NIPA 1DS6A 1E3MA 4CGZA 1IN4A 1QDEA 1W4BA 3AVOA 3IPXA 3O47A 1OHHA 2GCNA 2GF9A 2ZROA 1GAJA 3LA6A 1ZAKA 4HB0A 1NN1A 3KKMA 5G3YA 3QJYA 4LX0A 3I61A 1FUUA 4KO8A 4ERNA 5J40A 2H8KA 5CJPA 1P61B 4Q1AA 2IYYA 1YJ5A 1M7GA 4I4LA 5DISB 5B30A 4CEHA 4EJSC 2VP5A 3LBHA 4ZIRB 3LBNA 2FSIA 1VMAA 2WWXA 1EX7A 1R5OA 3K9HA 3OIYA 1G16A 2WJIA 1WCV1 1E0SA 3SC3A 4JS0A 1TADA 4V0NA 3X1ZA 4ZDJA 2PJRA 2AKAB 4P4UA 1KSHA 4JLMA 1SXJA 1XFAA 1CR1A 4JL5A 3E1SA 3B5JA 1KJWA 4Z1MA 1E2KA 1FP6A 1OKKA 5IRCD 1K6MA 1ZUNB 3MD0A 1OH6A 4TL7A 421PA 2WOOA 3QXHA 2GJ9A 2WWHA 4TLDA 1IAQA 2FSGA 3AKEA 1LS1A 4RKFA 2G1JA 4DLRA 2QAGA 2AK3A 4DT1B 2VBCA 2PT5A 1Z0KA 4TN1A 1S9DA 2BVNA 4Y0VA 4X8OA 1XCMA 3ADCA 4RD2A 1GITA 5AJWA 4DRZA 4LOAA 4W5WA 3OESA 1TF7A 4P3YA 2WZQA 4URVR 1E9SA 2B7BA 5JBQA 4UXJA 5CK4A 1MO5A 3LRPA 1WBDA 4MKIA 3KB2A 2F7SA 3GMTA 3PQCA 3H0KA 4PZZA 4E07A 1W48A 4B47A 2QP9X 4A8JB 3O8CA 1ZUHA 4ZCMA 3AVQA 2UZIR 2XX3A 4BPBA 1EFRA 3TW8B 5SZIA 4WZBE 5FL7D 1G9XA 1NJGA 1W2HA 3OIWA 4GL2A 1OB5A 1SGWA 2C9CA 1G3QA 3SNHA 1SHKA 5FR2A 1NBMD 3KXLA 3L43A 2WIAA 3R9IA 2VTKA 4GP7A 2J46A 5HKKD 2J0VA 4CEIA 4C7OB 2OFWA 1DO2A 3SYKA 3WY9A 1Z0AA 4OK3A 1M2OB 3RS0A 5EXTA 1W2GA 3BH7A 5FUXA 1GL9B 1P3JA 2Q0HA 4P32A 2FGKA 2CL0X 3IUYA 1XTIA 3QKRA 1L7VC 4A0RA 4F92B 4LJ6A 2CNWA 2YKGA 3SQWA 5AUPB 3GJ8A 1LS6A 1EFRD 3PENA 1HT1E 1M1YE 4HDOB 3M6AA 1Z0IA 5FFMA 3CZQA 4BE7B 1OSNA 4YMWA 1KMQA 4QGFA 1AK2A 2GCOB 3MCAA 2IYXA 2A5DA 2F6RA 3VNVA 4QM7A 4V0MA 1XTSA 4LYAA 1YR6A 1W0JD 3H4MA 4IOJA 4Q21A 5FPSA 1FOEB 4R2IA 5EP2A 4QKQA 4V02A 1ZCBA 5JSZA 3N70A 4JSYA 4PSVA 3B7GA 4FINA 2UZ3A 2RGDA 3KQNA 4XH9B 2ZYTX 4D4JA 2O0JA 2QRZA 1KKLA 2F3RA 2VF7A 4IW3B 4IDQA 5FTLA 3TSWA 3K8YA 3KJIA 1LF0A 1Z5ZA 3D8BA 3DM9B 3NEYA 4C0AC 4G3XA 3IKJA 4LHVA 4XVUA 3JZAA 1W0JA 2IUSA 4KCGA 4G5SA 1GZSA 2XNSA 1P2VA 3TVTA 1RC8A 4PQYA 2X2FA 2DWPA 3QXCA 4PZLA 4RZXA 2O8CB 2JEOA 1G19A 2QM8A 3KXKA 4H1VA 2WPDA 1OFTA 3IQXA 4TSFA 3K9LA 3I1FA 5AJZA 4XSHA 3L0SA 2PMKA 2V54A 4AK9A 2GESA 1MABB 1DE0A 1BS1A 2ATVA 3QNUA 1F2TA 1SVSA 3UANA 4RFSA 5FBVB 3J81k 1W36B 2OFOA 3SR0A 1N6KA 1FTNA 2KE5A 5TV2A 4B35A 4RJLA 1AKYA 4M1TA 2XTMA 2IS6A 2E9SA 4TYQA 4DDTA 1P72A 4RFVA 1IBRA 2KWIA 2JJ8A 2XAUA 3EIEA 1M8PA 2YYZA 2F1JA 2AD5A 3GCGA 1T6NA 5TXGA 4YMUA 3KJHA 3BB3A 3LFUA 5E7MA 5FTNA 4GMDA 1RRGA 1XDBA 3LAWA 3U6BA 4B3DA 3EPKA 1PLJA 3FB4A 5DN6A 1YZNA 3BK7A 1BKDR 4PHFA 2BBSA 4TMVA 5IHPA 1MH1A 1OYWA 3MGCA 5BN3A 1XCPA 4LC1A 4OKSA 3BIFA 1HQCA 1EFHA 1HURA 1T91A 3FFBA 4KXFB 3FWYA 3DL0A 2VRWA 5EE1A 2PCLA 5TDHA 4P0TA 4AKHA 2IBMA 2WHXA 2IEYA 5JJIA 4LV8B 5FL3A 2QP4A 3VR1A 2R6FA 4JBWA 1UDXA 1GIAA 4CRWB 4EUNA 1TPZA 2C04A 2ZRHA 3T06B 2Q3MA 3MJRA 3K0CC 2PCJA 4NBSA 1MR3F 3THYB 1L4YA 3DM5A 1JR6A 1W4RA 2ODWA 2HXYA 3EWSA 4F4IA 5LD2C 1XJQA 2PX3A 2ECKA 3KUCA 4PSKA 3THXA 2O8BA 4JLDA 1P7CA 3N5CA 3ECCA 2ZS7A 2ZRNA 2MMCA 2GEDA 1M7HA 2FPKA 3K0CA 3TNFA 5EJEA 2GVDC 3CZPA 3IDQA 2FEOA 4JT2A 2HXSA 2WICA 5C4MA 2WWWA 1E2EA 1Z6YA 1CBUA 4GNKA 1NJFA 2V6IA 4MITA 3B85A 3KJEA 4TTQA 1ETUA 3MFYA 2QBYA 3TUIC 4HDQB 4TMXA 3NBXX 5FTMA 1ZINA 4HYYA 3MWYW 4C3ZA 2ZR9A 4R2HA 3U3RA 4D26A 3B1XA 4CT5A 3CRQA 4URYR 1Z2AA 3QPWA 3GFTA 1QHNA 2ZI5A 2O5VA 4HAWA 4LJ8A 4KLZA 1P2SA 4KFSA 5CB8A 5BN5A 3S1AA 2XNDD 1D2MA 5JHGB 2O8DA 3UK6A 4KAXA 4Q03A 2GTPA 1ZUIA 3QPVA 3UMSA 2GA8A 1CS4C 1RFLA 1US8A 2XSZA 2YNMA 4HB4A 4PC7A 5CM8B 4ACAA 3GEEA 3Q9LA 5HCNA 1CIPA 4OK5A 1FL9A 3SFVA 3V00A 1JAHA 1JAIA 1O87A 2AD1A 4Q18A 3R9XA 1OXXK 4NYMQ 4LC0A 1Z63A 1GRRA 1KJYA 1BH2A 5CJ2A 3GLGA 1XPRA 2PZFA 2IT1A 3A8TA 1SVOA 3K0FB 4JLOA 1Z07A 2RGAA 4A82A 1G18A 2HV8A 1E9EA 3CBQA 2R65A 2QQ0A 3T15A 3B6EA 1XPUA 2LCFA 1DAHA 3NBFA 1HH4A 1F5NA 1RE0A 4MKGA 3D3QA 3CR8A 4PO9A 4B48A 4HEJA 1KKMA 1X3SA 4TMTA 2XXAB 1KHTA 2C8VA 4AKEA 1CR2A 1U0JA 2CK3A 1E96A 3ZH9B 4A0FA 1XD8A 4WXPA 2QPOA 1KI1A 4JVSB 1K8RA 2OCBA 2OO7A 2EWVA 3QUSA 1QBKC 5FOUA 4M9ZA 1KSFX 3QF4B 2BDTA 3HR7A 2JLYA 4QXAA 2B92A 1NVWQ 1A7JA 3SEAA 2D74A 3NH9A 4D82A 2IS1A 2CVFA 4MYTA 2CLCX 5L3VA 2XTZA 3THYA 2ANBA 1D9XA 1CKEA 5A5GA 2BMDA 2BCJQ 2CJWB 5KU1A 1AQYA 1DARA 3T1TA 4QC2A 5FUWA 4V0KA 3V4FA 4BECA 3H2YA 4CW7A 5JS8A 3NBZC 3OAAD 4Q4AB 2GZHA 2IYQA 2R44A 3BORA 1LB1B 1W47A 3VX4A 5L3QA 2AX4A 1M34E 1V43A 3WNCA 4EFNA 5AUNB 2GK6A 1VTKA 3LW7A 2FGJA 3KQHA 4Z1MD 3HYRA 2W0SA 3FVQA 5E7IA 3TLXA 2W6JD 1YE8A 1UBEA 4CEHB 2DBYA 1GFIA 2VP6A 1N3BA 3RSOA 2F1HA 5C18A 1G4UR 2IWHA 3QQ5A 4M22A 3KQUA 1HE1C 1NSTA 1CULC 1RJ9A 2OESA 1COWA 1JXMA 1BMFD 3MWLA 3K0SA 1DAKA 4B3CA 3U7EB 2D2EA 3SBDA 4O2LA 2WAYA 4FIDA 1LFDB 3QVVA 5JECA 5LPNA 4LV5B 1FPMA 3H84A 5CK5A 3L8YA 4L16A 3ZS8A 2FSFA 2OAQ1 1E79A 1Q20A 1J7KA 3FPAA 4Q9IA 2NO9A 2C9OA 2J41A 2ZUBA 1KK0A 4LYJA 1OIWA 3NWJA 3NXSA 4URXR 2RHMA 4OQLA 2YZ2A 2A78A 2E87A 3VR6A 2V1UA 2FV8A 5CDFE 1AM4D 4A2WA 1WP9A 5J4KA 4GOXA 4KFUA 4J0QA 2JATA 5G40A 2JLSA 2OILA 3REFA 1KO1A 2XB2A 4JMPA 2V4ZA 2JJ2D 1I4TD 2QTVB 1G3UA 2CCKA 4LHWA 1QHSA 2F9LA 1Q22A 1NN0A 3ZYCA 1X1SA 4C9BA 3RC3A 4Z54A 3SOPA 1E0KA 2NO6A 3C14C 3OAAA 4N0DA 3U3OA 1OV4A 2FWRA 2HYDA 3C41J 1NY6A 1OFIA 1WBBA 2YWGA 1RYHA 3EXAA 5H8WA 1NP6A 4PFSA 2Q9AA 2AWNA 3ZVRA 1FMJA 4A1FA 5LDDC 1U0HC 1Z08A 2ZI9A 3AUXA 2XZLA 4DUGA 4M1OA 1TL7C 3NG1A 4MGIR 3LV8A 4ILEA 4BRUA 4D0LB 4KFTA 2NZ8A 3N2EA 2W2TA 1NMZA 3TJZA 4NCHA 3JVUA 2C95A 2XZPA 4S2EA 4RD4A 1AQUA 5EZ5A 4EJSB 2ZSDA 4Q1CA 5G41A 4FMDF 4QNRA 4JLPA 4M2LA 4M21A 2VHJA 1XNJA 4BLPA 1TQ4A 2BBOA 2J0QA 4TT3A 1X1RA 4DXAA 2VQSA 1TQ2A 4NHOA 1NMXA 2ZRIA 3FHOA 2GKSA 1P2UA 1J8MF 2VO1A 4BFYA 4DUGD 4QRHA 1NIPA 1YR9A 4IJMA 3RSLA 1RKBA 4WBSA 5D3QA 2ZSEA 4IDPA 5P21A 3NKVA 3W3ZB 1PUIA 2ORVA 3GLHB 1JBKA 2R62A 3VR3A 2P6RA 1XX6A 4XWAA 4DKXA 1S2MA 1XEWY 4URUR 5ANRB 4LK2A 4JT4A 3ZS9A 1R10A 2PBRA 4TMWA 1GM5A 1GTVA 5FTKA 1R6BX 5CITA 4EPWA 1CEEA 5JCPA 3NHAA 2YOFA 1C1YA 1ZD9A 1E9RA 1MRNA 2FF7A 1YQTA 1WA5A 2FFAA 3MAAC 3VHLB 3UWKA 3QKUA 3Q5DA 1KY2A 1M7BA 2BMJA 3AKYA 5F9HA 4EFMA 3RS3A 1IY2A 3OF5A 1NVVR 3ADKA 2YWFA 4LJ9A 2EQBA 2WSSA 4Q4JB 4R71A 4EPVA 3O8DA 4C4PA 5L3QB 1YZQA 1DPFA 5KPJA 1Q44A 2IK8A 1WXQA 4DVGA 4M1MA 4ARZA 3BERA 3B78A 3K70C 3W3AA 5DYIA 5AR1A 4LJ7A 2WKPA 1G8GA 1YU9A 4JLNA 2CJWA 4YQFA 1JECA 3BFKA 1DAGA 3UXMA 2H7VA 3G82C 4GP6A 4NCIA 4LI0A 4KVAA 2GEUA 3CNLA 1F3OA 4D0NA 4BGDA 3VKWA 1N6LA 1UKEA 4OI4A 3BFVA 3LBIA 4Q4HA 5J5CA 3FGNA 2Z4RA 4HZUB 2VIIA 4IXNA 2ZRDA 4LBZA 4Q1BA 1NY5A 1BYIA 5FBWB 3LY5A 3A4NA 1IHUA 5FBLB 4JVNA 3BRWD 5FPYA 2P5TB 4DB4A 2VSFA 5AWFC 3W34A 3P1JA 1GKIA 3BAFA 1MRSA 3WYFA 4IVQA 4QNMA 2H17A 3A4LA 2VSOA 5HE8A 4CYMA 3DOFA 3TSOA 3ZIAA 1T3HA 4HUTA 2GCOA 1A5TA 1N6RA 5JEDA 2IS4A 4N3NA 3EZFA 3HDTA 3BE4A 4OJQA 3UMFA 2WMNB 2DYKA 1GL7A 1JXOA 4LHZA 3IPYA 2JCSA 3B1VA 4D0GA 2DCUA 4HDCA 1RVDA 2Y8EA 4IFEA 4RZ2A 1EFCA 2ZE6A 4DDWA 2RAPA 3DMNA 1KI3A 4OI1A 4C7OA 2WBLC 2JLZA 1FQJA 4QHTA 2A5YB 3EW9A 1HE8B 4CZ2A 1US8B 5KYKA 3ZJYA 1OYYA 2EVWX 1W4CA 5HCIA 3EX7C 2ERYA 4O25A 2ONJA 4B6FA 3K9GA 4FCTA 3SJBA 1E98A 2F43A 4TLEA 4ABYA 4Q1DA 3A36A 2IW3A 1J90A 4Q02A 1TMKA 4KITB 1HUQA 5KSYA 2I4IA 1ZNZA 5F9FA 1WMSA 4OBEA 5B2ZA 2J1LA 4Q5IA 2DWQA 1U9IA 2GWHA 4YMSA 1E9CA 1FX0A 5HZHA 3AB3A 3NC1C 5BWMA 4NYJQ 3CH5A 3PEUA 4WXRA 3LD9A 2D3WA 2FSHA 2ZSBA 3B1ZA 1R5BA 2C9YA 3B9PA 4PQFA 1QG4A 3UWOA 1R4AA 1S96A 1XEFA 1ZM3A 2DFLA 1W4AA 1EXMA 3Q5EA 4MYUA 1U9IC 3EA0A 3SJCA 1AGRA 4Q9KA 4RVCA 4FMCF 4I1SA 4W5JA 3K70B 1E0AA 2VL7A 1SXJC 4RZ3A 1FP7A 3TMKA 2GAOA 1UBCA 1TTTA 4NKRA 3VMFA 3WRXC 5KTYA 1GILA 2QTHA 1KDRA 1E0JA 4P4TA 2BWJA 3QF7A 2EYQA 4DLUA 4NCJA 4H9GA 4LBWA 2QORA 4YDSA 1TUEA 1K5DA 2ZJ8A 2PX0A 1MKYA 4TQ9A 1JJVA 2IXFA 3I62A 1SXJB 1XTJA 3SHFA 1KSGA 2GJAA 1CJUC 4LYHA 3A6PC 2D7DA 2CVHA 2OBLA 2G88A 4D6PA 4OHVA 1N5IA 1OIVA 4C30A 3RS2A 5KSOA 4OI2A 4EPXA 2ATXA 3RYTC 2GBLC 1FUKA 3IBYA 2A7QA 1CJKC 1E32A 1ZNXA 1VIYA 4AD8A 1NIJA 1LTQA 2EYUA 2W2XA 5AUQA 3LLUA 4TTRA 3L0IB 2GAAA 2NTYC 4XVRA 2RMKA 1E1RA 1KOFA 3BXZA 3EIHA 3RRNA 3IBGA 2ZSFA 1LV7A 4A8JC 1KO4A 1W46A 4AYXA 2ZJ2A 1F48A 1HT2E 2ODNA 4ESVA 1NVXQ 1FNMA 1MO6A 1M74A 3I73A 3MWJA 3IIMA 1QHHA 5FUVA 1SVKA 1ZIPA 3CRMA 3DO6A 1E9DA 4JKIA 4FCVA 4OHXA 2FE4A 2QMOA 4NYIQ 3WMEA 3U3JA 1Z6XA 1AJEA 5EZ6B 5FOXA 2QU8A 5GJWC 2OSBA 3AF2A 1LNZA 2GJSA 2ODEA 2XJ9A 1PUJA 3LH5A 1DG3A 3F5FA 1JQJC 4YXWA 1KI2A 1TEVA 2ZAOA 3NBYC 3B8HA 4ESHA 1IN5A 3QEOA 4ZO4A 5HTKA 1DOAA 2DFKB 3TQFA 2ZJ5A 1SXJD 1ZIOA 4TLBA 4BZQA 2ZUDA 2F55A 2FX3A 3SDZA 1S9HA 3Q7QA 3C5CA 3HWSA 1W0KA 2QENA 2RGCA 1W7AA 4AY2A 4NTZA 2VHCA 3U5ZB 1JR3A 1NKTA 2Z0MA 2ZIAA 1IJFA 2O8FA 4DJTA 1NN3A 1DG1G 3EPLA 1TAGA 1TQ6A 5EUQB 4LBYA 3RDPA 4R9UC 5G3ZA 2QPAA 3AVTA 1N6OA 3AGQA 5CIQA 4MQBA 5ELXA 4GI7A 3ZDQA 4G5RA 2ZREA 4OJKA 3TBKA 2CCGA 2O0KA 3A1UA 4KJZA 2QI9C 5FR1A 5HPYB 1P5ZB 1OPXA 1YHNA 2XITA 4RD0A 2X1VA 3WMGA 1ZRHA 3OIVA 2NPFA 1SKYE 2V1XA 4DLZA 2O0HA 1EFTA 3CO5A 2NO0A 4KVGA 4B73A 4GOJA 1Z6TA 2ZRJA 4P4SA 3MG9A 2WWFA 4Q9JA 4M1KA 1IQPA 4MKHA 3WHLA 3JVVA 6Q21A 4C2TA 4MUAA 2ZS9A 4A0HA 3KKOA 1TNDA 1FZQA 4EPYA 3GLIE 3QENA 3OEED 5EE5B 3GJXC 2YJTD 5JI2E 2H16A 2HDNB 2O52A 2B6HA 3ETLA 2REXB 4KYIB 2XNDA 1N0WA 3GJ6A 1ZM4A 4TYYA 3TR5A 2ZTSA 3X1DA 1CLUA 4EPRA 1VCOA 2WTUA 1LY1A 1ZNYA 4EQ6B 5K8UA 2WIBA 1TQDA 4G0NA 5JI3E 1JNYA 2SHKA 3BD9A 4OHWA 4TQAA 3I4LA 3KFXA 4O3MA 1SVWA 3U7HB 4ZDKA 4DLSA 4DLTA 4HLQB 5F98A 3ZQJA 2A3RA 3K0AB 3G0HA 2W83A 3FMOB 1OKKD 1KYIA 3MSXA 1ZM7A 5L3SB 4QGGA 1NG9A 3HR8A 2XGJA 1XZQA 2OAP1 2FZLA 2W58A 2JASA 3OFNA 1P73A 2QSZA 3AVUA 3W6PA 3F8TA 2ZAMA 2KBFA 3R8CA 2O8BB 2P5SA 1SKQA 4PPGA 5FBRB 4JJZA 4BFUA 1U8ZA 2V3CC 1KK1A 4Q1EA 1G7SA 2JA1A 121PA 4A4DA 4DCVA 1KDTA 2VA8A 3PUXA 2GVZC 2QRNA 2XOKD 2R2AA 4IRUB 2NGRA 2FH5B 3DEFA 4M1YA 1II8A 2ODBA 1P2TA 2ZI3A 3DDCA 3LQRA 5IT5A 4S35A 1ZCAA 1E69A 2Q9BA 2PH1A 4WZAE 3KZ1E 3ZD7A 1ZNWA 2YHSA 3TH5A 4NYMR 2YC4C 4B75A 1F2TB 1I2MA 3LO5A 4QBGB 3REGA 4QL3A 4US2R 1NNEA 2ZE8A 5JWRA 1G5TA 2DY1A 3DZ8A 1VDZA 2OZEA 5K8IA 2JJ2A 4RZUA 1QF9A 4EJSA 1CJTC 2FG5A 2RCNA 3MLEA 4LSGA 3A37A 3T1QA 2RH5A 1ODFA 2IYTA 4PQRA 3TSZA 4RKEA 1D6JA 1IN8A 3KXIA 1IONA 1N0VC 4TL9A 5BYKA 1ZC3A 3WNDA 4FW9A 2JLWA 1II9A 4LDJA 3K53A 2ZRCA 1VKJA 1D9ZA 4ON9A 4TL8A 4C0BA 2IX3A 3PEWA 1IM2A 4CVNA 1HYQA 3CUEF 5E7JA 4K8OA 1E2NA 2GETA 4N1AA 1Z3IX 4LJYA 1II0A 2VPPA 2PZEA 5K8LA 3X2SA 3IEVA 4JIMA 3SZRA 3BBPA 5B57C 4US0R 4AIIA 4B32A 2WWIA 4KLNA 2ZRMA 4HB3A 1Z6AA 2JLXA 1TEXA 1CJMA 3NDBB 1COWD 2BC9A 3FHCB 1MO3A 2ZYWX 4RY2A 4JLAA 5KHOC 2CXXA 4DEXA 1E2FA 2RGEA 4URWR 3EA5A 1NL3A 3I8SA 1S0UA 1SXJE 4II7A 3W8RA 3B1YA 4TLAA 2ASEA 1Z8FA 1IXRC 4GMXA 3WMFA 3V4RA 3PITA 3VU9B 4HUQA 3Q8XB 2NZJA 4JLJA 4BUJA 2BM0A 3GLIB 4BLQA 4ZDWA 4H1UA 1SHZA 2W2VA 5HKKA 4QBFA 3GJ0A 4NPHA 2NOAA 3K1JA 4HZIA 1P9WA 3UIEA 2BEKA 5DI9A 2WJJA 3CONA 4PC2A 4LJAA 3GQBA 3ADDA 3LQQA 4DCUA 4P4SB 2CHVA 4W9MC 1P9NA 3SU8A 2CLSA 2JIZD 4OQMA 1OXVA 2BEJA 4LWZA 2A5FA 1JALA 2G0NA 4HATA 4JLVA 4TLCA 3WHKA 5JSZB 2DPXA 2IYVA 5TMPA 2OLJA 1D5CA 3SJAA 4I81A 1LF5A 1T4GA 4GZLA 4TZ6A 2GXUA 4A8JA 1R8SA 2V6JA 1W1WA 621PA 1CRQA 3M0EA 3QXXA 4IDHA 1PLKA 2VHQA 2ZVQX 3RAPR 3BC1A 3WP0A 2VP9A 5LBIA 3T5GA 3GEIA 3HU1A 3RWMB 4CDGA 5FTJA 2VP2A 1N5JA 1GKUB 3THOA 1F60A 3AP2A 5DN6D 2QTFA 1FFHA 1NRJB 5LB4A 1UBGA 2OBNA 2YINC 2ZETA 3U61B 1QVRA 3CF2A 4EPTA 3O8RA 2AHOA 4PANA 4UNNA 4GT1A 4TSFD 1YRBA 4IDOA 1II8B 2GEVA 2RKOA 1X86B 2A9KA 3EC1A 3B9QA 3FE2A 3LDAA 4QHSA 3VKHA 1KAGA 2ZI7A 4PAOA 5IK2A 4MDEA 5SZJA 3DKVA 2ZS8A 4HUQB 5DHFA 2A30A 5KDDA 1CP2A 4D80A 1E1QA 4BWYA 5JLJA 4PO8A 2EFDB 1FQKA 4BFTA 2IYSA 3KB1A 1L2TA 3NC0C 2AFHE 4NP6A 2NO7A 4PZYA 1DAMA 4C0LA 4U7DA 3P27A 4LZZA 1X8LA 3IHWA 3BJIC 2RHDA 4PHGA 2WWYA 2IYUA 2IHYA 5BN4A 3R20A 3RNLA 2VP0A 1PZNA 3PEVA 2D2FA 1SVLA 3E5HA 1EESA 3QBVA 2RGNC 1RRPA 2KBEA 1WQ1R 4XIGS 3SFZA 4DSNA 1DAIA 3PUWA 3VTKA 4Q66C 1E1QD 1CTQA 3BFXA 3TK1A 2GRJA 2XB4A 1DO0A 3RHFA 2ZRBA 2HLDD 2R6DA 3IILA 3RRMA 5JHHB 3BS4A 4DB2A 1KO5A 2JGNA 2GBLA 1RIFA 2NO1A 2CE2X 1KDPA 2DWOA 4GZMA 5JS7A 2IF0A 1FMLA 3ONWA 2BBWA 4IEEA 1B0UA 1SQ5A 1UM8A 3IHLA 3MMPA 2IYRA 2CLDX 3QKTA 3WRYC 2A5GA 3PIRA 4C0HA 1W5TA 1XD9A 2QROA 5KUTA 1AS2A 2OHFA 1I2DA 5H1YA 3AM1A 4I1VA 3CX6A 1KI6B 4EIWA 1Z2CA 3Q85A 1N5KA 2XSZD 4A9AA 3PUYA 4MYCA 4M4SA 2J0UB 3W5JA 1L8QA 2OLKA 3CH4B 4NH0A 3D7MA 3OE7A 4FXPA 2XTNA 4AI6A 1G3IA 1EWQA 3GLFE 5KPDA 4MRVA 4OYHA 2LWIA 4C0SA 1OLOA 1BIFA 3EZ2A 2QE7D 1BMFA 2OFXA 2ZE5A 2KJQA 5FI1B 5UKDA 1KNXA 1U98A 5TVKA 2I3BA 2DFTA 5A4JA 3NVAA 3DOEA 2EFCB 4M9XA 4B33A 1VG9B 2B21A 2AL7A 3GJ5A 5LD2B 3K0AA 5CDFA 1R7RA 4BFWA 2VF8A 4RSGA 4LBVA 2JDIA 3K09A 1G1MA 1T8UA 2D7CA 2Q9CA 3S1AB 3ZZUA 4F4JA 1VIAA 2HLDA 4YLGA 1SVMA 3UMRA 5IF9A 1E9BA 4PR0A 1ZJ6A 3RWOA 4EQ6A 3GPLA 3ICQB 5CLLA 2YOHA 3TKLA 1CF4A 3O8BA 1TF2A 3I92A 4D4KA 2VYFA 2QSYA 4WW0A 4JLKA 2C98A 1T5IA 3MRSA 1KI6A 3AEZA 3SN6A 4HB2A 2CDNA 1E4YA 4Q9LA 1EGAA 3EPHA 2QL6A 2R6AA 2DHRA 1XBTA 1X6VA 4IOMA 5HE9A 4QBHA 2CE7A 3FHTA 3EZ7A 1AGPA 5JCZA 1KGDA 1ANKA 5JEEA 3U6KA 2HYIC 1S1CA 4BZPA 2BM1A 5GJVC 1VCNA 3RC8A 2JLQA 1W36C 2JLVA 1BOFA 3QBTA 2IC5A 1KMHA 2UKDA 1G64A 4KI0A 3CW2A 1N6IA 4JVLA 1KI4A 4URZR 1JR3D 5BYJA 3H86A 1UDWA 2BOVA 3E70C 3PV0A 5CYPA 5AK0A 4AG6A 3ZZ0A 1MT0A 1E2IA 2X77A 1KO7A 1U90A 4NDZA 1QHHB 5KNDA 3VNUA 2IEZA 1Q3HA 4RCZA 4JL8A 3ZLJA 2G77B 2BIFA 2ONKA 4RD3A 3IQWA 1LW7A 2E1RA 4JL6A 4YMTA 2QM7A 3AF4A 1OH5A 2AXPA 5KSZA 3P4XA 1D2EA 1N5LA 1YVDA 2V8OA 4A2PA 3LVQE 1TUIA 5CLQA 1UEJA 1XZPA 1XF9A 3W90A 1JPJA 2BKUA 1F6BA 3QXJA 1OW3B 3M1IA 3V9PA 1VG8A 3VR4A 4ZCIA 4HAUA 5EXSA 4TWZA 2D62A 4JYCA 1ZU5A 4YMVA 2OE2A 2FNAA 2YWHA 1P9RA 1G7RA 4L8GA 1VG1A 1HTWA 4WA7A 2OCYC 2PT7A 1NLFA 1G8HA 1G3RA 4E22A 2OXCA 1G8YA 2PJZA 4OQFA 1NVUQ 2D06A 4ACBA 5K8TA 4X8MA 4ZI3A 4M1SA 1NSFA 4HSEA 1R8QA 1XTRA 1Z0JA 2C96A 3KX2A 1J70A 4OK6A 2J87A 4GSYA 4V0ME 3WP1B 4TYWA 1UADA 1KZGB 4CEJB 1U2RA 2JLRA 3KL4A 1DAFA 4Z8XA 2QNRA 3CPHA 2ERXA 2C5LA 2WSSD 1VHTA 2QGZA 3AVPA 2HF9A 1IY1A 1XEWX 3SHWA 4MDFA 3AV0B 3LWNA 4NCKA 3DHWC 2PLRA 4DZZA 4W7SA 3WBJA 1FW6A 3L2OB 3P4YA 1A2KC 4AC9A 1JEEA 1GNQA 2WJGA 3K70D 3THWA 1XEXB 3U44B 2IXGA 2ZPTX 1XU4A 2J9RA 4LYFA 1Z06A 1IOZA 2MSEB 2RB4A 1W36D 1S8FA 5EUMA 2V55B 4KYUA 1E9AA 4CF7A 2RGBA 1N6PA 4HAVA 1XXHE 3KQLA 3B2EA 1UPTA 5AUOB 2QZ4A 1VCIA 4B76A 4L9SA 2CNWD 3C5HA 1Z28A 4B34A 2WPDD 5EE3A 4RFSB 4QJ4A 4FI3C 3AH8A 4PPNA 3A1WA 3TE6A 2P0EA 4QGHA 1AKEA 5GJCA 1NKSA 521PA 4TL6A 1IN6A 1G20E 4D2IA 1XXHA 3A1VA 5DI3B 4TT3D 1CRPA 2CEAA 3F0TA 1ZC4A 3GJ4A 4L4UA 1XMSA 2ZM5A 1YRAA 1QHGA 5FL7A 2FEMA 3AGPA 2RGNA 5FUYA 2IUUA 4B6EA 2YWEA 4QJ3A 1QG2A 1H8HD 2J7PD 4KSBA 4Q00A 5TARA 2J0SA 1ONBA 2BV3A 4M0LA 2Q3FA 2C2HA 3B60A 3QG5A 4I99A 4M1WA 2FA9A 3LVRE 1JPNA 4A0GA 1ESNA 2IA5A 1G7TA 3WBKA 3LXXA 3VHXA 4DT1A 4C0JA 3SYNA 1UBFA 4OI0A 4F4CA 4U5XA 3EG5A 1I4DD 4UNSA 2KB0A 5J4YA 5JFGA 4D25A 1GL6A 3VKGA 3R7WA 1Y63A 2IF2A 1D2NA 1OJLA 4Q47A 1ELOA 4QOSA 4MYHA 3CIOA 4AKIA 4E03A 3OIUA 1ZM9A 4G5GA 2PMDA 2OV2A 2C99A 2W6IA 1PVOA 4Q4JA 2N42A 2Z4SA 1KI9A 3VR2A 4WVFA 4DIDA 1KO8A 3RRYA 1T9HA 2WSMA 4A6PA 1OF1A 3OEEA 4DLVA 4Q01A 3DVLA 1UF9A 2L0XA 2VH5R 4MGZR 5DH9A 2G6BA 1Q1ZA 1Q57A 1V5WA 1OFUX 1GVNB 4M9QA 1KNQA 2WWGA 4LGMA 4Q7LA 5G53C 5DLQC 4BZXA 1T5LA 1GG2A 4K81B 4UNRA 5GVRA 4DSOA 2GZDA 5IK2D 2BKEA 4UQOA 3AF0A 5JRJA 2W6ID 3SBEA 2QAGB 4OL0A 4G5QA 1AA9A 1C9KA 1T3LA 4PX9A 1EWRA 3C7KA 2HJVA 2RGGA 3KFVA 3TUJC 2AR7A 4JZKA 5D3MB 2ZE7A 4DBLC 3U4QA 1VPLA 2C03A 1YZUA 2FFBA 5DO9A 1CR4A 1U8YA 3TR0A 3I5YA 1GWNA 1JQLB 1TU4A 4TMZA 3ZD6A 1KZ7B 3QSYA 1TF5A 1NBME 2YOGA 4K46A 5JMTA 3PVSA 5FPKA 3CLVA 1Y3AA 4OQNA 4CEJA 3C16C 5BXQC 3CB4A 3GJ3A 5J4LA 1PLLA 1G41A 1P6XA 5KNBA 4XJXA 2OXRA 2GXAA 4EKDA 5JRZA 2WJHA 4JBYA 4LHXA 4ZIRA 1XTQA 3UPUA 3A1TA 1NLYA 4FD2A 3HU2A 3ZVNA 3BGWA 4QGAA 4LPSA 4Q4HB 2IWRA 1UEIA 4CT4B 4IXMA 2QEQA 1NBMA 2NG1A 2QAJA 4MGYR 2DFNA 3GJ7A 2IHBA 4JSTA 4TTPA 1RZ3A 4IVRA 5C46F 5H68A 2GNOA 3AVWA 1KK2A 2ZR7A 4Y0AA 1XMIA 3QE0A 1L4UA 1E2DA 2IUTA 1AS0A 3I5XA 5DSZA 2XEXA 1P75A 4Q7KA 3OHMA 4JBXA 4BLSA 2WKRA 2Z5FA 3CM0A 2HT1A 4Q4LA 2ZI4A 1KTVA 4PO1A 2ZRLA 3W8NA 4V0LA 4ASUA 2LKDA 2JJ1A 4JLBA 5TY0A 1E2PA 3EASA 3CF0A 3KTAB 4XSGA 1XXHB 4WAUA 1D8TA 4IVPA 4C2UA 4Q7JB 2WMOB 2ZANA 3L0OA 1P4SA 3KKPA 1A82A 2C77A 3N2IA 1UKYA 3CX7A 3EPJA 1T0JB 3CWZA 2C78A 2J59A 4UNQA 5DNYB 1J8YF 3U7GA 2WKQA 2CK3D 3LLMA 3ND9A 1BYUA 3C8UA 1KMHB 1Z6GA 4TQUS 4YONB 1U81A 4G01B 3UG6A 3X1YA 1F2UA 5F3WB 1VCMA 8OHMA 1DBSA 3PG5A 4A6XA 2IYZA 2ZJYA 2GXSA 3GLFA 1IY0A 3U3KA 3GLGE 1GDDA 2A5JA 4MRSA 2ZRFA 3EAQA 3VAAA 4US1R 4UKDA 1XWIA 2K5UA 3I32A 1N0UA 4PSAA 4Z8YA 2WVJA 3THWB 5FOSA 4YXWD 4KBFA 2FPLA 4ZV4A 1S3SA 1PV4A 1GSIA 1F2UB 3FKSA 3C4JA 3AVXA 4HLUA 1DVRA 1ZM2A 3IEUA 3X1XA 5E3HA 1RPZA 5J4VA 4OHYA 3LX8A 4DCTA 3NDPA 1QZXA 4JKYA 5FPTA 3K09C 3AKDA 2EU8A 4MGKR 1XB2A 1UKVY 1Z47A 3QG1A 1X8JA 2D4HA 4XD7D 5JZVA 2H18A 5HZKA 4A2QA 4M8NE 1YZKA 3IIJA 4FCWA 3SQXA 2NMVA 2F1IA 3ZIAD 2HCBA 4B71A 2G0TA 1E1RD 2B7CA 3ZVLA 4MRPA 3AVYA 1GRNA 1UKZA 3TIFA 3DPUA 3OEHD 2P67A 4NMMA 1VHLA 2CL7X 2R9VA 4UJ5A 4GPTA 2O8EA 5JJLA 3B82A 3ICEA 4QG7A 3UG7A 3IGFA 3THXB 1RJ9B 2QMHA 3L0PA 3SYLA 2TMKA 3QKSB 5DHAA 1S4QA 3FKQA 4GRAA 2H92A 5AJVB 1G4AE 3F3YA 3RABA 1NVVQ 2VLIA 3KJGA 3NH6A 3HPQA 4GFDA 3T35A 4UNPA 3U2QA 3VFDA 5LB2A 2OCAA 4B43A 1G21E 1RW4A 2EFGA 2J0UA 3PEYA 2VEDA 2QY9A 3MWKA 3P20A 4DLXA 5AJYA 5H70A 1XD2B 4NYIR 5JWOA 3IO5A 4Q4AA 3QXSA 4XD7A 1XPOA 1M6NA 5SZKB 2PZGA 4Q19A 2OG2A 2H1LA 3FMIA 1DADA 2G9NA 3PR1A 4BQSA 1E2LA 3IIKA 4TZ0A 3CF6R 1W44A 2ZRKA 1KK3A 1SKYB 4GBMA 3K9NA 1HY3A 2AKYA 1CR0A 5DYGA 1JEDA 3CNNA 3T12A 2AFIE 1J2JA 2OBMA 4X8LA 1W49A 1EX6A 1FTSA 5EE9A 1T8TA 3QI2A 2QN6A 3C15C 4I1UA 5FPHA 3HP1A 5EP3A 4LHYA 1E2JA 2ZEJA 3UATA 1ZBDA 1OIXA 4NE2A 4UXHA 4DCNA 1W0KD 4PHHA 2ANCA 1ZP6A 1XCGB 5C2JB 3TUZC 2X19A 1MO4A 2JDID 1XJCA 3HPRA 3KKNA 3OFND 4C0KA 2JLUA 2UVQA 2ZUCA 4B2IA 1H8EA 1EFUA 1H65A 4B3GA 2ZRPA 4L9WA 1C4OA 2Q6TA 4PPQA 4WZ6A 2R8RA 2G1KA 2G3YA 1QVAA 3NEJA 1R0XA 2BJVA 1IN7A 2ZRAA 3A4MA 1MABA 1WRBA 2OCPA 2ZI6A 1IXSB 3I8XA 2W00A 3CR7A 1JR3E 3G5UA 2J3EA 4F38A 2F9MA 2CMKA 1TX4B 3R7WB 1ZMXA 2MMGA 2QP3A 4BFXA 4U00A 1GNPA 1T3SA 3GLHE 5B64A 5M04A 3AUYA 2YC2C 1R5NA 4HI0E 3WXMA 2EW1A 1OXUA 1GP2A 2OT3B 3EIQA 2V9PA 4HLUC 2P6UA 4MH0R 1G3MA 2IYLD 3P26A 2XJ4A 4G5OA 1N2CE 1E94E 4V03A 1HQYE 2W0MA 5FOTA 5A0FA 4P31A 4PTLA 5SZHB 4B2PA 4E09A 2QUZA 3QVUA 1FX0B 3HYTA 2AXNA 2GZAA 1OE0A 2IXEA 3TW4A 3W9YA 1WB9A 1S1MA 1E6CA 1WE2A 3CRW1 3E2IA 4NYJR 3KQKA 2YVUA 3K0FA 3CPJB 4BFZA 3GLGB 4A36A 3AVVA 3AP3A 2QBYB 2Z6VA 3ADBA 3T61A 3JZMA 1QHYA 2VP4A 2O8FB 3ZQ6A 2GHIA 3TQCA 1EK0A 1E2MA 1E79D 4O0MA 4FN5A 1KSJA 2QA5A 5EXXA 4ZKEA 1H8HA 2J7PA 4KV9A 3T34A 3EZ6A 4Q9HA 3KKQA 4BFVA 2BCGY 4LV6A 2Q3HA 4DDVA 3ZZTA 3RS7A 3SJZA 5KNCA 5KOYA 1QRAA 2EFEB 2R6CA 4KU4A 1BO6A 4NCNA 1KDOA 5KDLA 2A2ZA 2AWOA 2ZU0C 2V7QA 2B8TA 2RGXA 1DEKA 3WYGA 4DC9A 1RYFA 3SI7A 5KO2A 3K0EA 1E9FA 1VYVA 3MUFA 3W5IA 3X1WA 2ORWA 2ZR0A
chains in the Genus database with same CATH superfamily
1DJNA 3HSYA 3U44A 2ILTA 2W6JA 5FF9A 3VU9A 3O0DA 3RRZA 4IY1A 2VDMB 2XUOA 3FDXA 3FW1A 4PHCA 5JT1A 4DREA 4WI1A 1FBNA 2GXQA 5K6AA 1VPVA 3GMDA 4MYSA 5LYYA 1YNOA 4XR9A 5CNIA 4OXXA 4AMZA 1EM6A 1Q0PA 4DWWA 3L7BA 3DT6A 3OD5A 3KDSE 1GKYA 2P35A 3O4GA 5HJ7A 2HT6A 4L74A 3IBTA 3NHBA 4YA6A 5KS2A 4QFBA 2OGZA 4DSUA 1G20A 3NIDB 1KDVA 1ZS9A 3V7NA 1Y9ZA 3ZD8A 4NONA 3DLCA 4HQ0A 3ZGXA 4DWOA 1BTOA 1OWLA 2CNOA 4REQB 3OIFA 1ZK4A 3Q10A 1ENOA 3P71T 2GILA 1AHIA 3HG7A 1MOQA 4ISBA 4XGNA 4ODIA 3GPDG 1OLSB 2II6A 4O8ZA 4XTCS 1WDTA 3G2QA 4H3HB 1CG6A 3OLCX 5DVZA 4CQLB 2JLCA 4DBZA 4HH0A 1ZGCA 3I5YA 3K5WA 2GDJA 1P3Y1 2GYYA 1GGVA 1WXDA 1Z83A 1ZHFA 4MKFA 3EA4A 3BH6A 1AZLA 1J2YA 1LJLA 1UZAA 2JI8A 3AY6A 2VHZA 3H1TA 1GTZA 3M89A 4NZ9A 4TXJA 2OXTA 4A8PA 4BMNA 1U7XA 1YBVA 1UFQA 2JIRA 5IDVA 3WLMA 4RCYA 3M5WA 4TV8B 4OQXA 4JYPA 5L8VA 3E7DA 4FKBA 4KPUA 2V3WA 3B5EA 2XUDA 3M4YA 3ES9A 2OXFA 3DV0A 4WUVA 5G4KB 4MA4A 4PYJA 4PIMA 2AJTA 3AL3A 3VVCA 3EK2A 2QZPA 5AIAA 5AOAA 2Q1TA 2QPTA 3DUFB 4HAZA 1AZTA 5ALSA 2FMXA 3M6WA 3LUAA 4GEKA 4KQKA 5C4GB 2CZQA 3TRKA 1CPYA 4IMJB 4BEBA 1DRWA 2B8EA 3EULA 3FAKA 1EUCB 4L15A 3LDGA 5JNRA 3OPQA 1ZGZA 4U2CA 4GSLA 2WABA 1XK7A 3L8FA 3MMNA 3P19A 4HDSA 1VG0B 4Y9RA 5D1NA 5KYXA 5FWYB 1G42A 3IO3A 5HIJA 1XI2A 4N0PA 3ABRB 4D4GA 1EVEA 3DT8A 2XWQA 2YV4A 3ND6A 2XIQA 4YCJA 1VE9A 3BILA 1JWAB 3P5BA 3TOZA 4LXHA 1WJGA 1F4LA 2WJYA 3AEYA 5BO5A 4AYTA 4RKRA 1R0RE 1CQJA 4Q1VA 1U0LA 4F1JA 5EA2A 5F52A 4ZOLB 4M98A 4YCCA 4UASA 5DTQA 2GK7A 1A5AB 2GBPA 3W7VA 3H9JA 4F3RA 5F51A 3LX5A 4JYBA 4GMFA 3S2UA 1NLZA 3A31A 1A4UA 3W8NA 1QYVA 3Q72A 3FPFA 4X90A 1E6WA 1HV8A 1P1CA 4AF6A 4DQXA 2HTFA 3NHZA 3MT9A 2XB6A 1JNXX 1SFRA 5K4AA 2ZJBA 2QTCA 2VQEB 3AF6A 5AYVA 1O3YA 3I1IA 1X7WB 2FJUA 2QRQA 4J75A 3WE7A 4ZDIA 1K27A 1W5SA 2J45A 3BGOS 5CGZA 3EQ9A 5JIBA 2KI5A 1MVLA 1PR2A 4BUCA 4FZ5A 3WLQA 2GASA 5C52B 1C41A 2WM9B 1CETA 3FNGA 1KJZA 4E5MA 1SEPA 1N4DA 2GJKA 1NU8A 4BLRA 5KNBD 2B5VA 4M3NA 1JJIA 1KEKA 5K6RA 2D59A 3G88A 3K2BA 4LZPA 4WFJA 4R9NA 3STUA 5DK4A 5BNTA 2QE6A 5J4HA 4P3KA 1LD3A 4PAMA 2KSQA 5A0TA 2IH5A 3ZQUA 2AFRA 5IVIA 2Z83A 5DCYA 4B4DA 4YS6A 4KSCA 4E5YA 2Z08A 3FSRA 4FBGA 4WOPA 5LZ8A 1L7RA 4EW6A 4RJTA 5IZ4A 5KSPA 2HBQA 5EKXA 1ZU4A 2HMUA 3TAUA 5E1MA 4BVAA 4CV0A 4P93A 3AEQB 3CPEA 3NAQA 4JKOA 5H7XA 4S04A 2X9GA 3FYHA 2PO5A 5DTJA 4ZCTA 1XJ0A 2C07A 5FLKA 3PCRB 3UGKA 2DR3A 3DDUA 2NYUA 3A4YA 5DWDA 3ZE2B 1TVKA 5BT8A 1YMQA 2B4TO 1B1CA 3GZNA 3KQQA 4QJ5A 4GUDA 2Y0BA 2ZYVX 3WQQA 3PWZA 4E11A 3R0JA 4BFSA 5JZBA 4DEYA 1XQVA 1M2VB 1ZUNA 1XN1A 2AW5A 1SULA 4XTRA 1U8UA 4V2IA 3CNOA 4YAGA 4LMRA 3EGXA 2M2IA 1GADO 2OKGA 3NZEA 721PA 1QIEA 4TSKA 4YT8A 2WJVA 3DMPA 5AHWA 4B6OA 4ZQFA 1OH7A 3A26A 2B4KA 1T8YA 1CR6A 3DOHA 4FFSA 3CLTC 4G56A 4WEOA 5G1PA 4FS8A 3QWFA 4MGHA 4E88A 3HCDA 3R3HA 1LLCA 2FWIA 4MRMB 3L6UA 4JR1A 5FUQA 4Y7DA 5DIZA 1WVGA 3HY6A 5A5FA 1KBZA 3BPSA 1VYUA 1NHWA 3A9SA 1GRVA 4UDOA 2JZCA 4P3XA 2DHEA 4UM7A 5AK5A 4K6GA 3T3GA 5EP1A 3H0EA 3SZUA 1E1MA 2QMUA 4ZPXA 2BPOA 2B1IA 2MINA 5FI3A 4E5UA 3PC8C 4HSGA 4XUGB 1G7CA 3EF3A 1XRSB 1KKUA 1PFGA 1QWOA 2IOFK 2FN9A 1ODKA 4F1KA 3FFAA 4AW9A 1FE8A 1KA9H 1JMKC 2YXEA 3N9IA 4L5BA 3GLUA 4CTNA 1SXIA 3GD7A 3C7CB 1VLVA 2YFYA 4UPVA 3TPZA 3I2JA 3EFBA 5COAA 4CF3A 1W4LA 2ZJ0A 1KC1A 1NYQA 1SD1A 3GELA 5AI4A 1WG8A 1IPEA 1POXA 3C24A 1OWOA 3IE2A 4ZQBA 3LW8A 2XXAA 1K6IA 3BCHA 3R0XA 3EEBA 1HA3A 2V0NA 2ODAA 3BFPA 3HZOA 3IBCA 4J90A 2F59A 1RI5A 3N8DA 1XCOA 2HFKA 1YB5A 4HWKA 2KX7A 5F73A 5IAGA 3WGYA 1AKWA 1MOZA 1KYXA 2G36A 3CX8A 4EY4A 4M0EA 4YQZA 1QRRA 2GJ8A 2XUAA 2FQYA 3LUJA 4FFPA 4IQ4A 4ZVQA 5JE8A 3SF8B 3M6IA 4J4BA 3SLRA 3ZV3A 3QVLA 4MWBA 2N46A 4D4LA 3E8XA 4QU9A 2R6GA 4K8RB 4J76A 1RWVA 3R0ZA 4ZCSA 3CVYA 4Z4HA 3N2KA 3LP8A 2QE7A 2NZ2A 1R0YA 5KJ6A 4DRYA 4POAA 3JAKA 4YT5A 3GT7A 4V0OA 1M8GA 1NONA 4Q9AA 4WZAA 2P3SA 2HJGA 2CBXA 2AUTA 2PA3A 3EZ9A 3L1JA 2RAUA 1HI9A 5FOVA 1QU2A 4IUCS 3A58B 3CWCA 4I4NA 1VBMA 1QRTA 1E8NA 3FB1A 5A9RA 2WSLA 2Q1YA 1ZYUA 1ISMA 2QDXA 2XYHA 3Q7PA 5DASA 1Z62A 3WWDA 7MHTA 4PC6A 4EH1A 3OQMA 1Q3TA 1G6KA 2RB5A 1BDBA 4B09A 2PRJA 3NYIA 4PNPA 3RFCA 3PC4A 4CUZA 1XNGA 2O8DB 1MOPA 4I19A 4MWTA 4GI2A 3KWFA 2FN4A 4HKTA 2PXXA 1AURA 3F96A 3CLTD 3OM8A 5EJIA 2PIAA 5HJ2A 5LSAA 1TFUA 3LCMA 3SXUA 5IEJA 2PSFA 4MIYA 5BWNA 3RK0A 3WLTA 3HUEA 1NV9A 1KYQA 3BGSA 2A9JA 3T9FA 1PHPA 1QORA 4HNGA 4ND1A 4PCVA 5EYPB 4I1OA 1ZIYA 4ZICA 2GN8A 4XKJA 4YCBA 5AHXA 4G65A 3HA5A 4KODA 3FJ1A 5A2QA 3FPLA 5ALRA 3HVUA 4L75A 1JKIA 3UJCA 4B2YA 2I8AA 3TBHA 3ZE1B 2ZYUX 4LCBA 4DSTA 1XA3A 4L8WB 3JR7A 1OHHD 4U9IS 4XB6B 4W1SA 4M0KA 2EFHB 1S6YA 1U2ZA 3DAGA 4JR0A 4KE6A 1NRWA 1XZGA 2QRLA 5A71A 1N9KA 4MLZA 4PZ0A 1FYVA 4CCYB 1ZWKA 1PT8A 1DFGA 1XKLA 2C0QA 3QFTA 3HI6A 2X4GA 4MP3A 3GLIA 2WD9A 1NM5A 4B6QA 3N2KB 1CW2B 4WNAB 2QQ5A 1GXSB 5K1ZA 2QG6A 1EG7A 3C70A 4IINA 1JFVA 5CYFA 1YZLA 2YZMA 1OXBB 5F78A 5JROA 1MX9A 1EJBA 1KZYC 2C0PA 5ES3A 3T7RA 2DEUA 2I3ZA 1DTSA 1ZVQA 3C3MA 1AGNA 3V3KA 4J0JA 5EJ9A 1V3QE 3ABOB 1G17A 4BX3A 2L17A 1GTG1 2O3RA 4NAVA 4UBMA 2B36A 2WT4A 1JFLA 3A6ZA 4H6PA 3R09A 1AUXA 4FMCB 1CJVC 2XBMA 1V71A 3RVOA 1JQDA 1Q1EA 3LXRA 3F1LA 3KXDA 2UDPA 3DB2A 2BTQB 3E61A 3JX9A 3MXOA 4L08A 4N6NA 4Y1FA 4E7OA 5INTA 2NIPA 4B6SA 2DPLA 2EW2A 2J9FA 2W93A 4AS3A 2JG3A 1CK4A 5HZMA 1T2AA 3OPYA 3V42A 3BEOA 3PHHA 2IXTA 1Q15A 1V4NA 3ZWPA 5JJCA 4D3YA 1NN1A 2GN1A 4E14A 2RK6A 4MUMA 2H1RA 4ARUA 2BFWA 2JJYA 1Q0HA 5J40A 4MV0A 4Q1AA 1ZI9A 2IYYA 3R3WA 2QNBA 2IP1A 1M7GA 3ZBPA 4EJ2A 4ZVTA 3TD6A 3PGVA 4W1RA 1V4BA 4BV8A 3CSDA 3JW8A 4IDCA 4EARA 3MMSA 4ALIA 1KETA 2WWXA 2X8BA 4F6RB 2I4TA 3RARA 3K9HA 4B4KA 3REOA 2CF5A 3DBOB 1V1RA 1E0SA 3RVJA 1U0FA 1XCBA 1HL7A 4HYEA 4RAQA 2AKAB 5AW7A 1D03A 4JLMA 2UXBB 3L7JA 1XFAA 2QR5A 3QVKA 3UXYA 1OWPA 2AQIA 1CR1A 1UPCA 2IEIA 3AM3A 1SZCA 5D5PA 3EGEA 5IMSA 1KJWA 2VPYA 3EPPA 1E2KA 2VXCA 3BDVA 3T9DA 4PYRA 5KAPA 4BBAA 2X1HA 1WHTB 4TL7A 3F4BA 3KWLA 2WOOA 1E4EB 3QXHA 1IULA 4P3OA 3TDNA 2QF7A 2WWHA 3PPXA 3RYIB 2ZZMA 2YWBA 2Q50A 3B2QA 5HP4A 1T9GS 3L8MA 2MTBA 3WA6A 1LS1A 3OQPA 3MHPA 4RKFA 5ADHA 3PRYA 2PT5A 1Z0KA 3DAPA 4F4UA 3JARB 3BMNB 1CUVA 2EKQA 1QP0A 1OVGA 2NUPB 4Y0VA 4X8OA 2C7PA 3ADCA 2EZ4A 4X84A 1XWFA 3ISTA 4RVSA 4BNDA 3P2JA 4RPIA 2RGYA 3OESA 4ZVPA 2XD4A 5ALLA 4ZMRA 1CUGA 5K6TA 5JBQA 5KNCH 4KMMA 4UXJA 5CK4A 1B3RA 2B94A 3LRPA 1WBDA 4BO4A 2YVQA 3HADA 4V38A 4YBRA 5GTDA 4NWIA 4J0GA 2HMVA 2OGTA 3BIXA 4M6WA 1ZK1A 3K0HA 1WPXA 1Z4NA 3ANTA 1EUDB 2QR2A 3MRTA 3DNMA 3KTOA 1PR4A 1UM9A 2QP9X 4DYHA 4OSPA 1EHCA 3O8CA 1ZUHA 4XDHA 4ZCMA 2PGLA 5KX5A 3CF4A 4HH3C 2DQ4A 1I10A 2F67A 4DG9A 1M0EA 2XV1A 3SSOA 4BPBA 1EFRA 4H7EA 3TW8B 3OKFA 2PS0A 1XQYA 4MAAA 2WUFA 4WZBE 5FL7D 2AGVA 2FLKA 4RMHA 3IXLA 1OB5A 1ACJA 3SNHA 2PGJA 3V2IA 4BE4A 3I09A 2J09A 2BFBB 1NBMD 3VR4D 3RQIA 3B5IA 4XPIA 4EUHA 2ZKLA 1VSVA 3WISA 4CLEA 1L9XA 2R8ZA 5CA1B 2IOHA 4IIXA 2IV3A 4E0BA 3O5AA 5BWBA 2FXVA 2HA7A 4F04A 3BK1A 4U7PB 4FUQA 5JLAA 1Z2OX 2FGKA 2IEBA 3CV3A 3IUYA 5FIUA 4F92B 4LJ6A 1PK9A 2CNWA 4JHXA 2YKGA 1J5XA 2Y1KA 1TC1A 3EYWA 1DO8A 1HFJA 1JAXA 1LS6A 1LPPA 1NJ6A 1ZGHA 4JUIA 1ZDMA 1MJ5A 4MB0A 5AK6A 1DC6A 1XF1A 1Z0IA 3HSKA 1X2BA 1OSNA 1Z88A 5DGIA 4Z9YA 1AK2A 1U1FA 2J32A 2LP4Y 4JXXA 2WHQA 3L8HA 1C0EA 2MDTA 4R05A 1ZH0A 4QM7A 4V0MA 1XTSA 3TLBA 4LYAA 4HWOA 3OFVA 4XYGA 4ENTA 1W0JD 3VOTA 1H93A 2H11A 1WPGA 2BGKA 3OLQA 3EZLA 4G67A 3T99A 2LTAA 3TKAA 3U4GA 2E5WA 1MLDA 1VLMA 1JE1A 4PRLA 3HI4A 5B3AA 3B7GA 3FROA 1ENZA 5I9NA 2RGDA 3E7WA 1JYEA 1A8HA 3DVAB 2V5VA 4BHTA 1VBNA 2GAJA 4E3WA 2VF7A 5A9SB 3UMJA 6NULA 4IDQA 2BJHA 2P9ZA 1CVLA 3K8YA 1I0ZA 3KJIA 4C0AC 1D07A 3IUPA 5F2KA 2I33A 2JHAA 2R66A 4S1PA 2FUG6 1BRMA 2YY6A 3NETA 3ORFA 1LC3A 1ECPA 4IO0A 4LHVA 4MV7A 4Y2PA 1KVQA 3LDHA 3DLTA 4XVUA 1CYDA 3E9RA 2PMFA 1YS6A 5EQJB 1VLQA 2QAIA 3DBLB 4Z2YA 1P2VA 1UXGA 1RC8A 3QXCA 2DWPA 2O8CB 3FGZA 1PFVA 1N5OX 3M9XA 4PYMA 2WT9A 4LKOA 1V3VA 4KDFA 1MTZA 1SBZA 3OM9A 1G19A 4IG9A 3SQLA 1GGJA 1PJ2A 4H1VA 3LO8A 4B4VA 3TSCA 1GUZA 2WPDA 5JOQA 3ELWA 4O4JA 3FCAA 4TSFA 1V39A 4BQOA 1YHZA 4XSHA 2PMKA 2V54A 1K5PA 2CMDA 3F7OA 4N7RA 4ABTA 1MABB 4HWGA 2NX2A 2GN4A 5GONF 2G72A 3VJMA 1XQ6A 1BS1A 5FBVB 4RVUA 4ZU1X 3J81k 1O97D 3E8SA 2QN8A 4FS3A 3LQ2A 4RGQA 4W5OA 1FP1D 5K4GA 1FTNA 1EK2A 5TV2A 1EZ1A 3JQFC 4M1TA 1SO8A 2H4JA 2E9SA 2FZWA 4NPAA 4QDUA 2DMRA 4FK8A 3NVDA 5BOSA 1DQSA 1P72A 1VMEA 4RFVA 5CT6A 1IBRA 4D7AA 1UBSB 1ONPA 3ENZA 4MSUA 2XAUA 1TZBA 3RU7A 1M8PA 2YYZA 5LMUB 3HBFA 1YUMA 2AOXA 3K5PA 4WCFA 4HV4A 3O8OB 3WDMA 2XQJA 1XPJA 2Q4EA 4NMXB 1PS0A 1T6NA 3DL2A 3GCGA 5TXGA 4O2AF 3F8WA 5DM60 4QTYA 3GA7A 5JAHA 1SCAA 4PFKA 1XDBA 4H27A 3EPKA 2LRHA 1S3IA 1CJSA 4B3DA 4B3IA 4LI3X 2WB2A 2QK4A 2X9NA 4PAWA 1C9YA 2WHPA 4YJ3B 1HE4A 2LR0A 1BKDR 4PHFA 1UZMA 2ONZA 4JYZA 2ASVA 2QL5A 5JNVA 4ALJA 5IHPA 3EISA 4HG2A 2QTGA 2RHHA 3K0KA 3AR2A 3GN2A 3MGCA 1XCPA 1SKAA 1U3CA 4BNHA 1EFHA 4WK0B 3R5JA 4KXFB 3FWZA 2ID4A 4FU0A 3FWYA 4L9AA 5KYVA 4XA8A 2H7YA 5MN6A 2GYUA 2PCLA 5TDHA 3BHIA 2IZZA 4YV7A 3LWZA 2BFCB 3BE5A 5FWNA 2IBMA 2R8OA 1S2NA 2WHXA 4L8LA 4LV8B 3JTEA 1M6VB 3FR7A 2OUIA 1OI4A 2TMYA 3QM1A 4HH1A 3VR1A 4CRWB 2Y2VA 4O4LF 4YAWA 3FRJA 3R3VA 4BGIA 3O75A 4EHBA 3MJRA 5K7SA 3U3ZA 3IUEA 2PCJA 4ZALA 4Z7OB 1JR6A 1PFUA 5LCXA 1W4RA 4TVKA 2HXYA 4F4IA 4LXXA 4X24A 2WAMA 3V8NA 5LD2C 1CYEA 2W42A 2PX3A 1CQIA 3KUCA 4DM7A 5EHZA 2O8BA 5EXDA 1N36B 4KXWA 1DXHA 4PU0A 3VR0A 1N5MA 4I4TA 1NMEA 1XAHA 2Q5HA 3JQ6A 4KWHA 4TLLB 1BMDA 5EFOA 3ZZ1A 2IZ0A 3WB2A 1O54A 2X5JO 2ZRNA 3U0VA 2XT6A 2FPKA 2WFLA 4AT1A 4INPA 5EJEA 3IDQA 3FSGA 4AJNA 1ETHA 4GXTA 2HXSA 1F6DA 1XRLA 2WICA 4UM9D 2WWWA 3WWCA 3O90A 4TXHA 2X6RA 3E27A 3NDRA 3QBEA 1YT5A 2V6IA 5KVCA 2G4LA 3B85A 2QBYA 1ETUA 1UCFA 3ILHA 3V3TA 4HDQB 4GE0A 1NQAO 4ZOLF 2X1LA 5E8RA 3U7RA 4TUYF 1TYAE 5ECGC 4WLEA 2QTWB 3ICVA 4FN4A 3DZFA 2ARKA 3EVCA 4ZHSA 4EFKA 3QPWA 1DKNA 3GFTA 2O5VA 3TPCA 3JQ7A 4LJ8A 1KQNA 2DPMA 5CB8A 5L40A 2AN1A 2VWQA 4KK3A 4R7TA 1D2MA 2ISSD 3ZTYA 1J9EA 5JSUA 1B8NA 1HF3A 1FB5A 2HBYA 5CTAA 4IDFA 1KQFA 1RFLA 2YNMA 2PTHA 2XSZA 4J2OA 4UE2A 1N0IA 3ASVA 1Q7EA 5CM8B 4B1FA 1C1DA 2JBAB 3GAZA 2HN9A 2WG1A 4IH4A 3ELUA 4KIFA 3LT2A 4PTZA 3O26A 1FL9A 4IX9A 4F06A 4XRGA 2I9KA 4J03A 1XZEA 4M86A 4XIIA 3R9XA 1OXXK 4DIUA 2W43A 3N1UA 1BGVA 2OR3A 3G0GA 1E59A 3OX1A 1E77A 4RMIA 2UUBB 1Q92A 1KJYA 4MVJG 2IHNA 3N5KA 2GEFA 2IT1A 1J1UA 4D9HA 5DHPA 1SVOA 4GYJA 4O4IF 3UK0A 3EXHC 1SC6A 3QJGA 3QX3A 1QF6A 1J6UA 3CBQA 2PZ8A 1YB7A 3FCOA 3AHIA 4UM5A 1G2IA 5CB4A 3T15A 4YV0A 3HM2A 2LCFA 1EJ0A 3GRCA 1X1EA 3SE7A 4I1IA 4MKGA 1GGMA 1BE1A 3H3JA 5I9IA 4LSWA 3D3QA 1KH3A 5JNLA 3AG6A 1JR4A 1C3VA 2XXAB 2H0QA 2UV8A 4TMTA 1I4WA 3NJRA 4UUBA 4AKEA 1GVHA 1U0JA 3DCIA 2CK3A 4JCOA 1HDXA 2D6FA 1WPRA 3QUTA 1CY4A 3LOUA 2ORYA 1RD4A 3FDZB 1KI1A 3GX1A 2OCBA 2QRMA 3FVTA 1PD0A 2GZSA 5DBIA 1JT9A 3QF4B 4G0QA 1BXRA 3IUQA 4M9ZA 3HR7A 3W2IA 2PM8A 4JFRA 2B92A 5KQRA 2CXHA 2C8JA 1EB9A 3I28A 4D82A 5B7GA 2IS1A 2CVFA 3CINA 1Q1NA 1UXHA 4KRGA 4ZXFA 2Z6QA 4BP9A 1V6AA 3AWIA 1CKEA 1R8XA 2CJPA 2YXPX 2BMDA 2EJWA 3FDZA 4ZAYA 5KU1A 1AQYA 1UPFA 2QYOA 2Y27A 5HF9A 4N5HX 4NU8X 4V0KA 1MAVA 2CYBA 1QQAA 3DAHA 3UT5B 1ECJA 2AOTB 1OWNA 1C1XB 2GZHA 4PFJA 3NI2A 1RAAA 3MS4A 1TGVA 5KEIA 4ARIA 2HWUA 4GZ3A 4BWFB 5G1OA 1M34E 2Y4NA 1QFXA 1YV9A 3N0XA 4QT0A 3WNCA 2XCRB 1VTKA 3QOXA 5IN4A 2B2NA 2GBIA 3QVGB 1JIJA 2YZKA 2G70A 3FVQA 4KC0A 4ONEA 4RYDA 4EUEA 1NXVA 1SK8A 3GQVA 1JBQA 2DBYA 3BM5A 1JIXA 1X2EA 2HRZA 2F1HA 4O8CA 4CKBA 1BJRE 2VDQB 1JX6A 3GJRA 5J58A 3DEYX 1PV1A 3KQUA 2HHAA 2MOKA 4FYPA 2BI4A 2H85A 4YAFA 1COWA 1Y98A 2DHDA 3LQ4A 4OCZA 4Y2HA 2Y67A 2UXDB 1EG2A 2ZUUA 2Z3ZA 2EL9A 3DR3A 3K0SA 1DAKA 3GUHA 1H1DA 1QH0A 5BUCA 3HWWA 3STYA 3U7EB 3ZWYA 3T3OA 1T26A 2WAYA 1LFDB 1CUYA 1NX6A 2C4UA 3J7TA 2ZT6A 3FI9A 3QVVA 5K2MA 2NU8B 2P9HA 4LVOA 5CK5A 5LPNA 5CVCA 3G3EA 1GEGA 2Q4BA 2KLBA 1G9TA 1PNVA 4PG8A 3FYSA 2PZKA 2C5BA 3QYPA 3KKLA 3STHA 1PDOA 4MQEB 2ZUBA 1KK0A 3LXUX 4IRMA 1OIWA 3BWYA 3NWJA 3OE4A 4LYJA 1F0YA 2RHMA 4YRSA 4URXR 3DEIA 2PRZA 2A78A 4MYDA 4ZT5A 1CVIA 1FP4B 2IU4A 3CKKA 2QG4A 1L5SA 1WP9A 4GNRA 4DILA 1SMKA 4GOXA 5FFFA 1CZHA 2IHUA 2ZDHA 1CRLA 2VWPA 2RHLA 2Y6UA 1E60A 3L9WA 1P1HA 4GVXA 2JLSA 1LTHR 2OV4A 3X1KA 2HO4A 4NIMA 1NN0A 3U49A 3ZYCA 2HIGA 4C9BA 3EZYA 2IRWA 1PWHA 1F2VA 1YK0A 4Z54A 2UAGA 2B0CA 2FQWA 3OAAA 1WY5A 3AEXA 3I9V6 1EEHA 1Y8ZA 4Y2QA 3O8LA 1OV4A 2X41A 1YJAA 3L7NA 2NVUB 4JC4A 2PVSA 2CSUA 2MYUA 3DLPX 3HLYA 1N7HA 3Q87B 5IN5A 1NP6A 4PFSA 4LF8B 3GNTA 5C80A 3VNSA 1ISRA 1E3WB 1P5FA 4H17A 3ZVRA 1I3CA 2GLXA 1OYOA 3HJUA 3UAGA 1RWQA 3W5CA 1VM6A 4FDUA 4UVDA 1PJAA 3HJAA 4M1OA 3WSWA 3Q1KA 4MGIR 4ILEA 2UYGA 3HJGA 4M38A 2NZ8A 3N86A 4QDZA 4D0LB 3S5UA 4NCHA 3I04A 1SG9A 2C95A 1Y6GA 4S2EA 3BWXA 4Q1CA 4GQBA 5IH7A 5G41A 4O3FA 4FMDF 4QNRA 2P6MA 4M7PA 4M2LA 4BLPA 3HA3A 3U17A 3DOJA 3JZDA 4L73A 3DV9A 3LY7A 3VC2A 1PN3A 1KJQA 2XLBA 3VBCA 2EX1A 2I7TA 1X1RA 4DXAA 2NZWA 1TQ2A 1DTWB 4F4HA 4JBGA 2ZRIA 3V8RA 3FHOA 1CZLA 3BBLA 1J8MF 2VO1A 3AIIA 4H0NA 2CXTA 4LDRA 4B7XA 2DR0A 2EKDA 3MRXA 4ENRA 3K71B 3K0BA 4IJUA 3W3ZB 1LJUA 2C5EA 1MHPA 1PDVA 2ORVA 3GLHB 1HDZA 1EM8A 4LMPA 3UY4A 4LF9B 4V1CB 1JBKA 5K99A 3EUEA 1UT5A 4ZQGA 1XX6A 1TK3A 2X9LA 4LJKA 4TROA 1ABEA 4DKXA 1S2MA 4KWTA 1YL7A 3E9EA 3GJZA 1XEWY 3OO0A 4PGAA 4UHJA 4REMA 5ANRB 5JSYA 4LK2A 3VC1A 3ZS9A 1LQUA 2HPVA 2VR1A 1N2ZA 4CJXA 3G7UA 2GI4A 3R23A 1R6BX 2XADA 3O2NA 5IXJA 1EI9A 3U62A 4LF7B 2A1TR 4IUBS 1RYBA 4N7BA 1YQTA 4I2VA 3VHLB 3PXDA 3QKUA 5G0SA 2BFPA 4P7KA 3A1NA 1M7BA 2FN3A 2W8BB 3G2JA 5F9HA 2FG7C 1IY2A 1ILWA 3BF7A 5HF5A 2YCBA 3ADKA 1F2DA 2DSNA 2YWFA 3G89A 3JALA 2R7LA 4LJ9A 2EQBA 4IIUA 4PLTA 1P7ZA 4Q4JB 4BYGA 4QQKA 1YI1A 4CKWA 1FFDA 1T6YA 4FQ5A 1C4KA 1O6GA 2WTAA 3KQOA 1W88A 4IIJF 4DVGA 1LDMA 2Z2ZA 2FOIA 5DYIA 5IVPA 3H18A 3HYNA 2WKPA 1JHMA 5ELLA 4IIFA 5AW1A 1XZKA 1JECA 1NASA 3ACCA 3DO8A 3BFKA 1SN7A 3DEZA 3FUWA 3NM4A 2JGDB 3T94A 3UXMA 1WCIB 4CMBA 5KYNA 3GZJA 3CNBA 4BGDA 1L5LA 3UBMA 2IY8A 1V26A 4JGIA 4OI4A 1Q19A 1EM8B 3BFVA 4I9GA 2I7DA 1AQLA 5ALEA 2J85A 2M32A 5J5CA 4YV2A 4CKZA 3WGMA 1YMVA 4EK9A 3UWPA 4IO1A 2B98A 3MMXA 2Y05A 4IDGA 2NWQA 4IXNA 5H02A 5CJJA 1BS2A 1HLGA 4UUOA 2CB0A 2IPNA 1CERA 4WKNA 3A4NA 4WN3A 1MBZA 3BRWD 3L93A 5FPYA 4CLOA 2VSFA 3E3NA 4EAAA 5HYVA 1HDYA 3F6PA 1JEAA 4UD6A 4YMIA 3V5NA 5AH0A 1JP7A 5I8WA 3DE6X 1YWGO 2QUAA 3NP7A 2ATIA 3C5EA 3IT2A 4IVQA 1I13A 4GMHA 3AO0B 2Q2WA 3GL9A 4HDMA 5EIOA 2VSOA 3FZYA 3DFUA 1KAQA 3ROGA 1M34A 1BHO1 3ZIAA 4HUTA 2P4SA 2HH9A 4EHLA 3O38A 1T3TA 2WDPA 5DGHA 3CVUA 3VZDA 2IS4A 2DH5A 1C3OB 3BE4A 5ER6A 2F1OA 3ZV5A 2F4NA 4K9OA 5FA8A 4X45A 2JCSA 2O07A 1IDOA 3OWOA 4D0GA 1Z5OA 5DRTA 1SBCA 3L4BC 1JLRA 3IC5A 3BCUA 4UZEA 5H59A 3EHDA 3GXBA 3A9VA 4V3CA 3ZNQA 1AU9A 4WERA 3NKFA 1PS8A 3CZMA 3QMMA 4E5VA 3ZHCA 2PXAA 3AT1A 1JQAA 2VK8A 1WMBA 3EX7C 3KEMA 3FTPA 3FPSA 3N2ZB 4O25A 1RLUA 4B6FA 3ZYZA 1Z2DA 3NV7A 4FCTA 1E98A 1NGSA 1Z37A 4JMLA 4RHFA 2YUIA 5FNVA 4Q1DA 3T3MB 2IW3A 1UP4A 4DJDC 5BMOA 1NURA 2OVBA 3V8EA 2OENG 2Z57A 4FC7A 4KITB 2IIBA 2JIOA 5EVCA 2VDOB 3T3PB 4OBEA 4KNWA 1U9IA 1E6KA 2ZBGA 1XHFA 2QV0A 2GWHA 2NU7A 2YY7A 4MEAA 4QDOA 4YMSA 4I50B 4BRSA 5HZHA 2CKMA 3NC1C 4AY3A 5BWMA 5DM1A 3CH5A 1CNMA 2OQ2A 3AUSA 1C1HA 4W6ZA 4ZC1A 5T64A 2VXYA 3OBBA 4N7JA 3M6UA 2Q0XA 1X9GA 3B9PA 3B1ZA 1V16A 3T7DA 5A2GA 1ST2A 2ZUTA 4PQFA 2YFKA 1MQ8B 1O9HA 1XEFA 2DFLA 3PKJA 1ISJA 5K01A 5LMCA 5JO9A 3JARA 4P3NA 3EA0A 1AGRA 2YRFA 4OAOA 4FMCF 4W5JA 4B8YA 3UUFA 1U1GA 4RZ3A 3IVGA 1FP7A 4DQLA 2C1XA 3Q2KA 1GFWA 1Z6QA 2AC4A 1MPTA 1G8JA 1UBCA 4Z3KA 1M2EA 4NKRA 2IV7A 4EVIA 2WJWA 1N2BA 2REQB 2WU1A 1ULBA 3IB6A 3OO1A 1WHTA 4IWNA 1KDRA 4Y3UA 1IH8A 2WYHA 3WDKA 3UVEA 2BWJA 1SOUA 4UHEA 1LZLA 2JCYA 4RV5A 4FR0A 4RYLA 4O2AA 4IM7A 4OYLA 1QNFA 1ICIA 2RK3A 2OQRA 1RKUA 3PDHA 4M49A 3VO8A 4C4SA 1XTJA 3I62A 4MICA 1GPAA 1XROA 1E5VA 1I0IA 2H29A 5ESXA 3ZVNA 2OBLA 2X5OA 4RORA 2QTLA 2HZ7A 1OIVA 1HO3A 1SUFA 1TJYA 3EOAI 3LUBA 3Q9UA 4ZRNA 4EPXA 1BXGA 3PB3A 5DWQA 1UP7A 2A7QA 4L5YA 1LW6E 1TAHA 2PYZA 4F3NA 4RTKA 2XWSA 3V8QA 2EYUA 2ZIWB 3CLHA 1M1UA 1RSZA 5AUQA 1L4MA 4TTRA 3VDRA 4CIYA 1SXPA 4MIEA 3EFOB 3RUAA 2NTYC 4OIMA 5CPFA 2RMKA 1E1RA 3USZA 3EIHA 3BXZA 1NT4A 3IBGA 2AFVA 5F3RA 1XGKA 2BTQA 4JASB 4A8JC 4J1TA 3QXGA 2WU8A 3H19A 3N39C 1QG0A 1FNMA 3D2AA 3I73A 3K4PA 4DR3B 4PNEA 4WV3A 1LBEA 4JKIA 3DWGA 4FCVA 2FEXA 2Q46A 1K7EB 3DLIA 3W9UA 2FE4A 2QMOA 4L5CA 1TJPB 3WMEA 2ZJ3A 1SU7A 5IWCA 1SBQA 3U3JA 3F3SA 1EVJA 5EZ6B 1P29A 1W4ZA 4UW9A 5KC8A 2ZVJA 1QSGA 3V1UA 4EJ0A 1PT6A 4EG6A 5KSWB 1A27A 4YXWA 1SG0A 1KI2A 2I76A 1TEVA 3WWEA 3B8HA 2YDXA 3L4BA 1DBPA 1FNCA 2HQSA 4PZ9A 4ESHA 3TXXA 2GX6A 3IOCA 4MIKA 2DPGA 2HADA 3KQTA 1N1EA 3KUUA 4ZO4A 1OREA 5HTKA 3TQFA 2ZJ5A 2IZ1A 4Q15A 2R00A 3FDFA 4BZQA 5KVAA 5B1SA 3PTAA 3O2JA 1HPLA 4D8VA 2F55A 2HHLA 1AXEA 3MJVA 4BGEA 4X7RA 4F2DA 3T38A 5EAIA 5LQKA 4EQZA 2R86A 3QHAA 2VNKA 3LMKA 4YCLA 1FLDA 2YV1A 4BNMA 3U5ZB 2YBEA 1YMUA 5ADUS 2YCLA 1YRWA 1GQQA 1THZA 5HKLA 4IIVA 1FSGA 5CVUA 3K30A 1JLSA 1KH1A 3H13A 4ZOCA 2XB8A 2PKEA 3LWBA 1ADBA 5LXTF 5C8ZA 2WE8A 1C30B 1DJPA 3UJPA 2XUKA 4BEWA 1ZKDA 1QCCA 4Y6PA 4MQBA 4AF8A 3KZCA 4LAFA 4M89A 3NBUA 3O2QB 2PUHA 4GI7A 5LU9A 5ELXA 4IICA 4WFQA 5HIIA 4G5RA 4OJKA 3TBKA 4AXBA 2XQKA 3A9RA 1TECE 1QLJA 1X9IA 2X9VA 4KJZA 4IS2A 1DGQA 4LCJA 3VPXA 2PUVA 2XITA 3GRZA 2BKXA 4KQEA 3WMGA 4GSKA 3TRHA 1I9GA 2N9UA 1QPBA 4YRDA 3WGGA 3R6DA 1G8SA 5B55A 1EFTA 4AG3A 1MEJA 3CO5A 4JC5A 1D6SA 5A4MS 1YB1A 4X1YA 4P4SA 4PG5A 3FHLA 1A8UA 1PEDA 3FNBA 1RKQA 1SXGA 4JXJA 5F4BA 3AHDA 4PX3A 1SKBA 2XXJA 4OREX 2JHFA 4N5NA 2C4VA 4MUAA 1XXLA 2ZS9A 4QDJA 4A0HA 2G5CA 3DULA 3KKOA 2HRCA 3UMCA 2I6QA 2MU1A 1G5QA 3DOCA 3MCVA 4ZCPA 5HRUA 1LSOA 3B48A 4UFOA 5EE5B 1C7FA 1CUSA 1U80A 2YJTD 5AOBA 3I9OA 3KD3A 5JI2E 2O7RA 1VGQA 2H16A 4OSEA 2B6HA 3ETLA 3H65A 1V8FA 2HV9A 4X7PA 1XDDA 1PNQA 5TRTA 4BB9A 2VRBA 1W73A 1T9KA 2XNDA 3GFGA 1PGOA 3V1KA 3AUTA 3CC8A 1EP1B 1ZM4A 2GMWA 4TYYA 1T1RA 4WASA 5CX1A 3X1DA 4EPRA 3NCTA 1VCOA 2OP0A 4WADA 2QLMA 4QJBA 4HGZA 4G0NA 4LNAA 5ENDA 3FYTA 3WGTA 4TQAA 3GOHA 3I4LA 4ARSA 1SVWA 4EYKA 1V7PC 3U7HB 1M6HA 4M6WB