4TQGA

Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
319
structure length
297
Chain Sequence
SQINDKTIMIFGGSGSLGNRLIETYINNNIIVNYSRDESKHWSMELKYKSDKLKNIIGDIRDFEKVQQSIMRINPDIIIIAAALKHIDRCEYEINECLDTNIKGLQNVLKVTEINRSNLSNLKAVCFVSTDKACSPVNSYGMSKAICETLVVEKSKYIKDIKYVCVRYGNVLNFTLTHTSMTRFIMTLDDSVKLIEYAIINGNSGEIVIPKLNSMYIKDMIELFADKYPIVITGLRSGERMYESLINDTQSMKTVPKGDYYHILPTYDPTIVTEEFYEYSSKQNILSKQELENYLNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dTDP-d-glucose 4 6-dehydratase
publication title Giant Virus Megavirus chilensis Encodes the Biosynthetic Pathway for Uncommon Acetamido Sugars.
pubmed doi rcsb
source organism Megavirus chiliensis
molecule tags Sugar binding protein
total genus 114
structure length 297
sequence length 319
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4tqgA00
4NH4A 3EMKA 3W4IA 4XQ9A 3ZWMA 4CMKA 4BNKA 5IF3A 1F17A 1Z74A 2ZB7A 4CJXA 4GVLA 4BNMA 4PLZA 3AY6A 1B7GO 1DIHA 3TF5A 1SEPA 3DZJA 1V3UA 3H6KA 1BHSA 3H4VA 2DKNA 1A9YA 5ENVA 1C3VA 2RBEA 2P9GA 5KVQA 1BWSA 3GN2A 4G2NA 1PQPA 4MDHA 2R2GA 4GSKA 4PG4A 3F1LA 3EK2A 4CLOA 4MVJH 4OSPA 3KSUA 5JDCC 5JLAA 2VOEA 4TZTA 3PYMA 3D4OA 3C1TA 1LC0A 1GPJA 3AK4A 1QV6A 1GQ2A 3WGZA 1ZIDA 3DL2A 3KYCB 3NTOA 5AXCA 4E2YA 2NV6A 2C2XA 2VRCD 5DOVA 3ZCXA 5BSHA 3JD3A 4QT0A 5DULA 3SVTA 3TRIA 4BNZA 3F1KA 1P33A 2VZ0A 4GVXA 5EINA 3VZPA 1HF3A 1Q1NA 2JHFA 3RWBA 1F8GA 3I83A 1E1LA 1ISMA 4YJFA 4BO4A 1N8KA 1E3IA 4F46A 3TOZA 5JCJA 1O0SA 3AOGA 3BTUA 3HN7A 4TKLA 1PWZA 5HS6A 4MVJG 5HS4A 3MCVA 3H8VA 4I8XA 1Y8RA 4R01A 3L4BA 1J0XO 3DEYX 4DRYA 3ITKA 1BSVA 1WVGA 5L40A 1U8FO 2ZCVA 4CV1A 2YFQA 3M2TA 5JE8A 4CLDA 3B1JA 4YT2A 3FR8A 4NG5A 1W8DA 3U4CA 6ADHA 4WLNA 3U09A 1YVEI 4PCVA 4UUNA 2Y0EA 4CQMB 2IYPA 1NHWA 4CM4A 1MC4A 4PLVA 3WJAA 3LVFO 3CMMA 4J16A 4YT8A 1F8FA 1P3DA 1U3TA 4CMEC 3UGKA 3TWOA 1UJMA 2GN4A 3GT0A 4NHEA 3TOXA 1E7WA 2ZQYA 4D41A 3NT4A 4HBGA 4IM7A 1EE9A 3B1FA 1NXQA 3Q2IA 4PLTA 4HKTA 1EUZA 3HB4X 3H9GA 3QVOA 4XGNA 1C1DB 3ROQA 4CM5A 2ZTLA 1LI4A 4IDAA 3G0OA 4A0SA 1VC2A 1DC6A 3WYCA 1RYDA 4FD3A 1B0AA 2IEDA 4KQXA 2EIHA 2WSBA 2HMWA 1UAGA 2V6FA 2YV1A 1GYRA 1LLDA 3D5QA 2ZTMA 2CD9A 2Y1OA 3GVXA 1XQ6A 4JJIA 4CQMD 5ITWA 3CZRA 3GVPA 4PVCA 1FF9A 3GG9A 2D3TA 3DOOA 2J3HA 2VUTA 2WYVA 3R6DA 4E5PA 2Y0DA 1U7TA 2VNAA 3RBXA 4OH1A 3CXRA 5T8KC 1WAMA 3ZZNA 4IDBA 4MIYA 4EUFA 1EDZA 1NHGA 3PVZA 5K6AA 1VL0A 1NASA 1VKOA 5A9SB 1M76A 1MGOA 5IG2A 5I8ZA 5GY7A 4FSHA 2AEMA 4ZA2A 2JKVA 2HU2A 4WE3A 3ZHXA 5C7IO 4PRLA 4Z0HO 1C0IA 4RCVA 1ZJYA 1JN0A 1P9LA 4BVAA 1JKIA 4HNHA 5A06A 3GAFA 2W2KA 3BHMA 4IJKA 4B8WA 2BFOA 3LC1O 1U5AA 1U1IA 5JW6A 1ADGA 1U4OA 2BMAA 4K28A 3IDSA 3H9UA 2BELA 5DCWA 2RAFA 4E6PA 4H16A 4BO8A 4J43A 2VHXA 3VH3A 4CL3A 1JWBB 3HG7A 1ZEJA 1ZH8A 1LU9A 2X23A 4FOSA 1UR5A 1VE9A 3KYDB 4PLCA 3QWAA 4XJSA 1VRWA 2Y66A 3ON5A 4C4OA 4BUCA 3JQFC 4ZQGA 4BNXA 3H7AA 3R1IA 3PIDA 1UAYA 1D1TA 2AHRA 3TPCA 4D3SA 4WLEA 4M1QA 1BXZA 1DOHA 4IJWA 3O38A 4L4RA 3KLPX 1M67A 4CMAA 2H1SA 3PI7A 1KY4A 1PR3A 5F5LA 5ILGA 1PIWA 2FOIA 2IEBA 4IDCA 4WCFC 3GZNA 1SNYA 4BKRA 3GUYA 3E1KA 3KXDA 4AJNA 4R1SA 4DPLA 1PSDA 1HLDA 1QV7A 1ULSA 2X9GA 1U7HA 5JCJD 4UVGA 1Q0LA 2CMDA 3GHYA 1P45A 3NAQA 4Y6PA 1PGNA 1QYWA 1JTVA 2EP5A 4AFNA 2WMDA 1DJQA 1GZ3A 4N5NA 1ZXLA 3JQGB 4ALKA 3BTOA 2ZTUA 2Z95A 1RYEA 2Q1TA 1NYTA 1W0CA 4L4SA 4JK3A 2X7HA 5DNAA 3TL2A 5IDWA 1LDEA 4MPDA 4E2ZA 1EQUA 3VZQA 1DRWA 1UXJA 2QIOA 3BXXA 2Q3EA 1LEHA 1PJBA 3G17A 5IXSA 4BNLA 3RAJA 1O95A 3KTDA 1HE2A 1H6BA 2EKLA 1WMBA 2FRDA 1RWBA 3OJFA 4HXYA 4PFJA 4CM3A 4MVJA 4LN1A 4IS3A 2X0IA 4OSOA 1B2LA 1H2HA 1PJSA 5CG2A 3F47A 3H9JA 2JD0A 2GUGA 1I3KA 1NVMB 2Q49A 2O7QA 3MJ4A 2P4HX 5DZSA 2YHIA 4M55A 1CYDA 3PQFA 3RUDA 4IY1A 4DC1A 3ZU3A 4MVJM 2DUWA 5ER9A 2J8ZA 4ID9A 5BQFA 2CF6A 4BNNA 1X7HA 2NTJA 1C0PA 4UREA 3DHNA 4XGIA 1A72A 1UP6A 2RH4A 3PGXA 1ZSYA 3R3SA 4IQ8A 2O7SA 3V1YA 1CQJA 2JAHA 3IKTA 2FR1A 1T1SA 2QX7A 1PJQA 2A9FA 3JD4A 4KP7A 5CHEA 4L73A 3UH1A 3VTZA 4YT5A 5AQ1A 2A35A 2GERA 4R1UA 3ABIA 4UEJA 1ZMTA 1P1FA 1P0CA 3CIFA 2AW5A 3LT0A 4HWKA 3PDUA 1PTJA 1KS9A 4XA8A 3GPIA 2XOXA 1E3EA 2Y1DA 3NYWA 1PZEA 4BGEA 4TVBA 3UICA 3EVTA 1QYVA 3G3EA 5ITVA 1YL6A 4XB2A 2AG5A 4TQGA 2I3GA 2O3SA 1SOVA 1UDAA 5BSGA 3DBHA 1ONPA 2G1UA 1IHXA 4FFPA 4W82A 3WDSA 4CQLA 3HJAA 1KVQA 5TF4A 2HO5A 4NJMB 1LQTA 1U2GA 3NV9A 3AI2A 5TNXA 1QRRA 4WKGA 5F1OA 2JCVA 5CEEA 3I6QA 3ZU2A 1NR7A 1T25A 4NBTA 2D59A 1DO8A 2X8LA 3ENNA 5TRTA 1T4DA 3RC7A 3BHJA 3WIDA 2NVUA 4L4XA 4BNTA 4YACA 4JNKA 4TRJA 4OOEA 1JAYA 5TJHA 3ZV5A 3DMYA 4QXMA 3O8QB 4B3IA 5IJZA 5JMPA 5FFFA 3NGXA 1MB4A 1YKFA 1X1EA 2NVBA 3JQ9C 4IS2A 2NWQA 4K6CA 1OI7A 3RASA 1M2WA 1E5QA 4B8ZA 4YJHB 1RKXA 4UAGA 4RJTA 1GU7A 5L95A 4E32A 1ZXBA 1GUFA 3E18A 4CR6A 1DC3A 4R68A 5ER6A 4DYVA 1ZO8A 3D4NA 5F21A 1N9GB 1X7DA 3ZWCA 5GZ1A 4WOJA 3GLQA 2CSUA 3WMWA 3DB2A 1HXHA 4UVIA 2GDZA 3DFZA 1QYXA 2O3QA 4KDEA 5GMOA 4MIEA 3GZ4A 4FFLA 1CF2O 2P91A 4MKXA 4QO8A 4WPGA 2XF8A 3UKOA 4BKQA 5KKCA 2NADA 1PJ4A 1NWHA 5EIOA 4GGOA 3FF4A 4P22A 1GPDG 1H5QA 3GFGA 3WGHA 3R0IA 2Q50A 2OBYA 3MJVA 3MJCA 3OIDA 1G0NA 5H81A 4C7JA 1OZAA 4L8VA 4R41A 4A7PA 1UZMA 5IDQA 3G1TA 4P38A 4PG6A 1LDYA 2H6EA 5BNTA 4M87A 1DHTA 3U3XA 1WP4A 3KUXA 4D45A 4WCFB 1P1RA 2ZQZA 3PRJA 4FGWA 3W8FA 2YY7A 3VPGA 1B8UA 2J3IA 3JQBA 3RBVA 3FBTA 3QLJA 1U28A 1SC6A 4O1MA 1LXCA 5T5QA 2VWGA 2ZB3A 1ZK1A 1PGJA 2C0CA 3PWKA 1BW9A 1DRUA 3DZBA 2CVQA 5K9ZA 1ZK0A 5COAA 4DLBA 5J23A 4CM6A 2VNSA 2AEJA 1I3LA 2X0JA 3PLNA 2EXXA 5A3VA 4U0KA 4A26A 5I9LA 2W90A 4NQZA 1GZ4A 2G5CA 4H15A 1NVTA 4OMUA 3UCFA 5JY6A 4IGFA 1DXYA 1QLHA 3GQVA 3N58A 5DBFA 2FPGA 1UXGA 3GNTA 2VHVA 4QX6A 2VWHA 3AY3A 4Q3AA 3UOGA 1HE4A 4R1TA 2BFMA 2VOJA 3VOSA 4DREA 4Z6KA 1UZNA 2QYSA 3RQSA 4P4NA 3JTMA 2A92A 3F4BA 1LJ8A 1LA2A 2PKQP 4I9NA 3GMSA 4CM7A 5CG1A 1LNQA 1VLLA 1XQ1A 2X22A 3KV3O 4IJUA 5TLSA 3DTTA 5DCUA 1FK8A 3X2EA 4EI2A 4A27A 1BXGB 4J49A 1A7KA 1MUUA 4IXTA 3D7LA 4J7XA 3I23A 2B37A 3TZQA 4R9SA 3UUWA 1DIAA 3Q6IA 5JS6A 1VSUA 2C7VA 4P4LA 4ND1A 4RPLA 2FSSA 3KLMX 3PK0A 1Y8QB 4B7CA 2Y93A 4H7PA 3OMLA 4MVJI 3AW9A 1UDBA 1PJCA 4LK3A 1TLTA 4DL9A 3IOYA 5A5FA 1XCBA 3T4EA 4OXYA 4NJOA 2OO5A 3OHSX 2I3AA 4GAEA 3OSUA 4J4TA 1WDLA 1VL6A 4BQPA 1PGPA 2AXQA 2BGKA 2DFVA 3GAZA 1YB5A 3SC6A 1P77A 1X0VA 4EJ0A 3A06A 3K6JA 4N54A 2BH9A 4DVJA 2VRCA 2P5YA 1XEAA 1H6CA 1NQAO 3LC2O 4KQWA 3L4SO 3ZNNA 5K0ZA 1KVRA 2FZEA 1SEVA 3CZMA 1VJTA 4OL9A 4IBOA 4RVDA 4D3FA 1EFLA 1QLJA 1RJWA 2V65A 3ETDA 4KTVE 2W4QA 3OQBA 4RPHA 4G81A 3HWRA 1Q7CA 2VTDA 2OP0A 3HN2A 4GX1A 4KUHA 1SB9A 4PG8A 4C7KA 2AQ8A 2DC1A 3IKVA 4BNIA 1LLCA 4E3ZA 1Q7GA 4RLSA 1KC1A 3FNGA 3L07A 4BHTA 4LSMA 3RUAA 3WGQA 1HEUA 2GSDA 2ZATA 3GDOA 3JSAA 4II3A 5THKA 1ISFA 4JBHA 3QVXA 3VAZA 1AHIA 1DBVO 2X58A 3KYCA 4EZBA 2EWMA 1GFSA 2O3UA 4ZN6A 2WDZA 1GAEO 4E5YA 3INTA 3OJ0A 1F0YA 4BO7A 1XWFA 2PKRA 5GZ3A 2DT5A 3BMQB 1ZUD1 4I5DA 1LDBA 4UULA 3CE6A 1OBFO 3DMTA 1HETA 1ONOA 1T2EA 1BVUA 4KMSA 5CDSA 2GRAA 3WQQA 4OOFA 3PLRA 2ZTVA 3CUKA 4CMBA 3ANMA 3PZRA 1H0KA 1HDGO 4Z9YA 3BHIA 5ES3A 3MEQA 3IIEA 4FBGA 2NU8A 1Y1PA 4J0EA 3OA2A 3RFVA 3P2YA 4PLYA 2PD4A 3WNVA 3P2OA 4OQZA 2VYNA 5ENDA 2IXBA 4X54A 3U4DA 2LDXA 4IJVA 4NDNE 4OJNA 4XYEA 1G0OA 1IZ9A 1WXDA 3ICPA 1E3JA 4K9DA 5BSFA 1YO6A 3LF1A 4XX0A 2PY6A 4MOWA 5AXBA 4ZVVA 3RJ9A 3FNEA 3C7DB 3E82A 5AXAA 3ROPA 4EJMA 3ZU5A 1KVSA 2VT3A 1FMCA 3DFUA 4CQMA 5B1YA 3RCBA 4YQZA 1A4UA 2J6IA 4IZHA 2YV3A 4HY3A 3S8MA 2JCYA 5CP8A 2QRKA 2VRBA 3FD8A 1ENPA 1R6DA 2HRZA 5TX7A 2WD7B 3OJLA 4Z3DA 4YAIA 3RD5A 1YQXA 5IDXA 1GV1A 3MOGA 2QW8A 3U9LA 5L4SA 3I9OA 3ZWBA 4AJ2A 4ALMA 9LDBA 1ENZA 5ICMA 4TKMA 1HZJA 3PFFA 1LBEA 1O8CA 4AJ4A 4MJLA 3PWZA 4XQCA 1IZ0A 3E9MA 4QSMA 1YDEA 1C1DA 3HQ4O 3MJSA 4J4BA 5JO9A 4QTZA 4ONEA 1QKIA 3DZKA 1V3VA 4BKPA 3AM3A 3H3FA 4CR7A 1VI2A 4U0JA 2CDAA 4RF4A 4BOYA 2ZKLA 1U2DA 3RBZA 5I9MA 4QECA 1B16A 3PPIA 1WDKA 2GYYA 1R15A 4NU5A 4M49A 4TVOA 4UVHA 5JMWA 2I99A 1MX3A 4B4UA 4CL8A 1LQUA 5T67A 1M6HA 4KZPA 4QFCA 1G1AA 2HQ1A 1B15A 1E1MA 4O63O 1DIGA 3HUDA 3LQFA 3E6AA 4UEOA 2C54A 4LSWA 3DC2A 3QRWA 4HX5A 5A9SA 1E7RA 3JYPA 3VKVA 3WX0A 4CV2A 5JC1A 1S7CA 4EEZA 4IDGA 5IDYA 3OETA 3STHA 2VHYA 4FGSA 2ZYGA 1GEGA 1P44A 1QP8A 4IUYA 1VPDA 2ZIZA 3GFBA 3BMCB 3SXPA 3M1LA 3KVOA 1EBUA 4GWGA 1I0ZA 3CMCO 4DGSA 1KIFA 3IAHA 1VKNA 3JD1A 4BO0A 5CPBA 4AJOA 2CY0A 5FWNA 4NFYA 4NZ9A 4JJFA 1PL7A 4MIOA 3K9QO 3L0DA 5HWSA 4DYDA 1TT7A 1NPYA 4J1TA 3KM0A 1Y6JA 3WYEA 1CQIA 1E5LA 4FJ0A 3S55A 4E5KA 1MA0A 3ASUA 3VVCA 3WGOA 4EDFA 4BL5A 2YV2A 4CLRA 1DSSG 1E1NA 3BMOA 4B4VA 1DFGA 3LDHA 4ALNA 3KYDA 3LZ6A 3GGPA 2BI7A 2O50A 3QVWA 3O03A 2ZJ0A 3GPDG 3VZRA 5JPIA 2HK7A 3ULKA 4U6SA 4KUGA 2PZJA 4GMGA 4YJGB 4GKBA 4XD2A 3OQ6A 7ADHA 3QA9A 1I30A 5H83A 3VPXA 3H2SA 4CLHA 1GCOA 2QZ9A 1FDSA 5AVOA 2Q2QA 4GPD1 4NK5A 1ZZEA 5JDCA 1LDNA 5G4LA 4BGUA 3JQ7A 2WYUA 1KY5A 2Q1UA 1JWAB 4LMRA 5I7VA 2DBZA 2PKQO 1IPFA 1DAOA 3C3XA 1DIBA 3AFNA 5JYEA 1I5RA 3S2IA 4CM1A 2D4AA 2VYND 5K6AC 3JQGA 1XU9A 4F6CA 2PA3A 2GO1A 2CDBA 3HZZA 4RQUA 3RU7A 1KVTA 4GI2A 1EUDA 5ICSA 1NFFA 4PLWA 3D5TA 3OICA 3I9MA 4DLAA 4M54A 1U3UA 3OQ1A 2X6TA 4P4GA 3VKUA 5ADHA 2G0TA 1P74A 1IY8A 1V0JA 1XDWA 3ADOA 3OP4A 4JP3A 5EQDA 1GY8A 4WLOA 2B4QA 4TRMA 4XQEA 4D44A 4E5NA 4EBFA 2AQKA 3ONEA 4HFJA 3TZCA 1R4MA 5CDGA 1ADBA 3K96A 3F5SA 4OHUA 3SLGA 2AEFA 3B20A 1DJNA 2O3JA 2YDYA 3GF4A 3CPSA 4O0LA 1Q7BA 2H9IA 3INRA 1T4BA 3LYLA 4GSLA 4PLHA 2VN8A 1ZMOA 5L4LA 2QZZA 3DBRB 1DC5A 4W4TA 1Z82A 2WEKA 4YYZA 1E6EA 1H93A 3V1TC 3NRCA 4CMHA 1HSZA 1RM5A 4D0RA 2IZZA 3K31A 1GTMA 2VQ3A 4MVJE 3L9XA 2QHXA 4N7RA 4CMEA 5AOVA 3QV1A 3NJ8A 3E48A 3FPCA 4BB6A 3VC7A 2E37A 1I33A 5A9TA 4DQXA 4D79A 4ITUA 1DLJA 3M6IA 2EGHA 1O89A 3QSGA 3QWIA 4PG7A 3SJ7A 2VWQA 4B7UA 3TNLA 1J4AA 1HYEA 2EHDA 3GC6A 5HM8A 2B83A 1ISGA 3NT5A 2FR8A 3AUUA 4OM8A 1QXSA 4IGEA 4TWRA 1K2WA 2JJYA 3INGA 4IZIA 4BKUA 4CV3A 4WOKA 1YBMA 1PU2A 2PGLA 2Q4BA 4G5HA 3TN7A 3VHRA 2NTNA 3WICA 1B8VA 2YW9A 2OFPA 4NR0A 1J5PA 3DAPA 1LX6A 3W6ZA 2AMFA 2O23A 3RUCA 2WYWA 4MVJF 4NJMA 5COBA 1D1SA 3IQDB 3RSHA 4E2WA 4QQRA 1BGVA 4R54A 4ZGWA 1KETA 3DBLB 4J1NA 2AE1A 4CUKA 1KERA 5EJ2A 4GX2A 4YEDA 3BZUA 1S6YA 2J3KA 3HNPA 3SLKA 3AM4A 5C37A 4EJ6A 1K6XA 2PTGA 4E30A 4ZQEA 3FWNA 4BO5A 2C5AA 2D1YA 3O8QA 1AGNA 4OXNA 1Y8RB 4ZRMA 3ZWWA 4D42A 1UDCA 1JAXA 3Q9NA 1C1XB 3I4FA 4W7IA 3OIFA 3V2HA 4AVYA 1B3BA 1E6WA 5I8WA 3B1KA 3F9IA 1PJLA 4YJHA 1RM4A 1FDWA 2AE2A 1QORA 4OKNA 4YT4A 1LC3A 2YJZA 4WEOA 1SMKA 1XU7A 3KO8A 2OXIA 3RFTA 1P1KA 1N9GA 2D2IA 1YXMA 1BDBA 4MP8A 5KWEA 4Y9DA 4EEXA 2NQ8A 3UHAA 3GRKA 2FPIA 2DPHA 1BTOA 1NVGA 2JL1A 3DONA 1IULA 3DOCA 4J3FA 4BIIA 3G1UA 1A5ZA 3O4RA 4PIVA 1HDRA 2HRBA 4WASA 3U5TA 5IN4A 4O5OA 2Y1FA 1JVSA 1GD1O 2DM6A 1SOWA 2DTXA 3B70A 5L45A 3OF2A 3TDKA 3DZIA 2EJVA 3JQFA 1ADCA 2EKPA 5U1PA 1ML3A 9LDTA 2GNAA 4PZEA 4Q3EA 4OQYA 4I5FA 1WMAA 4BO1A 3BTSA 2GR9A 2PD6A 4FJ1A 5IFLA 1YL5A 3G49A 4IINA 3ZW9A 1WDMA 2WE7A 1EVIA 3U0BA 4Y98A 4BKOA 3CTMA 3UVEA 3GNQA 5IXYA 4LVCA 4ROSA 4Q39A 5JNLA 3OIGA 1XA0A 3BTVA 3SBOA 3A9WA 1HDCA 4Q3CA 3GA0A 3IC5A 1K6IA 1ZJZA 4PVDA 3W8EA 2XXJA 1ISHA 3SEFA 2Q2VA 3PJFA 3ZGYA 3RIHA 3RUEA 2O3RA 2D0IA 2Q2WA 3MJEA 4I9UA 4R5MA 1ZKMA 1ZCJA 2I67A 2Z5LA 3ZN2A 1JKJA 2X0NA 4BS9A 1DLIA 1MXHA 3MWEB 4QUKA 3V5NA 1OFGA 2HK8A 4D0SA 3UW3A 5B4VA 1F14A 1H6DA 2VCYA 2C82A 5G2OA 5KJ1A 4IDDA 2X86A 4YB8A 1NX6A 3TZKA 1T2CA 3PHIA 1EQ2A 4IMPA 3U4IA 2TMGA 3L6EA 4E4YA 5C7LO 3NUGA 1NBOA 4RF5A 1GUZA 1SZJG 3H5RA 2OHXA 3C1OA 4XEHA 4R1NA 1YL7A 1Q0QA 1EFKA 3EAGA 5IN5A 3A1NA 4JCOA 5DCYA 1GR0A 8ADHA 1BXGA 2OZPA 3W8DA 3F4LA 1T24A 4LRSB 4ZU3A 3ZWPA 4XKJA 3MWDB 1JVBA 3UFXA 6LDHA 2NU9A 2EERA 4YAGA 4NBWA 1Q0HA 1Y8QA 4BNWA 1OC4A 3WGGA 3AJRA 4R3NA 1ZSNA 4IIUA 2C29D 1YQGA 4JLWA 1R4NB 4ZRNA 4FDAA 3PZBA 1T2DA 3ONFA 1UXKA 4J9UE 2F1KA 3AI1A 1VJ1A 1PS8A 2GZ3A 3GZNB 4WNIA 2OP1A 4DQUA 3RC9A 4JJGA 4AJKA 4ZQBA 5HRUA 1CJCA 3RJ5A 3C85A 3JQBC 1P1JA 1E0DA 3PP8A 3WR5A 4I5EA 3DDNA 4FIZA 3A28A 4W99A 3K2EA 4O6VA 4Z0TA 5CDUA 4IQGA 1HDOA 5KOIA 3Q11A 1ONNA 2C07A 4WGGA 3HB5X 4J2HA 2JD2A 2UAGA 2NTVA 1KOLA 2YFHA 3CH6A 4YAJA 1E7QA 3OA0A 2Y67A 3W4KA 1A27A 3P7MA 4YVFA 4Z9FA 3AOEC 3SC4A 3HSKA 4N18A 2I6TA 1YS4A 3E9QA 1LDMA 3IJPA 5L7TA 1UXIA 3D3WB 3ZHYA 2B0JA 4J6FA 4RPKA 3JQCA 2P68A 1TT5B 4CUJA 3JYQA 4L74A 4DMMA 2DFDA 2GD1O 2B69A 4KUEA 1EEHA 2NLOA 1V6AA 2OOSA 3QVTA 2V6GA 2CVZA 4UUPA 2B4TO 2NNLD 4JX8A 4GX5A 3WGTA 4W9NC 2PR2A 4JGBA 1NQOA 5U4QA 1I3MA 3RKUA 3DAFA 2HDHA 2QRLA 1D3AA 1L7EA 2VWPA 3EVNA 5A04A 3JQ9A 4XWYA 4AL4A 2YHIB 2GZ1A 1QYCA 5L7YA 2IZ0A 2Y99A 1DEHA 1YWGO 4Y8VA 1NR1A 3RU9A 2QG4A 3WIEA 1ARZA 1WZIA 1C0LA 4PZDA 4Y6SA 3BMQA 2VHWA 4RDHA 3FHLA 4B7XA 1DDOA 1YH3A 2YZ7A 2UVDA 2PZLA 4FC7A 3KYBA 4JIGA 1A9ZA 2DBRA 1B14A 1PWXA 4U6QA 3WFIA 2ZK7A 1GQYA 3WGYA 2JAPA 1EVYA 4HADA 3H2ZA 4LISA 1PQWA 1H2BA 1W6UA 2HJSA 3PQEA 1ZEMA 3ZV6A 3GK3A 2V7PA 3PYXA 1TVEA 5IZ4A 5CDTA 2EW2A 2FN7A 4FFMA 1KVUA 4XZ3A 1IL0A 3PJGA 1NFQA 2HCTA 1ULUA 4KTTE 3MOIA 3UCEA 2I9PA 1JA9A 1N1EA 1X14A 4NFSA 4EW6A 1R0LA 5JY1A 3ADPA 2R00A 4OAQA 1SB8A 2RCYA 4DA9A 2JFFA 1L1FA 4U8GA 4BGIA 2A4KA 3ZHBA 4R16A 2C7GA 1I8TA 3EY4A 4ND3A 4DIFA 5DOZA 2FPPA 3OEWA 3PHHA 5EESA 1CDOA 2WD7A 3RKRA 4B3HA 5L3ZA 3X2FA 3AM5A 4A10A 3LLSA 5G0TA 3UF0A 3MTGA 4ALLA 3ETEA 2VYVA 2JCXA 3WQRA 3AI3A 3T4XA 2O2SA 4FJ2A 3AUSA 5DDIP 5GZ6A 2Y68A 3GEDA 1H94A 3S1LA 4JQCA 3CEAA 5IAAA 4W6ZA 2H5LA 5F1KA 4CR8A 4E31A 5B12A 1SCUA 1XIVA 4YAKA 4JROA 4RVGA 4ALJA 4PZCA 1UUFA 1V8BA 1LSUA 2D5CA 3F6YA 4GLLA 2AG8A 2RH8A 3DMTC 4ND5A 4FC6A 5DT9A 1EK6A 4Z0PA 4H3VA 3TQHA 1GYPA 2H63A 4NPCA 3WQSB 3F5QA 1Z7EA 3Q0EA 2I76A 1MLDA 1YOVB 3PHGA 3QHAA 4MVJP 4Z9XA 4HNGA 1R16A 2W2LD 1JDJA 4CMCA 1YBVA 2ILTA 3OJEA 3JQAB 3KZVA 3I1JA 4M86A 3ZDFA 1E3WB 5MDHA 1K3TA 5TQVA 1CETA 4XYGA 4N5MA 5IZCA 1Y9AA 5EN4A 2X5JO 4JXKA 3RVDA 4E21A 4IDEA 3C7AA 4PLGA 4NIMA 4WLVA 1ZSVA 3F3SA 1LRLA 3BMCA 3DQPA 4LMPA 1IPEA 4DBZA 5JBIA 3UAGA 5EMHA 3LLVA 5DBIA 2BGLA 4F45A 3AU8A 3KOUA 1UZLA 2FP4A 4CMIB 4R9RA 5TS3A 1IB6A 5JSFA 3GOHA 1D7OA 5TIIA 4GH5A 2CDCA 1XLTA 5T64A 2OBNA 3DR3A 1ADFA 3HFSA 2BHLA 3LT2A 1BW9B 3JQAD 3V2GA 3AUTA 2V6MA 4E33A 4FB5A 5ILOA 1IHYA 3I5MA 3TJRA 2P9CA 2WJPA 2HKIA 2GCGA 2VTEA 1K6JA 1N5DA 3F46A 5A3JA 4K6FA 4YJGA 3FRJA 5JAQA 1BXKA 2C2YA 3W1VA 5T6BA 4WUVA 2YHUA 2Q45A 1Y5RA 4YBZA 4CM8B 1LUAA 4DMLA 4IQ0A 3L6DA 5TGDA 1PJTA 3NTRA 5CEFA 1NQTA 4XR9A 4WCDA 2O4CA 2DBVO 1YJ8A 2J5KA 2NSDA 1Q2XA 1HE5A 3GGOA 1NAHA 4M8SA 1BVRA 1KEPA 5G4KB 1PS9A 3NJ4A 2X1HA 3KB6A 1JLLA 3AWDA 3LC7O 2PD3A 5G0SA 4BNYA 8LDHA 2I65A 3I4CA 3GH3A 4BO6A 3WSWA 1BDMA 1LLQA 1EK5A 2G82A 3PEFA 3P5SA 1T1RA 4JBGA 1NP3A 3VZSA 1YBAA 1XYGA 3JQDA 4XQGA 4M89A 3EW7A 3C1AA 4WECA 3VH1A 4XYMA 2FZWA 3WOHA 1Z75A 3TZ6A 3JYNA 1O9BA 3I9JA 5TT1A 5F5NA 2UYYA 1XSEA 1SAYA 2FY8A 1ZNQO 2GGSA 3ZWVA 4DPMA 4BNGA 3JQ6A 2EF1A 4E13A 3COSA 5TT0A 4J7UA 1ISIA 1DB3A 3GY0A 3MTJA 2X9NA 1ZK2A 3K73O 3QE3A 4CPDA 3RUHA 1Y9EA 3P19A 2VYVD 4W7HA 1VL8A 3A14A 2FHSA 2RIRA 1X0XA 4Q3BA 1YONA 1RM0A 1V35A 3L4BC 1DPGA 2Q46A 2PZKA 3OFSA 5BT9A 1KEVA 2PFGA 2CZCA 2EKQA 4U5QA 3BMNB 3DBRA 2IODA 3ZWAA 1A71A 4JP2A 3IUPA 3FWZA 5FEUA 3PIIA 5JDIA 2LDBA 3WBBA 3AFMA 2Q1SA 1HDXA 1U8XX 1ZK3A 3I9KA 4MINA 3DZFA 2SCUA 2FR0A 5B4TA 1YJQA 2BF7A 2X5KO 1FDTA 3EZLA 4D7AA 1KEUA 4LVUA 1PGQA 1NAIA 1M66A 1F12A 1I10A 5G0VA 1CWUA 1SBYA 2HAEA 4AJPA 5KNLA 1HE3A 3KBOA 2J5RA 1ZBQA 3K5PA 4YA6A 4B4OA 4OO3A 2CFCA 3L77A 3ORFA 1HKUA 5L9AA 1EZ4A 2J5QA 4J2OA 3ASVA 3LU1A 3FN4A 4RDIA 2V6BA 3ONDA 1UP7A 4UVEA 1R37A 2UUPA 4GLOA 4EUEA 1IOLA 4AJ1A 5JCXA 2W98A 2E4AA 1OMOA 2OMEA 3DBLA 4O59O 1N92A 1AXGA 3MZ0A 4XIYA 1E7YA 1K5HA 1MV8A 4RZIA 1EBFA 3QWHA 4GMFA 3PHJA 1HRDA 1GEEA 4DTIA 3FSRA 2P2SA 2PGJA 4RO0A 4EYEA 3NT2A 1BG6A 1H9BA 3HHPA 4DBVO 4XDYA 4J1QA 3ZWNA 5JYDA 3ZW8A 1C1XA 2YDXA 4QO7A 3WYBA 3D1LA 4RL6A 5EPOA 3RC2A 2NUAA 3EZYA 3C24A 4Z3KA 1V9LA 5KVSA 3O26A 4GQAA 1QSGA 4E0BA 2DTDA 4ESOA 1OC2A 4N5LA 1D8AA 3WB9A 3I9LA 2GZ2A 3W6UA 1BMDA 3HDJA 2D8AA 4E12A 1B8PA 2PGDA 3IL2A 1I3NA 4DPKA 2OGUA 1YB4A 2YQ4A 4OYRA 3KSZO 5G0WA 4KWIA 1N1GA 3S2EA 4ILKA 1X13A 2VUUA 5EERA 1HL3A 1VM6A 1NNUA 4IDFA 1NWCA 1ZK4A 2CUKA 5FI5A 1U3WA 4KWHA 4ZICA 3H9QA 4Y67A 3JQ8B 3PHLA 1LSOA 2HMSA 1YDWA 4RVFA 3JD0A 1KBZA 2UDPA 2E82A 5I7EA 2JFHA 3CSDA 4FN4A 3VPHA 5KTKA 4DUPA 4BB5A 4MKRA 1MFZA 1WZEA 2HLPA 4E5MA 4I9HA 2UUOA 3DTYA 1ZVMA 1T26A 3BIOA 4YTEA 2B36A 1TXGA 4FOOA 3JV7A 2O48X 2PH3A 2DBQA 5BNFA 4WK6A 3RI3A 4NMHA 3V2UA 3E9NA 1W73A 2HSDA 4L75A 1I2ZA 4HUJA 1PEDA 3EUWA 3U62A 2NVWA 3PDJA 2JFGA 1GUYA 3L9WA 1VSVA 2J3JA 5KIAA 4F3YA 1RM3A 5MGBA 3K8ZA 3KRTA 5THQA 4NBVA 1PJ2A 1JU9A 3VPFA 1PZFA 1ID1A 2DVMA 2RHRA 2BD0A 2YYYA 2NM0A 4CLOB 2WTBA 4BO9A 1DAPA 1FDVA 2XPCA 4ND2A 3WTBA 3IMFA 1GCUA 1Y5MA 2EP7A 3O9ZA 4PRKA 2GLXA 1TEHA 1H6AA 1HYGA 4EUHA 2Q1WA 1EUCA 1LLUA 3ZWOA 2VZ9A 2FWMX 3VPSA 3TFOA 4LCEA 2PNFA 2POQX 4CLEA 2O3TA 2HK9A 1YE3A 3M2PA 5KJ6A 5DF1A 5B4UA 4YJFB 1AXEA 3FPLA 4CV0A 1NPTO 1RPNA 4R4JA 1YQDA 3ST7A 3WWYA 4Q9NA 3JCZA 3Q3CA 5A4DA 1PZGA 5T8KA 3PJEA 4AJIA 4CLRB 5FF9A 3BMOB 2I5PO 4BMSA 1NQ5A 3PFWO 4TRNA 1P1HA 3IP1A 5KVCA 2P4QA 2IE0A 5JXWA 1HWYA 3E8XA 1TB4A 4XB1A 1PS0A 1PL8A 2IDZA 4A5OA 1NTOA 1DFIA 1WNTA 4INAA 3CKYA 4J90A 1IE3A 4GGPA 4NBUA 1XHLA 4AJHA 5EL0A 1R4NA 3BA1A 3VTFA 1QG6A 2ZB8A 3PTZA 2FMUA 5BR7A 2YUTA 3D3EA 4DIOA 4FR5A 2E49A 3I3OA 3TFQA 5B37A 3W4JA 2BLLA 2QQ5A 3QY9A 3WFJA 5JC8A 1CEQA 1OOEA 4CM4B 3GVHA 2NACA 3JQ7B 1TI7A 1HDZA 1JQBA 1XGKA 5KCZA 4CMGA 5L4NA 3GG2A 3WLFA 4BMVA 1LSJA 3B6ZA 1P31A 3L6OO 3EC7A 5EQFA 1L7DA 3OH8A 3OBBA 2DQ4A 2DU8A 4OGWA 5A9RA 1C14A 2EG9A 1LTHR 3PJDA 4D46A 1HZZA 4IPTA 3VH4A 2TMDA 1YGYA 3HFGA 3IS3A 3D3WA 1O94A 4BO3A 4QFDA 1TT5A 2IRWA 3ENKA 2HJRA 4OIMA 4G65A 1K0UA 4WLUA 3BYZA 4KOAA 4A2CA 1R66A 4AG3A 1A7AA 4WCFA 3HDQA 4ZD6A 3WBFA 2VT2A 4XCVA 3D4PA 3OM9A 2BFPA 5HA5A 4FS3A 3WS7A 1KEWA 5C5IA 1GADO 1R4MB 3AUAA 2Y1CA 2JD1A 4BGVA 3GDFA 3WJ7A 4MP6A 4ZQHA 1GDHA 4WEQA 3KEQA 2IYOA 3ZNQA 1CIVA 2Z1MA 5DBGA 2UV8A 3WLEA 4I5GA 2OUIA 1Z45A 1M75A 3JYLA 5CPFA 2HUNA 1N7HA 3Q1LA 4NFHA 4CLXA 5JAMA 5DP2A 3EHEA 2FSVA 5CDYA 1I2BA 3ICCA 4B79A 3IP3A 4BQRA 2Y0CA 7MDHA 3WWZA 5I7FA 2W2KB 1I24A 4J0FA 3IUSA 2D5AA 3E5RA 4R51A 1DFHA 5FYDA 3NKLA 3GNSA 1YB1A 3E5MA 3DAGA 1MC5A 4PG5A 1R12A 3R3JA 5A1TA 3GMDA 4P8RA 1X7GA 3UXYA 1P0FA 2JHGA 4ZHSA 2YQ5A 4F6LA 4URFA 4UVDA 3TZHA 3SJUA 4CODB 2BI8A 3GDGA 4FQ8A 2G76A 3QWBA 3RROA 2C20A 2GPTA 3NX4A 1EE2A 4FPXA 4TRRA 1P1IA 1PQUA 1R0KA 1D4FA 4UEKA 3WXBA 2ZYDA 3HE3A 1TA4A 4S3MA 4YJDA 2OL4A 3EDMA 4J1SA 4XGKA 4D43A 4NU6A 3NEPX 4HFMA 4DIBA 2ZJ1A 4J9VA 1EVJA 3GVCA 2GASA 2W8ZA 5JFOA 1ENOA 5CAEA 3GEMA 3K92A 4I08A 1XG5A 3OEYA 5KVVA 1U4SA 5AYVA 2GN8A 4FW8A 2W2LA 4JBIA 4YCAA 1Z7BA 3FCOA 1UH5A 1HLPA 4E2XA 1KYQA 1XELA 4R5HA 4UUMA 5LDHA 1U9JA 2Y05A 1GYQA 1SPXA 4BV9A 5JAIA 3DBVO 3FR7A 4BNVA 2QYTA 5COQA 4BNUA 2BGMA 5L7WA 4OXKA 4YWJA 1LSSA 1NFRA 4K1LA 4WLFA 1ZW1A 1E3LA 1QYDA 3ROKA 3LSYA 2EEZA 3ZH2A 4BNFA 3D64A 4XR4A 1J6UA 3KSDO 2EGGA 1GQQA 1XKQA 4BNJA 1DHRA 3IJRA 2PK3A 2E48A 4FFRA 4FFOA 1I01A 3PXXA 3A4VA 3AY7A 4CM9A 3Q2KA 1Z73A 3ETGA 4WNCA 4CMJA 4ND4A 3VH2A 1YOVA 3QIVA 1UP4A 2QRJA 2IXAA 2OORA 3RC1A 5DP1A 3ANNA 1ORRA 5KJEA 2GN6A 1HDYA 3T7EA 3JQAA 5C7OO 1O5IA 1V3TA 3GGGA 4GBJA 3GEGA 1E3WA 3QQPA 2NU7A 4J7CA 4J4HA 1N7GA 4A03A 5A03A 4ZJUA 1YRLA 2BFAA 5JO0A 4PLFA 4WJZA 1E7MA 2EJWA 1CRWG 1WPQA 4YR9A 2PV7A 3N74A 4YRDA 3ROMA 2O4UX 2C59A 1ISJA 2B35A 4TSKA 2ZYAA 2R00C 3FNHA 2ZCUA 3GUCA 3LF2A 2WD8A 2DLDA 2CF5A 2A94A 3QWFA 5LCXA 4CMIA 3ZU4A 2XAAA 1I36A 2CVOA 2NQTA 4ALIA 4IIVA 3WNQA 5TSDA 3FBGA 2ET6A 4PLPA 5FI3A 1E6UA 4Q3DA 3DHEA 4MVJD 2VUSA 5LDGA 3HDYA 2VZ8A 5I9NA 3ZV3A 4XRGA 4L0QA 1B26A 4DXHA 3NDIA 3DHYA 1LRKA 4LCJA 4D3DA 4Y6RA 4RQTA 4I1IA 3OECA 4PGFA 3VVBA 4S1VA 3AOEA 1MG0A 4DLLA 3S2GA 4RF3A 4YAEA 2P5UA 1KC3A 2DPGA 2PZMA 3DXFA 3U4HA 4FCCA 1GL3A 1DRVA 3EYWA 4XDZA 4CM8A 1FJHA 3LK7A 4GX0A 3DBHB 1CERA 1M6WA 3M1AA 2WWRA 1A4IA 3VDRA 1AHHA 4II2A 1ZFNA 4MKZA 4CQLB 3ZWYA 3FTPA 3ZHZA 4KDFA 1JKFA 5U9CA 1AE1A 4HFRA 1FXSA 3OJOA 1GZ6A 4W9NA 5F1PA 1U3VA 1HTBA 1C0KA 5DN9A 4YDRA 3E03A 5AXDA 3ZNOA 3ZV4A 1PJ3A 5KKAA 2PLAA 3GR6A 1HYHA 3GRPA 3ZWXA 3DOJA 2NVUB 1R0SA 3QJ5A 4PN3A 3NDRA 5G4KA 4XYLA 1MFPA 4RORA 3LT4A 5BNIA 5KJCA 3PWSA 4R3WA 3FI9A 4RVUA 4NI5A 3RUFA 3HADA 1O6ZA 3MJTA 5IZCC 5HBRA 2G17A 4R69A 2NU6A 1QR6A 1U5CA 2B5VA 2ZB4A 3EGOA 3QW2A 1X15A 5HTOA 3KEOA 3GVIA 2Q4EA 4BO2A 3HDHA 3H3JA 4DQVA 2R6JA 2F00A 1MG5A 5CEJA 1SO8A 1Z6ZA 1DIRA 3T7CA 3WTCA 2XXBA 4BNHA 2DTEA 1I32A 3BAZA 2E6UX 3NTQA 4MP3A 4TMFA 4K26A 4EGFA 3S2FA 4UUOA 4XYBA 2DAPA 3FTNA 3ZNPA 3KHUA 5T57A 4L9RA 1IYZA 2B5WA 4B3JA 3JD2A 4J91A 2Y1EA 1DC4A 2WM3A 3TSCA 4DWVA 1HT0A 1T2FA 3V1UA 4NNJA 1E92A 2VHZA 2EV9A 5TC4A 1AN9A 2AA3A 3BMNA 3H5AA 1X1TA 4B4WA 3WG9A 3QP9A 1E7SA 2C5EA 2GF2A 2PH5A 3ZI0A 4OKIA 4IXWA 3TL3A 4YXFA 2PWZA 4TZKA 2BKAA 4XRRA 1OAAA 3C8MA 2AQIA 2X4GA 5H82A 2HMUA 1H9AA 3PYLA 2HMVA 1HSOA 2Y1GA 5A02A 1PR9A 1PZHA 4YRBA 4YRAA 3RUIA 4RLHA 4CM9D 4YQYA 3WMXA 4NBRA 3KETA 4EITA 3ITDA 4YPOA 2X5OA 4AICA 4AJJA 3C7CB 4GWKA 4NK4A 4FFNA 4RGBA 3PGJA 4QEDA 1PX0A 4RZHA 1EVZA 3DO5A 3U49A 1WLYA 5TJ9A 1IUKA 4MO2A 1E1KA 3WSVA 5G0UA 5A05A 1BRMA 2X0RA 4LGVA 1Y7TA 2RHCA 3LT1A 3SX2A 4AJEA 1K89A 2CNBA 1XR3A 3FNFA 3Q9UA 4XJTA 4AJLA 5CFZA 3N7UA 1UXHA 4XIJA 2DUUA 4RPJA 5LC1A 3DZGA 3DZHA 2GN9A 1WW8A 2X9VA 4GL4A 1I2CA 3K2BA 2B4RO 1G6KA 3GHHA 3H65A 4BV8A 3H9EO 3JYOA 4ZQFA 3DWFA 2Q99A 3VDQA 1PGOA 2O2YA 3NDJA 3V8BA 4HV4A 3QVSA 1VJ0A 4JN6B 4L76A 5L51A 1WWKA 1NPDA 3G79A 1N2SA 5KJFA 4RVSA 3D0OA 2WE8A 1EMDA 1LRJA 3AU9A 2BRUA 1E77A 5L53A 5C3MA 4RVHA 2AQHA 2HMTA 4LW8A 5BSEA 1JW9B 3WGIA 3NGLA 1Y81A 1F06A 1J49A 4HFNA 5JAZA 2EW8A 4TROA 1LDGA 3H5NA 4HP8A 3UCXA 1ENYA 4Q3NA 3I6IA 5JDIC 1GV0A 1MP0A 4RPGA 1NM5A 2Z1NA 3CINA 4GKVA 2IZ1A 4LRTB 4RV9A 3UN1A 4CUZA 4RF2A 1EDOA 1T2AA 5A5EA 3GN1A 3JQ8A 3K30A 3PQDA 2P9EA 1FDUA 4A73A 1MXFA 5I7SA 3I9NA 2I66A 3RFXA 5F3RA 1AUPA 1PL6A 3I52A 4IMRA 4BMNA 4DC0A 1W4ZA 4U7WA 3ANLA 1E3SA 1B3RA 3JQEA 1QMGA
chains in the Genus database with same CATH superfamily
4NH4A 3GJSA 5AHKA 4G1VA 4MQFB 3W4IA 1K7FB 4CMKA 3SF8A 3CF4A 2NVOA 2ZB7A 4BNMA 3FCXA 3K8OE 3R4CA 3RVNA 3OU7A 4MPRA 4A9AA 5KDLA 1G64A 3OPQA 1B7GO 4KXMA 2YY6A 5A7GA 1IZ8A 1MEOA 5JISA 1OY1A 3TB6A 3U56A 3DZJA 3PXDA 5IK2A 3S2UA 4AYWA 1JXMA 1Z06A 2EKZA 5ISMA 5DN6D 1A8SA 3H4VA 3NR2A 4DRZA 1A9YA 1RHJA 5LQDA 1C3VA 1KJYA 2B1JA 3QITA 3MSCA 1JTFA 4X64B 3L46A 4IRUB 5I7WA 4FKZA 3RU2A 2AR9A 2R1VB 4G2NA 5F33A 4YONB 3G5UA 2ZTSA 3Q3EA 2J4DA 1XNHA 1I4LD 2AH5A 4GMHA 2VOEA 4KXUA 3RM3A 1KH2A 3V8RA 5IKXA 3JX9A 2J9XB 3D4OA 3TLZA 1LC0A 3AK4A 1QV6A 3WV4A 3QSYA 4GXQA 4NULA 2OZEA 2VJKA 3NTOA 2PUGA 4MI6A 1PQ4A 5FHQA 1CUVA 3F5FA 2I3BA 4QT0A 3SVTA 2JCBA 3HABA 2Q7XA 1TYCA 1Y42X 2O0KA 2WV9A 4WXHA 4Q4AB 3B3FA 3ZDXB 2VZ0A 1VHJA 4NAVA 3ZI7A 3ENWA 3LO5A 5DX1A 1TCVA 4K9MA 4MUYA 4Q24A 4CTMA 1TTPB 2EBUA 4Q7MB 4YJFA 2W2OA 4WZ6A 3AERA 5C5DA 2BUAA 1E61A 2BN4A 1FTGA 1N8KA 4NCXA 4F46A 4PWZA 2B0CA 1O0SA 2IYNA 3BTUA 2WSYB 1S2DA 2VHEA 3GDWA 4TTTS 5HS6A 2LE0A 3VGPA 4PAMA 5HVNA 5K4GA 3D6JA 3E7XA 5FV4A 1QF6A 1UC4B 2VF8A 5EY5B 3IMCA 5IT4A 4PR0A 1VIVA 4R01A 2W8BA 4NV0A 3NHRA 1FOEB 2QR3A 3LBNA 5JCOC 2PS0A 4DRYA 3TD9A 2ZUSA 5MN4A 1LPSA 1BFDA 2JI8A 2YHBA 1SC4A 5L40A 3SYNA 3W7BA 2X19A 3FYUA 2YFQA 3M2TA 2RDMA 4ZAZA 1J7JA 4UQLA 1YCDA 2FFJA 5JE8A 4YT2A 1IZZA 3IMKA 5ABPA 4TN5A 3HM2A 2RBGA 3R6LA 1MQ9A 3O94A 1BQEA 4B84A 3GLGE 3UH0A 4KI7A 2HJVA 4Z9BA 2IS2A 3QPUA 1NHWA 3TNDA 4PPQA 1D2MA 2ZITA 3WJAA 3JZAA 4TWZA 3W9YA 2XWBF 4CE6A 4ZZ1A 3KLOA 5LZ7A 3TNFA 1P3DA 1Q1QA 1V43A 2NSJA 2PLFA 4G4JA 1O57A 1U2EA 1WX1A 1C7FA 2GN4A 4D99A 3HCOA 4KG7A 4Q12A 1TJ4A 2EF0A 5JVDB 1NDQA 3CVXA 4UNNA 2O1EA 3NT4A 1EH5A 2XWQA 4IM7A 1AHPA 3OHPA 3B1FA 4WA8A 1NXQA 2QRVB 3LUAA 3U2QA 1BWQA 3I73A 5FAXA 3VC2A 3LPCA 4NDZA 1E2PA 1VC2A 3H42B 4M9UA 1QGOA 1CRZA 1UKCA 1U0EA 3CUUA 1D07A 3GLIE 2C5HA 2HT6A 2ZBUA 1L4FA 3OPNA 3TZEA 2EIHA 5A4KA 4ZO8A 1UAGA 2B6NA 2VF2A 1LLDA 2R79A 1XVVA 1XRJA 2CD9A 2ZTMA 5E9JA 3D5EA 3QLVA 4Q01A 2GPAA 2YMPA 3OLVA 3FGPA 2D3TA 1K8ZB 3EBLA 4MCHA 4UU0A 1HQCA 4QHSA 1AD2A 1VHDA 2HXGA 4IRMA 1OJLA 3QMWA 2JH3A 1OV4A 2V0NA 2F4NA 4UUQA 3GYGA 3R6DA 5DTRA 4E5PA 4EHKA 4C4RA 4DV3B 1DBIA 2AC4A 3ZI4A 3RBXA 1W88B 4X3PA 4V1CB 2AYZA 7AT1A 1G2PA 3AY0A 3ZZNA 2ACEA 3JRWA 4IDBA 5AKLA 1N6HA 4Z5XA 5CNJA 2ZIEA 5AVSA 4RTSA 1NHGA 2FN4A 3FGOA 1CEYA 2ORIA 1XEWX 1EXMA 1VL0A 2QTNA 2DPLA 3D8BA 5F77A 4D4HA 4EHDA 4F4DA 1M76A 3G68A 1WCIA 4LRYA 2F1OA 4P4SA 3WRXC 5E7QA 2H07A 2J30A 2XNJA 1B8NA 2HMAA 1M1UA 3NP9A 1CUCA 4FSHA 4ZA2A 3L4EA 1N6NA 6ABPA 1SOMA 4JD5A 9ATCA 1JMVA 1ZITA 1QGUB 4Z0HO 3HXOA 4A0HA 1NOJA 2JLYA 5LWQA 1JKIA 4YUWA 3KQKA 2A7XA 5EHIA 4N40A 1YJ5A 3VX4A 5A06A 4UFNA 2JFVA 1CZHA 4LDZA 3PXGA 5JTTA 4B8WA 5AKEA 3LC1O 5JS8A 4ZTUB 1U5AA 2FE1A 3MA0A 4EABA 2IS4A 4K28A 4E6PA 4QTYA 2BELA 1SXHA 2RI6A 2H52A 3A4YA 3KSRA 4QLAA 3C3BA 5HCNA 2GXQA 3ZDDA 4OPMA 5A6SA 1CQIB 2XYHA 4CL3A 3VH3A 1JWBB 4D4KA 1A96A 3H1GA 2J6BA 4IVQA 5DX0A 3S40A 1ZGBA 3HP7A 4EVSA 3A4IA 4FHCA 2PO5A 4BCBA 5DHFA 4MYCA 4PLCA 4UNPA 1VRWA 4PSAA 5IHXA 2VNHA 4GXRA 5DLQC 2PRYA 3OOJA 3TEFA 4HB4A 2IE8A 4BO0A 3G0GA 4BUCA 4L27A 3HB0A 4OP3A 2VA9A 1I6MA 1C9YA 1H0SA 1L3IA 2BTOA 3ESQA 3O9MA 4JR1A 4GBGA 4V0ME 3GFPA 1UAYA 1KDVA 4C43A 3BEOA 1NJ1A 1UBSB 5ECWA 2XDQB 5FO1A 3TB4A 3O38A 1KI3A 3KLPX 5HIJA 3K16A 4C87A 4ZVUA 4YPVA 4HZUB 5MFPA 3NU1A 3PI7A 2DHCA 3ZE8A 1BS9A 1DWOA 2OD2A 4HH0A 5DB4A 4BKRA 3GUYA 4OU5A 1PSDA 4CNBA 1NULA 4GW3A 4LJ5A 1UBEA 3EZ6A 3ND8A 1NSYA 1ULSA 1NP6A 5D01A 2O2HA 3WIBA 2C9DA 1O54A 1K9SA 5AOAA 4AMUA 1TU3A 3SVLA 4LSZA 1NVAA 2QJFA 2RB5A 4QBTA 3RYIA 1PK8A 2OZLB 3NYQA 4Y6PA 3DDUA 3IILA 4KLNA 1QYWA 2EP5A 3Q10A 1YRAA 4JI2B 3H2BA 3AP1A 2PBFA 2VDKB 2WMDA 2YZNA 2GM5A 2QRPA 2ZRHA 3BFKA 1ZXLA 3E3LA 1JSLA 3JQGB 3N76A 4BZPA 2ZTUA 2Z95A 1DKPA 4G5GA 2I2DA 2XNHA 4L4SA 2ZUUA 1DL5A 1QGYA 2PX6A 2GBIA 1GGMA 2YJTD 4PPNA 1LDEA 4YGYA 4UM7A 3SJAA 5LMNB 2ZUTA 2FFQA 3OEHA 1DRWA 2JLVA 3BXXA 4TXLA 4B3DA 5LA6F 1QAOA 2P9TA 3B3GA 1KMHB 3RSCA 3VKHA 1RAGA 3DE1X 3RAJA 1N6PA 1JHXA 1O5TA 3MJRA 1KDTA 4HXYA 3UBMA 1WMBA 2FRDA 3EIOA 5JADA 1RRGA 4M4SA 1EWTA 4NNOA 3EA0A 4MVJA 5DLPA 2X0IA 5J2TF 1RQ2A 3T1HB 1GM5A 1H2HA 4RS4A 1Y3IA 1I7SB 1MH9A 3B6KA 2PUCA 2GUGA 3U44B 1TYAE 2MYPA 2Q49A 4G5YA 2L2QA 3GJZA 4OGLA 2RK4A 1XZQA 4G25A 1BHO1 1P2VA 5DZSA 3OOWA 1RYNA 2PUJA 4HQKA 1KBOA 4KR3A 3A10A 3SEZA 4DC1A 2J08A 1L8LA 4MVJM 1IHDA 2J8ZA 1DDGA 1XRLA 2GH1A 4ID9A 5C4GB 4CVNA 1N5JA 2R9VA 4BMPB 3GD7A 4O29A 2QL6A 1TJNA 4M1KA 1PDOA 4UREA 2QE7D 4XGIA 5FX2A 3WK6A 1A72A 3B13B 3W34A 3UWPA 3JSXA 4IQ8A 3VO1A 3BXGA 1KMNA 3Q87B 3K9HA 1RVDA 3OLXA 2QX7A 2Y6UA 1PJQA 2R48A 3QYFA 5EKDA 2ECPA 4L73A 3UH1A 3HJRA 3ZUGA 4KMOA 2GERA 4R1UA 5IJXA 4WXPA 1ZMTA 3D2BA 1JPVA 2AW5A 4IDHA 3VO8A 1PT5A 4ARIA 1U3GA 1N75A 1YZTA 4UDYX 1BMFD 5FTMA 3MBKA 2HL6A 4IX1A 2RI0A 4XA8A 2QN9A 3MPUA 4UFOA 4A2QA 4RTPA 2F9MA 1MPTA 5T41A 4TVBA 3B52X 1P61B 3VSCA 1YHZA 1V5GA 2Z5FA 1DV1A 3F9RA 3G3EA 1K63A 1TM7E 3DDHA 2AG5A 2AWNA 3PB3A 3QYAA 4XB2A 2R5WA 1IJBA 2O3SA 1T5TA 3S81A 3SAJA 2Y2UA 4WNAB 3M4ZA 1SUAA 1YQWA 3DBHA 2OAGA 2WMNB 4C4AA 4UAJA 4PGMA 4WN3A 3VR3A 1D5CA 1XZGA 4ID3A 4CQLA 2VEDA 1KVQA 4DLUA 2RAUA 4ZC8A 1QPBA 2AXNA 3CSUA 4DILA 1FFBA 1FQKA 2A9KA 1JFVA 1U2GA 3PKZA 1L5VA 1CJMA 1J25A 3NV9A 2HPHA 1QRRA 2NZWA 5TNXA 2EL7A 2YNMA 4FW9A 1NR7A 4CFYA 4NBTA 1DO8A 1LW6E 3A7DA 1XQ9A 4IOJA 2VC2B 4QPNA 2DOKA 2RAVA 4HZIA 3TM5A 3TTWA 4C0SA 3IT0A 1FUEA 1Q1ZA 2NVUA 2ZYSA 4L4XA 4MA4A 5K8CA 1K4YA 1R6VA 1EA5A 3R9XB 3IR7A 4TRJA 1UKEA 5KTPA 3T7IA 1OZ0A 3ZJUA 4QXMA 3UXHA 1YE5A 4RJLA 3CE9A 1NJFA 5B1HA 3NGXA 2R6ZA 1YKFA 1X1EA 3JQ9C 4PYLA 4AKTA 3BF8A 3K09A 2CWWA 5FJIA 1Y7IA 2DSTA 4PYRA 3V6LA 1NXSA 1YA8A 2CL5A 4B8ZA 3KWMA 1S4QA 3GFOA 5L95A 2JC3A 3NHUA 1JYSA 2A57A 2HRQA 3L7BA 2JARA 2V9PA 1KH3A 3MD9A 4MI3A 4CR6A 9GPBA 3A4MA 4MV1A 4YRJA 5HX7A 1HV8A 3BRQA 3D4NA 2QVZX 5HRCA 1BXRA 3AEQA 1N9GB 4PBTA 4POOA 2L19A 3G8DA 5GZ1A 5FT9A 5F4ZA 4JIMA 3OM1A 4QDTA 2O0LA 5E3HA 4ETIA 5LFAA 3F5DA 4AO7A 4MUIA 1HXHA 1YA4A 2FPIB 3DFZA 4KDEA 2ZRQA 4K3UA 2AFIA 1I80A 3BOSA 1KKLA 1QTRA 4I0WB 1ABFA 2QRUA 2VHUA 3GZ4A 4P9NA 1JDZA 1EFVB 4I1OA 4QO8A 5EWJB 1G8HA 2G1PA 4Q5IA 5KKCA 4IIEA 2NADA 2IKSA 1NWHA 4P3YA 4AY5A 2W93A 3BGDA 2AMYA 2RBKA 1IU9A 5KINB 3BA6A 5HOQA 4D5EA 2WT4A 1P9OA 4R8MA 4EYSA 1MW9X 1U6IA 4C7JA 3OIDA 1G0NA 2GNOA 4RAOA 2IEIA 1YVPA 1OFTA 1TLFA 1UZMA 2H6EA 3OPYI 1ECFA 1LK5A 1YB6A 5BYJA 4PV7A 3BGWA 1HG1A 1RCUA 3QFFA 3FX2A 4FXOA 1WP4A 2J0EA 1DU4A 4D45A 4F91B 2DXIA 4KNYA 4P34A 3PRJA 5E4TA 3B3QA 5HMMA 4FGWA 3P8ZA 1E1CB 5LZ9A 1B8UA 4KFSA 4MWTA 1B43A 3JQBA 3FBTA 4RXUA 3RBVA 1UM9B 4YMHA 1KYXA 1GJRA 1LXCA 3C3CA 4O1MA 1GRVA 2CXOA 5TGTA 1L4HA 2JK0A 1VIMA 1S9DA 3LBIA 4ROTA 4ZODA 1KMQA 4TLCA 1N2OA 4MUKA 5ADUS 4FYIA 4G09A 5J23A 5AKYA 3ADKA 4PC1A 3T3EA 5KNDA 4PHGA 2G5GX 1OLXA 3PLNA 5A3VA 1Z13A 4N0DA 2VHTA 4AP6A 4UCWA 1JKJB 1WKVA 2QPOA 4BLQA 4QYWA 4IXNA 1G2QA 4OMUA 1VLMA 2PKXA 1XLUA 1PCXA 2JVKA 4UZEA 2IF2A 3N58A 5DBFA 3JWJA 1I4DD 1E2FA 1P72A 2FPGA 1C9EA 2I22A 3ZHSA 4WXRA 3GPLA 4XDGA 3HY6A 3ZQUA 3AY3A 4Q3AA 3UOGA 2AWOA 1HE4A 4R1TA 5EJ9A 1M33A 1T9GR 2MTBA 3I76A 5K51A 2OVFA 3RIYA 5CH3A 4Y6OA 3GLSA 1V26A 2Z98A 1AO0A 3BJIC 1JV2B 1SHZA 2A92A 1LJ8A 1QVWA 1LA2A 1NF3A 3HB1A 2H4ZA 3PFKA 5K6TA 3NBAA 2MHCA 3PC6A 2F43A 4H0FA 3SE7A 1XQ1A 4BYMA 1G5TA 4IJUA 2ZSBA 4UFPA 1K08A 1P5JA 1TGYA 2F4VB 4H7DA 3GRAA 3GEHA 4GEGA 1NXTA 4WJLA 2R6GA 3BK7A 3O4VA 5KNCH 4TUYA 4IXTA 4RKRA 3NUQA 2VJMA 2CHEA 2YJ4A 2DCMA 1CUXA 1KP2A 2ZR8A 3CBGA 2B37A 3LZCA 4OV6B 3SK0A 4E4RA 4CYMA 2ODAA 1X8JA 3GJ6A 3L40A 2DCUA 4O1HA 5I4KA 3T06B 1VSUA 2C7VA 3EB9A 1ZD2P 2WU4A 4UU1A 3Q7RA 2NU9B 3WLRA 2CD7A 1T3GA 3LQQA 3TAUA 2X41A 2ZIXB 1Y8QB 4BPBA 2WWFA 2Y93A 4H7PA 1UMDB 3D7SA 1TLTA 1UWVA 3QOYA 4NY1A 5F52A 2GTHA 4ABTA 1U9IC 3V7YA 4NJOA 2OO5A 1P29A 1TFUA 2G0AA 2NO1A 2WAMA 4G5RA 4ADSG 2B78A 3T54A 3E3NA 1WDLA 4U2BA 1VL6A 3R3VA 4QQKA 4BPRA 5KYYA 3NJRA 3AW8A 4FEGA 1TRHA 2AXQA 2BGKA 3GAZA 1SBTA 3TX6A 3OWHA 3THOA 1RBMA 4C6SA 4CKEB 1P77A 4CBVA 4BFWA 2ZXUA 5CVUA 1B2RA 1EJBA 2SKCA 2XNDD 3R3WA 3WDKA 4N54A 4E5VA 3NATA 2VRCA 2P5YA 1XEAA 1VOTA 4KV7A 4B82A 5KX5B 3LC2O 4TTVA 4ZVOA 3L4SO 4NENA 1YS7A 2IEGA 2FZEA 3T38A 1KPHA 1VIYA 1Z4PX 2KM1A 1FMFA 2FMHA 1M1NA 2HA3A 2QTCA 3IBCA 1EFLA 4OL9A 4OQ4A 1AG9A 4D3FA 1W35A 5FBLB 4BE7B 2PLWA 4DM7A 2YWGA 3LE8A 5CLFA 1OLOA 2RGXA 4S05A 3KVYA 1UBTS 2OP0A 3K1TA 3OCCA 5HF6A 3HN2A 4NYJR 1E79D 4L6IA 4PG8A 2ECKA 2CFRA 4KYTA 2OKGA 4NV1A 2P27A 2AQ8A 9ABPA 4BNIA 1LLCA 1Q7GA 4RLSA 5LXTB 2R68A 4LDQA 4LSMA 4B6OA 2ZBDA 4L5AA 1W2WB 4MZXA 1DX9A 1GRQA 5BYBA 5THKA 2YBEA 3UWKA 3SE0A 5L3QA 2YFYA 4JBHA 4IH1A 3EJWA 1AHIA 1DBVO 2X58A 4UARA 2IS1A 4EZBA 2HHLA 1Y48E 1H3FA 4K86A 3EIEA 3EF0A 3ZQ4A 3Q40A 1GAEO 4ZN6A 2YXEA 2YIJA 3INTA 3UXEA 4X1IA 3W5UA 1UPUA 3ROGA 2VK8A 3VKFA 4BO7A 1HL7A 5BWCA 3QVGB 5GZ3A 4B3MB 1P62B 2NO7A 4HQOA 1XO1A 3OY2A 5GADl 2OV4A 5I6DA 4B32A 1KEZA 2E0IA 1ONOA 1T2EA 4LGCA 2I4RA 2GRAA 4OOFA 1RQNA 3PLRA 4CKYA 3CTPA 3CUKA 3HY3A 4J29A 5EJ8A 3WQHA 3OE5A 1HDGO 2XCQA 2EDAA 3GUZA 1ZHFA 1D4OA 1P2DA 2CMFA 4FYXA 3EXHA 3IIEA 5BSRA 1PVOA 4UMFA 1CR1A 2H1IA 2FN9A 3RFVA 5KYKA 2O8EA 1FVFA 1TKBA 1Z6PA 2XUKA 3IQZA 3WNVA 2VYNA 4QM7A 4L15A 4HGQA 4BWGA 1E0AA 3MG9A 4EZEA 2LDXA 4IJVA 1NL3A 1GAQA 2PBLA 1D2EA 1G0OA 1KK2A 2CSXA 2RHMA 2AEEA 4IUDS 4G2TA 4EMTA 5K4HA 3OZ7A 1Q84A 2EOAA 3D0KA 5CLGA 1GGKA 3W8NA 2IYTA 3AHDA 2PY6A 4TQ9A 1E1RA 5F2EA 4ZVVA 7ABPA 4QU5A 3RJ9A 2NV0A 3FNEA 4LHEA 2B34A 4Q3KA 1OW3B 3BQNB 3IBSA 3EGDA 3ROPA 4V03A 1XA4A 2J7PA 4JVMA 5T4FA 1FMCA 4GBMA 4K9PA 4WD3A 1CJUC 2ATCA 1MJGA 3T7JA 1BGXT 2I0FA 2JCYA 2QRKA 5CNMA 1QP4A 2ZRLA 4TM8A 2YC2C 3T5TA 1Y1QA 4JQOA 5CGQB 1RI5A 1L8QA 3D81A 5IDXA 3RFFA 4DWOA 2F67A 2QW8A 3K2QA 2YYSA 4D92A 1W25A 2WIDA 2E1RA 5L4SA 4FWTA 2OO7A 4YP1A 4TKMA 4HLUA 3Q5GA 5EHGA 3ROEA 1LBEA 2A0WA 4LY6A 5EIBC 1OB5A 4W1PA 4XDHA 1Y8AA 1KI1A 4MJLA 3LQRA 2AXEA 4Y6GB 2Q3HA 3HS3A 3E9MA 4O4JF 5ENZA 3K0AA 4A6DA 1YDEA 3VV3A 1C1DA 4CGYA 3EVAA 1QB8A 5JO9A 3N2YA 4DBLE 1XZIA 1QKIA 1HH4A 2XTAA 4M6WA 4KSBA 1SCUB 1V3VA 1E0JA 2KB0A 2XYPA 1G7CA 3FKSA 5DHAA 1J0AA 3R2JA 5H3LA 1ZM7A 3AIIA 3TKLA 2IX9A 4D4LA 4CT4B 1F60A 1KRXA 4CR7A 1NMSA 1DMSA 1HFJA 4R0NA 4EHFA 2BGJA 3E1SA 2ZG6A 1RJEA 5JBNA 3PA6A 1B16A 3VJMA 2JEOA 4JI4B 1ZNYA 4M49A 5JMWA 4F56A 3AGPA 2GYWA 4A8JC 1MX3A 1M2EA 3HPRA 4B4UA 2AJ8A 1JMYA 3OFJA 2IZ5A 4CL8A 2PRZA 2VQFB 4XQ0A 1M6HA 2ZXFA 3C5CA 4QFCA 1AV6A 2XF2A 2IYRA 2QAGB 3NM5A 4R40A 1RCTE 1Z07A 4O63O 2O57A 2WF7A 2OFXA 1W9HA 1TADA 3DOEA 3LQFA 4UEOA 3VBEA 2IUFA 3EG9A 4XLZA 1JP7A 1QGDA 2OXRA 4WFQA 5BSTA 4L3VA 1CHDA 4F60A 5I7FA 3ZV7A 1ZD5A 2D06A 8ABPA 5H8WA 2NO9A 5D3QA 5IDYA 2ARKA 4B6EA 5DIFA 2GA8A 2VHYA 4U9IS 5BQ5A 4UXHA 1QCYA 1RAHA 1UC8A 2ZYGA 3SBDA 4IUYA 1VPDA 4XAQA 3SXPA 3EQ7A 3D1JA 5JFTA 4DBLC 1EBUA 2O2EA 1WD7A 3U7QB 1WXWA 1I0ZA 4S1OA 2H1FA 1MRZA 3VU3A 1RRMA 2XRFA 1QZTA 2CY0A 2OWEA 1NLZA 2ROQA 3KOMA 5ALOA 3U4GA 1P6QA 5FWNA 2RGNC 3C98A 4RSMA 4JS0A 1IWOA 3L0DA 3L0BA 4J16C 1TT7A 2XGMA 1NPYA 1VB5A 1DAGA 3CHYA 4M1EA 4Q9KA 4Y2UA 3ASUA 3VVCA 3WHPA 2YV2A 4BL5A 1JEYA 1DSSG 4GOND 1SOUA 1DFGA 4AWAA 3DUWA 3KV1A 3KYDA 4FCTA 1NSTA 3M9WA 1L7VC 1X6VA 2WW8A 4G4IA 4H1UA 3KZKA 4L78A 4F72A 2ODWA 4JYBA 1UBCA 1AHNA 3O03A 1QIHA 3NDBB 3NIFB 4MWCA 1Y80A 3GPDG 3ULKA 2HK7A 3AXTA 4BBZA 5CYOA 4CG0A 5ALMA 1BN7A 2J5XA 2XKBA 4KUGA 4X20B 1GL6A 4YREA 1LGYA 2CVPA 4XD2A 3CKLA 3OQ6A 5E6RB 4KAXA 3QA9A 5C7YA 4IFEA 2W2QA 5K2MA 1I30A 3CXUA 3H0EA 4MKHA 3VPXA 3H2SA 3ZLBA 3AETB 4BJ5A 4H7HA 2XUZA 2WNHA 4NE9A 4XTCS 4BRWA 2HBRA 3WB1A 4QOSA 4PONA 4V39A 4BGUA 1JQEA 2WYUA 1UPXA 3MGAA 1U90A 1JWAB 3HSSA 3PUJA 1NUUA 2KYRA 5I7VA 5ERXA 2DBZA 1V37A 2PKQO 3L6UA 4F11A 2CBGA 3EIUA 5GINE 1DAOA 1XQVA 3MFQA 2BSAA 2QSJA 3JXEA 2VLIA 1A2OA 1UOEA 2LUOA 4GP9A 4Y2XA 2K87A 2PUWA 1M2KA 2Z3VA 5AI6A 2HFJA 1WXIA 4KGVA 4P7FA 3HZZA 1V1RA 5E3IA 1EG2A 3FMIA 3EOZA 4DR7B 2HBZA 3EDCA 2ZJ6A 1RHUA 3DA8A 3AT1A 1KVTA 4FB4A 3EPJA 4B44A 4Q4CA 1NFFA 1T3HA 1X7ZB 4CKWB 2Z5VA 3NM6B 2PZFA 2BSQA 5EEGA 2BFCB 1F2VA 3QJYA 4ZAWA 3QU5A 4TKUB 3DHWC 1Y82A 4HVAA 3DV0A 4PICA 1VMIA 1MAVA 1W59A 3CRRA 4DY6A 2DE0X 4W63A 3VKUA 1KPGA 4BEWA 2QTTA 2ZWOA 2P3OA 3SC3A 5EQDA 4F93B 4WLOA 3OJWA 1V5IA 4XQEA 4E5NA 3AP2A 1ADBA 2FYTA 1JILA 1K66A 2IDKA 3K96A 2WIGA 3CIOA 4RHFA 4PTYA 5EOVA 3K0BA 4G0XA 1TF7A 2A1UA 5FFMA 4DG8A 1NYQA 4PZAA 2VP0A 1ORDA 1RU3A 4L9WA 4M9QA 4NWIA 1TAGA 1VE1A 3DXZA 2X9LA 4WOCA 1Q7BA 3LNTA 3INRA 4MWBA 1T4BA 5H0IA 4ASUD 4U2FA 4LDJA 4D6YA 5CDHA 3TCXB 5L4LA 1NVWQ 3G7UA 3Q0IA 1UANA 2QZZA 4MLPA 3DBRB 1NN0A 1DC5A 3E8MA 4HJRA 4PZLA 3TLMA 1HQKA 1XU4A 1YFZA 2C9ZA 4GUAA 4D0RA 1H4QA 1RM5A 5T3UA 4GMKA 3VKGA 1V6SA 1YVDA 3D4BA 3OUUA 1WZUA 3TTTA 1T6NA 3N07A 3LIPA 4N7RA 4B09A 1EFAA 3ELYA 2ONZA 3P27A 3T3GA 5LP6A 5CMLA 5LIRA 3PSAA 1IY9A 1KXJA 1O9GA 1I33A 2E37A 3HA5A 3O75A 2DERA 3UK6A 3OQOA 4C4SA 4AQ7A 5IHPA 3F6CA 2JA2A 2RC6A 1U0SY 4X44A 3QWIA 3LDGA 5HBGA 5KJFA 3TSWA 3MYYA 2ZS7A 3GC6A 3L41A 1TUGA 2EHDA 1ML4A 1TRKA 5B2EA 5AKZA 1YC5A 3JARA 1WE2A 2BZ1A 1QE0A 1XPUA 4IO0A 4QSHA 2PGLA 2FUKA 4IV8A 3W5JA 4OHPA 2OFPA 2FUCA 3P9ZA 4NR0A 4ZV4A 5K7SA 4R2LA 5ICEA 1KDRA 4MVJF 1VCIA 3BH0A 4NJMA 5COBA 4G23A 4R54A 5ULLA 2WWYA 3IHWA 5FPPA 1ZBDA 2VJOA 4PHTA 1KETA 3DBLB 4J1NA 1NJ5A 3QLEA 5DYGA 1SK9A 4NCKA 2AVNA 4I4LA 1ZMRA 3AGQA 3LQ2A 4A2WA 4GX2A 4DLPA 3WK8A 3SPXA 5KBYA 2IWRA 4Y9TA 3DC7A 3E84A 3ZVKA 3STXA 2PTGA 1Z0AA 4E94A 1WOMA 1ANKA 2QW0X 1X7XB 3CVWA 4ZQEA 4X6LA 4B8YA 3O8QA 3K20A 2GO7A 3R5FA 2FZ5A 3ZWWA 1FSSA 1NIJA 1QKKA 4MB0A 1UDCA 1NF9A 4K6MA 3VR2D 1WY7A 2PSEA 3WBJA 4AK9A 1RKUA 2QVLA 4R6XA 4W7IA 2RB4A 5AW7A 4S0ZA 1U1FA 4AVYA 3A6JA 3F49S 4QGSA 2NUAB 5I8WA 2LZ0A 3B1KA 3F9IA 1Q7RA 4EENA 1J5XA 1PJLA 1M34B 2CLMB 3D43A 1FDWA 1HFKA 1QORA 2PV0A 5K03A 1AS3A 4YT4A 4M0KA 3LVBA 3HVUA 2D2FA 3PITA 2P7IA 3QW4B 1SMKA 4GNKA 1U8TA 3I62A 1PFVA 1RZUA 4Y9UA 4MJXA 1KZ6A 3CWCA 4MRMA 2IY7A 3OZIA 2WZDA 3NRJA 3ZEAA 1ZGZA 5KWEA 1PR6A 1Z2EA 4WZAA 2XCRB 3F74A 1Q0UA 4GKJB 1XYVA 1Z56C 2IQIA 4N6OA 3F8WA 3KTFA 3UHAA 1JG4A 1I4WA 3I42A 1Y3AA 3NHYA 3FHCB 3LOQA 1PEKE 2FZCA 3WNCA 3I5XA 3WO1A 4RD6A 1CD5A 3G1UA 1A5ZA 3EE6A 3O4RA 3PNBA 4LYDA 1KY3A 2JIZA 3HEBA 2QM7A 3UV7A 2W4MA 2Q5JA 3IURA 4DZRA 3UK1A 1Q17A 3T5GA 2I2BA 5JCPA 1SOWA 5L45A 1JHAA 2ZSDA 1O96A 4YBRA 3OF2A 4JLPA 5C8YB 3TDKA 1JI0A 2EJVA 3CRMA 3RC8A 5A0VA 3L5OA 2YVAA 2ZJ5A 2RI1A 2C77A 3HMQA 1L9XA 1I4OA 2HWWA 3ZWDA 2GNAA 3FRHA 1CW2B 2JLCA 4LDRA 4JQSA 3HR8A 1RXWA 4GG1A 1WMAA 4I5FA 4RZSA 3E5NA 1NVXQ 4FJ1A 2VQSA 2NIPA 3HJNA 3G2MA 2OFFA 5KWIA 10MHA 2F7SA 1XVIA 3G49A 4OXQA 3A2LA 3Q7PA 1Q3TA 1E8NA 1GU1A 1MX5A 5DGIA 1L8OA 1UBUS 2AW3A 3CTMA 3GXOA 3U0BA 3B1WA 3FTDA 1GPH1 4FNOA 4MMYB 5EFOA 1X8XA 1AGRA 4ROSA 5FBVB 4OJQA 4F12A 1DBPA 1Z0SA 2PQ2A 3BTVA 3OIGA 3SBOA 3A9WA 4D9FA 3RRNA 3IC5A 1K6IA 2YZKA 1ZJZA 2DFTA 2H8GA 4O8CA 4PVDA 3LH5A 3S2SA 2JCSA 4BWVA 1A8PA 1R3UA 2O1XA 1ISHA 4H9GA 4OA5A 2RONA 3QF4A 2C04A 2O3RA 2D0IA 3MJEA 5DM60 1YV9A 4R5MA 2CNNA 1N0IA 1V1JA 3UC9A 3SXUA 1CJBA 3ZN2A 1UDWA 3A2KA 1C81A 2X0NA 4BS9A 1DZIA 3MWEB 4QUKA 2VXCA 3KU1A 2ATVA 3EXFB 3RVRA 3SX0A 4F4JA 5B4VA 4X00A 3OIVA 3H18A 4I5IA 5KJ1A 1U3DA 3DMPA 4ZV7A 2QD1A 2QJRA 5HPYB 2CNDA 3PHIA 4EO4A 3L6EA 4LPSA 2Q3DA 3C48A 3UTCA 4ZMSA 2I62A 3H5RA 4WKPA 3MLEA 4JQZA 3C1OA 2HTEA 4LTNA 2C5BA 1GRCA 4UOQA 4POAA 4V2IA 4D9BA 1DEAA 4OFXA 3DBOB 4JB8A 5IN5A 1RADA 2HYIC 3A1NA 3QPAA 5DCYA 4R0MA 3GLGB 4TWBA 2ORED 5A6SB 2XT0A 2OORC 1WA5A 2BKVA 3WP0A 1GR0A 4QIHA 4IGIA 3K72B 1ETUA 1UZUA 5EZYA 1I14A 5J58A 3KYJB 4LXGA 4EUSA 2QM3A 4ZT4A 2YVLA 1KAQA 4RIGA 3CZCA 4R2WA 4WK4B 3UIEA 4DMRA 3STWA 2PJUA 5AK3A 4BZWA 3CLUD 3FZGA 3KUKA 1OX4B 2G4LA 4XKJA 4BJ3A 1JVBA 4UM9B 4X6YA 4OREX 1S2NA 1Q0HA 1QFXA 2HA7A 5IWCA 2A1TS 5AM3A 3AVTA 3CJQA 1W6RA 1RZRA 1ZSNA 4MVWA 1KR2A 2C29D 1JFLA 1UJBA 4JLWA 3TLAA 3TSZA 1KFKB 1BFUA 2P30A 3BIJA 3HB7A 3PZBA 2FEAA 3L7JA 3HXMA 4FZ3A 1QU3A 2F1KA 3I2IA 5AJXA 1PV4A 1PS8A 1U0FA 4BX3A 3BN3A 4DQUA 3RC9A 4HDSA 5LR6A 2W4IA 4D3ZA 1PW7A 3KU4A 3RJ5A 3C85A 3ZVRA 1P1JA 1G20E 2WK1A 3LGXA 1WU7A 4WXYB 4F3NA 2WJJA 5HMLA 4Q1CA 1PLLA 3DCYA 1AKTA 3R0QA 4RV5A 4S1PA 3RYIB 1HDOA 4WOPA 3P0RA 4I1SA 2C07A 3DOFA 4O8ZA 1A4RA 1KI6A 5AVTA 1HC7A 3BRWA 1FTWA 2UAGA 1P0MA 1J22A 5CB8A 4B3SB 1M7BA 4DCNA 1AQIA 1IEXA 1A27A 3P7MA 4JWKA 3E05A 2C31A 4YVFA 3TMKA 2XUFA 2HYDA 4GM4A 3HSKA 4CG1A 3KHTA 1T43A 2FW8A 3KLNA 3E9QA 4G41A 2ZIWB 1JEJA 1E6MA 5BW5A 2GK4A 3D3WB 2WSSD 3EMDA 3WLIA 2NTEA 1JSXA 2H1CA 4NZZA 2C2OA 4Q1EA 5C31A 4IHKA 3DQZA 1CRLA 1V8ZA 4L74A 2HI0A 4B6RA 4RCZA 1EEHA 2HWKA 1J39A 1CDEA 2IH4A 1U9CA 1AURA 4TUYF 3LUBA 3OOSA 3P9KA 1TD1A 1QCCA 3PGA1 4OUDA 2NNLD 4JX8A 2CXTA 2C2MA 1YT5A 4D80A 4XWKA 2H17A 5BV1A 3ERCA 1I3MA 1SU8A 2PXXA 2WWHA 5CX4A 3RYHB 2WA1A 1KWGA 3EVNA 1D3AA 1D2CA 3HO8A 3RS7A 3KJIA 2GOYA 3LPAA 1U80A 4LPKA 5L7YA 2AL7A 2RGCA 1V4NA 3TNYA 1NR1A 1QANA 2VQDA 1VSQA 3SQNA 5A7FA 1WZIA 4F2HA 1C0LA 4BLWA 3THRA 2WMYA 3FROA 1IK6A 3UUFA 1G63A 2P1DA 2VHWA 3BMQA 1GPUA 3QXHA 3FHLA 4PSKA 4ZVNA 5F98A 4LOAA 1XRNA 5JU6A 4EI8A 2C4UA 2NSLA 1TAHA 1CJTC 4JIGA 1NW5A 1WPRA 5CIWA 4O4HB 5AKJA 1E0SA 2DBRA 5IKEA 5JMTA 1OHHD 4U6QA 3BE4A 2QLMA 1UBRS 2PS3A 3M1YA 1XK7A 4HUQA 3CUVA 4ISCA 4LEIA 4YO8A 3RT1A 1W85B 4FFDA 3WGYA 3O8OB 1I5EA 1CZRA 1EVYA 1XZLA 1QRDA 2FQWA 1ZVJA 3PV0A 3EWAA 3CVYA 1EWYA 2IHZA 2FPLA 4RA6A 4KQ2A 1Q0ZA 3WDLA 3ZVNA 1RPAA 3U40A 4MUHA 2WP8J 3O84A 1NDUA 3CCFA 1Y1RA 2QP4A 3IVCA 3PYXA 5IZ4A 4DDMA 2PCLA 3DAOA 4KWEA 2HA5A 2MSNA 3QZUA 5AVWA 4FFMA 3JAMA 4JB3A 1UMBA 3D8NA 3LQ1A 1ULUA 3CN9A 3LYUA 4K03A 1DDIA 1MOSA 4HOYA 1W8IA 1ZOLA 3MOIA 4G0YA 5BVGB 2I9PA 4QOHA 1N1EA 5K3OA 3K9GA 3P9XA 4ZPXA 1SA0A 3IBTA 2WJGA 3LG2A 4OAQA 5ED0A 1P4HA 2GTPA 4JJ4A 4KVGA 3GLHE 4C7VA 2O2JA 3NVMB 5M7EA 1PWHA 3V48A 4RE5A 4CNQA 1I13A 4ZXFA 4BMXA 3PHHA 3OEWA 5DV9A 4Z4CA 4YK7A 2WD7A 3GIDA 3AR3A 4C01A 4W5OA 2PWAA 1CTQA 1FX0A 2IYQA 4K6KA 3VR5A 1WR8A 4OHWA 3UF0A 4ALLA 1MH1A 1SWVA 2VYVA 2JCXA 3LPNA 4H6VA 1U1CA 1QFZA 2JVIA 3EEBA 1V39A 4PX2A 3FDXA 4H18A 4E6EA 1PX2A 2G8LA 2QRZA 4UBLA 2Y68A 4CG3A 3ZEIA 2QJOA 3H4MA 2J9YB 2PIAA 3R20A 1IG0A 4PWYA 1Q1GA 5D1NA 1XTJA 1PHPA 2H54A 2XAUA 4JI1B 3DULA 3R8CA 3ZDBA 2FOLA 4JROA 3ZZMA 4UATA 5D8DA 4RKEA 1XFDA 3UJ6A 4JI5B 2Q3BA 1C9DB 1E9VA 3CLSC 1LSUA 3DVLA 3F6YA 5IFKA 2CT8A 2RH8A 1ZOIA 4RLQA 4L02A 3LRTA 4FC6A 4KREA 4JLMA 4RFSB 2BE7A 4Z0PA 2DUMA 3L3BA 3MTDA 4X71A 5AW9A 4P82A 2IYUA 2BE9A 1VE5A 4INPA 3WQSB 5BQPA 4XPZA 4P0TA 1SCBA 1SU4A 3PHGA 2ZUEA 4UOEA 1R16A 1VBNA 4MQBA 3AVXA 5EMKA 2H57A 4DDKA 2CMHA 3OJEA 1KHTA 5F9HA 3JQAB 2IPMA 2WJ3A 2ZS8A 3I1JA 4E5DA 4M86A 3W8RA 1E3WB 2P4UA 1XMVA 1EM8A 2J9ZB 2OWDA 3FHOA 3P1JA 5TQVA 2CNWA 1EP9A 2QEQA 2AD5A 2CVFA 3L7IA 1NVVR 4YLEA 5IZCA 3HKBA 3RVDA 3TO5A 2ACVA 3D8UA 1ZCZA 1UFVA 3AVQA 4NIMA 2BRUC 3F3SA 1W5EA 3BMCA 5DGDA 1IPEA 5DHSA 5JBIA 2IU4A 4ND7A 4FE3A 4NU0A 4X3OA 2OOKA 2ENUA 3PENA 1OLSB 1U8EA 1SIWA 4RGQA 4CMIB 1E59A 2FP4A 4NE7A 5TS3A 5JBQA 5JSFA 3GOHA 3S7ZA 3E3MA 1PKXA 5TPZD 2LCQA 3PUKA 4BASA 5G41A 5T64A 5JCZA 5DNYB 3DR3A 2CE7A 5UKDA 2XZOA 1ADFA 3TBFA 1SUPA 3S2ZA 2NZ2A 1K7EB 3MIZA 4IIJA 7REQB 3THWB 4D96A 1YGPA 3I2JA 1QP7A 4QWMA 1F9AA 4JKIA 4U2GA 3FBWA 2AN4A 3I5MA 3I0ZA 4QULA 2FZLA 4FLMA 4KRYA 4Q7QA 2WJPA 4IYJA 5ESXA 4GRDA 4MULA 2VTEA 2OA0A 3V8EA 4MICA 4Q9LA 3VV2A 1QUFA 4JYZA 3QH4A 4CT0A 4JL6A 3KAJA 4OAOA 5BUZA 1KK0A 3TRJA 2FZKA 2JGAA 5CH8A 3EYAA 4DLZA 1Y5RA 1M2OA 3RRJA 2CBZA 1YQ9A 2VP6A 1JDBC 2G40A 1TKRA 2FW6A 3RS8A 3AUXA 3WLPA 3L1HA 3OQIB 3NTRA 2WLTA 3PT5A 3W06A 1D2RA 2BP7B 2Q6LA