4TQOA

The crystal structure of methanol dehydrogenase from methylococcus capsulatus (bath)
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
573
structure length
573
Chain Sequence
NSELDRLSKDDRNWVMQTKDYSATHFSRLTEINSHNVKNLKVAWTLSTGTLHGHEGAPLVVDGIMYIHTPFPNNVYAVDLNDTRKMLWQYKPKQNPAARAVACCDVVNRGLAYVPAGEHGPAKIFLNQLDGHIVALNAKTGEEIWKMENSDIAMGSTLTGAPFVVKDKVLVGSAGAELGVRGYVTAYNIKDGKQEWRAYATGPDEDLLLDKDFNKDNPHYGQFGLGLSTWEGDAWKIGGGTNWGWYAYDPKLDMIYYGSGNPAPWNETMRPGDNKWTMTIWGRDADTGRAKFGYQKTPHDEWDYAGVNYMGLSEQEVDGKLTPLLTHPDRNGLVYTLNRETGALVNAFKIDDTVNWVKKVDLKTGLPIRDPEYSTRMDHNAKGICPSAMGYHNQGIESYDPDKKLFFMGVNHICMDWEPFMLPYRAGQFFVGATLNMYPGPKGMLGQVKAMNAVTGKMEWEVPEKFAVWGGTLATAGDLVFYGTLDGFIKARDTRTGELKWQFQLPSGVIGHPITYQHNGKQYIAIYSGVGGWPGVGLVFDLKDPTAGLGAVGAFRELAHYTQMGGSVFVFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Protein-Protein Interactions of Methanol Dehydrogenase from Methylococcus capsulatus (Bath).
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methanol dehydrogenase protein, large subunit
total genus 176
structure length 573
sequence length 573
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01011 PQQ PQQ enzyme repeat
A PF13360 PQQ_2 PQQ-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.140.10.10 Mainly Beta 8 Propeller Methanol Dehydrogenase; Chain A Quinoprotein alcohol dehydrogenase-like superfamily 4tqoA00
4CVBA 2AD6A 1YIQA 2AD8A 1H4IA 1LRWA 4MAEA 1G72A 2D0VA 4CVCA 1FLGA 1KB0A 1KV9A 4MH1A 4AAHA 1W6SA 2AD7A 1H4JA 4TQOA
chains in the Genus database with same CATH superfamily
1XFDA 1HJ3A 2I78A 3G0GA 3KWJA 3G0CA 3O95A 2JIDA 1H9YA 1Z68A 4DTCA 1N15A 4L72A 4Q1VA 1QKSA 2D5LA 5KBYA 1KV9A 1GJQA 5T4FA 1YIQA 2BUBA 1N50A 3C43A 4WJLA 4PV7A 2AJCA 1GQ1A 4PNZA 3G0BA 1HJ4A 2P8SA 1ORWA 2GBIA 2DCMA 2ONCA 3W2TA 2BUAA 4G1FA 1WCYA 4DSAA 2OGZA 2IITA 3OC0A 2G5PA 1HJ5A 2AD6A 2BGNA 1R9NA 1RWQA 2OAEA 1LRWA 1W1IA 3CCCA 3O9VA 2FJPA 3HABA 4MH1A 1NNOA 3NOXA 1NIRA 1PFQA 2GBCA 5I7UA 2HHAA 2QOEA 3G0DA 1TKRA 1DY7A 1FLGA 4QZVA 3VJKA 1J2EA 3OPMA 3SWWA 1R9MA 1N1MA 1KB0A 4AAHA 4CVBA 4J3JA 2BUCA 1ORVA 3KWFA 2AJBA 2GBGA 4N8EA 5T4EA 1HCMA 3VJMA 1TK3A 1X70A 2OAGA 3Q8WA 3C45A 4JH0A 4CVCA 2OLEA 4A5SA 2AD7A 4DSZA 2QJRA 2G63A 1HZVA 2AJ8A 2GBFA 2I03A 3QBJA 4LKOA 2QKYA 2D0VA 3Q0TA 5LLSA 1AOQA 1HZUA 5T4HA 1AOMA 3VJLA 1H4IA 2I3ZA 1G72A 1AOFA 5J3JA 4FFWA 3SX4A 4KR0A 1NU6A 2IIVA 2QT9A 3HACA 4N8DA 3WQHA 3BJMA 2Z3WA 2RIPA 1H9XA 2AD8A 3H0CA 2G5TA 3EIOA 5ISMA 2AJLI 1NU8A 1N90A 2ECFA 2OPHA 2OQIA 1W6SA 1BL9A 1E2RA 3F8SA 4FFVA 4MAEA 1U8EA 2BGRA 2RGUA 2QTBA 4TQOA 5T4BA 2Z3ZA 2AJDA 2OQVA 3CCBA 2EEPA 1H4JA 3D4LA
chains in the Genus database with same CATH topology
4CVBA 2AD6A 1YIQA 2AD8A 1H4IA 1LRWA 4MAEA 1G72A 2D0VA 4CVCA 1FLGA 1KB0A 1KV9A 4MH1A 4AAHA 1W6SA 2AD7A 1H4JA 4TQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVB A;  2AD6 A;  1YIQ A;  2AD8 A;  1H4I A;  1LRW A;  4MAE A;  1G72 A;  2D0V A;  4CVC A;  1FLG A;  1KB0 A;  1KV9 A;  4MH1 A;  4AAH A;  1W6S A;  2AD7 A;  1H4J A;  4TQO A; 
#chains in the Genus database with same CATH topology
 1XFD A;  1HJ3 A;  2I78 A;  3G0G A;  3KWJ A;  3G0C A;  3O95 A;  2JID A;  1H9Y A;  1Z68 A;  4DTC A;  1N15 A;  4L72 A;  4Q1V A;  1QKS A;  2D5L A;  5KBY A;  1KV9 A;  1GJQ A;  5T4F A;  1YIQ A;  2BUB A;  1N50 A;  3C43 A;  4WJL A;  4PV7 A;  2AJC A;  1GQ1 A;  4PNZ A;  3G0B A;  1HJ4 A;  2P8S A;  1ORW A;  2GBI A;  2DCM A;  2ONC A;  3W2T A;  2BUA A;  4G1F A;  1WCY A;  4DSA A;  2OGZ A;  2IIT A;  3OC0 A;  2G5P A;  1HJ5 A;  2AD6 A;  2BGN A;  1R9N A;  1RWQ A;  2OAE A;  1LRW A;  1W1I A;  3CCC A;  3O9V A;  2FJP A;  3HAB A;  4MH1 A;  1NNO A;  3NOX A;  1NIR A;  1PFQ A;  2GBC A;  5I7U A;  2HHA A;  2QOE A;  3G0D A;  1TKR A;  1DY7 A;  1FLG A;  4QZV A;  3VJK A;  1J2E A;  3OPM A;  3SWW A;  1R9M A;  1N1M A;  1KB0 A;  4AAH A;  4CVB A;  4J3J A;  2BUC A;  1ORV A;  3KWF A;  2AJB A;  2GBG A;  4N8E A;  5T4E A;  1HCM A;  3VJM A;  1TK3 A;  1X70 A;  2OAG A;  3Q8W A;  3C45 A;  4JH0 A;  4CVC A;  2OLE A;  4A5S A;  2AD7 A;  4DSZ A;  2QJR A;  2G63 A;  1HZV A;  2AJ8 A;  2GBF A;  2I03 A;  3QBJ A;  4LKO A;  2QKY A;  2D0V A;  3Q0T A;  5LLS A;  1AOQ A;  1HZU A;  5T4H A;  1AOM A;  3VJL A;  1H4I A;  2I3Z A;  1G72 A;  1AOF A;  5J3J A;  4FFW A;  3SX4 A;  4KR0 A;  1NU6 A;  2IIV A;  2QT9 A;  3HAC A;  4N8D A;  3WQH A;  3BJM A;  2Z3W A;  2RIP A;  1H9X A;  2AD8 A;  3H0C A;  2G5T A;  3EIO A;  5ISM A;  2AJL I;  1NU8 A;  1N90 A;  2ECF A;  2OPH A;  2OQI A;  1W6S A;  1BL9 A;  1E2R A;  3F8S A;  4FFV A;  4MAE A;  1U8E A;  2BGR A;  2RGU A;  2QTB A;  4TQO A;  5T4B A;  2Z3Z A;  2AJD A;  2OQV A;  3CCB A;  2EEP A;  1H4J A;  3D4L A; 
#chains in the Genus database with same CATH homology
 4CVB A;  2AD6 A;  1YIQ A;  2AD8 A;  1H4I A;  1LRW A;  4MAE A;  1G72 A;  2D0V A;  4CVC A;  1FLG A;  1KB0 A;  1KV9 A;  4MH1 A;  4AAH A;  1W6S A;  2AD7 A;  1H4J A;  4TQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...