4TQGA

Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
319
structure length
297
Chain Sequence
SQINDKTIMIFGGSGSLGNRLIETYINNNIIVNYSRDESKHWSMELKYKSDKLKNIIGDIRDFEKVQQSIMRINPDIIIIAAALKHIDRCEYEINECLDTNIKGLQNVLKVTEINRSNLSNLKAVCFVSTDKACSPVNSYGMSKAICETLVVEKSKYIKDIKYVCVRYGNVLNFTLTHTSMTRFIMTLDDSVKLIEYAIINGNSGEIVIPKLNSMYIKDMIELFADKYPIVITGLRSGERMYESLINDTQSMKTVPKGDYYHILPTYDPTIVTEEFYEYSSKQNILSKQELENYLNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Giant Virus Megavirus chilensis Encodes the Biosynthetic Pathway for Uncommon Acetamido Sugars.
pubmed doi rcsb
source organism Megavirus chiliensis
molecule tags Sugar binding protein
molecule keywords Putative dTDP-d-glucose 4 6-dehydratase
total genus 114
structure length 297
sequence length 319
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4tqgA00
2PA3A 3DR3A 1EK6A 4B7CA 4A7PA 4YQZA 2OL4A 1V0JA 3KHUA 2TMGA 4Q9NA 3GQVA 3WS7A 2AEMA 2IZ0A 3I52A 2GO1A 4R51A 4WLEA 2E4AA 3DBHA 2HMWA 2NM0A 1T2CA 2X5JO 4J0EA 1AGNA 3G1TA 4NI5A 4CM3A 1QR6A 5EL0A 1SB9A 1VKNA 3V2HA 1Q1NA 4DPLA 3CPSA 3WGZA 4BO4A 2NTJA 2X23A 5ER6A 4LVUA 1ZKMA 2AQIA 3ETEA 1U4SA 4R16A 4RLHA 1K5HA 3N7UA 4K26A 3GAZA 4RPLA 2PWZA 1LLQA 1T26A 3OIGA 2D5CA 2DPGA 1GY8A 4ZA2A 1R16A 2GSDA 3FNFA 1J6UA 1TT5B 3BXXA 3K31A 3F47A 1DHRA 1MV8A 5A5EA 3H9UA 2Y68A 4E2YA 4CLDA 3SLGA 1PJCA 4OM8A 4J1TA 1ISJA 5IZCC 2EJVA 3AJRA 4PZEA 4DLAA 3PJFA 4WCDA 2PGJA 3JD0A 4F6LA 2CY0A 1T24A 2ZB4A 3CE6A 3PI7A 3WMXA 4AL4A 1JVSA 3S1LA 1R0KA 3H3FA 4WOJA 5TC4A 1C0PA 3ZHBA 5DNAA 4IQ0A 4QO8A 4FFNA 2JAPA 2VUSA 4IQ8A 1N9GB 2X9VA 4PLPA 4DVJA 5L3ZA 3L4BA 2Q3EA 5LCXA 2FMUA 1QORA 1ISMA 1XWFA 4JP3A 2OBNA 4BGIA 4FQ8A 2ET6A 1I01A 1A9YA 1H6AA 2GUGA 1RM4A 2Y1FA 3ASUA 3GFBA 1L1FA 4OJNA 2HDHA 3CZMA 1YO6A 4CR8A 3H2SA 3QY9A 2VWGA 5THQA 5L9AA 4FB5A 3VTZA 3A06A 3PQFA 4PRLA 4L4SA 3EYWA 4AJ4A 3T4EA 2C07A 2B4QA 5CDGA 1EDOA 4PLFA 3AUUA 1UDBA 1YDEA 2BGLA 1A72A 2PV7A 3HWRA 3I83A 4WASA 3IQDB 3TSCA 3FNHA 4GBJA 4DQXA 4EZBA 1DJQA 5I8ZA 2EXXA 3OMLA 4CMGA 4RVFA 2I5PO 2PKQO 3M1LA 1H6BA 3JD2A 4FR5A 1FDSA 3D0OA 3H7AA 1OC2A 2Q45A 3MJTA 3SBOA 2BHLA 4X54A 3KZVA 1I30A 3JQAB 1DLJA 3GH3A 3UGKA 3AOEA 1QRRA 4LGVA 1IE3A 3WTCA 4EI2A 5ICMA 4L4RA 4BNLA 3PRJA 3OBBA 4GWGA 3ZDFA 4A73A 4CMCA 4AFNA 3K5PA 4NG5A 4ITUA 2CD9A 3OA2A 3GFGA 3QP9A 5FEUA 4K28A 1H9BA 3QIVA 4GL4A 4IDCA 1LUAA 2DPHA 4IY1A 4XRRA 3DBHB 3EUWA 1UDAA 3NGXA 2FP4A 4PLTA 1SNYA 1E1NA 4YAJA 3E82A 3I5MA 4RVUA 4F45A 3G17A 3MJSA 3DZGA 4GI2A 2QG4A 3RUFA 5ENVA 4D3DA 1CF2O 3OHSX 4AJEA 3PHJA 1EQUA 2P9EA 1GCOA 2I6TA 1UXGA 4PLVA 4YAIA 2BFAA 4TVBA 3H6KA 4FJ1A 4IIVA 1M76A 2VCYA 1ENOA 4XD2A 4CV2A 5COBA 4MVJG 4E5YA 3PHHA 1E6WA 1GV0A 2YV2A 1D4FA 4HWKA 2Q50A 1DOHA 1GQQA 1PIWA 2XXBA 3JSAA 5AXAA 4J7CA 3Q0EA 2HK9A 2O4CA 4EUEA 3BHMA 4R4JA 3ZV4A 1BXGB 4WECA 2XOXA 3ADPA 4FFLA 4QT0A 4TROA 1TI7A 4XDZA 4CQMA 2VYVA 4B4OA 3DXFA 3GVCA 3JQ7B 4M86A 3ETGA 5B37A 3ZNQA 4BNUA 1ZSNA 1HLPA 1RM5A 3OJLA 1NQAO 1XLTA 3GGPA 1SAYA 3I1JA 3TQHA 3D3WB 1YL5A 3IMFA 5B4UA 3JQGB 1I3KA 3OP4A 3KV3O 5MGBA 2VZ9A 1HL3A 4HFMA 1K0UA 3NGLA 3AU9A 4NFYA 5G4LA 4BNYA 3HZZA 4J0FA 4OKIA 5TRTA 1NFQA 1X7GA 1XCBA 3NT4A 4YTEA 5CEJA 1UAYA 3UF0A 4P4GA 4K6FA 1XQ1A 5JAIA 1X0XA 2Z1MA 1GDHA 2H5LA 3RAJA 4CM9A 3WJAA 5G4KA 1D8AA 3GNQA 1KVUA 4R1NA 1UXHA 5C7IO 2HRBA 4J2OA 3LK7A 3PXXA 2F00A 1V3UA 3BTVA 4PG5A 4UVEA 4YYZA 4FN4A 2W2LA 4BNXA 3D1LA 4FGSA 3HSKA 4Q3CA 3AI2A 4KUGA 4BL5A 4WPGA 5MDHA 2VNSA 4YT4A 2I9PA 3PHIA 1CYDA 1ADFA 5JAMA 1GUYA 3FSRA 3PJDA 4DYVA 5CHEA 4H16A 3RUEA 3DZHA 4EYEA 1K2WA 1U2DA 1XR3A 4P4LA 3GNTA 1I36A 2W2KB 3SC6A 3ZHZA 2ZYDA 2YW9A 1NFRA 1P45A 1U7HA 2YV1A 2WYUA 2GNAA 1M6WA 2PD4A 1KOLA 3ZWYA 4BMSA 3D3EA 4HY3A 2AG8A 4FFMA 4LSWA 4AJNA 4JJGA 4MDHA 4P22A 2IE0A 4IDFA 1QYCA 4CQLA 5JCJA 2EGHA 5DCYA 1A7AA 4YEDA 2GDZA 4ALNA 3O26A 3S2GA 5G0SA 2BF7A 4NPCA 1WDMA 2HMSA 3NJ8A 1VE9A 2V6GA 1E7QA 3RJ5A 1GYPA 3RQSA 4E31A 4NH4A 4CLEA 1JU9A 1Z7EA 2VZ0A 3PP8A 5JPIA 4WLUA 1JAYA 4BNKA 3RC2A 1P77A 4BB5A 4G2NA 3E48A 1NR7A 4ZQBA 4BNGA 2DVMA 3KYDA 1DAPA 2QIOA 4B4WA 2O3QA 1KVRA 1AXGA 3P7MA 1XQ6A 4N5MA 1D7OA 1D3AA 4MVJP 1QKIA 1SOWA 4LW8A 3GC6A 2H6EA 3JYPA 4Z9FA 4NFHA 3UCFA 1PJ4A 1ZK3A 4RQTA 2BI8A 1BDMA 4R1TA 5TNXA 3BA1A 4IGEA 3WGOA 2PKRA 5U9CA 4U6QA 5CPBA 1E3SA 2Y67A 5EIOA 3PK0A 3TFQA 2C0CA 2YYYA 3VDQA 3FBTA 3FR7A 2B69A 1LDMA 4PZDA 3IP1A 1XHLA 2YJZA 2R00C 2W4QA 4R1SA 5DDIP 5IAAA 5HRUA 1WVGA 1KBZA 4MVJH 1LA2A 2IZ1A 2JCXA 1QLHA 4RCVA 5TJ9A 3JQ9C 4Y6SA 2D3TA 2RCYA 3JTMA 2RIRA 2O4UX 4LMPA 4GGPA 1IY8A 4FGWA 1U3UA 1GTMA 5CDSA 4R5HA 4JXKA 3DONA 3GT0A 4ALKA 1PJBA 2X58A 3K6JA 5DOZA 4Z6KA 5BSGA 2Y1DA 3JQFC 3JQFA 3IIEA 4PLYA 1P1KA 3I9KA 3QVOA 3E1KA 1QV6A 1IB6A 4CM1A 1EVIA 4CUZA 4YT5A 3BMQA 1BXGA 4IDBA 5BQFA 3KXDA 2HSDA 1E5QA 1BSVA 3KTDA 3PQEA 2Q2QA 5HBRA 3GZNA 1GYRA 1YS4A 3WSVA 5ADHA 4YJGB 4M1QA 3PHLA 4HFNA 4EJ0A 4IIUA 1E6EA 4OOEA 1JKJA 3UH1A 4N5LA 3MJEA 4L9RA 2IRWA 1LX6A 3PTZA 3V2UA 2PTGA 1IZ9A 3LT1A 3JQCA 4CMHA 4EDFA 4R3NA 5A06A 2PKQP 3L0DA 4Y6PA 2J5RA 1Y8QB 4D0SA 1Q7GA 2GN9A 4WUVA 4IUYA 1N2SA 3LYLA 4LMRA 4NJOA 5K6AA 5KCZA 1M6HA 1BVUA 3LSYA 4ZQHA 4JN6B 4BO5A 1ENPA 4Y98A 4H3VA 4U5QA 2BRUA 3HDJA 3ANLA 2OXIA 2AE2A 3RKRA 4MOWA 3CH6A 2X5OA 5B12A 1RWBA 3EDMA 1RPNA 1PGJA 4L0QA 4DRYA 1DPGA 4CLOB 2C29D 1PJLA 4QX6A 4UEKA 4RDIA 1PR9A 4DPKA 4W99A 1HDXA 4MP8A 2PK3A 3ZNNA 2VT3A 4NJMA 1N1EA 3ZWNA 3L9XA 9LDBA 3WQSB 2DBZA 5EPOA 2AHRA 1XGKA 3BTSA 5GZ6A 1FJHA 1H5QA 3C8MA 4CM4A 3JQ7A 4UULA 4PG6A 3QWAA 2G5CA 1NR1A 4L73A 3I6IA 1HDGO 1YQXA 4OGWA 1H6DA 4B8ZA 1T4BA 2VHVA 3HDYA 4DWVA 5ICSA 1YJ8A 2A4KA 3VPXA 4CMKA 4TKLA 3GF4A 3BZUA 3N74A 4XB2A 1PL7A 4OIMA 4E12A 1YDWA 5ER9A 1EUCA 1E77A 3WOHA 4WCFB 5A3VA 4BNWA 1TLTA 4KZPA 1O9BA 3W4JA 3GEDA 1UH5A 2JHFA 1E3JA 4S1VA 3WICA 4CV1A 5ENDA 1KEWA 4GAEA 2NUAA 2ZTMA 3DBLA 1FMCA 1H0KA 1YL7A 1JW9B 2CVQA 1I8TA 3C1OA 2PY6A 3P2OA 5JC8A 2CDBA 3MJVA 3QWHA 3ABIA 4NR0A 4YRBA 2ZIZA 1EBFA 2P68A 4NU5A 4QO7A 2GD1O 2NNLD 3PLNA 2P91A 1U2GA 4B7UA 3PYXA 2O2YA 4UVDA 1I2CA 1EBUA 1KYQA 3DB2A 2DC1A 1F12A 3U4HA 3WFIA 4HV4A 2JHGA 5T67A 3VH3A 4EEZA 4XR4A 1CJCA 2C2XA 1L7EA 3QWFA 5EQFA 5TQVA 3K30A 4HFRA 1ZSVA 4M87A 3ZWPA 2VWQA 2YDYA 3ULKA 4JJFA 1VPDA 4WCFC 4YCAA 1ZH8A 2HMVA 2AQKA 5JDIC 4CQMD 5COAA 4GX2A 5I7EA 1QG6A 2OHXA 2VNAA 1NQTA 3AK4A 4DLLA 5KKCA 3R0IA 2HO5A 3LC1O 5H81A 4CPDA 4IXWA 1HLDA 4W9NA 2PGDA 3LT4A 1Y6JA 2JFHA 4KWHA 4AVYA 3I23A 2UUPA 5HTOA 2G76A 4ZVVA 1F8FA 4ZRMA 4BKUA 1QYVA 1V35A 3NDRA 3VPFA 2X0NA 4ZJUA 4XQ9A 4JBGA 1ZBQA 3PGXA 1ZEMA 3C1AA 4PIVA 2E48A 1MFZA 2EKPA 4ND3A 4ONEA 4PG8A 5DT9A 1PZGA 4WLNA 1IULA 2QYSA 3LT2A 1P0CA 3VOSA 1P0FA 2Q49A 3EY4A 3UVEA 2C59A 3VH1A 1LSJA 2JJYA 3O4RA 4DBZA 4BO0A 5A4DA 3SVTA 2LDBA 1U8XX 4HXYA 2BI7A 1DIRA 4KMSA 1U28A 2O3SA 1DFGA 3I9LA 3AUTA 1V9LA 1V6AA 3E9NA 5AXBA 2C20A 2W90A 1ZK4A 2X0JA 3TL3A 4G81A 3KVOA 2Y1GA 3H2ZA 4TWRA 4YXFA 3ANNA 4CM5A 2Q1TA 4F46A 3L6EA 3GZNB 3WBFA 2WMDA 3NJ4A 1P33A 3IUSA 2O23A 2DBVO 3PFWO 3PEFA 3JCZA 1O5IA 1T2EA 1ZXLA 4MINA 2IZZA 1NWHA 5L7WA 1LSSA 3VH2A 5ILOA 3BMOA 4GX0A 4D41A 1B0AA 5JYDA 2NWQA 1PL8A 1GD1O 2PR2A 1CERA 3FD8A 1ZJYA 3OJOA 3QVXA 4TQGA 5JS6A 3QJ5A 4NBUA 7ADHA 3JD3A 3E5MA 4TRNA 5FI3A 1QLJA 4GGOA 3DC2A 1HT0A 4CL8A 4J90A 4WGGA 4B7XA 3QA9A 4RZHA 1OMOA 4G65A 3OQ1A 2AW5A 3NKLA 4BMNA 4GLOA 2O3UA 4DL9A 2YY7A 4BKQA 4C7JA 3X2EA 2B35A 3LF2A 4K6CA 5TT1A 3PDUA 2VHZA 2DT5A 3UHAA 3Q2KA 1SO8A 4ID9A 4OSOA 1GZ4A 2YDXA 2Q1UA 5CP8A 2J5KA 4CJXA 1P9LA 4AJLA 1GPDG 3IC5A 4YJHA 3BMNA 1B8UA 3NTOA 4DXHA 1O95A 2ZYGA 3GMSA 1B26A 3SC4A 1DLIA 9LDTA 5I7SA 2OZPA 4HUJA 5COQA 3E9QA 1GAEO 3R3SA 3H4VA 3GR6A 1LDYA 2UV8A 4DYDA 4CUJA 5FFFA 4PVDA 1X0VA 1RM3A 3PZBA 1H94A 2E37A 4IGFA 4UUPA 1NBOA 2A35A 3E18A 4NU6A 3W8EA 5DCWA 1JAXA 1PJQA 1C1XA 1NXQA 4CODB 3QSGA 3UCEA 1NM5A 3BMNB 4ZD6A 4IBOA 3SXPA 2W2KA 4IJKA 2OO5A 2WWRA 4MVJF 1AN9A 2I3AA 2VT2A 3ZWVA 3TN7A 3PHGA 4Z0PA 2NTNA 4NFSA 2HKIA 2OORA 4DIFA 3C85A 1SBYA 2X22A 3H9EO 1B7GO 1HXHA 4QUKA 3FCOA 1D1TA 3C3XA 3MTGA 1DBVO 1PL6A 3N58A 3DOJA 3R3JA 1OC4A 2C7VA 3FWNA 3PLRA 1LSUA 3RIHA 3QVWA 2DQ4A 3D5QA 1KVQA 1F14A 1R12A 3CSDA 1NFFA 1ZNQO 4GKBA 5F5NA 3P19A 3D5TA 1KVTA 2P9CA 2GN8A 4QFDA 4GWKA 1GCUA 1C0IA 2A9FA 4OXNA 4XX0A 3GEGA 4O1MA 3H9JA 3B6ZA 4IMRA 3G79A 1DXYA 2D5AA 2B4TO 4RL6A 3UN1A 1U4OA 1YWGO 5JSFA 1Y8RA 4Q3EA 4W9NC 4EEXA 1B2LA 5C7LO 1X7DA 2NVUA 3QQPA 1VL0A 5B4TA 3GPDG 4J4BA 1E1MA 4Z0TA 3HUDA 3WSWA 3E9MA 1BMDA 4PRKA 3WGIA 4OMUA 3K73O 3OECA 3PJGA 3DTYA 4W6ZA 3EK2A 2OUIA 1BHSA 3HQ4O 3C24A 4MVJD 4RVSA 4BO3A 1Z82A 1WW8A 2Q4EA 2UUOA 2F1KA 1FXSA 1YQDA 3D7LA 3F46A 3Q9UA 4QSMA 4DMMA 1ADCA 3DOOA 4B4VA 2FWMX 4M54A 2UYYA 4Z3KA 3H3JA 4KQWA 1OOEA 4II2A 2J3JA 1NAIA 4JGBA 2RHRA 3STHA 1HYEA 2J5QA 5KOIA 4XQGA 4UVIA 1EQ2A 3HE3A 3AFNA 2D2IA 1U5AA 4J7XA 1NTOA 2VYVD 3DZKA 1Q0LA 3F1LA 2WEKA 2XF8A 2CNBA 4BIIA 2Q1SA 2WSBA 4DUPA 4DMLA 4KDFA 1I0ZA 4D46A 1DO8A 1UXKA 3EHEA 3GK3A 1O6ZA 4OQYA 1WZEA 3DZJA 5G4KB 2NACA 4W7HA 2AXQA 4MVJE 3JQ6A 2PFGA 1IPFA 3EMKA 1M67A 3DFZA 2IYPA 3CKYA 5IF3A 1NP3A 3QLJA 4CV3A 3LQFA 4YA6A 1B15A 1SEPA 1CEQA 2FY8A 3FRJA 3VPSA 2JFGA 4YQYA 4ND2A 4EJ6A 3IL2A 3PJEA 4YVFA 4CMBA 3E5RA 4DQVA 4RORA 3I9NA 5I9MA 1VL8A 3RC1A 4RF2A 4XJSA 4KUEA 1YBAA 3WGGA 4XGIA 1ZK2A 1WMAA 1VSVA 1R0LA 4J3FA 3IUPA 1DFHA 1AHHA 3BMOB 1E3IA 1LDGA 4I9HA 4D43A 2HK7A 5CDUA 4J49A 5ITVA 3WGQA 4BNMA 3VAZA 2Y1OA 3NAQA 1DHTA 3PIIA 4YPOA 2NV6A 3BMCB 2AQ8A 1P1IA 2BGMA 2Y99A 4NDNE 1KEUA 1U8FO 4A5OA 5CAEA 4E5KA 4DBVO 2GCGA 2XXJA 3VDRA 2B5VA 3AFMA 2FSSA 2CVOA 2CVZA 3NDJA 1E7RA 3ZH2A 1NHGA 5JFOA 6ADHA 4K9DA 4E2WA 1G1AA 4B3IA 1DC3A 1VLLA 1YE3A 2Q99A 2X1HA 5T5QA 4KDEA 5A5FA 4UUOA 5BNTA 1UP6A 3JQ8B 3RFXA 3TJRA 2O3RA 1U3TA 3DMYA 4GKVA 3CIFA 3L4SO 3GUYA 4FC6A 4URFA 3ZNOA 2QRKA 3WWYA 2GERA 3QVTA 1UAGA 1SCUA 1B8PA 1E7MA 1HE3A 1MP0A 4BNFA 1WMBA 2BKAA 5TS3A 3GDOA 1E5LA 1KY5A 1N92A 1YONA 3QRWA 1EVJA 4N7RA 1YGYA 4BQRA 3FBGA 1NNUA 4FPXA 4XYEA 1N9GA 5THKA 2O3TA 4DREA 4GMGA 3DDNA 1A4IA 4BGUA 4Y6RA 2DBRA 1TT5A 4LCJA 4YT2A 4CMIB 2ZYAA 1MG5A 3CXRA 3ZU4A 1TB4A 3HB5X 1T2DA 3RBZA 5BNIA 1OBFO 5I7VA 5IDQA 1RM0A 2YHIA 4EUHA 3UICA 1PQUA 4CM4B 4HBGA 4DIOA 1KEVA 3ETDA 1HETA 4FD3A 5JAZA 4PLWA 3OJFA 3B1KA 1DJNA 4N54A 4WEQA 3CINA 3EGOA 1ZUD1 3GDGA 5I9NA 5IXYA 1X14A 3KOUA 3VKUA 1ZW1A 4OKNA 4GX1A 1BWSA 1T25A 2CF6A 1JN0A 3DBLB 3WIEA 4LRTB 3MWEB 1YBMA 4M55A 2Y0CA 4BMVA 5JC1A 1E3WA 4WK6A 4YJDA 2FR8A 1Z6ZA 1KC3A 3ENNA 2G1UA 1B14A 2DU8A 2UVDA 1NASA 4YJGA 5TX7A 1QMGA 3HN7A 1E0DA 1Z7BA 4QEDA 3IP3A 3ONDA 3ZNPA 5K0ZA 2Y66A 1YBVA 4MVJI 1VM6A 3JYNA 2PZMA 4WKGA 1Y81A 3ZN2A 1FDTA 3WMWA 4OOFA 2Q1WA 3HDHA 3TOXA 5B4VA 4XDYA 3JQAD 4Q3AA 4UAGA 4DIBA 2O7SA 5L7TA 4Q3BA 3TF5A 4BNZA 4P38A 3NTQA 4WCFA 5F5LA 4E33A 3BTOA 5DP2A 1W6UA 3OIDA 5BSHA 4O6VA 5JO0A 1K89A 5AOVA 5GZ1A 4R69A 2CUKA 4MIYA 3RC7A 4BS9A 5G0WA 1W4ZA 2GF2A 3AM5A 4HFJA 2JCYA 3ONEA 1CIVA 1X7HA 5A1TA 2R2GA 1VKOA 4IQGA 4FJ2A 3S2FA 2ZQZA 4C4OA 2P4QA 5AVOA 4ZICA 4BOYA 1KEPA 4MIOA 4FCCA 5KVVA 3V1TC 2X0RA 2FZEA 1I2BA 1W0CA 3KYBA 4C7KA 5A03A 1BXZA 1PGQA 4OYRA 1GV1A 2VYNA 1ZSYA 1TXGA 4NHEA 4JLWA 5JAQA 2C2YA 5LC1A 1BXKA 1M75A 1J5PA 1VRWA 2W98A 4NJMB 4HNHA 4ZQFA 4BNJA 1DIAA 5JCJD 3EZYA 2DUUA 4FC7A 1BRMA 1IZ0A 4R9RA 2EP7A 3ZV3A 1LDNA 3RBXA 2DTEA 2X6TA 1OFGA 5I7FA 1GUFA 1ZFNA 3FI9A 2NU7A 1LDEA 1DRVA 2JAHA 1U3VA 1PZHA 3PVZA 2PZKA 1VC2A 4NIMA 1D1SA 1RYEA 3JD4A 4FOOA 4UEJA 5JDCC 3M1AA 4Y9DA 1UXIA 4PG4A 4OO3A 2EW8A 3OICA 5IDYA 3RVDA 4FFPA 1IHXA 1JTVA 2QX7A 1A7KA 3SEFA 3VHRA 2VHYA 5C7OO 1R4MA 4BO1A 1F06A 5IN4A 4I08A 2HJSA 1LDBA 3ADOA 5FI5A 3PWSA 1SOVA 4NZ9A 5L53A 4ALMA 1LJ8A 4IM7A 3UUWA 3G3EA 1NVMB 2HAEA 1K6XA 2B36A 5L51A 2FSVA 3COSA 2J3KA 1DEHA 4OXYA 5A9TA 3A28A 5AXCA 5J23A 3NEPX 5L45A 4CMEA 2E6UX 3JQDA 1YB1A 2VYND 4BNVA 4F6CA 3A1NA 2BH9A 2I67A 1E3LA 1KIFA 4D3SA 3S8MA 4B79A 3Q3CA 1SB8A 1C1XB 1SMKA 5IN5A 3GRPA 4WOKA 1T2AA 1MX3A 3MJ4A 5A04A 2P5YA 3ZU2A 2C7GA 4LISA 1QYXA 4BKOA 3M2PA 4YBZA 4LVCA 2VTEA 4IDEA 3ZU3A 2VUUA 3ROMA 3WLFA 4WLVA 1IL0A 1C1DB 3DWFA 2FPGA 4R1UA 1C3VA 5H83A 4FSHA 3RUDA 3KSUA 4J16A 3TNLA 5JBIA 5HS6A 4CR7A 4WLFA 4L8VA 1LSOA 2Y1CA 2PD6A 4RPJA 4J91A 1QXSA 3L07A 2UAGA 1PWXA 4BO9A 1NHWA 5KVSA 2X9GA 1VJ1A 2Y0EA 2BMAA 3EAGA 2AG5A 5FWNA 4QQRA 3D4OA 3F5SA 2EIHA 3G1UA 2Z95A 3ZHXA 4AG3A 4HP8A 4BO6A 5CG2A 4ND4A 1Q7BA 4FFOA 3TZCA 5HA5A 1B3RA 1F8GA 5AQ1A 5TJHA 1I3MA 3IOYA 2YFHA 3WDSA 3ZGYA 2RBEA 2HQ1A 4Y8VA 4MO2A 3BAZA 2LDXA 1U7TA 3DZBA 1C1DA 4R5MA 3GN2A 3T4XA 4FJ0A 2EWMA 1PSDA 3JQBA 5CPFA 2I65A 1DC4A 3WNQA 3KRTA 4I1IA 5G0UA 3B70A 5L4LA 4GH5A 2J3HA 4XGKA 4WEOA 1CRWG 3SJUA 1LRKA 1V3VA 1YOVB 2VWPA 3L6OO 4R41A 3S55A 3FF4A 3OQBA 5JMPA 2VHXA 2EF1A 1DDOA 3DL2A 3G0OA 3RKUA 2QRLA 3ON5A 4TVOA 2RHCA 4U0KA 4XGNA 1HE2A 1Z74A 3TFOA 3G49A 1EMDA 2EKQA 4J9UE 4GVXA 3KLMX 1JA9A 2EEZA 4NNJA 3WYBA 1C0LA 1HZZA 2QQ5A 3GMDA 1LLCA 3JYQA 4BV8A 4D42A 1UZNA 1MA0A 3W6ZA 1MFPA 3DAGA 4EGFA 4CLRB 4Z0HO 1LI4A 5JLAA 1Z73A 3IAHA 4BKPA 4BHTA 5KJCA 2ZB3A 1XU7A 5JE8A 4PZCA 3T7EA 5L95A 3IDSA 3KETA 1P44A 4GQAA 2OBYA 4RF5A 4Q39A 4M49A 1FDVA 2AQHA 4E5MA 1N5DA 2NLOA 1XYGA 1ARZA 1GR0A 1ISFA 4CM7A 4J9VA 3QHAA 3BHIA 1F0YA 1R66A 1ONOA 3OEWA 4Y67A 1BW9A 3RUHA 1E1KA 4FIZA 3NV9A 1N8KA 2P4HX 1YB5A 2Q2VA 1PR3A 4CMAA 1T4DA 2R00A 4KP7A 4GSLA 1GL3A 2FOIA 3TZ6A 3EC7A 4R54A 4IINA 4JNKA 4E21A 2NVWA 3I6QA 2YFQA 3PPIA 4D3FA 4DTIA 3RC9A 3ROPA 4D0RA 5TLSA 3JQAA 3H8VA 2QHXA 4RDHA 3U4DA 1PGNA 2RH4A 2QYTA 5T57A 1U5CA 1EK5A 3KO8A 3ROQA 3TL2A 1IOLA 2EHDA 4WJZA 2GZ3A 2ZJ1A 4YAGA 4WNCA 2G0TA 4RGBA 5IG2A 4RJTA 3GEMA 3GRKA 2VN8A 5F21A 4E0BA 4L75A 5JDCA 4H15A 2C5EA 3ONFA 5JNLA 2EKLA 4PLGA 5C5IA 2IEDA 1X1TA 3I4CA 1YJQA 1NPTO 2PH3A 3D4PA 4A0SA 5I8WA 4DA9A 2ZCUA 4JK3A 3WNVA 1UZLA 3GLQA 1LTHR 4CMEC 1QYDA 1KVSA 2ZJ0A 2FPIA 1PGPA 2W8ZA 4KTTE 3WX0A 4OQZA 5EJ2A 3BTUA 4ZU3A 3ASVA 1HKUA 4XB1A 3L9WA 4QECA 1H2BA 4A27A 2CZCA 5F1OA 5ITWA 3WYEA 2B4RO 1UJMA 2WJPA 1ZXBA 5IDWA 5DN9A 3O8QB 3RBVA 4QFCA 4OAQA 1WDLA 2Y05A 3INTA 2GGSA 2PGLA 1JKFA 4N5NA 2FRDA 2I99A 3DO5A 1EZ4A 2D8AA 2OGUA 4D44A 3DHYA 4CR6A 2WE7A 3H5RA 1LRJA 3E8XA 1PZFA 3IKVA 2AMFA 1EUDA 1EEHA 3H9GA 4I5DA 3HDQA 5KJ1A 2VWHA 2ZTLA 5DULA 3ZWCA 2WTBA 2YV3A 2FZWA 4RVDA 2JFFA 3UOGA 1Z45A 2G82A 1GQYA 2IEBA 4ROSA 3CMCO 3U4CA 3ZWMA 4JIGA 4RF4A 4TZKA 1KS9A 1SC6A 1WWKA 4IS2A 2JD1A 4NMHA 4CM9D 3ZWBA 4IMPA 8ADHA 5TIIA 1P31A 1HYGA 1YRLA 2PH5A 3C7CB 5G0VA 1PJTA 3NDIA 2FHSA 5FYDA 3UKOA 2H63A 1AUPA 1T1SA 2VHWA 3KB6A 5FF9A 5AXDA 3UCXA 1ENYA 4BO8A 5JYEA 3WGHA 4CV0A 4UVGA 4RVGA 5KVQA 1C0KA 1QP8A 3FNEA 3KSDO 1HDOA 2NTVA 3R1IA 4OSPA 3FN4A 2X7HA 2X0IA 3PWZA 1A9ZA 3OH8A 3MOIA 1L7DA 4ALJA 5T8KA 3GN1A 3NRCA 4O5OA 1CQIA 3RFTA 2OOSA 1GZ3A 4BUCA 4J43A 4XQEA 1TA4A 3AOEC 4AJJA 3B1JA 4CMJA 1LQUA 5IZ4A 1AHIA 4UREA 1ZK1A 2DFVA 4P4NA 2OMEA 5U1PA 4DGSA 4B3JA 2J6IA 4II3A 3JYLA 2V65A 4CLXA 4KQXA 1RJWA 4HADA 4IXTA 4NK5A 5L40A 2JKVA 4E30A 3ZV6A 4PLCA 5C3MA 2DTXA 1ZK0A 3GVIA 1O94A 5TF4A 2GRAA 3EVTA 4EW6A 1ULUA 2X5KO 1ISHA 4DC1A 5KJ6A 4G5HA 4GSKA 4MPDA 3TOZA 4YAKA 2A94A 3OSUA 1E1LA 3V8BA 3AM3A 1LLDA 1CDOA 1Y8RB 3A14A 3U49A 3BMCA 3OJEA 4XYLA 4NBWA 1A4UA 2C82A 5I9LA 2VRBA 1JWBB 5F3RA 2CMDA 1EFKA 5CDTA 1FF9A 3PDJA 4YDRA 2QZZA 1U9JA 1DB3A 3FNGA 3DZIA 4U7WA 2VRCA 2V6BA 1R37A 2CSUA 4LK3A 5JY1A 1CETA 2Z1NA 2B0JA 3K8ZA 5ILGA 4ND1A 2A92A 3VPGA 4MKXA 5CFZA 5DF1A 3ICPA 2V6MA 1GFSA 4BVAA 4E4YA 1I3NA 1WAMA 4R68A 2Q46A 4S3MA 2VOEA 3MJCA 4K1LA 2IXBA 1KC1A 3P2YA 1P74A 3O8QA 3OQ6A 4KOAA 2WE8A 1P3DA 4I9UA 3EW7A 4L4XA 3BMQB 4OHUA 5EERA 2YQ5A 4XYGA 2BGKA 1I33A 1G0OA 3D4NA 1F17A 3JQBC 5T8KC 5EN4A 1TVEA 2UDPA 2WM3A 3P5SA 2HU2A 3W4IA 2O3JA 3RD5A 1V8BA 3ZZNA 4B3HA 1MXFA 1NPDA 3EZLA 1ENZA 4PLHA 4D45A 2IXAA 4AJ1A 1ULSA 3M6IA 4N18A 3L4BC 5IXSA 3I9MA 3RUAA 3JQ9A 4TZTA 2YZ7A 1T1RA 3PQDA 1LBEA 1OAAA 5HM8A 4ND5A 4F3YA 3DQPA 1HSZA 4CM6A 5L4NA 2IDZA 2NVUB 1H93A 1Z75A 1ZCJA 1A71A 4YB8A 1ONNA 1I5RA 4J1QA 1WNTA 1J0XO 3U4IA 4I5FA 3GGOA 1YOVA 5DZSA 7MDHA 4YACA 5IZCA 1EE2A 4JQCA 2DFDA 1ZMTA 5JDIA 4AJOA 1LRLA 2H1SA 4PN3A 1GEEA 1IUKA 1WDKA 4FFRA 4YRDA 3Q6IA 1E7WA 4FDAA 3C1TA 1UUFA 4O59O 1Y1PA 1NQ5A 4NBRA 2H9IA 3CTMA 4IDDA 2ZTVA 3AU8A 4RQUA 1XDWA 3V2GA 1NVGA 3H5NA 1JWAB 4MVJM 3DBVO 5G2OA 4Z3DA 4MVJA 2C5AA 5C37A 3PGJA 2VOJA 4DQUA 3RWBA 4XR9A 2HCTA 4ZQGA 1WLYA 4RPGA 2B37A 2WDZA 1TT7A 2FPPA 2P5UA 4MP6A 1MC5A 3ZI0A 1R0SA 5CEEA 2POQX 2DKNA 4RPKA 1M66A 2WD7A 1N1GA 2OFPA 3O9ZA 4E2ZA 2X86A 4GPD1 3WXBA 3RSHA 3TDKA 2JCVA 3Q2IA 2WYWA 5CDYA 4XWYA 2NQ8A 3WWZA 1ML3A 4ESOA 2CDCA 2YUTA 1MGOA 3VKVA 1VJTA 2V7PA 4U6SA 1ADBA 3PZRA 1PEDA 1U1IA 2WYVA 1HDCA 2EJWA 3C7DB 2WD8A 4GX5A 2ZQYA 4E2XA 3UAGA 2HJRA 3T7CA 3DTTA 1NQOA 1PQPA 2O50A 1P1JA 1VJ0A 1BVRA 3TZKA 2ZK7A 1LC0A 4JBIA 3VVBA 2AEFA 3FHLA 3WYCA 4A26A 4ZQEA 4BB6A 3PYLA 4XIYA 1KY4A 4IZHA 3DZFA 2BD0A 6LDHA 3GHYA 1R4NB 4J2HA 4H7PA 3QV1A 1VI2A 3DAFA 4M89A 4O0LA 2D1YA 3DHNA 2QRJA 5EMHA 1ADGA 4BGEA 5JCXA 1ZZEA 4CM8A 5EQDA 1XELA 2XAAA 4Z9YA 2ZTUA 5A05A 4AJKA 3WFJA 2VUTA 4NQZA 4Q3NA 3V5NA 1B16A 1IHYA 4BO2A 1UXJA 4INAA 4XIJA 1JQBA 5JY6A 4XYBA 3U0BA 1DC6A 2HLPA 1K6IA 3WLEA 2V6FA 1YL6A 2RH8A 3IJRA 2EG9A 1IPEA 3DBRB 2IODA 3GA0A 4MKZA 3VZRA 3Q9NA 1LEHA 1DIHA 4O63O 3JD1A 1ZIDA 3VPHA 3PWKA 1ID1A 1SZJG 2X4GA 1G6KA 5KVCA 3AUAA 2Y93A 2Y0DA 2PLAA 1FDUA 4QXMA 4FBGA 3CEAA 4GVLA 5HS4A 3KLPX 1A27A 4A2CA 2DBQA 4AJIA 3WQQA 1DRUA 1P1HA 3GNSA 3TZQA 4J7UA 3D64A 3I4FA 3KSZO 3TWOA 4J1SA 5LDHA 1QYWA 4HX5A 4RLSA 1FK8A 1GQ2A 2Q4BA 4CQMB 3BIOA 3RASA 4LSMA 3RROA 2BLLA 2CFCA 3ZWAA 2C54A 4WLOA 2O48X 3AY7A 4IPTA 2X9NA 1YKFA 3VZQA 2PZJA 4OL9A 1Q2XA 5KIAA 4J4TA 4TRJA 2NQTA 5IFLA 3FPLA 2B5WA 3OF2A 2YQ4A 4EITA 2D4AA 4IS3A 3X2FA 1Y9EA 1XEAA 1PJ2A 3PFFA 4JP2A 2NU6A 2AEJA 3RI3A 1LLUA 4MJLA 3WTBA 1CWUA 5LDGA 1YH3A 4OXKA 3ENKA 2EP5A 3INGA 1DIBA 4R01A 2D0IA 4YAEA 4BO7A 1DRWA 1NAHA 3F4BA 3WIDA 3OFSA 2I3GA 5GZ3A 2GASA 1I3LA 4RZIA 3ZW9A 5DOVA 5GMOA 3OIFA 1NVTA 1EDZA 4FW8A 1R6DA 3I3OA 2FR0A 4ZRNA 3GG2A 4JCOA 3K9QO 5BNFA 1E7SA 1X1EA 2HRZA 4W4TA 3ZWWA 3O38A 3V1YA 5KNLA 3AOGA 3LLSA 1GEGA 3GZ4A 1EFLA 1PGOA 1HEUA 1WPQA 3TZHA 1VSUA 1HSOA 3GGGA 1NYTA 4XCVA 4XA8A 4CMIA 1GZ6A 1XIVA 4I8XA 1Q0QA 1I2ZA 2VTDA 4I5EA 2JD0A 2Y1EA 2ZATA 4P8RA 4B4UA 1UDCA 3AUSA 2XPCA 4RVHA 2SCUA 3HB4X 2GLXA 3F6YA 3NT2A 1PX0A 3AW9A 2NU8A 4E13A 1PTJA 1SEVA 4EUFA 1O8CA 3S2IA 4BNHA 3EVNA 4AJ2A 3ITKA 3GDFA 3ST7A 3ZU5A 2CDAA 3K2EA 3FWZA 3IS3A 5U4QA 4I9NA 3H65A 2DLDA 2NVBA 1TEHA 3OJ0A 4ILKA 1ZVMA 4LCEA 5BR7A 4W82A 2EGGA 4ALIA 1C14A 1K3TA 3O03A 1Y5RA 1PWZA 3ZWOA 1EVYA 2GPTA 3B20A 3OEYA 5IDXA 1PU2A 3AI1A 3ZHYA 2TMDA 4BNTA 2P2SA 2EW2A 1MLDA 1MXHA 1UP4A 3JQ8A 3ZV5A 2B83A 5KWEA 3QVSA 2J3IA 1A5ZA 2O7QA 3C7AA 3HFGA 1OI7A 2O2SA 4A10A 4HKTA 3GVXA 3NTRA 1VL6A 3CMMA 3MWDB 5EESA 3RUIA 1E3WB 2ZB7A 4OH1A 5BSEA 1HRDA 4TKMA 4JX8A 1NWCA 3GVPA 5KJEA 4KUHA 3DOCA 5JW6A 3OETA 3HG7A 5DBFA 4ALLA 1HTBA 1HDZA 4UVHA 2GN4A 1DC5A 4AJHA 4E5PA 1W73A 1UZMA 3GPIA 4KTVE 2VZ8A 2DUWA 1WP4A 1QV7A 3LLVA 3W8FA 1E7YA 3HFSA 3U09A 3SLKA 2P9GA 5A9RA 1J4AA 1SPXA 3U62A 3WG9A 4YR9A 4RF3A 2YHIB 3WR5A 4GLLA 4L76A 3RU9A 3PIDA 3VC7A 3QWIA 1PS0A 1FDWA 1H9AA 4YJFA 2QZ9A 1ZEJA 1XKQA 1X13A 3HJAA 4DPMA 1ZJZA 1PS9A 3U9LA 4EJMA 4CLOA 3RFVA 3W8DA 4EBFA 3VZSA 4NK4A 1Y8QA 1M2WA 3LT0A 1YB4A 2W2LD 2BELA 2NSDA 5DBIA 1GPJA 1KERA 5TT0A 1N7HA 4WE3A 3V1UA 1P1FA 2DTDA 1G0NA 2GZ2A 3FR8A 4Z9XA 3KYDB 3FTPA 2R6JA 3OA0A 1HZJA 4MP3A 4XQCA 4E5NA 3F1KA 3FTNA 3I9JA 3TRIA 3DMTA 3ZWXA 3F5QA 3DEYX 3L6DA 3UXYA 4LN1A 2OP0A 3LVFO 3HHPA 5DBGA 4MKRA 3K96A 1DSSG 1PJ3A 2I76A 5JMWA 1DFIA 1H2HA 4PCVA 1X15A 3INRA 3TPCA 4Q3DA 3HADA 3DAPA 1I24A 1NX6A 3UW3A 2DAPA 3JV7A 4ZGWA 2AE1A 4XYMA 2X8LA 3WJ7A 5G0TA 1IYZA 1S6YA 4CQLB 1PQWA 1Y7TA 1LQTA 3AY6A 1GUZA 1GADO 1R4NA 5JO9A 5KKAA 4JROA 1N7GA 3NX4A 4TMFA 2ILTA 1MUUA 3DFUA 1YXMA 1HF3A 1MG0A 1UR5A 5DP1A 4YWJA 3AWDA 5AYVA 3W6UA 1P1RA 1AXEA 3KEOA 2GZ1A 3E03A 4J1NA 1B3BA 5A3JA 2PZLA 4HNGA 1AE1A 2CF5A 5EINA 4A03A 2PD3A 2Q2WA 1LNQA 5KJFA 1UP7A 5B1YA 1PS8A 1HE4A 5TSDA 1EVZA 1Q7CA 3Q1LA 4IJVA 3HNPA 3W4KA 4IZIA 3ANMA 3KYCB 1S7CA 3MEQA 1BW9B 2BFMA 1XU9A 2VRCD 1ISIA 5DCUA 4BV9A 1GU7A 5A02A 1HWYA 3DHEA 5T64A 3WQRA 3CZRA 4WNIA 3IKTA 2I66A 4RO0A 3MTJA 3WGYA 1JDJA 3M2TA 1PJSA 3LU1A 1ONPA 1PZEA 3DBRA 4TRRA 4UEOA 1O89A 4CM8B 4ZN6A 2WD7B 5CG1A 4D7AA 4PGFA 1MB4A 1YVEI 5K6AC 2JD2A 2EV9A 4IDGA 2HK8A 2GYYA 3MZ0A 3B1FA 4PLZA 1B8VA 1DAOA 1MC4A 4CLRA 5F1PA 5A9SA 1E6UA 3GUCA 3GAFA 4XJTA 4AICA 1RKXA 3LDHA 4FOSA 3LC2O 2HUNA 1XSEA 3BYZA 2J8ZA 4LRSB 5L7YA 3SJ7A 1ZO8A 3WB9A 5BSFA 4UUMA 3F4LA 1E3EA 1ORRA 3GOHA 4IDAA 2BFOA 1JKIA 1EE9A 3L77A 3MOGA 4UUNA 4W7IA 5BT9A 3WGTA 4FS3A 4M8SA 4E32A 1I32A 3KBOA 3MCVA 3QW2A 4GMFA 5F1KA 4XZ3A 2ZKLA 3W1VA 1I10A 4BNIA 3BHJA 3F9IA 4DC0A 1LC3A 2PNFA 4JJIA 4BKRA 3PYMA 1HDYA 4IJWA 3JQEA 4CUKA 4ZHSA 1WXDA 3KEQA 3AM4A 2D59A 2FN7A 3SX2A 1Y9AA 3F3SA 1HYHA 2E82A 3VZPA 3U5TA 4E6PA 1LXCA 4BQPA 3RCBA 3JYOA 3KUXA 4RV9A 2Z5LA 2VQ3A 4DLBA 2JL1A 3ICCA 5A9SB 1K6JA 4XKJA 3VVCA 3GG9A 1CQJA 4XEHA 4J4HA 4TSKA 2HMUA 3H5AA 1BTOA 4BGVA 2RAFA 4YT8A 1ZMOA 3VH4A 3RJ9A 5L4SA 3OM9A 1T2FA 3ZW8A 4PVCA 4B8WA 3CUKA 2ZB8A 1HDRA 2DM6A 2FR1A 1U3WA 4MIEA 4R9SA 4XRGA 4TRMA 4CL3A 3GHHA 1HE5A 1J49A 2G17A 2E49A 4NBTA 3AY3A 2HMTA 3LC7O 2AA3A 1LU9A 1YQGA 1ISGA 3RUCA 1W8DA 1R4MB 5HWSA 3KYCA 1WZIA 1JLLA 5GY7A 2YHUA 4J6FA 3K92A 3I9OA 4R3WA 4CLHA 1RYDA 3A9WA 1R15A 2NU9A 4YJFB 2GR9A 3IJPA 3JQGA 2BFPA 4L74A 3FPCA 4JBHA 4U0JA 1EUZA 8LDHA 3QWBA 1JVBA 5CEFA 3NYWA 1H6CA 3HN2A 4AJPA 1BDBA 4PFJA 5K9ZA 3ZCXA 5IJZA 3A4VA 1BG6A 1XA0A 3DMTC 1Q0HA 3AI3A 3RU7A 3QE3A 1BGVA 3WBBA 1GYQA 1O0SA 3LZ6A 4I5GA 3S2EA 2NADA 3GVHA 3NT5A 3D3WA 3ORFA 1E92A 4PG7A 2IYOA 5H82A 5KTKA 2QW8A 3E6AA 5T6BA 1Y5MA 2EERA 3K2BA 3R6DA 3Q11A 3KM0A 4QTZA 3LF1A 3UFXA 2GN6A 1QSGA 4RPHA 4YJHB 3U3XA 1XG5A 4YRAA 4NBVA 4E3ZA 3ITDA 4KWIA 5TGDA 3ROKA 2OP1A 2ZCVA 3NUGA 4U8GA 1DIGA 1KETA 1NPYA 4BNNA 3VTFA 4IJUA 5JXWA 3H9QA 3GY0A 4D79A 1OZAA 1V3TA 5ES3A
chains in the Genus database with same CATH superfamily
5EFZA 4E3WA 4B7CA 3QBDA 4YQZA 4UQOA 4S04A 4DXAA 1FVOA 5D3QA 4YV0A 4QRIA 2TMGA 4Q9NA 5FBLB 3WS7A 2AEMA 3S5UA 3I30X 4BQQA 1QK5A 4NPAA 1UWLA 3ZVKA 3SZUA 2WQ6A 4DCNA 3EFOA 3TBKA 4BXOA 4R51A 1WEKA 1U5BB 4WLEA 8ABPA 1MQAA 3JASB 3TSAA 3WLTA 1VSBA 1XZ8A 2WWIA 5TVGA 1IBMB 1N2HA 1T2CA 2X5JO 3ELYA 4TYNA 4CM3A 2ZM5A 4MEAA 4RETA 2C9MA 4E08A 2BBOA 3IHTA 3SGLA 2OFWA 3MQ2A 3V2HA 1KYVA 5J1SB 2K5UA 3CPSA 3L41A 3Q12A 2QT9A 2RHTA 1T9AA 2NTJA 1GZUA 5ER6A 2QGFA 3OTHA 3LO5A 3N7UA 3J7AC 2CFSA 3TQQA 5K0SA 1G8KA 3AFHA 3G59A 5JIBA 2BFWA 2R86A 1OLOA 4RPLA 3E61A 1T26A 2H00A 3C5CA 1GY8A 3RABA 2GSDA 3FNFA 4TKZA 1J6UA 4YWHA 3O8CA 3U4QA 2JGKA 1OYOA 2OA0A 1TM4E 3TQCA 1V16B 2AYXA 4JYAB 3U5ZB 2OV1A 4IFEA 4MDYA 4CT0A 1JKMA 4OJQA 3DKKA 1A5AB 2XRYA 4FINA 5IJXA 2VQEB 5F77A 3GLGB 4OM8A 2NAFA 3WYDA 3KEGA 3EISA 1WJGA 2EJVA 3H17A 3AJRA 4UTVA 2V5UA 3PJFA 1GPLA 2PSSA 3G2JA 1M34E 4ND8A 1CUWA 2QVZX 3Q3GE 2EW1A 1GPKA 2DXIA 2ZBQA 1SK9A 3C7TA 3BGOS 2ZE6A 4KIWA 2XWPA 3ZWQA 1C0PA 3TI9A 1I94B 3THRA 4C6RA 2REXB 5ALHA 1C7EA 3BB3A 3O8DA 3C14C 2QSYA 2BEVA 4FFNA 4IQ8A 3F97A 4KVFA 4EHAA 2X9VA 4PLPA 1AN0A 3SYRA 1SU4A 3IEUA 3L4BA 4GLFA 5L3ZA 4MRRA 2FMUA 1Q3KA 3G7NA 3O8LA 3O1JC 1K9SA 3U4MA 1TDJA 1L7VC 2OSBA 1YDFA 1R00A 5E2IA 1I01A 2A0XA 4DMKA 1RM4A 3PEVA 4G84A 3RWOA 4KMOA 2Z56A 1E2LA 4UTXA 5KTNA 4HJXA 4CR8A 2HLDA 2VWGA 1OILA 1YA6A 2XDQA 3M70A 1X87A 2WT4A 3WYNA 3VTZA 2QZPA 2QM8A 1A9QA 1CUCA 1K8RA 3BWBA 3DOFA 4AJ4A 2HB6A 1I4TD 3Q98A 5ENZA 3EW9A 2ID7A 4PLFA 3AUUA 4W9RA 5KNDA 4LYJA 1KAHA 2A5YB 2H5EA 3HWRA 4ZI3A 2FN8A 4V0KA 2E1PA 1ZCBA 4WASA 3CR7A 2ZYVX 4X61A 1JU4A 1DJQA 1YJCA 2GJKA 4BZPA 4C14A 5B1IA 2GXQA 5I8ZA 1ITZA 1T4CA 5B58C 1SVLA 2QRZA 5KYYA 1MH9A 5AHOA 2CXUA 3OMLA 4MV0A 3QUTA 1A3CA 4RVFA 4M7WA 4OLAA 2PKQO 1H6BA 2QTLA 2BJWA 4D6XA 2F4NA 1PTKA 3K20A 4D4GA 5HIAA 1FDSA 2ZT7A 3RYFA 4ARZB 3MJTA 1YZQA 3OEHD 2QTVB 1KKLA 1W46A 2C03A 1IB0A 2GH1A 3SR0A 3KQOA 4QUJA 3TXYA 3GH3A 3AOEA 1QRRA 2ZJ3A 1RQ2A 1L7OA 1TVCA 4MUAA 3OBBA 4LWQA 3UK1A 2J7PD 4E5SA 3KUCA 4AFNA 3K2IA 4CMCA 3ZDCA 1QOZA 1KOJA 3R9XB 3ZDQA 1P7YA 1PWEA 5AESA 5EJ5A 1KDPA 1H1DA 1AF4A 2O2ZA 3ZIAD 4DMFA 1LUAA 2DPHA 4XRRA 2KBFA 5KTRA 1FEZA 3A8TA 1UDAA 3HDTA 2CJXA 4TKUA 4PR3A 5KTPA 4RGYA 4GI2A 1P5ZB 1TRHA 1NUQA 1XTIA 3HKEA 4O4IF 2JH8A 2DWQA 5L3QB 5GIPE 3OHSX 2VDPB 1NN1A 3LS2A 4PX3A 1EQUA 3T4UA 4PLVA 1CQZA 1T8RA 2RHBA 1BCSA 5T3YA 2H52A 5DHRA 5LJIA 1Z83A 1Y89A 4NOJA 2HJGA 1LGYA 3HDVA 3O93A 1Z2DA 4AECA 1HA3A 1ENOA 1WF6A 1M6VB 3JRXA 4FEYA 2PRYA 2VJQA 3PHHA 1E6WA 1GV0A 1BWRA 1TCUA 1GQQA 1JPVA 1KY3A 3SJBA 4I9FA 1DELA 3RVMA 5G40A 1WXXA 2HK9A 3Q0EA 1ZNXA 4EUEA 2QT0A 3BSYA 4UZEA 4F45A 1J0AA 3ZV4A 3OQPA 1K4MA 2BR4A 3SFZA 5IJWA 3G7SA 3S44A 1ORHA 3WL4A 4M8KA 3KQHA 4TROA 4FFLA 4OHPA 4C4RA 4CQMA 1KEKA 2WZQA 4YMWA 2OHGA 2IS1A 2OAQ1 4YREA 3GJTA 2X76A 1I0LA 1L8QA 4OH7A 3TQHA 1AS2A 4YRGA 3D3WB 3IMFA 5B4UA 4EF5A 2PUHA 5LXTF 1M0EA 4XLZA 1F2UA 2QUKA 3OP4A 1GT91 4D0GA 4Z51A 5MGBA 2ZG6A 1RP1A 4MAAA 3WA6A 3T5DA 4BMDA 5HUJA 1HL3A 4HFMA 3F73A 3I0ZA 1K0UA 4UCWA 1J24A 4MW7A 4YP1A 4N47A 4MPJA 4E7PA 3AV3A 4EZEA 2VPWA 1K4YA 1NIJA 3HZZA 3HBFA 5TRTA 3EEOA 3TLEA 1NFQA 4TV9F 2Q8PA 2JLRA 2XEDA 1R0YA 1TO2E 2YJ3A 2ONCA 4RH0A 3UMCA 4P4GA 2HXYA 5IU6A 1WXIA 2AOUB 5JAIA 5P21A 1C7ZA 1X0XA 1KU0A 4LFAB 3Q7QA 4FFDA 3RAJA 5LKRA 4KH0A 3FFWA 5JQGA 3ETHA 1KVUA 3TX2A 4MHOA 1XRNA 1D4AA 2C88A 2FTKE 1C29B 3B1ZA 3QXHA 3T1NA 1V3UA 5C7IO 5KHLB 2IEZA 4IIJB 3F67A 4BNXA 1JYFA 1I1OA 1LLFA 2CXTA 3L0CA 4P0TA 3H5VA 2BCEA 1OFIA 1U8AA 2ZI6A 3LPAA 4NABA 4BL5A 5MDHA 4TOIA 2NZ8A 2IDKA 2VNSA 3AI7A 3AR2A 3EBLA 4MUMA 3IESA 2B2XA 1NLMA 1JIVA 1YDHA 3IPXA 3PJDA 5DHTA 3WZMA 3RUEA 4NZOA 1HT3A 5CYFA 1RPZA 3ORYA 2H4ZA 4L02A 1XR3A 1Z16A 4BBZA 3GAMA 1YSCA 4JS0A 4ZCTA 2C9DA 4MRMB 2PWPA 1PT5A 3ZHZA 1E9CA 3HI6A 4MWSA 2AJBA 2YV1A 3PR1A 3C39A 4UM9B 2PD4A 1O96A 4Y6LA 3S6JA 3VNRA 5K0BA 3G88A 4FFMA 4HDNA 3T5GA 1T6ZA 3ONNA 1OU4A 1Q0UA 4P22A 1QNFA 4QNRA 1UBRS 4CKEB 2OUKA 1P5FA 1LCIA 1AMOA 2BEUB 3CEMA 1J2UA 2EGHA 5KAPA 5DCYA 5KI6A 1CUBA 4YEDA 2GDZA 2D5IA 4JEMA 1P9RA 4ALNA 2FLWA 1JQJC 1AS3A 1P4JA 3EWSA 4HAIA 4UE6A 2Z2IA 5G0SA 4NPCA 2RDMA 2Z3WA 3AJAA 2HMSA 3HH8A 4CIAA 4DG9A 1YQUA 2IHNA 3RJ5A 3EEYA 1FQJA 1QZTA 4EJSB 3RQSA 4V0QA 2VDOB 5ITSA 1EJ6A 3RYCA 3KKOA 4YCJA 5FLXA 2A9PA 3L0OA 2IUFA 1E8DA 2RI0A 3OOJA 1RYBA 3OJXA 3L5OA 5CB6A 2P2GA 3GJQA 1P77A 4YAFA 1QF9A 3U7QB 4L6CA 3I1FA 3BL5A 4QDXA 3JATA 4EHIA 1BAPA 2V9PA 3GGDA 4ZDIA 3GOQA 5BW4A 9MHTA 3K6SB 3P7MA 3TCNA 1OH6A 2IX9A 1CZLA 1D7OA 4JODA 4PQGA 1QKIA 1TMYA 4LW8A 3DKIA 1DXHA 4S12A 3KTFA 2DEUA 3UCFA 3TVYA 4KV9A 1PJ4A 4AWBA 1NN3A 4WVFA 3PBKA 5JZOA 4R1TA 1AG9A 5ALEA 5U9CA 4U6QA 1E3SA 2XCTB 3P2MA 2PCJA 1C9YA 4ZGBA 2A1UA 3Q7PA 4M0MA 1PBNA 2YYYA 1PT9A 1KWGA 2V8BA 4PZDA 3VO1A 3IP1A 2V5AA 5IAAA 1NBAA 4YRFA 4NEQA 1CPYA 4XM0A 1A9XB 3LK6A 1KBZA 1J06A 4NMXB 3AEUA 4XUEA 2E4XA 4KQCA 1QLHA 2D3TA 3JTMA 1M74A 1RU3A 4FOTA 4RS4A 2RIRA 2GEFA 2XKKA 2CJWA 2O4UX 3HWX1 4FGWA 5EIXA 4MQFA 5CDSA 2EHJA 2MJLA 2GCOB 2O0HA 1Z0AA 3HV2A 3FYCA 4LBVA 4EKIA 3OQVA 5H5JA 3PR3A 4AZ0B 1LZKA 5ICMA 3CJQA 4YLEA 4ITVA 1XAGA 2YH2A 2Y1DA 4NEHB 3JQFA 4YDSA 1M6VA 1QC5B 3I9KA 3SOPA 821PA 2OC9A 1WY5A 4O1HA 4PIPA 4CKEA 3E1KA 1XNHA 5M3BA 3SZRA 2ID8A 3ANSA 3T3HA 2CXSA 3GD7A 4JI8B 1R6UA 3L4EA 3ZIDA 5JS8A 1RZRA 1WSAA 1F8XA 1AMUA 1BD3A 2C5BA 1E5QA 3FPHA 5EEGA 2QX9A 3KPYA 5AJWA 1F4VA 1XF9A 4XD7A 5HBRA 4KFUA 2GXAA 1L7RA 3ZHQA 1NYLA 2EQ5A 2JAWA 2Z43A 1B00A 1A1SA 2NXEA 3L8HA 4HFNA 2PZAA 4LZOA 2OD2A 3SNKA 3TLMA 5K6RA 4N5LA 4RJJA 3MJEA 1K3UB 2A8YA 2CGEA 3NWOA 1H2XA 4B6FA 4MIKA 3BRWA 4CRWB 2H7VA 3JQCA 5G1OA 5A06A 1NGSA 3Q3EA 3L1JA 5KNDD 5AP9A 2YVKA 2RAVA 3QVLA 1OJLA 2OWEA 1GXSB 4KQ6A 3WLPA 3SBXA 2QTVA 1Z0JA 1O7JA 4BLWA 3GPLA 4D9BA 2P2NA 2JGLA 4MJXA 3QKWA 2AK3A 4UU8A 4ZHQB 1RBQA 2VDLB 3EASA 4ICIA 4Y9UA 2YCBA 1OZ0A 3H2BA 3ESQA 5F9MA 1INLA 4BO5A 3E0XA 1ECFA 1W9HA 4U5QA 1LPNA 3AYZB 4PXSA 1DXOA 3CNEA 1ZXXA 3C15C 3FOAA 2OGZA 4MOWA 3X1KA 3ZG6A 3A2KA 5EJGA 4B9AA 3DT6A 4G0XA 1QQAA 1OXVA 3PG5A 1PGJA 3IVRA 2FVYA 1MB2A 3CH4B 3VBEA 3SC3A 1PJLA 2GA9A 4RE6A 1PR9A 1M54A 3RNLA 4V2IA 4ZOBA 2A5FA 2FWBA 1FFCA 2I2BA 5FPYA 3ZHUA 2Q0XA 5T6MA 5BURA 5AFSA 3E35A 4XJVA 5B3JC 3RT1A 2VT3A 1FLAA 3P9ZA 3IAAA 5LNK6 3HUEA 1Z5GA 5JISA 4ME6A 2QPLA 4GPIB 4HAVA 4IW3B 1RHJA 2AHRA 4LXTA 3TLGA 2CL6X 2ZVQX 1OA1A 1YC5A 3UKJA 1SKYE 2CHVA 4UULA 6Q21A 1Y1KE 4PG6A 4Q48A 2D2XA 1G8HA 4RD4A 3TZLA 1NR1A 2L69A 2QORA 1KDTA 1ZD9A 1WPXA 2QI9F 1VXOA 1MU0A 1IMJA 3M89A 2RD2A 5ICSA 3KVRA 3WJ7A 1WMFA 4CMKA 5KQGA 1U2DC 4L15A 3PNYA 3BZUA 4YN3A 1RLUA 1J8QA 2F55A 4K3VA 4E12A 2FMFA 1I6KA 3U17A 3NHAA 1E77A 2R48A 1T0UA 3WOHA 4ZO6A 1M1XB 1FUEA 3AP3A 4BEVA 3X43A 3N5KA 1G5TA 1E3JA 4M46A 3WICA 4CV1A 1O6BA 2AMYA 5SZIA 3A9SA 1SUAA 1XFAA 5ENDA 3QLVA 5BY2A 3T3DA 2ZTMA 1H0KA 3W6PA 3E9YA 3ZZ0A 2CVQA 1GGMA 1I8TA 3ORRA 4F71A 5EZ6B 4OX9Y 2CDBA 3K9GA 1NSYA 3ABIA 5ERYA 3QH4A 3PXBA 1ZH2A 5BN5A 1KOFA 4GEGA 4OYYA 4ZZ2A 5IUJC 4QO7A 3WLAA 1XZBA 1FE8A 5AWFC 5LUAA 3GJ7A 1U2GA 1Y3HA 3CB4A 2VA9A 4B7UA 1CW2B 1O97D 4AYXA 4BZQA 4YMLA 3FSGD 3N28A 5DNEA 3SHTA 4TS9A 2GARA 3UV7A 3ESRA 2HK6A 4DN6A 4DLNA 1KYQA 3LRPA 4JYBA 3DB2A 3WFIA 4X7RA 4D98A 3MWLA 5T67A 1FYXA 3JWGA 3QMMA 2VHQA 4B47A 4K87A 1CJCA 2C2XA 4KGDA 2R6GA 2FSFA 4HFRA 1TM7E 2VNIA 4R1OA 4WIAA 2A7XA 3U37A 3LQQA 5CB4F 1Q22A 3ULKA 1Y3AA 4YCAA 2X8WA 4OXXA 3DCYA 4PONA 1S9DA 4REMA 1ESNA 4I2NA 2BVNA 4N8SA 2OZLA 2JI8A 5I7EA 1C3OA 2AB0A 5F64A 2FMIA 2AI2A 2P35A 4Q9HA 1D2GA 1E1CA 1O1YA 4FWIB 4LJKA 5HM6A 2FZCA 2IU0A 3SZGA 4DLLA 5KKCA 3R0IA 4JJ6A 4LJLA 3VC1A 4C0QC 2ZJ6A 3WZ2A 3CG4A 4CPDA 5JWOA 3P0JA 5DMHA 3KZCA 1E63A 2ZJBA 1LW7A 3LECA 4M76B 3V8VA 4OLJA 3WL6A 4G63A 4EKGA 4Q02A 5HTOA 2IIBA 3RS9A 3KVVA 3P9NA 4WY5A 3MGKA 4BKUA 1TMGE 1CS4C 3NDRA 2X0NA 1EYZA 3QX8A 2ZUBA 1IBRA 3HTXA 3ONWA 1ZBQA 2VH1A 3I6MA 3H2YA 3ABSB 5FTKA 4RD6A 1T3ZA 3TE7A 3LY5A 2XDYA 4F46A 3K1ZA 2OTCA 1NUHA 1UJ6A 4NICA 4NOLA 3UANA 3IBGA 4WLNA 2VUHB 3FKQA 4IJMA 3ZGVA 3EY4A 1Z2EA 2NXWA 3GLIE 2Q9AA 2VQ6A 2BSXA 3AKYA 3AVQA 2WWGA 2WUGA 3EGWA 3KPJA 2CFOA 4PHTA 1OJ7A 2LDBA 4Q7EA 1U8XX 4OTZA 5E1OA 3UV6A 5E9QA 1KMMA 2O05A 1AKTA 3DLIA 4X63A 1P1CA 4MWDA 4WBNF 2NO4A 5JOQA 3FMOB 1NF9A 4UXIA 3L7KA 3N0XA 3M6LA 3BCUA 4HZIA 2C20A 4W8GA 1ZK4A 2X0JA 3TRDA 2WZCA 4WFIA 1A77A 1TUIA 2HPAA 3KVOA 4TWRA 3TLGB 3LTNC 1XVIA 1CB0A 1PEYA 4H7IA 1EWRA 3WBFA 4W1PA 4FYIA 3USZA 1P33A 3ER8A 5KPDA 1TYAE 1Z5NA 2GHRA 3G9QA 4OQQA 1NZJA 3PFWO 1FVFA 3N70A 2WQZA 2VPZA 5DEOA 2QXYA 3BJMA 1WV0A 4QYSA 3WRVA 2J33A 4RJIA 3STWA 2JI9A 4XSVA 5L7WA 1LSSA 4AF7A 5ILOA 2OQ2A 5DLEA 2P1DA 2X40A 4DV2B 1EESA 3EOBI 3IIJA 2VK2A 1GA1A 5JYDA 2WI8A 1XTSA 2NWQA 1PL8A 1HFEL 1TZCA 3QVXA 1CERA 1ZINA 4CI9A 4TQGA 4GYWA 2W6OA 3QEAZ 2JIQA 1IC6A 4IDHA 3JD3A 5GGXA 1Z5ZA 3LBHA 1E9VA 1K27A 3ML1A 1C7IA 4EGSA 2UYQA 4YRZA 3S29A 1NN5A 1U5BA 4W5QA 1K6EA 1RXYA 1QLJA 4NRDA 3UB3A 1DCTA 4X41A 5C51B 3QPVA 1HT0A 2PMWB 5FV7A 3LL4A 1DX4A 2W6PA 1E5XA 4B7XA 3C8HA 4G8DA 4TXJA 4HLUA 3EIHA 4O4JF 5B58T 5LQKA 1MPXA 2CLCX 3AEUB 3BXHA 4OJMX 4BKQA 3MAJA 1JA1A 4MMZB 4C7JA 4D4HA 1SVIA 1NMSA 2QLBA 3LF2A 5TT1A 3TAHA 3PDUA 3ICVA 2QTBA 3Q2KA 4ZVSA 3A6JA 3F7TA 4GMKA 2DP4E 3ZX5A 2H4WA 2CXNA 4KFRA 3V7WA 3RR2A 2NSHA 1RKBA 3MT0A 4W7SA 4I1PA 4J2TA 4UUAA 3DZ8A 2IEIA 1DNPA 3SC4A 4XDHA 4ZVMA 1J90A 1QGOA 1PDOA 1JJBA 2C9YA 3E3LA 2JFBA 1AUXA 1JXMA 3I2FA 3OUUA 3DFKA 3E9QA 4HUJA 1TA0A 2WBLC 3MTIA 3R3SA 4ID3A 5IANA 1BJKA 3V00A 2UV8A 3I6YA 3Q0TA 4L3VA 1XDSA 3ISTA 4GMXA 3C8UA 4GMDA 4TUYB 1YJAA 5ADUS 1AO0A 1XQ9A 1NRIA 2C4NA 1W8IA 3G13A 1UBCA 4L85A 4F6RA 2JFQA 4ER7A 3ZEAA 1NBOA 4XM1A 2A35A 3E18A 4BEJA 1HEIA 3DE7X 2W2NA 3P2IA 4H0FA 5EPEA 1P62B 1PJQA 1RCFA 1UXOA 4LJYA 4UMEA 2AN9A 4CODB 3K71B 3CRW1 4Q9JA 4Z53A 2ZQ5A 1V7PC 1NM5A 4IVPA 4G8BA 3D9QX 1QFYA 4BP3A 4BRWA 1M7GA 1KI6A 1AN9A 2GBFA 3PL5A 4N5DA 5EGSA 1P6XA 1YUBA 3VQTA 2XZLA 5AI9A 5G1PA 3VC2A 4X62B 4PSVA 1EAYA 4TTVA 5B3LA 1ZY2A 1XMPA 1KF0A 4GYJA 1OIVA 8ATCA 4LFCB 3B6MA 5D8DA 1XVAA 2FW6A 4HDKA 5A0FA 4MDFA 4BZXA 3MTGA 1B0ZA 1BZYA 3MCUA 1N2IA 2BKXA 1JHMA 4P84A 3P52A 5BMVB 4V0ME 1O8BA 3FUXA 3QVWA 4OF4A 4Q1DA 4DQUA 2DQ4A 3K9BA 1Q17A 3D5QA 3VAYA 1GCIA 3ZEIA 5ICGA 3P9RA 1T0BA 3HKBA 4DDTA 4R2JA 3P19A 5KS2A 4O0MA 3K5WA 4B3SB 1XMVA 1XYVA 2GKOA 3NM6B 5J63A 3U7QA 1I4DD 4MUXA 1UKEA 2O8DA 4RV5A 5E6RB 1W0JD 2VP9A 3UM9A 4GBMA 3LTEA 2Q3BA 1JXAA 1YQTA 3G5UA 4XX0A 1XRLA 5EHGA 4EM6A 1VG1A 5J4HA 3OU6A 4M38A 4HWOA 4IMRA 2HOQA 5IT5A 2D5AA 4ND7A 3K0AA 3OLXA 1XDBA 5I7UA 3DVQX 3QNWA 2C2OA 2QZ4A 4YRKA 3QQPA 3T52A 2OWDA 1TTQB 4JR1A 2QDKA 4LXGA 1XRQA 2FQWA 1JSRA 5J40A 2FQYA 4EBBA 4UQPA 4J4BA 5CA1F 1L7XA 2WTAA 4DR1B 4QVKA 3QFRA 3HUDA 3WSWA 4TLBA 1RI4A 1VHQA 2MT9A 2VTVA 1BMDA 3E9MA 2O8EB 1EVLA 4LZLA 4OFWA 4PGGA 4L9AA 1JDSA 3EPJA 3DNFA 4W6ZA 3WK7A 5EFOA 4EF4A 5E2BA 2GYUA 4TTSA 1BHSA 3ZBQA 2ERCA 3HQ4O 4MVJD 1EEXB 1NVDA 2JLBA 1W36B 2QJWA 1Z82A 2I9KA 5ALDA 3GIDA 2H4YA 4GOLD 3NCTA 4LOLA 4EL5A 2HXSA 3DOOA 4FYXA 2OAGA 4WNYA 3H3JA 2FV8A 1TEVA 4OHWA 3AF5A 4TV8B 1F2DA 2R6AA 1JILA 1RPAA 5KOIA 1VPTA 4I3HA 2HQSA 3M1IA 3CEHA 1N2CB 3ND7A 4DUYB 1EFVB 4KR2A 4DCVA 3QOXA 3PA6A 2WSBA 3ZGOA 2IIQA 4KDFA 1BWPA 4IIBA 1I0ZA 5FOSA 1V1RA 1NBHA 4EB6A 5F7OA 4H60A 4D46A 2BTEA 1DO8A 3L7IA 3IRVA 2WM8A 3V32A 2FW1A 3GK3A 3WHPA 5KYWB 4AY4A 5ARBA 2QN3A 2FUG6 5E7QA 2NACA 1NQUA 4U7DA 4U2EA 2CHUA 3ESZA 2H31A 3KDAA 5YASA 4L0DA 1TMKA 2G04A 3CYFA 2JHPA 2HADA 2UZIR 1XI2A 3M1YA 2ATXA 3CKYA 4ZAFA 4F5EA 2UU9B 5JCPA 1O77A 3DE3X 5AUQA 3LQFA 1B15A 4IDQA 1CEQA 2QRPA 3FRJA 4UAUA 1ZD3A 4B44A 2VF8A 4UZFA 4US2R 4YQYA 3RSFA 1JHYA 4BQIA 1YE8A 2ZUEA 3D4LA 1E6LA 3GLTA 4GHWA 4QJ4A 3U60B 3GZJA 4F85A 2YVUA 3E5RA 4EKDA 2Q6KA 2V7EA 4I4TB 4DQVA 2PMBA 2C0PA 3I9NA 1P2VA 1XKTA 1VBKA 4XJSA 4BECA 1YBAA 3C45A 3TQTA 3WA7A 2ZBRA 4QT4A 5AVQA 3BB1A 1TO6A 2VP5A 3GDHA 1RLJA 5CT4A 4YMHA 1LDGA 2Z5GA 2ZR8A 4I9HA 3EBOA 4Q7KA 4POAA 2G1KA 1MJFA 4Q1VA 4BYGA 2HK7A 2IYXA 3FBWA 5DK6A 5B53A 5KNCA 3BGDA 5ITVA 4J49A 4BNMA 5KWSA 4LY3A 1W0KD 1T9ZA 2CNNA 1MRSA 3KCNA 4PPQA 2Y1OA 4U2DA 3NAQA 3PIIA 1JIJA 1A97A 2VH2A 3ZTYA 1Z56C 4LMAA 2JLQA 5B3JA 2XSZD 1P1IA 3OLZA 3WGUA 1LKZA 1JR2A 2FVXA 2ORWA 1GPYA 4JD5A 1D2RA 4JYCA 4NDNE 2W6CX 1TM5E 3BCSA 5CAEA 5MFZA 1DS6A 2GCGA 1RC1A 2JK0A 2ZR9A 5D5PA 4F06A 4RTRA 3FI0A 4OQEA 3ZH2A 5JFOA 6ADHA 4QICA 1IHOA 3H11A 3DYIA 5JSYA 4FHCA 3L7JA 2F1OA 1CR2A 4E2WA 4UJ5A 4S1WA 3IAM6 1G1AA 4TTQA 1DC3A 2X1HA 3MWEA 4KWCA 2HU8A 3EH2A 5EZQA 3TJRA 2P9ZA 1SU8A 1IU9A 2O3RA 4R2HA 2FPSA 3CIFA 2MSCB 3GUYA 4FC6A 1FP4B 5JH7B 2E5LB 2O8CA 5GQSA 2GERA 2Z2YA 1ZC4A 1GM5A 2W93A 2V7UA 2W6IA 3RHTA 1EP3B 2WSIA 3FHCB 4C6SA 4CKCB 1ODLA 1QX3A 3IKJA 4A6DA 1E5LA 1YONA 3ZXIA 4Q4AA 4EGJA 3RAGA 1O95C 3FBGA 3FWYA 1N3BA 1NNUA 2JI6A 2Q3MA 1CDZA 3E22B 1R18A 3H0KA 2BH2A 5THKA 2D7DA 3M4YA 2XBMA 2DBYA 5JWHA 4GMGA 1JMKC 3LWBA 1AS0A 2HSZA 1XTQA 3N8IA 3OFJA 3S8YA 3QZUA 5FORA 2AKEA 2BFDA 1S1MA 1TT5A 4LCJA 3FOWA 2M32A 3RYFB 4PSDA 4MPPA 2ZUCA 3V3TA 3VR5H 1QGZA 5IM4A 3IMCA 4JR2A 1DT3A 1QCZA 1TB4A 2VEOA 3CF0A 3EPRA 3HB5X 4F60A 4NE9A 1U0NA 3TZBA 1G1MA 1Z18A 2J6HA 5CLGA 3B6JA 1SGWA 5LYJA 4CTKA 2IIPA 3DOIA 1J23A 5IDQA 4HLUC 1DKLA 3K9HA 1RJDA 2MINB 1RZRD 5EWMA 1PQUA 1A1VA 3K70B 1KEVA 3ETDA 1W6RA 4F1KA 2C3OA 1SQFA 3E3NA 4PLWA 4BC0A 4U7GA 2VDQB 3OJFA 5ICEA 1O54A 4IJ5A 4MRVA 4N54A 1WE2A 4WEQA 1QYRA 5D3KA 5DNCA 1FMTA 1R8QA 4BCCA 3EFEA 4ZODA 4BMPB 4M1WA 5I9NA 3LCCA 4ZU6X 3IB3A 5IXYA 4DBLE 1N3IA 4OKNA 3Q5GA 4PWZA 5DRYA 2CF6A 4GQIA 3O31A 3GLHA 3PDIA 4JBYA 4ZXFA 4WGFA 2ZAIA 4XUDA 3MWEB 1YBMA 1J2TA 3DEZA 4M55A 1FYVA 2IS4A 2W8BB 1XZLA 1XVTA 5JC1A 2FR8A 1Z6ZA 3GLVA 3L2OB 3MWDA 3PPVA 2ZI7A 2O59A 1X2EA 3BULA 3G5AA 4OIFA 4ZCMA 3C0KA 2BEVB 2DU8A 1MIOB 1ZMXA 4BMOB 1U9CA 4MAMA 1VXRA 1XNGA 2A30A 2F64A 1QMGA 4HOYA 4KO8A 2VNKA 4TSFD 1ZA1A 2QU7A 3C6YA 4MUGA 4KLAA 2HXGA 3GJ4A 3U3ZA 2Y66A 2LCQA 3ZNPA 1RACA 1NQWA 2YY5A 3JYNA 4MA5A 5CD9A 3TLCA 4GP6A 4CCYB 1CUIA 1FDTA 1ZS9A 3WMWA 1JT2A 3VYSB 3TOXA 2BSQA 1N2CA 1V4BA 3FA2A 4Q3BA 1ETUA 3NAZA 1GRNA 2C1EA 4BNZA 2XGGA 1DMRA 4B6EA 3FF1A 5CCDA 3RTEA 2Q29A 3FM9A 5DP2A 2I1LA 4O6VA 2WJ6A 3GD5A 1RQPA 3KXLA 1WXWA 1PP4A 1YQWA 2ZYWX 1C4OA 1K89A 4KO1S 5KCMA 4MTLA 4Y6GB 5CB8A 4NZNA 4HFJA 1FTSA 3EH1A 2HC9A 2YIVX 3F3YA 4DDVA 4CKZA 1VKOA 2LR0A 4IJ6A 4FJ2A 2NU8B 3NATA 3K72B 4OP3A 1L5KA 4UFNA 1XPUA 2P9QA 3FLMA 4NMLA 1C9NA 2ZRIA 3CLKA 4MIOA 1QH8A 3CPJB 3HLYA 3HKCA 2X0RA 4XIGS 5CXSA 4C9BA 1W0CA 3MM4A 4C7KA 5A03A 1BXZA 2YR0A 1ZSYA 2VYNA 3IUJA 3QUQA 4JT8A 4NHEA 1YRAA 2OCKA 3BM5A 3RVNA 1BXKA 1M75A 1J5PA 1VRWA 2CNOA 3AKDA 4JEIA 5I9TA 3VR6H 5K0TA 4QUDA 1KPGA 4OK6A 2V7VA 1JEYB 4FC7A 4YMIA 1IN1A 1OT5A 2H8GA 1FLDA 1Z0SA 3HS3A 2WVAA 2FSGA 1LDNA 3I72A 3RBXA 3ZV3A 2X6TA 3SIRA 1POWA 5I7FA 1ZFNA 1GQFA 1O95D 3R0QA 2Q2OA 3FI9A 3RREA 5DW3A 1LDEA 1X9GA 4M9RA 5BYKA 4M1ZA 5FPQA 1DTSA 4IWNA 3F8TA 3O47A 2WUWE 4H0NA 3GLFE 1D1SA 3JD4A 4FOOA 4EGAA 2GPNA 5JDCC 2R1VA 2OLKA 4FS8A 3SM9A 4HNTA 3ABRB 4PG4A 3L6RA 4C7XA 5JANA 4LF4B 3ENZA 3PC4A 5IDYA 2I2CA 4WK4B 3RVDA 1SU7A 2ODAA 4EG3A 4ERXA 1KQPA 2XAUA 1JTVA 5IJAA 4YCNA 1A7KA 2FMXA 4EKEA 3VHRA 2W0MA 5C7OO 3THYB 4ZJZA 4LQDA 1U7UA 5EYPA 1F06A 1F6DA 1W0KA 3DF7A 2VKQA 3ELWA 4KYVA 2GFIA 3L8GA 1UQRA 1LDBA 4MMXB 3ADOA 4OQMA 2DPLA 3B13B 1QHIA 1SOVA 3LHIA 4NZ9A 4D26A 3QELA 3AEQB 3NORA 3G3EA 2HAEA 3CX4A 1K6XA 4JL5A 2V1UA 2FSVA 1SUFA 1DEHA 2ZAMA 3CWQA 5ALKA 4LOIA 3LPNA 3A28A 5HSGA 2DR2A 5IDVA 4DM7A 4QHYA 2B6HA 3TQSA 4CDGA 3K0EA 4M0CA 2B1GA 1R6XA 3VZBA 4ER0A 2X9LA 2VYND 2WF7A 3THWB 1TCCA 2ZJAA 2BH9A 5AW2A 5JXIA 3OCZA 3UAOA 2ANCA 4X7PA 2BCGY 3UGTA 1TIKA 2WF9A 1VP3A 2ZYSA 3Q3CA 1DARA 3A9UA 1SB8A 3IERA 4HO1X 4P33A 5KOHA 2I29A 1SMKA 2QZJA 3KKMA 3H3XA 3NIWA 1EFAA 1QRTA 2P0EA 2HLNA 3LQ4A 3MJ4A 2OCGA 3ESYA 5JD5A 4ZVTA 1P7WA 4DLSA 1SKYB 3A9VA 2G07A 4BKOA 3DLHA 3KXKA 2C2WA 4R8RA 4US0R 1JE0A 4LVCA 4IDEA 1G7TA 3W2GA 2VUUA 2I6FA 2HX1A 2COUA 1YOBA 2NU9B 4IGKA 3EQ9A 1VIMA 4K88A 2ECOA 2FPGA 2XLBA 4LBZA 2BL4A 4R1UA 2NPIA 1EM8B 3RSSA 4JQSA 4ETNA 2Z5VA 5J2TB 3AF1A 5HS6A 4WLFA 1M72A 2Y1CA 2FH5B 2PD6A 3M0EA 4Y9SA 3ZKAA 1XTTA 5IASA 3K70C 2DH6A 3FFXA 2UAGA 3KLOA 3THYA 5EHIA 4A2QA 4YJ3B 3IDAA 2NV2B 1FLNA 2R3SA 1ZM2A 5M34A 5JBNA 3D8HA 1HPLA 1TLFA 4HUTA 4KYIB 1YFJA 3HUTA 2QJFA 3GAAA 2ZAGA 2Y76A 3PQCA 3CVXA 2OBXA 2Z30A 3FTDA 2NZWA 4AO7A 1RBZA 1X1CA 3BKXA 1CJBA 2LD4A 4FFOA 3DFMA 4I9GA 4PTZA 4MW9A 1GAWA 1Z08A 5TQ0B 1SXGA 3ZWKA 3O4VA 3RYCB 3WDSA 2FMHA 3BUSA 2HQ1A 3WLKX 3C48A 4Y8VA 5IT9A 4QJIA 4J0JA 4G36A 4MS1A 1OHHA 1LTQA 1Q0PA 5TVKA 1KDVA 3KR9A 1C1DA 4LZPA 4TV8F 1CDEA 4R5MA 3GN2A 3Q1KA 4S24A 4FJ0A 3ROXA 4RAQA 3ZR4B 2O5VA 1S7GA 4TTIA 2CFTA 3KRTA 4I14A 1IHPA 1RKUA 1P18A 3B70A 4LDQA 1ZN9A 2CNDA 2J3HA 4MKFA 4UNPA 4FFWA 4X71A 4XGKA 1F5SA 4JJZA 3B82A 3T1QA 3SXJA 1LRKA 1V3VA 1GGKA 3L6OO 4KPYA 3W06A 1VGQA 1DI0A 1OX4B 3OQBA 4JMLA 5T4BA 4RHTA 5C46F 1SC4A 3DFIA 3P0HA 5ECYA 4JXXA 1GSIA 2EF1A 2ADMA 1V26A 3DL2A 2MSDB 4MUJA 4BU0A 1H4TA 4XGNA 1ND6A 3JW8A 4GM1A 1JYEA 4X5OA 3UWDA 1P19A 3MMSA 3M9LA 2EKQA 3PC8C 3KLMX 3F49S 3DDZX 4CG2A 3B9PA 1YK0A 2IQ5A 2WOJA 4LXUA 1EP2B 1LLCA 4DHWA 3P4YA 3V8RA 4D42A 2X19A 1L5NA 1N0HA 1UZNA 3KFVA 4R0VA 1PR1A 2J4DA 1NI4B 3U4DA 3W6ZA 5A4MS 2FFQA 3TTUA 3AL3A 4DWWA 5HOQA 4FSXA 4CLRB 1EHCA 4Z0HO 1LI4A 3CX7A 5JLAA 3W04A 4BKPA 2QNIA 2AFIB 2JATA 1F9EA 3LPDA 4LJ9A 1SK8A 3KETA 4GQAA 4FQ5A 1VYHA 1BS1A 4F1JA 1FDVA 4UBKA 4ARIA 3GIWA 3CF4G 3OPYB 4J94A 3AEQA 3A4LA 4AWXA 4ZO7A 1ISFA 4CM7A 3FYTA 1WUYA 1F1BA 3QHAA 3BHIA 4F2DA 2CL0X 3KR0A 4F91B 1ONOA 1Q50A 3DVLA 4M37A 1E1KA 3NV9A 1JR3A 1I2MA 4Y0VA 4EFDA 1TECE 1PR3A 1T4DA 1HE1C 5FT9A 3UYLA 3VU9A 4UZSA 5JXJA 4R54A 3PUVA 4PC7A 1SBIA 3JZFA 1YRQA 2NVWA 2Q3HA 2C2BA 3OY7A 1GSOA 2UXBB 4ZVPA 2Z9BA 4ESVA 3UOAB 4UBNA 3ROPA 1D5CA 3JQAA 5EQJB 2X3FA 2YFKA 5K0FA 2BN4A 2W37A 3CVOA 4LHXA 4IIHA 3ROQA 3LE8A 5A2GA 1K68A 3DPIA 1EP9A 4YAGA 4AXBA 1Y4DE 3EPHA 2H1OA 4ZYUA 3DM9B 1J39A 3H18A 3SIXA 4L57A 5AOBA 5I47A 3DXXA 3GLKA 1L5RA 3EDCA 5DTIA 4RJTA 1ZVQA 3G2MA 2VN8A 3JALB 1AQYA 2GAOA 2X8AA 1DKQA 3QU2A 4L75A 3IEVA 4H15A 5KQPA 1E1YA 2LIPA 2GCNA 3SKYA 2G09A 5LQNA 5A5GA 3QEOA 4B6QA 4BQEA 5CTJA 5EHXA 1ECBA 1PBTA 2P78A 5JG7A 3I4CA 3K5IA 4HVTA 3AIIA 1NPTO 4IGIA 1FUUA 1JEDA 2PH3A 3D4PA 3B85A 4M7RA 3C6XA 3HCEA 4AU1A 2KLBA 3MELA 2FFBA 1ZZGA 2KBEA 1ONBA 4UUBA 5JH7A 3EPLA 2XVZA 3EOAI 3QBJA 1U63A 5CW2A 2ARKA 3K8OE 1N0WA 3P9PA 5ESDA 2CE7A 1HKUA 5BV1A 1MB3A 2ONZA 2MTBA 3L9WA 5TMDA 4MPRA 3D2BA 1FU8A 1C3OB 2QTAA 3UB4A 3WYEA 5ITWA 3SDSA 3UPTA 2QLTA 2C58A 2ZSUA 1ZXBA 3UHPA 5IDWA 2JH3A 5DN9A 1EKXA 2Y9MB 3O8QB 4Y2UA 2Y05A 4N5NA 2GGSA 3PQ6A 4RTPA 3D0RA 2OGUA 3AVVA 3NHPA 2GF0A 2QPTA 4MLDA 3LIPA 4GG1A 4KSYA 5JAPA 1SC9A 1YR9A 3C3AA 2HDNB 2Z6VA 3WWOA 1PZFA 4WESA 4FMDF 1EUDA 1EEHA 4TM8A 4EYGA 3H9GA 5ALVA 2JCGA 2GAIA 2VK8A 5KTTA 5DTMA 4Q7LA 4RESA 4AMBA 3TR5A 2YV3A 1DC7A 2Q8QA 4OI4A 3LNCA 1OTHA 2G82A 5DCLA 3KB1A 5IWAB 4MLPA 2WA1A 3ZWMA 1AKUA 2CBXA 2I4MA 4JIGA 4BNDB 2ZCJA 2I3ZA 3B6EA 4RF4A 4PZAA 4IS2A 1A04A 2VSOA 4HAZA 4NMHA 1QBGA 2E0IA 4JWKA 4CM9D 1EVEA 1JHRA 2FQQA 3OM1A 1YRLA 5EIBD 1LNZA 2PH5A 3C7CB 5G0VA 3BZBA 3NDIA 4MW1A 5LL6P 2F8TA 3RVJA 1ZICA 2B1IA 3KB6A 5AXDA 2B0CA 4CV0A 2G28A 2PH7A 2AGVA 2WAYA 4UVGA 4X92A 1GVNB 1C0KA 3DLAA 1QP8A 2AN4A 1IDOA 3CJRA 3H4MA 3HFRA 3HLKA 3KSDO 4M9QA 4UTNA 1JG3A 3B53X 5LYJB 3R1IA 1T36B 4CQJA 4F9FA 3QF7A 5JSQA 1QO0A 3A58B 2ASEA 3K0SA 3T5CA 1OFHA 1BYIA 3PWZA 4OHVA 1WQ4A 4MWOA 2UZ1A 3R7DA 4D3YA 3LPMA 1A9ZA 3GXBA 1IIBA 3SDZA 3JASA 3ZCQA