4TQGA

Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
319
structure length
297
Chain Sequence
SQINDKTIMIFGGSGSLGNRLIETYINNNIIVNYSRDESKHWSMELKYKSDKLKNIIGDIRDFEKVQQSIMRINPDIIIIAAALKHIDRCEYEINECLDTNIKGLQNVLKVTEINRSNLSNLKAVCFVSTDKACSPVNSYGMSKAICETLVVEKSKYIKDIKYVCVRYGNVLNFTLTHTSMTRFIMTLDDSVKLIEYAIINGNSGEIVIPKLNSMYIKDMIELFADKYPIVITGLRSGERMYESLINDTQSMKTVPKGDYYHILPTYDPTIVTEEFYEYSSKQNILSKQELENYLNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dTDP-d-glucose 4 6-dehydratase
publication title Giant Virus Megavirus chilensis Encodes the Biosynthetic Pathway for Uncommon Acetamido Sugars.
pubmed doi rcsb
source organism Megavirus chiliensis
molecule tags Sugar binding protein
total genus 114
structure length 297
sequence length 319
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4tqgA00
2PA3A 1CIVA 4J1NA 4NR0A 4FOOA 5ENVA 3CINA 4FR5A 1H6DA 3QA9A 2EIHA 5H83A 2OBNA 1XR3A 3AW9A 5TX7A 1J0XO 4RVFA 3SLKA 3TNLA 4RVSA 3CTMA 1P0CA 2YHIB 3OETA 4PGFA 3W8EA 1IZ9A 4D46A 1PIWA 4GVXA 1R0SA 2VZ0A 4WJZA 5BNTA 4A0SA 3JD0A 4Q39A 3L9WA 1N7HA 1A4UA 1X0VA 1HKUA 1K2WA 3PGJA 3QHAA 1DDOA 2DTEA 5DZSA 4AJPA 1F0YA 3F6YA 5EPOA 1DBVO 3JQBC 5MGBA 1P31A 1U3WA 3GT0A 4KDEA 5L53A 1HSZA 1ISIA 2ZTUA 1HL3A 4FFRA 5TT0A 3TZHA 4BHTA 1I32A 1PL7A 5IDYA 5HM8A 2PGJA 3L07A 3IKTA 3B20A 1M75A 4O6VA 5JW6A 1YJ8A 2E82A 2G1UA 1R0LA 1YL5A 2GPTA 3UF0A 1DC3A 4JBHA 3VPXA 3ASVA 3CUKA 2HMSA 3GDFA 1C1XA 3H9UA 1GQ2A 2HJRA 4IDCA 3BHIA 1EMDA 4BNJA 1I2ZA 4QX6A 3RQSA 3WTCA 4A73A 3ZHBA 3ZWMA 4EUEA 1O8CA 5KVCA 4R5MA 2AG8A 1HSOA 1V3VA 4ND1A 3MJCA 3EZLA 2RBEA 4B8ZA 4H15A 4YJDA 5B4TA 3AI3A 2VT2A 4KMSA 3UN1A 3D64A 1DIAA 1ZKMA 3F1LA 1FF9A 5TRTA 1PGQA 1GZ6A 1Z7EA 1K6JA 2J6IA 2NWQA 3LU1A 4XYMA 2BLLA 3IDSA 1VJ1A 5ES3A 4F45A 4I1IA 1YB5A 1HDCA 4FGSA 4TWRA 5F5LA 4J7XA 3MCVA 4R1NA 2GNAA 2NTVA 3RBVA 1KERA 1YONA 3TF5A 1DFHA 3OJEA 4IDAA 3C7DB 3GDOA 4ROSA 2C20A 5IJZA 5A9SB 3ZW8A 4J43A 4LMPA 3KYCA 4QSMA 1SB8A 4MVJA 4B7CA 4M89A 5JAZA 1XSEA 2YUTA 3RI3A 3WGTA 3NDJA 1IB6A 4I5EA 4LCEA 4BGUA 1B14A 2PLAA 3JYOA 3R0IA 2UYYA 3CIFA 5HBRA 4CR6A 3OP4A 3U9LA 3WGQA 1AUPA 4GGPA 4OMUA 4CMGA 1R4MA 4GSLA 2X22A 4MO2A 3ZWPA 1OFGA 4QO8A 1EE9A 1I30A 4EGFA 5T5QA 4ND4A 1BVRA 2AQHA 3ZU3A 3IP1A 2I67A 2ZYAA 3C85A 4PLZA 1I01A 4XDYA 1NAIA 4E5KA 4YRBA 1V3TA 2JCXA 4JNKA 4CQMA 4AJEA 4OAQA 4YRAA 1QYWA 2P5UA 3FRJA 2NQ8A 3HN7A 2NU8A 3MJEA 3WWYA 3ZWXA 2V6BA 3LLVA 3ST7A 4CMIB 5KJ1A 2TMDA 3ANMA 4NNJA 1LDMA 1R12A 1OC2A 1E6UA 3JD4A 5IZCC 3Q9UA 3NAQA 5DCYA 5A02A 3NV9A 3JQ8B 4P4NA 1D8AA 2YYYA 5G0VA 1VSVA 1V8BA 4J2OA 3RJ5A 2PZLA 4I5GA 4A5OA 5JY6A 4W9NC 1E5LA 3NDIA 3RKRA 2G5CA 4TVOA 2EERA 3GFBA 3P2YA 2D1YA 1F12A 1U1IA 1EVYA 4IDGA 4TZTA 3WJAA 4FBGA 4XWYA 4DQVA 3RIHA 2JD0A 3V1TC 1CRWG 3ZNQA 1EK5A 5C7OO 1H94A 3KHUA 3ZWCA 3UXYA 2BF7A 1MX3A 2Q45A 4KQXA 1QLHA 2FPIA 3GC6A 1FDUA 4J3FA 1PGNA 1XKQA 1GPDG 1V35A 2NADA 1TLTA 4BOYA 1KEWA 2VT3A 4KDFA 1QMGA 1NTOA 4ZQFA 5U4QA 3CZRA 5KJFA 3JQ6A 1Q1NA 1FDTA 2JHFA 4J4BA 2AQIA 2Q4BA 4BNVA 2PTGA 1GZ3A 1PJ3A 4GX1A 4R69A 5JAQA 3E9MA 3TWOA 1R4NB 1MFZA 5H82A 2YHIA 5JE8A 3U0BA 1BHSA 3KXDA 3E6AA 1ZVMA 1YOVA 4UUMA 1WXDA 3ZN2A 3INGA 3KRTA 4JP3A 4AFNA 2NNLD 1CF2O 1P0FA 4IQ0A 3V2UA 1C0KA 1H9BA 3TJRA 1YB1A 2VZ9A 4FN4A 3AU9A 2DT5A 1I3MA 4JROA 3S8MA 1JKJA 3HN2A 4PVCA 1ZXLA 3D4OA 3UW3A 5KJEA 1CQJA 4BUCA 1MUUA 2IEBA 3QVOA 5L4NA 3B1KA 4CLOA 1UUFA 1NHGA 2E37A 1B3RA 3GZNB 2VYNA 3OMLA 2NSDA 1E3EA 1LRJA 4IUYA 4GX0A 2D5AA 3NYWA 4MVJE 4PG5A 4AVYA 3ZWOA 1ZK4A 4E5PA 3OJOA 4ZICA 3RUCA 3BMNB 2X1HA 4NI5A 3RUEA 4IIUA 2I66A 3HDYA 2QRKA 1E5QA 1WDKA 3DBLB 5G4KB 3AJRA 3BAZA 1NVGA 2YHUA 3VZQA 5DULA 3O26A 2FP4A 2LDXA 2GD1O 1GQQA 2WYUA 4ALKA 4EYEA 3BTUA 1GYPA 5I7FA 1E3JA 3LC1O 4BNWA 4M55A 5KVVA 2EW2A 3GHYA 4UVIA 3VH3A 3HB4X 3WQQA 2VHVA 4A2CA 3DAPA 3TQHA 5A9SA 3WOHA 3DZJA 5FI5A 5F1PA 1GYQA 1NX6A 5L3ZA 1PGJA 1EUCA 3I23A 3OQBA 2YDYA 3WFIA 3KBOA 1I2CA 1QG6A 1PJCA 5F5NA 1TA4A 2PGDA 4WOJA 4B4VA 3O8QB 1ISMA 3FTPA 4NU6A 1M6WA 1NQOA 3FI9A 3NEPX 2HQ1A 1BXGB 3KUXA 1DIBA 4PG8A 1PQWA 3K30A 1IZ0A 5IZ4A 4FC6A 1ISFA 3WNVA 4YT4A 4DLLA 1SC6A 2DTDA 3NT4A 4E5MA 4Z9FA 3D1LA 1GEEA 1D1TA 3DWFA 3OEYA 4LRSB 3M2PA 3GRPA 2SCUA 4XGNA 2DQ4A 2FOIA 2RCYA 5A04A 3GFGA 5C37A 1UP7A 3STHA 2GN9A 1JQBA 3ZV3A 3WGIA 1I5RA 2D59A 1KEUA 1RYDA 1VJTA 5C5IA 1RWBA 5T57A 2NU7A 2Q4EA 2B5WA 3SJ7A 3FPLA 3JQ8A 2AEMA 4B4OA 4B3HA 1EFLA 2DBQA 1LDGA 3PTZA 4L73A 3U4CA 3Q3CA 4DC0A 3QVTA 2JFHA 5FEUA 3TZQA 2DKNA 1TVEA 4RF5A 1YJQA 4PG7A 3L6OO 4RVDA 3ZDFA 1VLLA 2UUPA 2AMFA 4MINA 4XZ3A 1H6BA 3HFSA 3E5RA 3HUDA 3GRKA 3VPFA 1OZAA 4CUZA 4IXTA 3RFXA 3B1JA 4TRNA 4X54A 4BO1A 1YBAA 4AJHA 3VH2A 4NU5A 2H6EA 5BNIA 3ZHZA 4W82A 3GUCA 4BS9A 3KOUA 2QG4A 1WNTA 5AXDA 4K6CA 1PGPA 7MDHA 8ADHA 1FK8A 3JTMA 3L4SO 2X86A 4CV1A 5JFOA 1V3UA 3DHEA 4DVJA 4XB2A 2P9EA 1KS9A 3UICA 1B7GO 3JYQA 1WMBA 4Y9DA 9LDBA 4L4RA 2FY8A 4IZIA 4ONEA 3DFZA 5KOIA 1E7SA 1KVSA 1A9ZA 2EKPA 3GVHA 4YXFA 4ZGWA 1UJMA 5GZ6A 2VHZA 4BKUA 4I08A 2FPPA 1UZLA 4WNCA 4ZQBA 1R4NA 4YR9A 5EQFA 3ZWNA 3RBXA 2BELA 1P45A 5IXSA 1X7GA 3I9KA 3ZI0A 1BDMA 1HDOA 3QWFA 1F8GA 2J5RA 5HTOA 2B4QA 3RUAA 3LYLA 4JGBA 4CMAA 4CQLB 1PJBA 1T1RA 3SEFA 5G4LA 3EC7A 3ZWAA 4W99A 1I8TA 1DHTA 3V1YA 4J1QA 1HE2A 1E3SA 4U0KA 4BO6A 4DWVA 1PZEA 3BA1A 1H2HA 1GCOA 1I3NA 4XYEA 3WNQA 3ANLA 2ZATA 4PLHA 3E8XA 1JN0A 4GQAA 2BRUA 3WTBA 2P91A 1H93A 3GZNA 3VHRA 2DC1A 4FSHA 5TGDA 2W98A 3GVXA 2NVUB 4ESOA 1X14A 5I7EA 4WLOA 4FDAA 2VN8A 3Q2IA 1DRUA 1UP4A 3FNEA 5BT9A 5COBA 1B16A 2B35A 4TQGA 3SC6A 4PLTA 1Y1PA 4MVJI 5F1OA 3AUSA 1NVMB 1HDRA 4BNZA 1U4OA 1D4FA 1FXSA 2LDBA 3BMOB 1ZH8A 4YQZA 3KTDA 2DFVA 1R15A 2E4AA 4I9HA 2Z5LA 1AN9A 1LLCA 4MIYA 3BMNA 1Z73A 2X23A 4IS3A 4A27A 3JQFA 3W4KA 2XPCA 4YAIA 4PZEA 3AFMA 1E92A 3FBGA 3DOOA 3WYEA 1HXHA 1GADO 4K26A 3RU9A 3E9QA 3G0OA 1E1MA 1H2BA 3DBLA 3EYWA 4G81A 4ZA2A 3VVCA 1SNYA 1TT7A 2O23A 3IP3A 4LN1A 4RJTA 5L7WA 3VPSA 5EMHA 1YB4A 3ZV4A 1N8KA 3SVTA 5DBGA 3F5SA 5COQA 3NTOA 3WLFA 3KLMX 1R66A 2IZ0A 5IDQA 1DIRA 4JXKA 4XR4A 3SBOA 1NP3A 4NBUA 4Y67A 2O3JA 5ER9A 3BZUA 2D3TA 4J7UA 4FJ0A 4GL4A 1RJWA 3GR6A 4ND3A 4BKOA 5L40A 4BO3A 2BFAA 4ZQGA 5FF9A 4KWHA 2WDZA 1HDZA 1YRLA 4XB1A 5DF1A 3RKUA 4BO5A 1DHRA 2B5VA 3VZSA 2PD3A 2ZK7A 1C0LA 1KVUA 3JSAA 4BNIA 4Z0HO 2Y99A 3UOGA 3O8QA 2OO5A 4CMKA 3GEGA 4RPGA 1M66A 1BXGA 1UXHA 1QSGA 3AFNA 1RM0A 2FR1A 1LLQA 5IG2A 4NPCA 1NFFA 1N5DA 3I9LA 3QQPA 3ROKA 3WX0A 5LDHA 4DLBA 3KB6A 1TT5B 3QLJA 2H1SA 1LSJA 5L95A 1I3KA 2VYVA 2Y93A 4EUHA 4CMEA 3VKVA 1TXGA 1C14A 4RO0A 1DO8A 1ZZEA 1YXMA 3HDHA 4YPOA 3WWZA 3GEDA 4P4LA 1SCUA 5G2OA 4EDFA 4MIEA 3ROMA 4CLHA 1Q7GA 4OYRA 3Q11A 1H6AA 4LVUA 5JDIC 1F06A 4XGIA 3IUPA 1QP8A 1EZ4A 5ENDA 3QV1A 2YQ4A 3AK4A 4DGSA 1LLUA 2EJVA 3GVIA 3WBBA 2Y1CA 3CEAA 2YDXA 3PYLA 5K6AC 1U5CA 2UAGA 3UHAA 4ND5A 4CV3A 4PLGA 1DRWA 3BMCA 3KSUA 4E21A 4AJOA 4JQCA 3GAZA 1DC6A 4L8VA 1W73A 1SO8A 3B1FA 4OOFA 1L1FA 2PY6A 3RUIA 3DAFA 1WPQA 5CDYA 3EDMA 3DZHA 3IS3A 4QEDA 1GV1A 2CFCA 1I33A 4I5FA 4J4HA 3H5RA 2AEFA 1DLJA 4BO2A 3LT4A 4K6FA 1UP6A 3PHHA 1GEGA 4Z9YA 3SC4A 4XJSA 4XCVA 1JW9B 1LDEA 1M76A 1LNQA 4H3VA 4W7HA 1NFQA 1ZSNA 4WUVA 4XA8A 2CSUA 5EIOA 1ENPA 1ZJZA 2ET6A 1ONPA 2NACA 5AXBA 3PVZA 2WD7B 5KVSA 3V2GA 5AQ1A 4WCDA 2OFPA 3GY0A 3OJ0A 3JV7A 3TOZA 1K89A 3D7LA 3S55A 4R01A 3H9EO 1DLIA 4FFOA 1NNUA 4YBZA 1B8PA 2X9GA 2CUKA 1LEHA 4ALLA 2WWRA 4CQLA 4DQXA 1ZSYA 2R6JA 3NT5A 3D3WB 3ZWWA 1PS0A 3GNTA 3GNQA 2WE7A 4KQWA 4ZHSA 1ZNQO 5TJ9A 3OEWA 3DB2A 5K0ZA 3NJ4A 3CE6A 3PGXA 4DL9A 4QTZA 3OICA 1QLJA 1GUZA 3IAHA 3VDQA 1W6UA 4NBWA 4BNNA 1E0DA 5CAEA 3FHLA 5DP1A 2ZJ0A 4WECA 5JCJD 2W2LD 1ZIDA 2W4QA 2R00A 3KYDB 3VH4A 4BMNA 1HDGO 3BMOA 3DMYA 4O1MA 3OF2A 5I9LA 1N92A 1UH5A 4JJGA 4WCFA 1LBEA 3GF4A 1IYZA 2Q1UA 2VOJA 4ALIA 2I9PA 3HB5X 4AJNA 4R68A 4NFSA 4J0FA 1YDEA 3HWRA 1E77A 5CPBA 2GZ2A 1EQUA 2QRJA 4GWKA 1VKNA 1MG5A 4GAEA 4B7UA 4CR8A 3GZ4A 1HE3A 2ZYGA 4L4XA 3T4EA 4RLHA 4M8SA 4LMRA 1DPGA 2OHXA 3PFFA 3NKLA 2X0JA 4P8RA 2BKAA 1FDVA 1JDJA 1YGYA 2YJZA 3COSA 2ZB7A 5F1KA 5TT1A 4AJIA 2EEZA 4QT0A 1P44A 5CDTA 4QFDA 1A5ZA 5CEEA 2WD8A 3RBZA 3TOXA 3I6IA 4TSKA 1CYDA 3DZBA 3P2OA 4B3JA 3JQ9C 6ADHA 3QWBA 4P22A 1YO6A 2PH5A 3ONFA 2Q3EA 1K0UA 1X15A 3PHGA 4PLFA 1Z82A 3ITKA 1NPYA 1J4AA 1G1AA 1P3DA 4CV2A 4MVJM 3FNGA 1DFIA 3PXXA 2FPGA 2GASA 1EBFA 5KWEA 3ZWVA 2DBRA 2VNSA 4OXNA 1JKFA 4KZPA 4M86A 2JL1A 2BMAA 3WB9A 4Z3KA 4E2WA 1T2AA 1U8XX 4TMFA 4PVDA 2E6UX 5DBFA 3DHYA 3QE3A 4ALMA 1Q0HA 4IGFA 4F3YA 1Y7TA 4J1TA 1UAYA 2Q1TA 4IY1A 2RAFA 4YAGA 4BNXA 2GERA 2OORA 1E6EA 3RUDA 3FR7A 4PLWA 1ZBQA 4B79A 3DAGA 1RM5A 1Z75A 3T7CA 3F9IA 3GGPA 4YT5A 5JSFA 3HADA 4KUGA 2Q2QA 3EVTA 2VCYA 3IQDB 4N5NA 3HG7A 1LDYA 1V9LA 3OHSX 3UAGA 4RGBA 2WMDA 2OGUA 4E32A 4HNGA 3ROPA 2Q1WA 2ZB8A 4HP8A 1XIVA 3G79A 3GVPA 3WQSB 2HLPA 4KTTE 4GGOA 1LX6A 2AW5A 4AJJA 4GH5A 3I1JA 1JWBB 1ULSA 2G17A 2RHCA 3F46A 4FS3A 3IJRA 3ZWBA 4XEHA 2PV7A 2Y1DA 4RVGA 5A3VA 1MG0A 4JIGA 1MP0A 2B36A 3A06A 1LRLA 1BSVA 1KEVA 4UEKA 1XYGA 2BFMA 1YL7A 1UXKA 3FWZA 4CM9D 3PQEA 3Q2KA 3AOGA 1ADCA 1LSUA 5AYVA 4ID9A 1KIFA 2X5KO 2ZTMA 1PS9A 4D7AA 2DBVO 1E7WA 1HZZA 1UXGA 1VI2A 4TROA 4YJFA 3EY4A 1T2DA 3RC1A 4CR7A 1S7CA 5GZ1A 5A05A 5A9RA 1DB3A 3TL2A 3CMCO 1PQPA 1PR3A 3FN4A 4IBOA 5T8KC 3OQ6A 2D4AA 2WD7A 4CLXA 1AHIA 2B83A 4ZVVA 1JAYA 4E2XA 2A4KA 1NASA 3PLRA 4PLVA 3CZMA 4BB5A 4IS2A 4OOEA 3CPSA 3U49A 1PQUA 4OGWA 3I83A 1LDBA 4RZHA 5TIIA 1WP4A 1A72A 3Q1LA 3QWHA 3WXBA 4DYDA 3E18A 1UZNA 2ZQYA 3C7CB 3H3FA 4B7XA 1HF3A 3NUGA 1C0IA 3PJGA 1FDSA 3TL3A 1XQ1A 4IDEA 2PGLA 3PZRA 2VWHA 4CM1A 5DDIP 2HKIA 1C3VA 3W4JA 5IDXA 1HYGA 3VH1A 2CF6A 4BNLA 2NU6A 1O9BA 1HWYA 5L4LA 4BO9A 3ONEA 4UUOA 3S2IA 5LDGA 2EJWA 2J5KA 5A5EA 4CMHA 1ENOA 1P1KA 2EP7A 3PQDA 1L7EA 2ZCUA 2EF1A 2GRAA 5JPIA 1KEPA 2B4TO 3PEFA 2DVMA 2O3UA 2Y66A 4IMPA 5CG2A 2P5YA 2VRBA 1PS8A 2C0CA 1Z74A 1OMOA 2WTBA 1BG6A 1QR6A 4BNKA 4EEZA 5KJ6A 4Y98A 1Y5MA 4J0EA 1BRMA 2I65A 1HETA 1Y6JA 1P77A 2XAAA 1C0PA 3FNHA 1WAMA 2VOEA 1LLDA 3ICCA 3WYBA 1K6IA 4MKRA 2A92A 2IZZA 3L6EA 4CMEC 1Z7BA 5ITVA 4N54A 4ZD6A 3I52A 2DTXA 3PHLA 2ZJ1A 5CPFA 4J1SA 1PL6A 2QHXA 2EG9A 5HS6A 1ONOA 1GZ4A 3K8ZA 5JAMA 3U5TA 3QJ5A 2ZB3A 2ZQZA 1ZFNA 5FI3A 3O03A 2J3IA 3LT1A 4IINA 3PWZA 5JYEA 5TQVA 5LC1A 5THKA 3K73O 3ZW9A 3Q9NA 4CMBA 1YH3A 3RUHA 4XD2A 2O3QA 1P1RA 1H6CA 2W90A 4INAA 4OM8A 2C54A 1H5QA 3NT2A 5BR7A 4FFMA 3X2EA 2EKQA 5ICSA 1UDCA 1DSSG 4MIOA 3ETEA 2J8ZA 2H5LA 4R3NA 3MWDB 4NH4A 4EJMA 3OA0A 3WYCA 3I9OA 2E49A 2VRCA 4MVJP 1ZO8A 1DJNA 4YRDA 1ZK1A 3HDJA 3RAJA 5JS6A 3WBFA 4M1QA 2V7PA 4QECA 4K28A 1LUAA 5TNXA 3SXPA 4LISA 3WMXA 4DIOA 1NR1A 3U09A 1GCUA 3NTRA 4GSKA 1X0XA 3BYZA 4L75A 3VOSA 1NFRA 3F1KA 4KOAA 1VL6A 5DP2A 3TN7A 1WVGA 2O3SA 3KO8A 4J16A 4EJ0A 3MWEB 2ZKLA 4JK3A 4FPXA 1GPJA 1F14A 2X0IA 3PWSA 3VPHA 1UDBA 2DFDA 2WSBA 3OFSA 3TZKA 1NQAO 3ADPA 1Q2XA 1GR0A 4NDNE 4UUNA 1IUKA 4XQEA 2W8ZA 2VQ3A 3UGKA 4DC1A 1EVIA 4CPDA 1JA9A 3I9MA 4CQMD 2NQTA 3K92A 4M87A 3V1UA 4FQ8A 3ZZNA 1OOEA 2I5PO 3L4BC 3M1AA 5CEFA 4GLLA 1XELA 4HUJA 2Y1GA 4IM7A 4PIVA 4JP2A 5JBIA 4BQRA 2OP0A 3FCOA 5JNLA 2IXBA 2D8AA 3K9QO 3I4FA 3FPCA 3DZFA 2O3TA 3PK0A 2B0JA 1PJ2A 1X7HA 2IRWA 1ULUA 1W4ZA 5IN4A 1DAPA 3MEQA 4W7IA 1DAOA 4P38A 4YJHB 3SJUA 1T25A 2R00C 3DMTA 4CMIA 5ITWA 1LU9A 1UAGA 3P7MA 1EVJA 4MVJH 4DREA 2YFHA 3F47A 4WCFC 1KY4A 1U7HA 3DO5A 4BO4A 2YW9A 4BNMA 1OI7A 3ADOA 4BGIA 3WGZA 3E9NA 3KYBA 3ZU2A 2ZCVA 1I24A 2F1KA 5DN9A 3QVWA 3RFVA 2O4UX 1EQ2A 4J6FA 3S2EA 1G6KA 1Y9EA 4MJLA 1PSDA 4ZRMA 1O94A 2UUOA 4QFCA 3I9JA 3RC9A 4P4GA 1XWFA 3ONDA 4JJFA 4PG6A 5JLAA 1PR9A 2C07A 3K5PA 2OMEA 1ISHA 4HFNA 3V8BA 4WNIA 4IPTA 3CKYA 3G1TA 2VZ8A 2VWQA 3JQBA 4IDDA 4XRGA 1LA2A 1P1HA 1XEAA 4Z0PA 2FRDA 4NIMA 3VZRA 3M2TA 1SBYA 1ZEMA 1I0ZA 1D7OA 2UV8A 2BFOA 3IL2A 3L77A 4WKGA 5K9ZA 2IZ1A 1N9GB 1Y8RB 4IJKA 4BNYA 4Z3DA 1NWCA 3S1LA 1T26A 5BSGA 3DBHB 4NMHA 4EW6A 3HE3A 1GAEO 2DM6A 2IYOA 4ZN6A 1IPFA 1VKOA 3F4LA 3MZ0A 3H4VA 4GPD1 2WE8A 2FR0A 4E5YA 4DLAA 1B8UA 3KLPX 4BV8A 4BMSA 1KBZA 4ZQHA 3K2EA 2O7QA 4WE3A 5EINA 5T6BA 3TRIA 3DBRB 3ZGYA 1YKFA 4XJTA 3AI1A 1ML3A 2YV2A 2NUAA 5A5FA 2I76A 1B8VA 1LXCA 1Z6ZA 2PZMA 3N74A 4Y6RA 1UXJA 2VYND 1ZXBA 2I6TA 3NRCA 3D4NA 3X2FA 2PKQO 4D45A 1AHHA 2BHLA 1PZHA 4WK6A 2Q50A 4MOWA 4CJXA 4LGVA 3GPDG 4FOSA 3OBBA 4CM5A 1T4DA 2A94A 5AOVA 4CLRB 1U2DA 4KTVE 4E13A 4FFPA 5KNLA 1H0KA 2P4QA 3H6KA 3EMKA 4D43A 5KJCA 3B6ZA 2ZTVA 2NTNA 1UR5A 3AI2A 1XLTA 3RCBA 4TRJA 4LCJA 1B3BA 1WW8A 2X9NA 3Q6IA 1VE9A 2A9FA 2B69A 2GN8A 2X6TA 3DL2A 3IIEA 3K31A 4AJ4A 3D5TA 5A3JA 3DHNA 2IYPA 3INTA 4E0BA 4G2NA 2O3RA 1Q7CA 3E82A 3LZ6A 2YFQA 4ALNA 1JKIA 2O7SA 3D3EA 5A03A 3O4RA 2HMTA 2CDAA 4HFJA 1F8FA 2D0IA 1HRDA 2CDCA 1C1DB 2QIOA 4CM3A 4J49A 1ZW1A 1NVTA 5CP8A 2I3GA 1ARZA 1D3AA 3ANNA 3D0OA 5JO0A 3G3EA 2P2SA 2F00A 1J5PA 5J23A 3DTYA 5G4KA 4I9UA 1GUFA 3KETA 3AUTA 2JKVA 1TEHA 1GYRA 3MOIA 1JTVA 4WLUA 1E1KA 3MJVA 5TSDA 4O59O 1NPDA 1BGVA 1GY8A 1VRWA 3RROA 1BTOA 4YT8A 2AQKA 3C24A 3TPCA 3IOYA 4YYZA 5KVQA 4FJ2A 4W9NA 3GH3A 1KVRA 1DIHA 2GLXA 3MJTA 2HK7A 1QYDA 4IJVA 5I8ZA 5JCJA 4BNHA 5CEJA 5ILOA 4UEJA 3PJDA 2BFPA 1RYEA 3KEOA 3HNPA 4G5HA 4NBTA 2HCTA 3U4HA 1E6WA 2CDBA 5IXYA 1EUZA 3GGGA 2Z1NA 4S3MA 1T2CA 3FSRA 4BNUA 1YDWA 3JQ7B 1MXHA 3VPGA 3CMMA 4WPGA 3G17A 4E2ZA 3VKUA 4J91A 4U8GA 5EN4A 4XQGA 3OQ1A 1BXKA 3OIGA 1E7RA 2XXJA 4FJ1A 4PN3A 3ZU5A 2GYYA 1NBOA 4Y6PA 4YJHA 4EJ6A 2EWMA 1HLPA 1OAAA 1A7KA 5CFZA 2IODA 4QO7A 4BO8A 1B26A 4D79A 1E3WB 4RDIA 3D5QA 2FN7A 3WR5A 2C59A 3ITDA 4NK4A 2BGKA 5B4UA 4YB8A 3DEYX 4WGGA 4WLEA 2YZ7A 5DBIA 3I4CA 3BIOA 4W6ZA 1P1JA 3P19A 1BXZA 3EW7A 1MC5A 2O2YA 4XX0A 2CMDA 3AU8A 3BTOA 3IC5A 4AJ1A 3RD5A 4YVFA 2QZZA 1M6HA 3PLNA 4HWKA 1CDOA 1NHWA 3AM3A 3JYLA 1Q7BA 1ENZA 3RUFA 1EUDA 4RPLA 1IPEA 2Y0CA 2EKLA 3E03A 5JMPA 4E3ZA 1FDWA 2DUWA 4C7KA 1HE4A 3UVEA 2QQ5A 1NWHA 5HA5A 5A4DA 4HNHA 1Q0QA 3RWBA 4XR9A 2BI7A 5JDCA 4FCCA 4CM8B 2X0NA 3H2ZA 4M49A 3EAGA 4KUHA 1YQXA 4S1VA 2HUNA 3H5NA 3ON5A 1T4BA 4AJKA 4N18A 5T67A 4YA6A 1VL0A 1N9GA 1CJCA 2X5JO 3WGYA 1Y8RA 3WS7A 5JCXA 1T24A 4E30A 1ORRA 3KEQA 3DBHA 1LSOA 4EUFA 3H9GA 3GQVA 3PIDA 2IE0A 1YQGA 3AY6A 4FFLA 5I7VA 1Q0LA 2Y68A 3PYXA 5TS3A 4CODB 2HAEA 1DC5A 2FZWA 2QX7A 2FMUA 2PWZA 3MJ4A 2RHRA 4NHEA 4XQCA 1JWAB 1SAYA 4Q9NA 3TDKA 2B37A 1T2FA 1AXGA 5ILGA 1R0KA 4RPHA 1VM6A 3DBRA 3WIEA 3C1AA 2CF5A 1SMKA 5DNAA 1WLYA 5A06A 3ZNPA 4LW8A 1Y81A 1QV6A 4J9VA 4OXKA 3WGHA 3AUAA 1R4MB 2PKRA 3PJFA 2GDZA 4TRRA 1ID1A 4YDRA 4CLRA 3LQFA 3OIFA 1LQUA 4EITA 3F3SA 2AHRA 4CQMB 4UVDA 2XOXA 2C2XA 3AOEA 4MPDA 4HFRA 1M67A 4OSOA 1KVQA 3GMSA 4HADA 4GKVA 4HY3A 4DQUA 2AE2A 2NVUA 3NDRA 4IQ8A 3GGOA 1CWUA 4YAJA 4NG5A 5EJ2A 4HKTA 4BVAA 4PRKA 4BNFA 4AJ2A 2EXXA 1NR7A 4WEQA 2ZIZA 4WASA 2WM3A 4N5MA 1PTJA 1JLLA 1BWSA 5COAA 4B3IA 4H16A 1HYHA 4CV0A 1C1DA 1TI7A 5JMWA 4GLOA 2NM0A 2C5EA 3GDGA 4UVEA 1ZMTA 1IHXA 3KSDO 3WLEA 2GN4A 4GKBA 3FNFA 4WOKA 1SEPA 3DOJA 3WJ7A 2CVQA 2GZ3A 4EZBA 4RLSA 3A4VA 4FC7A 2PD6A 1HT0A 1J49A 1HZJA 2Q99A 1X1TA 3U62A 4A03A 4RORA 1CQIA 4MP3A 1FJHA 2O48X 4PZCA 4OH1A 4RF3A 4NJMB 1PJQA 2G76A 1QRRA 2VWGA 4BB6A 4BGEA 3AM5A 3PHJA 2QZ9A 4CM6A 4G65A 3PPIA 4DPMA 4WLFA 3DMTC 4A7PA 3ZV6A 2PFGA 2VYVD 2E48A 4L4SA 4XGKA 5GY7A 4IDFA 3ZV5A 4FIZA 3I9NA 2V6FA 3NX4A 3JQ7A 3OM9A 3TZCA 1HLDA 3RVDA 4QXMA 2FWMX 3R1IA 2P9CA 3GPIA 3H9JA 5L7TA 3KM0A 1UXIA 2VUTA 1YOVB 1KOLA 3ASUA 3JQDA 2AQ8A 2C29D 1TT5A 4ITUA 1PL8A 5AXAA 5TJHA 5HS4A 1PWXA 3PI7A 1OBFO 3A28A 5AXCA 1YVEI 1ISGA 3F4BA 2BH9A 4BKRA 1U3UA 1DEHA 1KC3A 3NGXA 4U7WA 3BTSA 2WEKA 3GN2A 2EGGA 4CLOB 1N1EA 1XA0A 1E3WA 5A9TA 2VHXA 2X5OA 5JYDA 1X7DA 4UUPA 3UH1A 4DIFA 5TLSA 5B12A 3HDQA 1MGOA 2DAPA 1DFGA 3HHPA 3UKOA 3A1NA 4LSMA 4XDZA 3WFJA 3C1TA 4RPKA 4BKPA 4D0RA 5JAIA 5C7IO 4R5HA 4D3FA 4HV4A 3L0DA 3GOHA 5EESA 3EUWA 1N1GA 4JJIA 2O4CA 1KYQA 3W6UA 4BO0A 5BNFA 3C7AA 4IXWA 1HTBA 1WMAA 2P9GA 4IJWA 1GV0A 3WGOA 1ISJA 3S2GA 3QWAA 1DIGA 3FR8A 1Y9AA 3ABIA 3GEMA 1RM3A 3HQ4O 2UVDA 1DJQA 3PZBA 1O0SA 4ZQEA 2AE1A 5C3MA 4ILKA 3EVNA 4CM8A 7ADHA 2YV3A 4CM7A 1QYVA 5G0TA 4GX2A 3TSCA 2OUIA 3ZU4A 1VL8A 5MDHA 2B4RO 2V6MA 1GQYA 2UDPA 4R1TA 1GU7A 5I7SA 3PWKA 3H8VA 2JD1A 1EE2A 1R16A 2VNAA 1O89A 2J3HA 5LCXA 2OBYA 2CD9A 2X7HA 1MB4A 1SOWA 3JQGB 4Q3CA 4R1SA 4CLDA 1XCBA 2YV1A 2ZTLA 2JJYA 3PRJA 2HMWA 4RQUA 2ZB4A 2A35A 2BD0A 3GNSA 1CERA 4XYBA 4Y6SA 3BMQB 5ER6A 4DBVO 2GCGA 1UDAA 4RF4A 3ZWYA 1ZUD1 5HWSA 4L0QA 1WDLA 3D3WA 3OH8A 2NU9A 4HFMA 4D42A 3JQAD 4OL9A 3JQFC 3OSUA 3AY7A 2J3KA 4U5QA 2Y1OA 2EHDA 4Z6KA 3T7EA 1HEUA 3NGLA 1PJTA 3EGOA 3RC7A 4EI2A 1MFPA 3V5NA 4II2A 1W0CA 1SB9A 1VPDA 1ADGA 3OJFA 4BNTA 2WYVA 3LSYA 3KZVA 4K1LA 3U4IA 4Q3BA 5BQFA 4Q3DA 4XYLA 2VHWA 4DPLA 4R9SA 1EDZA 3FWNA 3KYDA 3HJAA 4ALJA 4PFJA 3MTGA 1R6DA 4FGWA 5FFFA 3U3XA 2POQX 1WZEA 3DXFA 3LDHA 1T1SA 1Y8QB 3HFGA 1JVBA 2Y1FA 3WDSA 3NJ8A 3JYPA 3EHEA 3GG9A 5KIAA 4IJUA 4YAKA 4DPKA 4WLNA 2Y67A 3GHHA 4E33A 2XXBA 4LSWA 2OP1A 3VZPA 4JCOA 2PZJA 3DOCA 6LDHA 2RH8A 4E4YA 1U8FO 4J2HA 5JDIA 5L51A 3PDUA 2NLOA 3DZKA 3VC7A 2AXQA 4NBVA 2H9IA 4DUPA 1M2WA 4B4UA 3MJSA 1NXQA 2OXIA 1JU9A 3K2BA 1MV8A 1YBMA 4I5DA 1E1LA 5G0WA 3RASA 4CLEA 4E12A 1AGNA 4NJMA 1WDMA 2NV6A 5F3RA 5K6AA 3DDNA 4PZDA 4CUJA 4RV9A 5B4VA 3RU7A 2AEJA 4FD3A 3DBVO 3H9QA 1E7YA 2DBZA 2JFGA 3IMFA 2C7VA 4GX5A 4R41A 2X4GA 3T4XA 1GDHA 2CVOA 2IEDA 2R2GA 4A26A 4XQ9A 4OJNA 2CY0A 4TKLA 1LI4A 4II3A 1CETA 3K6JA 4N5LA 4TKMA 1N2SA 4D41A 1K3TA 2RH4A 2BI8A 4IQGA 3S2FA 4GI2A 5KKAA 3VDRA 3OJLA 4OIMA 2PNFA 5GZ3A 1KETA 4RVHA 4D0SA 2CZCA 3LF1A 5JDCC 4CM4B 1G0OA 1XGKA 1LC0A 4DXHA 5F21A 4BGVA 4KP7A 5L4SA 3GVCA 3WGGA 3DFUA 1IY8A 3DZIA 1ONNA 1DRVA 1K6XA 3P5SA 4MVJD 4OHUA 3O9ZA 1QYCA 2NVWA 4Z9XA 1IE3A 4R9RA 1PJLA 4L74A 3E5MA 2Q46A 1ZCJA 4GWGA 1R37A 4MVJG 1AXEA 3C1OA 2W2KB 4BL5A 1RKXA 5U1PA 5BSEA 1E7QA 1GUYA 1E1NA 2AA3A 1F17A 1VSUA 5JC8A 3AUUA 1V6AA 2AG5A 2BGLA 3WIDA 3R6DA 4YJGB 1QKIA 1A27A 4IZHA 4PG4A 4YQYA 3C3XA 3MOGA 2G82A 3O38A 1P33A 1YE3A 2CVZA 2IDZA 5I8WA 4U6SA 3AOEC 2ILTA 1I36A 4R54A 2IXAA 2VUUA 1A7AA 3JQGA 1V0JA 1Y5RA 1U5AA 2C82A 5JY1A 1UZMA 2GGSA 1A4IA 1LRKA 3G1UA 4FFNA 4YCAA 3KSZO 4BMVA 5DOVA 5CG1A 1U28A 4MP6A 3BMQA 4C7JA 3KVOA 2BGMA 2QYTA 4O63O 3L6DA 4GBJA 5DCWA 3Q0EA 4OXYA 3PP8A 2WYWA 4GVLA 2Q1SA 5BSHA 4JN6B 3H5AA 5JO9A 1HYEA 4UEOA 4L9RA 3IKVA 1LC3A 1S6YA 2GO1A 2NVBA 2HMVA 5L7YA 4PLPA 4H7PA 3I3OA 4F6CA 3QY9A 2VUSA 3INRA 1EBUA 4R1UA 3BXXA 3JQ9A 2OOSA 4CL3A 1HDYA 2P4HX 3BTVA 4R16A 3WQRA 2V65A 4XIYA 4BO7A 4NBRA 1KC1A 4JBIA 4J90A 4O0LA 1ZMOA 5TF4A 1EK6A 4YEDA 1O6ZA 3QIVA 5G0UA 2Y0DA 3UCXA 4IMRA 1HE5A 4D3DA 3NTQA 4TRMA 3D4PA 1Y8QA 3N58A 2C2YA 2EV9A 3UCFA 2Y1EA 2Z1MA 1HDXA 4I9NA 1LSSA 3BMCB 1SPXA 1PWZA 3QVXA 3VTFA 2X0RA 1SZJG 2QYSA 2P68A 4XKJA 2YQ5A 3ZCXA 1PGOA 1DOHA 2H63A 4LK3A 4EEXA 3G49A 4K9DA 2Y0EA 1PJSA 3DR3A 3FF4A 1ZEJA 2DUUA 4ZJUA 1W8DA 3AWDA 3V2HA 3ZHXA 2TMGA 1PZGA 2JCYA 5JC1A 4F46A 2VTEA 2D2IA 5THQA 2JHGA 3DZGA 3DC2A 3JQCA 3QWIA 2HRZA 2I3AA 2GF2A 4LRTB 4XRRA 1P74A 4UVGA 3TZ6A 1GL3A 3PQFA 3IUSA 2X9VA 2XF8A 5IF3A 4D44A 1U2GA 3LVFO 3GG2A 3JD2A 1CEQA 1XU9A 1U3TA 3QP9A 1B15A 4J4TA 4DYVA 5HRUA 1E3IA 4YT2A 1Z45A 1ZK2A 1KY5A 3HSKA 4E31A 3LC7O 4DBZA 5DOZA 3DONA 5CHEA 3IJPA 1PU2A 3CSDA 1K5HA 2EGHA 3QVSA 4MKXA 2VRCD 3H7AA 3TFQA 4KUEA 3FTNA 1JAXA 3QRWA 3GAFA 1E7MA 4J9UE 2HU2A 4ZRNA 3ZNOA 3B70A 3UCEA 1BDBA 1I2BA 3JD3A 5T64A 1U9JA 2I99A 3W8FA 4HX5A 4F6LA 4D3SA 2PK3A 4R51A 4UREA 4UULA 4LVCA 5FWNA 5H81A 4B8WA 1L7DA 4M54A 4IIVA 2HRBA 1XG5A 2JAPA 2GSDA 3TFOA 4RF2A 2JFFA 2J3JA 2EP5A 4I8XA 2WJPA 5T8KA 5B1YA 3H3JA 9LDTA 4HBGA 5JXWA 4CM4A 1B0AA 2QRLA 1YWGO 2D5CA 1NM5A 3L9XA 3M1LA 1BW9B 3UFXA 5C7LO 2GUGA 3LC2O 2DPHA 4W4TA 4BV9A 4MVJF 3JD1A 5EL0A 4RZIA 3JQAB 3LT0A 4BKQA 4DIBA 3ORFA 5IZCA 2HJSA 1N7GA 2FSSA 4O5OA 4WCFB 5L9AA 4GMGA 8LDHA 3H65A 3PHIA 2W2KA 3ENNA 5BSFA 2FR8A 2PH3A 1EEHA 4BQPA 4CUKA 3JYNA 5KKCA 2JCVA 3SLGA 1QXSA 1XDWA 2W2LA 4XIJA 1PEDA 1ENYA 1X1EA 1LJ8A 4FB5A 3GMDA 4YJGA 4DMLA 5CDUA 3AM4A 5A1TA 3ZH2A 1OC4A 2JD2A 2C7GA 1I10A 2GZ1A 3RFTA 5ICMA 3GA0A 4AJLA 1IHYA 4DMMA 5I9MA 4NJOA 1PZFA 4OQYA 4EBFA 3VAZA 1ZSVA 4OQZA 4XYGA 3WSVA 4YTEA 3VTZA 2FZEA 2V6GA 1LTHR 1XQ6A 4JLWA 3OIDA 5L45A 5IN5A 4ZU3A 4IDBA 3RC2A 3R3JA 1U7TA 2VWPA 5B37A 3WMWA 3DQPA 5DCUA 4MKZA 1JVSA 3PYMA 3I6QA 4OSPA 1XHLA 2Q49A 4NZ9A 4DTIA 1MA0A 5KTKA 2X8LA 3AY3A 2HSDA 5CDGA 2Z95A 1NQTA 1IOLA 1YQDA 1MC4A 2PD4A 1ADBA 4RQTA 1EDOA 2DU8A 1D1SA 5KCZA 3LLSA 1VC2A 4RDHA 1C1XB 4L76A 3I5MA 3MTJA 5EERA 5AVOA 4DRYA 4KWIA 4Y8VA 3ZHYA 3HZZA 1LQTA 2VTDA 4PRLA 3BHJA 5ADHA 1GTMA 1P1IA 4NQZA 4AG3A 3LF2A 4JBGA 3C8MA 4YWJA 4BIIA 2DLDA 1YL6A 3FD8A 3RJ9A 4R4JA 4BNGA 2YY7A 5GMOA 5FYDA 1DC4A 4NFHA 4RPJA 2HK8A 2CNBA 5IDWA 5DT9A 2O2SA 1ZK0A 3LK7A 4PLYA 3UUWA 3BHMA 3ETGA 1NPTO 4RL6A 3E48A 3GN1A 5TC4A 3R3SA 5U9CA 3A14A 4N7RA 4PLCA 1J6UA 3W8DA 2GR9A 1PJ4A 1AE1A 4QQRA 4YACA 5I9NA 1I3LA 1NQ5A 4HXYA 2O50A 3KV3O 2OL4A 3ENKA 3JQEA 1QV7A 4CMJA 3KYCB 1IL0A 3PFWO 1PX0A 2HO5A 3EK2A 1G0NA 1RM4A 1GD1O 3GK3A 3GUYA 3VVBA 4MDHA 1U3VA 4QUKA 4TVBA 3K96A 3JCZA 4B4WA 4MP8A 4E5NA 3CXRA 3U4DA 1SEVA 4C4OA 4YJFB 1BVUA 3GLQA 1EFKA 4YAEA 1WZIA 4WEOA 2FSVA 4PCVA 1ADFA 2QW8A 4Z0TA 5IAAA 3N7UA 2NTJA 2RIRA 1BMDA 4CM9A 5G0SA 1XU7A 1P1FA 4E6PA 1SOVA 4GMFA 1T2EA 1TB4A 3DTTA 2G0TA 4NFYA 5IFLA 2PR2A 4R3WA 4UAGA 2C5AA 4OO3A 4A10A 3ICPA 4DA9A 2GN6A 3ETDA 2JAHA 4RCVA 4OKIA 3LT2A 1A71A 2X58A 1ZJYA 3PDJA 2HK9A 3RSHA 3L4BA 1WWKA 1P9LA 2PZKA 2Q2VA 1ZK3A 1MLDA 1KVTA 1B2LA 3ZNNA 2ZYDA 3EZYA 3E1KA 4TZKA 3SX2A 1H9AA 3QW2A 2Y05A 4NK5A 1EVZA 3W4IA 2FHSA 4FW8A 4U6QA 3M6IA 3H2SA 4CMCA 3OA2A 1BW9A 4ND2A 4Q3EA 5EQDA 4CL8A 1QYXA 1VJ0A 4WLVA 3W1VA 3WG9A 1X13A 1O95A 4Q3NA 4U0JA 3PIIA 4RVUA 1DXYA 3JQAA 1QORA 2EW8A 1O5IA 1MXFA 2DPGA 5CDSA 3WICA 3ROQA 2Q2WA 2PKQP 3PJEA 4URFA 2OZPA 3ULKA 1LDNA 1NAHA 1E3LA 2HDHA 4J7CA 1FMCA 3W6ZA 3A9WA 4Q3AA 1GFSA 4IGEA 3QSGA 4OKNA 1U4SA 2J5QA 3CH6A 4AL4A 2VHYA 1A9YA 3OECA 4JX8A 1RPNA 4E2YA 1IULA 1YBVA 3F5QA 1NYTA 2HMUA 3WSWA 4AICA 3FBTA 4UVHA 1YS4A
chains in the Genus database with same CATH superfamily
1OXMA 1N6LA 1T9GR 2PA3A 1W30A 2QD1A 5CXSA 4CN9A 5FOQA 3ZLJA 5IBQA 3ONVA 4FR5A 1H6DA 3CY6A 3RF6A 1Z4MA 1BMTA 2ZAOA 5LZ2A 2Q3LA 2H1RA 2J6CA 5JI3E 3C98A 4CNBA 1N2CA 2HRCA 3CTMA 1P0CA 1VIVA 2YHIB 4AYTA 3W8EA 3PCRB 4UOZA 4XIIA 1PIWA 5J2UA 1N3BA 3PDIB 5EE5B 2VZ0A 1EDEA 2B9EA 3JAKA 4WJZA 3C45A 1IHOA 2OHVA 4Q39A 1ODIA 2Q6TA 1FXUA 1X0VA 3PGJA 3NXKA 5KEIA 5FL3A 1L3IA 3EGVA 2HA6A 5DRYA 3Q7IA 3KVRA 4KAFA 3F6YA 2YRFA 1TVMA 1TJPB 3GT0A 3RS3A 1K9VF 2MINA 4MCJA 4XASA 5IYZF 3NB0A 4B6PA 1NURA 2PX6A 4FFRA 5TT0A 1UC5B 3TZHA 2XCRB 1I32A 1Z6GA 3I61A 4QULA 5IDYA 4CF4A 1YZNA 1XBTA 2PGJA 1TZJA 2PVCA 3BRSA 3DO6A 4JS0A 3TVTA 5HM8A 2E82A 1V1MA 2HSGA 4D9HA 5A0TA 2XTMA 2VH5R 2ID9A 3MUOA 3UQYS 2H2DA 1PVVA 1GSHA 1XLWA 4FYYA 1ZQ1A 4JBHA 3VPXA 3ASVA 1CEEA 3CUKA 5HF9A 5AH0A 1AKVA 3CFYA 4N12A 1C1XA 4D6YA 1JZTA 1GQ2A 1N6KA 4D97A 5IK2A 1XPOA 3QZUA 3CSSA 3IHWA 3NWBA 3N8IA 2JFUA 4BFCA 3UAOA 5JNWA 4LCBA 1ACJA 2ZRAA 4GPIB 4RSHA 3WLKX 4ACAA 2RARA 5JFGA 3MJCA 5K99A 4JI2B 3EZLA 4BY9E 2DR3A 5D6NA 2CC2A 3VJLA 1RDFA 1YB7A 3ONNA 3M6UA 3KB8A 3HHEA 3D02A 4QICA 5JAHA 3KLNA 4L9WA 1CYEA 4FDLA 3AWIA 1ODCA 1R3UA 2D5IA 1DIAA 3P0HA 4OY3A 3R7FA 1QQ6A 2CBZA 3M5PA 3QUCA 3P2KA 3TZLA 3ZE0B 4XYMA 1IN1A 3IDSA 1VJ1A 4XPIA 1OLOA 1U2GC 3PT9A 3A9TA 3CONA 5KSZA 2NTVA 4F38A 3HYRA 3TF5A 1X80B 1ZRHA 4FB4A 3OJEA 2YTZA 1TKAA 3V4SA 3GDOA 1QUEA 4ROSA 3WFZA 3KPVA 1OWNA 4KGDA 4YNBA 3SHWA 3TRFA 5LP6F 1YR9A 3QE9Y 4KMOA 1OH8A 3A04A 3LDUA 1S1MA 4N0PA 1DTSA 1UINA 3D4BA 3ZW8A 4PZPA 4Q0MA 2QQFA 1ULAA 1XLTC 1TK3A 1PFUA 1CZNA 1XSEA 1ZU4A 3KZKA 4M89A 4O33A 3WGTA 3NDJA 5JAZA 4DR3B 2WWVD 2QTWB 1RRGA 2JLRA 5DASA 4MGHA 2WYHA 1EIWA 2XRMA 4WBXC 2WG0A 3R0IA 3BX1A 2UYYA 2DYKA 2XGGA 3U9LA 1D9ZA 2GA8A 4TLLB 1JLMA 3NI2A 1GFWA 1KAEA 4OMUA 3B6JA 2X7JA 3ZCUA 2JGLA 2YZ2A 2FWRA 1Z5NA 3NC0C 4RZUA 3OY2A 1KMCA 5BV0A 1Q1AA 4BYGA 4QO8A 1CJSA 1P19A 1UMKA 1ZUNA 2ZE8A 2QSZA 1BVRA 3ZU3A 4N8DA 2ZYAA 1P4JA 3H86A 3G8DA 1I01A 4E5KA 1NAIA 2C2BA 3TTWA 4BJ3A 3L18A 2ID8A 2JCXA 4CQMA 4NH0A 4D4LA 4KR2A 1DL5A 5KU7A 1OLUA 2FFAA 4G0QA 4H1VA 4WOBA 5CNIA 1G5QA 2ORVA 4UDXX 1LS1A 2QQGA 1NMSA 1WKVA 4ZZIA 1DINA 1ODSA 3WWYA 4F11A 1P91A 3LLVA 1R0XA 4R2KA 2CJWB 3AR4A 5KJ1A 4BNDA 2QVGA 2PSSA 5B3JA 3JD4A 3OCVA 3QOWA 3Q9UA 3TRDA 2P9TA 1D6SA 3NAQA 2BAGA 1CEYA 4F5DA 4FDMA 3NV9A 2PIAA 3DVSX 4FR0A 2YYYA 2FPWA 1JDZA 5G0VA 1DUVG 1RVV1 1V8BA 2I1LA 3SJBA 5HQ3B 1PWHA 1UEIA 3NJRA 4I5GA 4F9FA 1V41E 1JYEA 3D8UA 1DKQA 3NDIA 3RKRA 3NPAA 5KTYA 4Q4DA 2C1XA 2A9QA 2EERA 3GFBA 2MR6A 4DDWA 3LQ1A 5JNTA 5DJ5A 1ST3A 4EHBA 1Z2PX 2O2HA 2XKKA 2H1HA 5K4HA 4JB2A 2OECA 1BXRB 3H6GA 1JLHA 1Q14A 3I01A 4PQEA 4RJ2A 2KSQA 3TVYA 5JS1A 1HM5A 3HVIA 4NL4H 5F73A 3V1TC 4YP5A 1CRWG 2GHRA 5I01A 4JXXA 1JU4A 4ARCA 3KHUA 1KKMA 4MA4A 4HPJB 4NYJQ 4Z8YA 3SQDA 4DA8A 3UXYA 4HMPA 1J33A 1K5GA 1V43A 3FUUA 1YZQA 2GN2A 5AT1A 2VYFA 1MX3A 3D8RA 1QIHA 2FPIA 2PS0A 3L93A 5HQJA 4Q19A 1IVNA 2FQQA 5FOUA 3PUXA 1V35A 1OX6A 4PR0A 3KE8A 1U1GA 4MV7A 3EXFB 3H11A 3GIWA 2XVYA 2G36A 1E9EA 4BOYA 3HUUA 4UFOA 3C6MA 4DMCA 2FXVA 4H0NA 2VUIB 1HO3A 4P7FA 4DMUB 1KFCB 4J07A 1R1DA 1YDHA 4ZQFA 3WZLA 3BXFA 5U4QA 2PO5A 1HTWA 2PZFA 3JQ6A 4KO8A 4L8YA 1D5CA 1WQ3A 4DSAA 5BWCA 2O8CA 2WVAA 1PV1A 4J4BA 4KQCA 4O4JF 5C9ZA 4A1FA 3QITA 1LK5A 4BNVA 2I1VB 4EB6B 3SOPA 5B64A 3L49A 2BCJQ 4GRIA 1SCNE 4DV4B 3V8EA 2JAXA 1AB6A 3EQ8A 4RM2A 3MXOA 1QF9A 5JE8A 3M6MD 3CZAA 3U0BA 1P80A 4KYUA 3TQQA 1US8B 2X76A 3HA5A 3KXDA 1CQPA 3A1VA 4UUMA 2A5YB 4WXYB 3T3HA 3K1YA 2RKBA 1ORIA 1J9ZA 1EJ0A 1SBIA 3F96A 2X41A 4JP3A 4JUCA 2NNLD 4Y2YA 1NG1A 4AFNA 5EVCA 5F4BA 1H9BA 4LFAB 2ODNA 3TJRA 1YB1A 3D8BA 5DRTA 3WKAA 2DT5A 5EZYF 4JROA 4PFKA 1NVVR 3CUVA 2GEUA 1XD8A 2QW0X 1FYDA 4QWWA 1TKBA 1LF0A 2XCIA 4KODA 1HKHA 3TAUA 3N2GB 4DDTA 1X94A 4BUCA 3VKHA 2FQYA 1MUUA 1VL2A 1YZHA 3K6RA 2IXFA 1NHGA 2E37A 3ANSA 2QVZX 3F5DA 1B3RA 3SM3A 3U3KA 1KZ7B 3MCZA 1K3FA 2GCNA 1H22A 5KSYA 3H2GA 3S40A 2RI1A 2OB1A 1E3EA 2BHSA 2HWYA 2YV5A 1SXJB 3D81A 1V11A 4UNPA 3K9BA 2CKDA 4F2WA 4IUYA 3WWPA 5JSZA 1F6WA 2WVJA 1KQFA 4DQKA 1C9NA 2NIPA 3FF1A 5AKHA 3FFAA 4R3UC 4MLDA 3ZWOA 2APJA 1R4AA 5AUNB 1O6FA 4E5PA 1Y89A 3DOUA 4HB4A 4M8IA 1K63A 1NG9A 3BMNB 5KHLB 3D6AA 3NTLA 4L22A 2WICA 1NUUA 3CEMA 3DTNA 2VTVA 2SNIE 3F8TA 2AFIB 3H1GA 3CBQA 2CDNA 3HTXA 5C35A 1QUFA 3BE6A 3CLTD 5IARA 3BAZA 1WB5A 4UU0A 4HGNA 1N5OX 3IPCA 1F6DA 4EZIA 3T9CA 2FP4A 2BT4A 2LDXA 3EDYA 2GF0A 2WYUA 3SE0A 1W1WA 3BTUA 4DCNA 5JNRA 1GYPA 3BXZA 4QXRA 5I7FA 5LWHA 2PFSA 2XHZA 1NF9A 2HA2A 5FDFA 1M5RA 4KKVA 5E38A 3GHYA 3ZDBA 4MRPA 4C20A 4GPEA 2X8AA 4A2CA 4MPTA 2HA5A 1L1EA 2Z8YM 5A9SA 5T7BA 2ONYA 5DX8A 4CFSA 5BMVB 2V4MA 1CY1A 3I2HA 3WOHA 1DCTA 1UOOA 2F3PA 3L7KA 1RD4A 4XDHA 1ZOPA 1NX6A 1IQPA 3GXOA 3GAAA 1X7YA 5EKXA 4DBLC 1GUDA 3OQBA 4MWTA 4KR3A 3KBOA 4L1KA 2OEPA 1BHJA 1G4HA 4JBLA 1M1NA 2C31A 3BXPA 1XOIA 4TMYA 3DOEA 1MAVA 2PGDA 4PIPA 1HPLA 4WOJA 5EMKA 5JNVA 1ISMA 2JS7A 5BV8A 5CDHA 2KJQA 2IHYA 1JFTA 1FTSA 4L4UA 1G38A 4RKQA 1PTJC 1WHTA 3ITEA 2GD0A 1NC3A 1NIJA 3W2IA 4QUAA 4C03A 2AZTA 1K4KA 3GBSA 5E1OA 4KW7A 2L18A 2H1VA 1JG3A 4MW0A 1NXXA 5IZ4A 1ISFA 3FDXA 1WD5A 4YT4A 5ALEA 1SC6A 2I2BA 3QFRA 4JL6A 1N2XA 1WX1A 1UM9B 1ZLXA 2VK2A 5HF8A 5LYYA 3PPXA 1SCJA 3AB7A 4H18A 4XGNA 4QUDA 5A04A 1LTQA 1IBMB 3WIBA 3VU9A 4TKUB 1DBWA 1J56A 1UDRA 2GN9A 1X86B 3ME5A 1I5RA 3K0AB 1JR4A 2QW1A 3HXKA 1G5TA 3U40A 5EE3A 1LY1A 5FBVB 1TLFA 1H8ED 1OAOA 9MHTA 1JQ5A 2B5WA 2VUHB 2ZXEA 2AEMA 4B3HA 5BYBA 2DBQA 1XP5A 3PTZA 4OIFA 4C3UA 1E5VA 2YZGA 4UE3S 3W1WA 1AF4A 1T35A 4G1MB 5BURA 1E5TA 2DT8A 2JFHA 3QVTA 4R9UC 4DC0A 3Q8LA 2AI2A 2DKNA 3DUFB 4DCVA 1YJQA 4P3PA 2A78A 3AEKB 3DZ8A 2VHCA 4RVDA 3ZDFA 1VLLA 1O6BA 1OY1A 4I6JA 1H6BA 1GGFA 4NY1A 5GAJA 1C4KA 4LOIA 1JZQA 1HFWA 1YASA 2BCEA 3E5RA 4O4HF 4ZVKA 4PX2A 4E11A 4RTJA 1POWA 4IXTA 4DQLA 3KQQA 1IHPA 2YXLA 2ZUCA 3CXUA 4X54A 2DKFA 4AJHA 1ZR4A 3CNNA 3O31A 1ESMA 4F5YA 5MGNA 3VH2A 4NU5A 1TU4A 4G5QA 4TXJA 4BS9A 2QLBA 1CDDA 1O58A 5DBEX 3SJAA 2H1CA 4QTYA 4KV9A 1PWEA 3L4SO 1THMA 5E4FA 2X86A 1V3UA 3DHEA 5GM2A 1BX0A 1P9WA 1PFVA 2VDKB 1KS9A 3DXZA 3RTEA 2LIVA 3BH0A 3KKPA 3UICA 2RAUA 3JYQA 4MRSA 3OLVA 4DNOA 3DVAB 4ZDWA 1TMKA 4X1IA 2FY8A 3MWFA 3H2JA 3SC2A 9LDBA 3M4ZA 4IZIA 5HW0A 3UWKA 1S8NA 1T5TA 4DDMA 3GFPA 5E6SB 4Q1BA 4A8JA 2B92A 4PEVA 4WH0A 2WWYA 1N1MA 1B23P 1V6CA 4NAHA 1XHEA 2VHZA 3ANTA 2ERYA 4O4LB 4WNCA 4ZQBA 1ZH4A 3QX9A 2BL4A 1JX6A 3RU2A 3ZWNA 1SC1A 4RWZA 1P45A 1Q6YA 3CVOA 3W3AD 3JZFA 1AB5A 4F9GA 5IXSA 3I9KA 4MICA 5L53A 2CB0A 4Y6OA 1UJ2A 1BDMA 4OB8A 4OD0A 4F1JA 2Y4NA 4V3CA 5DH9A 5BXYA 7REQB 3VVMA 4J76A 3KKKA 1Q77A 3LYLA 4YO7A 5FH9A 4S0XA 4IIXA 1L5GB 1PR4A 4CMAA 1PJBA 5PNTA 4EGQA 2R5FA 4GKJB 1EM8B 4MYDA 4DNQA 1DHTA 3C74A 2DFKB 3UANA 3V1YA 2ID4A 4X45A 4DWVA 1I3OA 4RZ2A 3JXEA 2IEGA 1GCOA 1I3NA 1J42A 5GVRA 2YWDA 3WNQA 2AUMA 2JC3A 3E8XA 4LSGA 1M10A 4K6KA 2FXIA 4PTZA 4PTYA 1ECLA 1H93A 2P91A 4Q1CA 5H9WA 3PE3A 4GU5A 1L5NA 3G8BA 3RYIB 4FSHA 1T3HA 2NVUB 1CP3A 4YLGA 4F7WA 1X14A 5JI2E 3GJQA 1ETHA 4WLOA 2VN8A 2VJNA 3HDGA 1UMDA 4RFLA 3V4LA 1CY6A 2YOFA 5COBA 1XZLA 2I62A 3HKEB 4CL2A 1QTQA 2OXRA 5IBPA 3RSLA 3SF8B 4B84A 1Y1PA 3EPJA 1RADA 3TZEA 3AUSA 4RK5A 1CV2A 1AV7A 1NVMB 4GOMD 4R6WA 5F64A 3LQYA 1D4FA 4WFKA 1TADA 3BMOB 3BGVA 2UVQA 1RIIA 1G8HA 1R15A 1X3LA 4TLMB 4M36A 3WDKA 2Q6VA 1LLCA 5C3UA 2IUUA 4D0NA 1Q0TA 4B81A 1P2SA 1PAUA 2XQIA 1V39A 2XPCA 4AF8A 3OZEA 4QBIA 2P0EA 1GARA 1GADO 5LXTA 1XZQA 3G0OA 2JI4A 3DNPA 3T7DA 4ZA2A 3DBLA 3W5HA 4BMPB 4C1BA 3IP3A 1TT7A 2O23A 4H4CA 3BBLA 3JASB 4MS1A 3RYTC 1S1CA 5K0TA 4RL4A 2QTMA 5L7WA 2GBPA 5AHRA 5EMHA 1G3UA 1YB4A 5CA0F 1N8KA 3OQOA 4KWTA 1SD2A 2CL5A 2QJWA 5BWBA 3F5SA 4TSFA 5COQA 3EUFA 3ABRB 5F51A 5D2CA 2AOUB 3FUXA 3RS9A 1PG5A 3L43A 3WLFA 2VAVA 3LWZA 3TAXA 3QX3A 4JXKA 2OCLA 3HMKA 1Z35A 2AI3A 1QM5A 2R9VA 2RG7A 4TS1A 3TM4A 4MS3B 4Y67A 5ER9A 4J7UA 2O9JA 2VTBA 4E5DA 2WNIA 4GL4A 1AGRA 3M34A 1V8DA 2ZU6A 2C9YA 3FYTA 2PBFA 4KWHA 5FF9A 3RUPA 3WMRA 1YRLA 2HY7A 2IQ5A 3ZDDA 3KOMA 1DHRA 1HK7A 4DCGA 1Y4ZA 3R8CA 3JSAA 1G7SA 2JNWA 3OFJA 2EBUA 3DL0A 4BNIA 2HD4A 3ACBA 3E81A 4RBNA 3KQNA 1OFIA 1VHQA 3SKVA 3UJ7A 3O8QA 4UTXA 3HRHA 2OO5A 3AEYA 1KI9A 2JPDA 3QJGA 2FPGB 2HNBA 4H6WA 4LJSA 3SP1A 2H51A 3L1HA 1BXGA 1UXHA 3V7NA 5G1OA 4K81B 5H1YA 1RM0A 3VI3B 2FR1A 1LLQA 3PX3A 5IG2A 3FWHA 1FFHA 3I9LA 2QTRA 4EYQA 2PRKA 4UEWA 3QEJA 4L5IA 4BLQA 4D56A 4R9NA 4XWOA 1O6GA 4NICA 4GP9A 2G1JA 2LPMA 3EXAA 1VPLA 2VYVA 4Q4LA 4XB6B 3CRVA 3FYUA 1U3DA 2PXXA 4JQZA 3RYHA 1DO8A 1YXMA 4QPZA 4F93B 3HDHA 3ZG6A 4YPOA 3M49A 3HM2A 2QRVA 5G2OA 4EDFA 4MIEA 2GJAA 1Q7GA 1W5BA 2WZDA 3Q72A 3FAZA 1H6AA 2X19A 3Q11A 4LVUA 1F06A 4L3WA 5CYFA 5FL7D 2Q5JA 3SEAA 5KSWB 1Z6TA 3TX2A 4YMTA 5BOSB 3EFOB 1EFVB 1Y1QA 1SELA 1L4EA 2HFKA 3Q7RA 3QUBA 4UM9D 5ENDA 1O0BA 1LLUA 5H5JA 3W2TA 2ZULA 4HGRA 5JJLA 5INTA 4ETMA 4TYMA 3LGXA 1H2EA 5DNYB 3ZCPA 2AC2A 3GT4A 2YDXA 3IAM1 4JP1A 5K6AC 1A9XA 1W36C 2V7GA 2UAGA 4J0KA 4IZ6A 2H1FA 4INZA 5H9VA 5HIJA 1A1VA 3D8HA 3N7TA 4NLLA 1OASA 4AJOA 3NW9A 1RAHA 2KX7A 4K9RA 1W0JD 4HWPA 1J20A 2XADA 3OAAD 4N3BA 4L9SA 3B1FA 4QBGB 3UUFA 2RJ3A 1L5RA 4EHNA 4B6OA 1G8SA 2GXUA 1L1FA 4BV3A 5C80A 3DAFA 3HJGA 3RV4A 4GMKA 4QEDA 5ALVA 1JR2A 3N87A 4V0ME 1SC3A 5UKDA 6NULA 1P60A 3V00A 3ZTYA 1CBUA 1NNSA 1DLJA 7YASA 4BFXA 4BO2A 3LT4A 4JU8A 4X00A 4DCTA 2FWNA 2ZI6A 4K6FA 1N0WA 2WJHA 3OUUA 1MRNA 5CT6A 5J5AA 3MRSA 3SC4A 4XM1A 1GU1A 1UWLA 1JW9B 2H8KA 4MTLA 4XCVA 4CNQA 1LNQA 1XCOA 5DW3A 1DUIA 2ZTSA 3PUKA 1ZA2A 3B89A 2GM4A 3NFRA 5J4HA 1KY2A 2M98A 4N03A 3AETB 3P4YA 4NU0A 4DNFA 3HV2A 5LYJA 1ENPA 5L3QB 1ZJZA 1DZ3A 2ET6A 3HYNA 5D7BA 2PJZA 1SXJE 4A6EA 1Y8AA 1UBEA 5ALHA 2ZS8A 4LYHA 5ALXA 2OZLB 1IQUA 1CJBA 3PVZA 1K7SN 1PG2A 2OFPA 3OJ0A 1JEYA 4FYHA 1KJQA 2XB6A 3O8LA 2ANBA 5YASA 1XKLA 4EG0A 1LPSA 4FMDB 3S55A 2Z9CA 2GM3A 3AVOA 3QF7A 3V9AA 2DHCA 3H9EO 3KTOA 2IGTA 3NETA 1NNUA 4FFOA 2V7QA 5DK4A 4YRZA 3ETHA 1WM1A 1GILA 3U1BA 4E94A 4GM1A 5KNCH 2AFIE 1WSAA 4FILA 3OZWA 4CQLA 3LYUA 1M73E 4DFDA 1T8WA 1CU1A 4EKIA 4J94A 2H08A 2VSFA 3EPPA 1VB5A 2WE7A 3F7MA 3CWQA 3PDWA 2PRIA 4RTQA 3JZDA 2Q5CA 3OEWA 3WK4A 4YJ2B 3BREA 3KKLA 3CE6A 3QKRB 3CYFA 5HIIA 4A4DA 1DV1A 3C2QA 4OKSA 2DXIA 1G63A 3DLBA 1QLJA 3G6WA 3KD3A 2QN6A 2GZAA 4ZCRA 2GK3A 1JB9A 4J6EA 4AO7A 4M8LA 3NM6B 3S7ZA 4Q9KA 1L8OA 1J8MF 4M1KA 1QHHA 3V80A 3PEWA 3EG9B 5C51B 3COWA 4BVJA 5E1MA 2BKVA 5TVGA 2HIMA 4I9GA 2KMLA 3TL6A 2W4QA 3U4QB 1IPHA 1KI3A 3ZYCA 4F3NA 3UA4A 4MUKA 5I9LA 1UH5A 3KT3A 1XNJA 4U7JA 1LBEA 1DQPA 3NHBA 2J4CA 4DUGD 4F91B 2IZOA 4EKYA 5IMBA 2B8NA 2HLDA 1YS9A 3FLEA 3ILHA 3HB5X 4HEJA 4IIFA 1TIKA 4RKEA 4CIXA 1RZUA 3KOZA 4DRXA 5IAJA 1U28C 5FUXA 1UFQA 2RK4A 3I9FA 3IBYA 1E77A 1SA0A 1ZITA 4BAUA 5IANA 1EQUA 3ASZA 4EUSA 2X4IA 3HWWA 4OXRA 2WHYA 1U8ZA 2OG2A 5C5EA 2D2VA 1T43A 4L4XA 4X64B 2V0GA 3W9UA 3T4EA 2OESA 4RLHA 2UZAA 4H3SA 4MVWA 3NCHA 4HDNB 4EDHA 5DTEA 5I4BA 5JJIA 3DT9A 3GCXA 3BG5A 3Q1KA 1HNNA 4NATA 2WILA 3CLRD 1GPMA 4JA2A 4KN9S 2ZB7A 2O6LA 3FDIA 3IILA 3OD1A 4QT0A 4H4DA 3NAMA 4QFDA 5CEEA 2WD8A 3RBZA 4B3JA 3I6IA 5IM4F 1J22A 2P9ZA 2PX8A 2C1ZA 3P0JA 4X1YB 2PH5A 3ZBPA 3BD9A 4BTLA 2C9CA 3CR7A 1IY9A 2Q3EA 2ZJYA 4TTRA 4FXOA 5FAXA 1XQ9A 4IZOA 5ICCA 1PR5A 4CYMA 1Z82A 3ITKA 1NPYA 3FPAA 4MB0A 2B7BA 3UK6A 1RAAA 1C1YA 3MJRA 4BU1A 4CV2A 5I4KA 4ND6A 1RRFA 2Q27A 3Q8KA 1QP4A 5C52B 4G5OA 1FTYA 4ZEVA 3ZWVA 1EU1A 2HA4A 4J0HA 1QRDA 2ECPA 2V9PA 1R27A 5HDQA 4RELA 4RM3A 3M6AA 2PZAA 5JCXA 3KSAC 3HH8A 4A91A 4Z3KA 4MW2A 5HPYB 3IBSA 4L07A 4DEVA 2WVHA 3QE3A 3Q5DA 1ZGJA 4ALMA 1TTPB 1TU3A 2PUFA 1K98A 4IGFA 1BFKA 3AP1A 2Z4TA 2Q1TA 1J1IA 4EKEA 2YWBA 1FS6A 4K5QA 5AMXA 3L8CA 4G37A 1RQXA 2VAXA 2QRNA 2VPZA 2DF8A 4G23A 4M0LA 3FR7A 1ZBQA 2WMNB 1E2LA 3S4YA 4HDAA 3DAGA 5ALIA 2YWXA 5KOYA 3AR5A 3HADA 4DR6B 2FPRA 3HG7A 3L6BA 4HH3C 4O2BF 1E64A 5L3SA 2Y2VA 4WW0A 3NO4A 4YH1A 4ARBA 2WMDA 4C6TB 1F38A 4FYIA 4HNGA 3ROPA 2Q1WA 3EWNA 1AH2A 3LCUA 1PKXA 4MULA 5CCBA 4KTTE 3RRXA 2B25A 2AW5A 3BULA 4GH5A 5JNUA 1JWBB 1G7TA 3CRQA 2I6XA 2RHCA 4RZQA 4A8JC 3GFQA 2O8VA 2H1OA 2Y1DA 4EG8A 4KNVA 5A3SA 4C29A 1MG0A 4CFYA 5JQGA 5KAPA 1RS0A 3VAYA 1YJCA 2A59A 4RLFA 4HNAA 4Y2PA 1MP0A 6GPBA 2DWCA 1C41A 3A06A 1LBQA 1LRLA 3AJDA 1G64A 3WB0A 2XB8A 4UEKA 2PU7A 4KPUB 5K03A 2BFMA 1YL7A 4IJMA 1UXKA 2GH1A 1WB6A 2YNMC 3TDMA 1N0IA 1URPA 4WK2B 4CM9D 3AOGA 1GN8A 1HC7A 3EB9A 4IJ5A 4AN1A 4EFMA 2XT6A 3HCBA 3K0FA 2X14A 2ONCA 2YWRA 1HZZA 3KOXA 1JHDA 1VI2A 3QFTA 2EIXA 2BBTA 4TROA 3IP8A 1T2DA 3JR7A 1S7CA 2RG1A 5GZ1A 4BQIA 5AM3A 2YH2A 3MGKA 4IKEA 3CMCO 2F3TA 4IBOA 1GTZA 3OQ6A 1ZM9A 2WD7A 2YMPA 2HZ7A 3PIRA 1Z17A 4ZVVA 4E2XA 2CJXA 4MMYB 3S81A 3PLRA 1P2FA 3QVUA 5BSUA 4BB5A 4AT1A 5JISA 3S8EA 5ALNA 1XMXA 2VDNB 4W1PA 1WUIS 5EWLA 3N86A 1PQUA 2BGRA 1H66A 1U65A 1AY0A 1ISRA 3K6KA 4R6XA 1O9HA 3I83A 3UB4A 5TIIA 4QNRA 5K6TA 5A3QA 4XCQA 4QUHA 5FX2A 2XYHA 5BPFA 1Z9BA 1QQTA 3UYKA 3CVJA 3KPYA 3V8RA 3C7CB 4GR5A 5JYCA 5B7QA 2FWIA 2A0WA 3NUGA 3HJNA 3GJ6A 3TL3A 6PFKA 4KL8S 4B71A 4QL3A 1XQ1A 5DIFA 4ARZB 4IDEA 1B00A 4PS0A 5J43A 2ACWA 2ERCA 5KCMA 3A1DA 5K8CA 3PKZA 10MHA 3D2AA 1RPJA 4N49A 2A57A 3HA7A 2P1RA 2VF5X 4DMRA 3PS9A 4DHEA 5DDIP 5KYXB 1RXEA 1C30A 4DCJA 3N8HA 2F55A 4RD0A 5LA6B 4BZXA 2CF6A 3AR7A 1E79D 1FBTA 3OJCA 2V3WA 4OYLA 3ND8A 1KY3A 2HNKA 5L4LA 2NV0A 1UBJS 1QQ5A 2ZYUX 2RGGA 3KSBC 4ZTUB 2EJWA 4HQRA 1GPAA 5IKMA 1FLVA 2NV2B 4GC9A 4Z3OA 4F2PA 4GLFA 3AERB 2Y0PA 3B3AA 7GPBA 3PXUA 2QTVB 2W2PA 1N9ZA 4O8ZA 5LBUA 3P9SA 1PZXA 3KPUA 1G59A 5TS2A 1YQQA 5AI4A 3WQHA 4PSUA 2I2WA 2WYIA 5TQJA 3HO8A 1RRVA 3GLFB 3WDMA 2BWJA 2DVMA 2Y66A 4HWTA 1ITZA 4HMOA 3DW1X 4WBNB 3ZCSA 5CG2A 4OLFA 4PANA 1XNQB 2VRBA 2ZYRA 3DSRA 5K0EA 2OO5C 1NTRA 1PS8A 3LXRA 2ZRNA 3RVKA 1SU4A 1BG6A 3QNUA 4WACA 1V5EA 1N2OA 4LDZA 5H16A 1EFPA 4JJ4A 4JVNA 5GPBA 1HETA 1NP7A 1Y6JA 2GPNA 3GLIA 1DEKA 1E4EA 3KALA 4EP1A 13PKA 3CNOA 1GTSA 4QARA 3ZR4B 2V3CC 2VOEA 1Y34E 2ZIGA 2CFTA 1LLDA 4C0AC 2EX4A 4MKRA 3UAVA 3AYXB 2PBZA 2YWCA 3DXYA 2GCPA 3FYUC 1GPNA 1A5AB 4MGYR 4OI1A 4F4CA 4AWXA 1P29A 3OCCA 4NBLA 1NMQA 1TQ2A 3AILA 3BOSA 3KAQA 1P7YA 2EJCA 2QHXA 4NVRA 4QLAA 4WDQA 5B30A 4RDXA 2GZRA 5C1OA 5LMCA 1U99A 5LFAA 5GONF 4BX8A 4BIMA 2Q5FA 3U5TA 1GT91 4YJKA 5FI3A 3T5CA 3CSUA 1UJNA 2WNHA 3AF5A 4MWSA 1KFJB 3TIVA 3PWZA 5E7MA 1T4CA 5JYEA 3EVZA 5TQVA 4J0GA 5THKA 1YH3A 2WF9A 4I2NA 3CF6R 4FGJA 3HYSA 1T2UA 1Y1LA 2PRZA 2DQKA 2D2FA 4TTQA 4INAA 3NM4A 3TXAA 2C54A 1VYTA 5EIHA 2IP4A 1TO2E 3EQ9A 2HHAA 5EJMA 3IQFA 2B61A 3HVRA 4UCXA 3SYNA 4EPXA 3RK1A 2J08A 4CIYA 2UZ4A 3ETEA 3QKSA 1W88A 2H5LA 5AD1A 3MWDB 4LNUB 4NH4A 1C7IA 4GPAA 1IU9A 4C7MA 1YQUA 3I9OA 1SPBS 2LW7A 2H1LA 1OGIA 4KE9A 4NPAA 4HDSA 3USCS 5GJBA 4AY2A 1M2EA 3PNOA 1AJEA 1ZK1A 4MHOA 2PH1A 3IMEA 1DXQA 5TQ0A 2ORIA 1L3BA 1UKCA 3KU4A 1JFVA 2X77A 2G4VA 2ZSEA 1FP4A 1OU0A 1MAHA 3ENVA 2PUCA 4UMFA 1C3OB 3ACDA 1XD2B 2AR0A 3IV7A 2J4DA 3C3KA 4JMLA 3UOWA 2GZSA 2ST1A 4DQDA 2Y9MB 4KOAA 1K08A 2CLCX 2K6GA 3F1KA 2YV4A 4HDMA 4CT0A 2G25A 2UUBB 5EOVA 4CZ2A 5KQRA 4Q3KA 1AGXA 3T38A 4G1VA 2GS9A 2O3SA 1MO5A 4ZRDA 5I8PA 1XMQB 4BWFB 2XSZD 2C7BA 4KHPB 3LTNC 2ZKLA 3QOYA 4FPXA 3R3WA 4Y2SA 1MW8X 5GGYA 1F14A 2X0IA 4G4SO 4UJ5A 3UV3A 5K8VA 3W3ZB 2Q5QA 1NBMA 1KAOA 1KMMA 1M8KA 1P8AA 2GVDC 2XE6A 3REGA 4LJ8A 1RAEA 1RYZA 2L82A 3C4QA 4IEIA 4L3VA 4OVKA 3HKDB 4EYKA 2C99A 4LEIA 3T9FA 5D3ZA 1JA9A 1ZC4A 1EWYA 3HYLA 4BX9A 1ZM4A 2WU8A 1GNTA 4FNAA 4WGFA 3ET4A 3V1UA 3U7GA 1T5IA 3CX6A 1G2OA 2R8RA 3ZZNA 5F23A 1E9SA 3ID6C 5HZGA 4YHHB 3IR6A 1V2GA 1IMJA 3F7TA 4JR0A 2NUPA 2FMFA 2VDUE 2Y1GA 1XA3A 4XD7A 3WLIA 5AUOB 3RAFC 3H97A 2PX3A 2G9VA 4KFRA 4Q3OA 1SU6A 2UZ0A 4TLEA 5IUNC 1NY6A 3K9QO 2V58A 3FMPB 3FPCA 3DZFA 2J85A 1Z0AA 1Y3HA 2B0JA 4AS1A 1X7HA 2D1RA 2GA9A 2DY1A 2G40A 3VYUB 4WN3A 1JPUA 1GSOA 4B8YA 5JANA 3H6HA 3RFUA 5ERGB 5GJVC 3HO1A 3IUEA 4M38A 1XTIA 2PL1A 4PV7A 4P38A 1M6YA 2IZ7A 4YJHB 4IHAA 3KOYA 1KMQA 1KQOA 3HCOA 3RRFA 4XWWA 2DBYA 3SNKA 1UAGA 2YFHA 3LLMA 2VXOA 1U7HA 4YQFA 4G0YA 2CB9A 3OT1B 1TGVA 3D3JA 1GAJA 1Z13A 3WGZA 1RKVA 1WVMA 4F60A 3JWJA 2Y3IA 3LIIA 3DWEX 3QVWA 4EX7A 4L27A 3CNLA 3N07A 3GA7A 1EQ2A 1B1CA 2XWBF 5AP9A 5C31A 5B6PA 4TS4A 4XX0B 3A3OA 2A14A 4JEIA 2VH2A 3PX7A 3I9JA 3FZYA 1VJ5A 2FX3A 1A97A 3ONDA 4L5BA 1PR9A 2AKAB 1RTKA 2C07A 3EZ7A 3H0KA 1ISHA 2QMUA 1N6RA 4IPTA 3OFND 3JQBA 1HFKA 2BEWB 5CFOA 4IO0A 1GGHA 1EVQA 3PCTA 3WL7A 1P1HA 1XEAA 1JQDA 2HV8A 4Z0PA 4LC1A 3ZY6A 2HA0A 3TE7A 4CFZA 4UD2A 1ZN8A 2YIDA 1X7WA 1QMPA 2UV8A 1NXSA 2R1VA 4S1PA 4UUAA 5BWMA 5K9ZA 1XZFA 2P6PA 1BCRB 5EAIA 1WHSB 1A8HA 3P26A 2WP8J 5HILA 2VPTA 1RPAA 4R0MA 2IZ1A 1WZ2A 1N9GB 2VATA 3FZNA 4KMRA 2QD2A 4BB0A 1XLUA 1N5RA 2YC4C 3C43A 3DBHB 3HE3A 3SBEA 1GAEO 2IYOA 1HNZB 2BONA 1IPFA 1VKOA 3VPDA 2V59A 4GYKA 1EWKA 1IQ0A 1B2RA 1HYBA 1N2BA 2ZWMA 3A1FA 3UH0A 2CFIA 4DOMA 2WE8A 4B2LA 3I76A 4UZEA 1Q0UA 2W6CX 5DNVA 3EX7C 1X8LA 1OJLA 4DZTA 3KWFA 1RPTA 4HAOA 2O7QA 2WLSA 5J4KA 3NC4A 3V7FA 4EWLA 3TRIA 3ZGYA 2J4FA 3TM5A 2DHQA 1EJ6A 3WXMA 1YKFA 4HVLA 3AI1A 5B2EA 2VT6A 5JCPA 1JLKA 2NUAA 2WFZA 2PZMA 1ZNZA 1KJ9A 1WKCA 1ZXBA 3F90A 4R71A 5B7NA 4EG5A 1ECJA 3JZAA 3AF0A 2ZTHA 2ZYTX 2QD4A 1XAJA 2BHLA 4WK6A 4UC0A 4CJXA 4LGVA 4US0R 1G60A 1TAHA 2JCSA 5EIBD 5EKTA 5EYPA 3Q7PA 3KR0A 3OBBA 4GECA 4MAFA 2J7PD 4O08A 4CM5A 4EB3A 1N33B 5FA8A 5BW8A 4E13A 1CR6A 4IDOA 1FW6A 3ZUPA 1H0KA 2O7RA 2W6ZA 4IOLA 1TCAA 5DBHX 4CTJA 3LPLA 5KJCA 3ODGA 5LVAA 5IRCD 4C4TA 2NTNA 1YA8A 1SKUA 2H4JA 2KS6A 2J0QA 1MPTA 4H9GA 1JJVA 4LZZA 5KWVA 2B69A 2DHRA 3IIEA 2OCXA 3I45A 2HW8A 3D5TA 2CSXA 3DHNA 5DM2A 3G59A 1QTRA 3INTA 4YC7A 3CHYA 4RAQA 4KGVA 3SX4A 2A58A 5BVGB 4X91A 2QROA 1Q7CA 3LZ6A 2YFQA 1K66A 3SDZA 4EPTA 2IC5A 2O7SA 4O0MA 5KYGA 1JBQA 4OEHA 3JSXA 1EK2A 2CDAA 2J09A 5FPHA 3JATB 3V8NA 3GFTA 1QHNA 1TVKA 1NVDA 2D0IA 1XZBA 3L46A 3NBKA 2QIOA 4XPZA 5FP0A 3ZTTA 1TQ6A 2WU0A 3GX1A 4V0LA 5FBHA 4OQNA 4JJEA 1TRHA 3O4FA 1N8NA 4G25A 1AK2A 2AWNA 2P2SA 2F00A 2QEQA 4EJSB 4IIGA 1TUBA 3KWLA 1GUFA 1MJ5A 4B4DA 3KETA 3P4XA 1QIEA 3MOIA 3NRJA 4WLUA 1H05A 1EXMA 1F7UA 1RLIA 1PNTA 1V4VA 5TSDA 3TSZA 1CIJA 2ARKA 4HH4A 4KO3S 1BGVA 1GY8A 1QX3A 2C61A 4FW9A 4M0CA 3RROA 4YREA 5KNBD 1IAQA 5KWSA 5FAKA 2H7CA 1RZRD 4KREA 4FM9A 1CQIB 3C24A 1U81A 3L4KA 4FJ2A 1ADJA 1MNAA 1QH1A 4W9NA 1EM6A 2P4SA 4WXPA 2HSJA 3BE4A 4AZTA 3BXOA 2FFRA 2JLWA 2ZR9A 3FKSA 4ZVPA 3W7VA 2FCRA 4B74A 4BNHA 2HK7A 1QYDA 3DYBA 2EJTA 1ZU5A 2W37A 2Q0HA 4MW5A 3KTFA 4WOCA 4JI5B 2ZUDA 3BCHA 1EX9A 1FDRA 2I29A 1M6NA 4ECEA 5HIAA 4C87A 1II0A 4HLDA 3GGGA 3M5CA 2Z1NA 3D7RA 3FSRA 1HI9A 4PYRA 4URUR 2VF4X 4BNUA 3ICVA 4EFDA 2Z43A 4EQ6A 4LSZA 1R64A 3D3KA 3QNMA 4MCHA 1NBHA 3HUFA 1DO0A 4OK3A 2H0AA 3ND6A 2WIJA 3NYRA 3OQ1A 3TLAA 1YR2A 4PPYA 1I7LA 1VHDA 1F8YA 3ROZA 4AG5A 4DWOA 3OM0A 3HCAA 4Q12A 1Z83A 3UTDA 4IFIA 5BRAA 3WDLA 1TJ5A 2DWOA 3RSGA 1W7AA 1M74A 1I7QB 4Z9AA 4BN0A 1AZTA 2XYPA 3L8HA 3NEAA 1MJHA 5KTOA 2EWMA 1HLPA 3KZNA 4H0FA 3SDBA 4ZAVA 3VI4B 4F8YA 3A4MA 5CFZA 4I7EA 3RFFA 1NT4A 4B80A 3N6XA 1Q20A 3PFKA 3N0VA 3GLFE 1B26A 5DNDA 1E3WB 1P5HA 3AR3A 3D5QA 3LC0A 3W8RA 2FN7A 2PL3A 2BFFB 3DTVB 1M8GA 3ITDA 2BGKA 3FPBA 3WR5A 3M5WA 2XMCA 3GYBA 4YB8A 4WGGA 4WLEA 1MIOB 2YZ7A 1M9NA 5DBIA 1X2BA 3BIOA 2D7DA 1Z15A 4BASA 4RENA 1JQ3A 1P1JA 2FG6C 3L0ZA 3H87A 3EW7A 4UPDA 3WRVA 3WQBA 2FOXA 2JVIA 2CV1A 5AK0A 1JFLA 2CMDA 2II6A 3AU8A 3BTOA 3FSEA 4Q01A 4BV2A 3LGSA 2QZZA 3OTHA 4DCMA 4AQDA 3EEOA 1CDOA 2QLTA 3G2PA 3JYLA 3P2MA 1ENZA 1UBRS 4KR9A 1KRWA 2G63A 3FOAA 3U6KA 1IPEA 1VMIA 5DO9A 4HQ6A 2KB0A 5FHRA 1A2KC 2ZUWA 4RNDB 2ZYWX 2YUIA 4C7KA 5B7PA 1HE4A 2QQ5A 1OXKB 4LJ5A 2LKDA 1OH5A 1W5AA 3I37X 1YACA 2AOTB 1V16A 1OLSB