4TR0A

Crystal structure of gssg-bound cgrx2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
91
Chain Sequence
MKNITIYTKNYCPYCKKAVSLLSSKGVDFKEVDVTHDSKAFEDVMAKTGWDTVPQVFVDEEFLGGDDIHALDRQGILDKKLGLKLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin 3
publication title The GSH- and GSSG-bound structures of glutaredoxin from Clostridium oremlandii.
pubmed doi rcsb
source organism Alkaliphilus oremlandii
molecule tags Oxidoreductase
total genus 27
structure length 91
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4tr0A00
2EIRA 1SD9A 3GH6A 4XRAA 2JL4A 2V32A 3UVTA 2OJLA 1Z6NA 2YJ7A 6GSTA 3PGTA 2K8SA 5DAKB 4HS1A 3CRUA 4POKA 3UIWA 4K0NA 4D73A 1G7OA 1NW2A 5G2ZA 2Z9SA 1X9WB 4G9HA 1ST9A 1YEXA 5A4VA 4PXOA 5JWQB 1GSFA 5IMDA 5J9BA 3FHKA 2VUPA 1YDKA 5CO3A 1F2EA 2B5XA 1TOFA 1Z6MA 3ZMLA 4H86A 2LQQA 1NSWA 3CTFA 1XFLA 2O8VB 1J08A 1MTCA 4AF2A 3C73A 2IFQA 2GT6A 2FGXA 1WIKA 4IJ3A 3ZRDA 1B9YC 4G19A 1QXHA 5HR0A 2OKAA 1TXXA 2WFCA 4EE0A 1AIUA 1TK5B 4IHUA 3ERFA 3MNGA 4OD7A 2BMXA 2VCZA 2C3NA 2H1DA 1T00A 1ZYEA 5EPFA 1F9MA 4OO4A 3WYWA 2YNXA 3C8EA 4WF4A 1EGOA 1HD2A 2HZFA 3DXBA 3ZIVA 4WBJA 1OC9B 1THOA 1U3AA 5D9XA 3GA4A 1VF3A 3RPNA 1GTAA 2CAIA 2FY6A 4OCFA 4YQVA 1DBYA 4L5LA 3I9V2 4KDXA 4RI7A 3KZQA 2QKEA 2H19A 1T4YA 1F37A 4PGTA 5CNWA 5J5NA 4XCSA 1B48A 2R3XA 3W6GA 3D21A 4HI7A 4NMUA 2YWIA 3I43A 5DCHA 4ZL7A 4MCUA 5GSTA 1M7TA 3FR6A 2H1GA 4PURA 4CHSA 2N5BA 3TRPA 3VWUA 1ERWA 4MMMA 3DGQA 2C4JA 2K18A 4I6XA 4LL4B 2ZCTA 3ERGA 3H79A 1EP7A 4TR1A 2WZ9A 1GULA 2IFQB 5FHIA 4GQCA 1BX9A 2CZ3A 1U3IA 1K3LA 3VWVA 3DIEA 2H66A 2TIRA 1M2AA 3VPTA 4IBPA 4L0UA 3FKFA 4BPYA 5IIZA 4EO3A 4EVMA 2C0DA 2OACA 4N10A 4BA7A 1G6WA 3CSHA 22GSA 1J9BA 4NHWA 2PMTA 1YY7A 2ZNMA 4MJEA 2F9SA 3D5JA 2GZZA 4CDOA 4NV2A 1I9DA 3APQA 5KN1A 5ID2A 4KSMA 5ECKB 3TRXA 4TW5A 3P90A 2CZ2A 3A5WA 3RHCA 1O73A 4DVCA 1B9XC 2JU5A 2VIMA 4BWQA 4LMVA 1YKAA 3JCML 2WCIA 4POLA 1GSDA 2H70A 1SK0A 2HSYA 4J2FA 2XBIA 1MDJA 2DC5A 4O7HA 1ACVA 5HFGA 3F4TA 3E0UA 2PERA 3GKNA 4POBA 5JWRB 4IVFA 3L9SA 1AQXA 1O8WA 1MDIA 5ECNB 2V2GA 2CAQA 1WMJA 1AAZA 5CRHA 3DRNA 2H0HA 4MPFA 5IO0A 2LS5A 1GUHA 3UOMA 4BL7A 2LJKA 3TJJA 4PQHA 4TR1B 1GUKA 5HFIA 3TJGA 6GSSA 5H5QA 1Y6EA 2VL9A 3TDGA 3HJMA 2N5AA 3UEMA 4GWRA 5IMVA 4HUAA 1GSUA 3IXRA 3ZREA 1XWGA 2DMMA 1SYRA 2QC7A 1X9SB 1LBKA 4WBRD 2VCTA 5KN2A 3ZFLA 2TRXA 2K9FA 3IK7A 2PVOC 2DJ0A 3UBLA 4FO5A 4OMVA 3RBTA 4FH8A 1BQ7A 2H6YA 2MMAA 2AHEA 2CV4A 5IMFA 1GH2A 1GLPA 3QPMA 2GZPA 1V9WA 3HXSA 3CSIA 3GKKA 2CA8A 3KM6A 1VGLA 2X64A 1EWXA 1BYEA 4NXIA 1VRSD 4NHZA 1SKWB 2RM6A 3HZ8A 3UARA 1X9MB 1DE1A 4MJBA 2P31A 3VWXA 17GSA 2FA4A 3TKRA 1FHEA 2C0GA 4F0CA 4O32A 3TJKA 5J3RA 2DIZA 2V1MA 4IELA 1XVQA 2H73A 3AY8A 2VLUA 1S3AA 3BOAA 4MLYA 2H6ZA 3TKSA 5ABRA 2GQKA 5IO2A 1Q4JA 4XHMA 2FNOA 1KEBA 3QD9A 3IBHA 1R5AA 3L9VA 3C1RA 1B8XA 4L8EA 1MEKA 4V2NA 4OWYA 3IR4A 2OE0A 3LORA 1T1VA 2IJYA 5JCGA 2DJ2A 3D6IA 18GSA 3WD6A 2MZCA 4KGIA 3LEFA 5IOXA 2JZTA 1PA3A 2X8HA 3WGDA 3OR5A 4TKYA 3VWWA 2FWEA 5J41A 3DKSA 5AIXA 3SBCA 2V41A 2HLSA 3GV1A 2V6OA 2IPAA 3NZNA 1XOAA 1EZKA 4OFMA 2GTUA 2LUSA 3U6VA 2I3YA 1ZL9A 13GSA 1QQ2A 2PN8A 2YV7A 4MPGA 4JZQA 4YH2A 4J56E 4KA0A 3F9UA 2OA7A 1Z9HA 1XXUA 3LXTA 5ECQB 1FVKA 2YZUA 1H75A 3D4MA 3F3RA 2H74A 4OFTA 2CVDA 4KDUA 7GSSA 2H30A 2C80A 4XS4A 3TUEA 2O89A 4AJ7A 1TJDA 2XPDA 5IPGA 5D73A 1URMA 2OBKA 3FZ5A 3PINA 4YQUA 4IN0A 5AISA 3HDCA 4ID0A 1DSBA 3SWLA 1XIYA 2VCWA 5H5SA 1K3YA 2O7KA 2C8UA 5KN0A 4FYBA 3W8SA 5B8AA 1R7HA 3TKSC 5G31A 2LRTA 4K9ZA 2TRCP 2LTKA 5DALA 5F8BA 2H0GA 2PBJA 1EOGA 2LNTA 1SJ6A 1FVJA 3HD5A 4EC0A 2R4VA 3KJYA 2I81A 2F3MA 4JEDA 5G30A 3QR6A 3ERWA 4KB3A 2HYXA 2MMOA 2YWNA 2C0EA 4XS1A 1M99A 1A8LA 2P5QA 4IQ1A 3GYKA 2DJKA 3ZFBA 2FA8A 4IKHA 3LYKA 4ISDA 2M46A 3O3TA 2AAWA 3HHVA 2HT9A 3FYGA 2R37A 2J9HA 6GSWA 4LL1B 5JWOB 1PKZA 1M2DA 1IYIA 1O6JA 4K7NA 3FZAA 1K0CA 1FB0A 1F3AA 2DIYA 2B5YA 4IJIA 2PVQA 3KH9A 4HEA2 1YF1A 4IS0A 2L5OA 4KCAA 1KNGA 4GXZA 2H72A 2A2RA 4EXJA 3GTUB 3LQ7A 3L4NA 4KE3A 4X43A 3EC3A 1EEMA 2B6MA 4KX4A 2PUKC 3MWHA 3ZIJA 4BVYA 1A2MA 2B7KA 4N0ZA 2ZUPA 3GL3A 5CRDA 1MD3A 2RUFA 3M9JA 3IRAA 4YAVA 3CBUA 5D8IA 1GTUA 1PMTA 4FYCA 4O5RA 2IIYA 4L0WA 4YAPA 2PPTA 3H4KA 3L0HA 3KTBA 5DJLA 4XIHA 5CREA 3HCZA 4TXOA 3P2AA 3IOSA 5KN3A 3GNJA 1T8EB 2AB6A 5ECRB 4HQSA 1RK4A 2KP1A 2VL2A 3GX0A 2OADA 4EF0A 1TTZA 3GUSA 2L6CA 1WE0A 4PX1A 4I2UA 3FZ4A 3IHQA 2B1KA 5IPHA 2C1YA 3MDKA 4RI6A 1RQMA 4PNFA 1SK2A 5B8BA 9GSSA 3C71A 3FR9A 1G6YA 4JBBA 3KCMA 1XOBA 3H1NA 4POMA 2IMKA 4PQIA 4EDZA 1TDIA 5B6MA 1BAYA 4PQ1A 1TI1A 1XW5A 3M9KA 4TR0A 1PQNA 2H75A 4D73B 1V57A 5GAPD 3WT2A 4PUAA 1WPIA 2NVLA 3HKRA 3L78A 1A2LA 3ZITA 2IWTA 3F0IA 2CVKA 3Q18A 5INYA 5ECLB 1NHOA 1FOVA 3KD0A 5DBQA 1PX6A 5CYYA 2GZYA 5D9VA 2LKUA 1TW9A 2IMFA 2CQ9A 1M2BA 3KTLA 2WS2A 2YANA 2QSIA 1A23A 4WKWA 4IW9A 2FD3A 1Y25A 3GRXA 1OKTA 4AJ6A 3TB2A 1YJ6A 2K6VA 2L4CA 3KP8A 3K8NA 4WR5A 1VF2A 3U5RE 4XTSA 1F3BA 2AJQB 2E2GA 3QAWA 1GSSA 2VL2C 1ZGNA 4X1UA 1B4PA 1N8JA 5IMCA 1LU4A 3FZ9A 3QMXA 1ERTA 5ECIB 4ACSA 5ECHB 2I9HA 4GTUA 4RUVA 3GX8A 1E2YA 1EV9A 2L59A 5JCUA 1X5EA 2FWFA 3KP9A 2GLRA 1X5CA 3G7JA 3LSZA 3S9FA 4IQAA 3Q19A 4JR4A 1T3BA 2EC4A 2YPMA 3IPZA 4ZBBA 2DSAA 3ZYWA 3NIVA 4HZ4A 4CW9A 2C3QA 4MF5A 3APSA 1SK1A 1OKDA 3GL5A 3ME7A 5ELAA 3HA9A 1M9BA 3HVSA 4GLTA 5CP1A 3GN3A 2F51A 5ECPB 2L5LA 1XWAA 3GSSA 4K7OA 1GTIA 2JADA 2P5RA 4RQRA 2VCQA 5A4UA 3WT1A 2LRNA 5IMZA 1SKSB 3HVVA 4BVXA 1SJZA 4JRRA 4OO5A 3HJOA 3RHBA 11GSA 3QAGA 1ERUA 3V1WA 1QFNA 5EY6A 1FO5A 2WULA 5CAXA 3GHAA 3VI7A 2REMA 2DJ3A 1G0TA 4P3YB 1ILOA 2ES7A 5IOWA 4KW6A 4J57E 4HDEA 1PSQA 2RIIA 3HVXA 4HJ2A 3UVHA 1BG5A 2B7JA 1TRUA 3J7Yb 4L5OA 2IMEA 5ID2B 1MDKA 2I1UA 5H5RA 1TU8A 5DQYA 1SU9A 1A24A 2E7PA 3QDNA 1EV4A 4MZBA 1TRWA 2CT6A 3N9JA 3H93A 2L6DA 1G7EA 1W89A 2H0IA 3FR3A 1K0DA 2BJXA 4MK3A 1Z5YE 1CQHA 2HRNA 3DWVA 2I4AA 1TKDB 3DD3A 1JZDA 5DVBA 5HR1A 2IMIA 3VI5A 3RAZA 3PH9A 2AYTA 1OVNA 1HNAA 5FWGA 3EWLA 2LEGA 2JSYA 2JACA 2PWJA 2YN1A 3A3TA 5AIVA 2C0FA 1AQWA 1USBA 4LMWA 1SKRB 3EVIA 1XW6A 1ML6A 3ED3A 4V2MA 2LQOA 3BBYA 4HQZA 2CX4A 4HOJA 5E4WA 1FW1A 1PL1A 1Z3EA 2DBCA 3M0FA 3ZMKA 5LD0A 2PU9C 5E59A 6GSVA 3IE3A 1BJXA 3DVWA 4I8BA 3Q6OA 4I2TA 4K2DA 4IP6A 2RUEA 2VM2A 1HNCA 3ZVJA 2IN3A 2KOKA 4XS6A 1DUGA 1ZMAA 3ZL5A 3HZ4A 2LJAA 3VK9A 2MMZA 3HJPA 1SL0B 2N5FA 2GQMA 1S3CA 2VD1A 1TK8B 2FHEA 1V2AA 4MF6A 1Z7RA 1K0AA 3HY2A 4TR3A 3GIXA 3IAS2 1HYUA 3UBKA 2F8FA 1OE8A 1H4OA 3VPQA 3QCPA 1WRYA 2ON7A 3FEUA 4DSSA 4Z7XA 2WDUA 2ON5A 2YJHA 4LA1A 4ZB8A 1XBSA 3KMOA 2GDRA 1QUWA 4EL1A 1JHBA 2R2JA 5DDLA 1K0BA 1R26A 3P8WA 3US3A 1K0OA 2R6KA 1QK8A 3EYTA 2VCVA 3G9BA 3KGKA 4V1Ag 3CTGA 1TK0B 3FY7A 4OFNA 2IMDA 1GP1A 4GF0A 3FW2A 1NHYA 4KSOA 8GSSA 3EINA 3F6DA 3DEXA 4GSTA 10GSA 3D0ZA 1XPVA 2OE1A 4MH2A 2YWOA 1GNEA 4ZXGA 1UA5A 4AGSA 1WP0A 12GSA 4NWYA 3I69A 3F4RA 5J4UA 4DSQA 3FRCA 1PRXA 2XBQA 3NOFA 5AGYA 3UAPA 3BCIA 1JFUA 4WETA 1S3DA 2NBSA 4F03A 1YF0A 4HU9A 1OAZA 1GUMA 2LV3A 19GSA 4GSNA 5JCWA 5LNKe 4KAEA 1TU7A 3DMLA 5ECSA 2AV4A 3LYPA 5D96A 5D9WA 3LGCA 3D4TA 3ISOA 1OC3A 3TJFA 2KP2A 2L57A 3UJ1A 3LG6A 3KEBA 1AUCA 1VF4A 1X0RA 3E9JB 3BD2A 3EURA 3QAVA 4HJMA 4RQXA 2G0FA 2VO4A 1GRXA 3C1SA 1XWBA 1O81A 1YQ1A 3IK9A 3WGEA 3BJ5A 3F3QA 5A4WA 3N5OA 6GSUA 1WJKA 4ECCA 4F0BA 1JLVA 3LFLA 5ECMB 3ZZXA 5B7CA 4DSSB 4TRXA 5G1LA 5IM9A 1GLQA 5F06A 4NV5A 2YP6A 4N11A 1XZOA 2R5GA 1YEPA 2ALBA 3EU4A 4I97A 4MH3A 3GFKA 1Z7PA 3GH9A 1KBNA 4ZL9A 5HQPA 3IV4A 4GCIA 4XS4B 1PL2A 2IL3A 1PN9A 1W4VA 4PNGA 1EEJA 1KTEA 3Q74A 3G7IA 1ZYQB 4MDCA 1MD4A 1NM3A 1ZCPA 5IQYA 1ZOFA 1IYHA 1K0NA 3KIJA 4YQMA 2X99A 5DALB 4ZBAA 1R5PA 1U88A 4ZB9A 2OE3A 2NTOA 4ILFA 2XPEA 1XWCA 1SYXA 4TR4A 1UC7A 3GMFA 1FB6A 1ERVA 2F8AA 2GVPA 2KUCA 3QFBC 3A2XA 4ZB6A 2FWHA 3APOA 2YOIA 3EMXA 2HRFA 4F9ZA 2E0QA 3MSZA 1SD8A 1V58A 4ULXA 3I6AA 5EL8A 4MZWA 2RLIA 2LJRA 4KNDA 1TI3A 1V40A 2HI7A 2L4QA 5D93A 4K1FA 1GTBA 3LJRA 2GSTA 3KXOA 4AJ8A 3M3MA 2G2QA 2VL3A 5ELGA 1N2AA 4GRFA 2CVBA 6GSYA 1UN2A 2DJ1A 4ML6A 2B3SA 3QFAC 4X0XA 6GSXA 2EIQA 5CRWA 2XHFA 5KEJA 3TJBA 4ZIJA 2CX3A 2X8GA 2VLVA 1AQVA 2GSRA 1JLWA 2VM1A 3F4SA 4MA9A 4O92A 4ZBDA 1GSQA 1A0RP 1GNWA 5LCZA 3E3EA 4TXOB 2VCXA 3ZTLA 3C7MA 3GSTA 3UMAA 2HXKA 1U6TA 1HNBA 1EOHA 3LWAA 5F05A 2YV9A 3BCKA 5A5KA 2RM5A 3O76A 4N30A 1T7PB 2MBTA 2B1LA 1M9AA 5DJMA 4LLRA 5IMAA 4TOPA 5L71A 4QQ7A 4OCEA 3IC4A 3VFIA 1JZOA 1BEDA 4TN8A 2H8LA 3CYNA 5DQSA 3FK8A 3VLNA 1O7UA 2H71A 3ZLPA 1PKWA 2H76A 2VOCA 2JZRA 3M1GA 2O87A 1ABAA 1OE7A 5GAND 3CRTA 2FUG2 2MYGA 4Q5QA 2HNLA 1SL1B 3TKQA 1TRVA 2WGRA 2FWGA 3ZVJD 3TCOA 20GSA 3TGZA 3F8UA 2JZSA 4KH7A 4JR6A 2WJUA 2GSQA 2MMNA 4Q5FA 4V2LA 1OC8A 2LRCA 4WF5A 1TP9A 4WXTA 2V6KA 4ECBA 2GGTA 1GWCA 4IP1A 4MZCA 1XW9A 1JZWA 2HZEA 4KUNA 4MABA 5G5FA 1JZRA 1EGRA 2JSZA 4IGJA 2XC2A 3P7XA 4QL9A 5ECOB 5B6NA 1C72A 1YZXA 4WEYA 1GL8A 1XCCA 3QOUA 1XVWA 1T4ZA 4NPBA 1SL2B 2P0GA 4K7IA 3O6TA 4TXVA 1UVZA 2M72A 4Q5RA 2YWMA 2HFDA 5AN1A 4GQFA 4K8MA 4WR4A 2GQLA 2H6XA 1WWJA 1YKCA 2K8VA 5GZZB 2LSTA 2WRTA 2FCHA 3DVXA 3VURA 3TRQA 1GSYA 5COHA 1THXA 5HFKA 1PX7A 4KDYA 1E6BA 5F07A 3M8NA 1V98A 3RPPA 2VLTA 1DE2A 2C3TA 1FAAA 4GSSA 3PR8A 4Q5NA 5C00A 1OYJA 1A2JA 4QL7A 4ECIA 4PUFC 4V1Ap 1AC1A 1K3OA 2OBIA 4EUYA 5EVOA 2H1AA 2DLXA 5DCGA 1WOUA 1LJRA 4JU5A 2MBSA 1QMVA 3EU3A 2NDOA 3RDWA 4K6XA 3D22A 5G5EA 3TKPA 3IA1A 2LNSA 4FIWA 3KMNA 4E8EA 5HR3A 4ZL8A 3CMIA 2HZEB 5CRGA 1RW1A 3ME8A 1QGVA 1SENA 4E8HA 2YCDA 2J23A 2GSSA 2HE3A 14GSA 1I5GA 1GSEA 3EE2A 3L9UA 3IDVA 2KHPA 5G1KA 2DMLA 5D9TA 1K0MA 4MF7A 4HZ2A 4BWSA 1U87A 4ECJA 3CSJA 3WGXA 5FT3A 3GKXA 2BTOT 1HQOA 4MJAA 3TOUA 4I5QA 1ZZYA 1EP8A 2QGVA 5DAKA 5J9CA 3TOTA 1XWKA 5ENUA 1PD21 2M80A 2H01A 3F6FA 4F82A 2EIOA 4N0VA 2YZHA 2A4VA 1R4WA 3LXZA 1M0UA 1ON4A 5F0GA 2B5EA 3W8JA 1A0FA 1B4QA 3F63A 1Q98A 3MAKA 1AW9A 2FLSA 1PGTA 4TVEA 3GTUA 4JE1A 3GKMA 1A8YA 4MJCA 2O85A 1VF1A 3EMPA 4DSRA 2GS3A 1O8XA 4HU7A 3TKSE 3IAM2 3H8QA 3DYRA 3KH7A 4ZILA 3A2VA 4NAXA 2WB9A 2X8CA 3J7Yk 4KCEA 3CXGA 4K0GA 2H1BA 2VAFA 4EDYA 1SJIA 3A2WA 3HYPA 4XRDA 1F6MC 4G10A 4EKZA 2HSHA 3GURA 3R2QA 2D2ZA 1TRSA 2PGTA 2DJJA 1FG4A 2A2SA 2GT5A 1X5DA 2VD0A 5HR2A 2AUVA 5GSSA 4F2IA 3UL3A 3G7YA 2E2MA 1AXDA 1O85A 1OC9A 5C04A 4DEJA 2KLXA 1J0FA 2NPBA 16GSA 4FYUA 4MP4A 1CQGA 4G2EA 4ML1A
chains in the Genus database with same CATH superfamily
2EIRA 2HRAA 1SD9A 3GH6A 4XRAA 2JL4A 2V32A 3UVTA 4G0IA 2OJLA 1Z6NA 2YJ7A 6GSTA 3PGTA 2K8SA 5DAKB 4HS1A 3CRUA 4POKA 4ICYA 3UIWA 4K0NA 4D73A 1G7OA 1NW2A 5G2ZA 2Z9SA 1X9WB 4G9HA 1ST9A 1YEXA 5A4VA 4PXOA 5JWQB 1GSFA 5IMDA 5J9BA 3FHKA 2VUPA 1YDKA 5CO3A 1F2EA 4YKFA 2B5XA 1TOFA 1Z6MA 3ZMLA 4H86A 2LQQA 1NSWA 3CTFA 1XFLA 2O8VB 3PPUA 1J08A 1MTCA 4AF2A 3C73A 2IFQA 2GT6A 2FGXA 1WIKA 4IJ3A 3ZRDA 1B9YC 4G19A 1QXHA 5HR0A 2OKAA 1TXXA 2WFCA 4EE0A 2QA1A 1AIUA 2DKIA 1TK5B 4IHUA 3ERFA 3MNGA 4OD7A 2BMXA 2VCZA 2C3NA 2H1DA 1T00A 1ZYEA 5EPFA 1F9MA 4OO4A 3WYWA 2YNXA 3C8EA 4WF4A 1EGOA 1HD2A 2HZFA 3DXBA 3ZIVA 4WBJA 1OC9B 1THOA 1U3AA 5D9XA 3GA4A 1VF3A 3RPNA 1GTAA 2CAIA 2FY6A 4OCFA 4YQVA 1DBYA 4L5LA 3I9V2 4KDXA 4RI7A 3KZQA 2QKEA 2A4HA 2H19A 1T4YA 1F37A 4PGTA 5CNWA 5J5NA 4XCSA 1B48A 2R3XA 3W6GA 3D21A 4HI7A 4NMUA 2YWIA 3I43A 5DCHA 4ZL7A 4MCUA 5GSTA 1M7TA 3FR6A 2H1GA 4PURA 4CHSA 2N5BA 3TRPA 3VWUA 1ERWA 4MMMA 3DGQA 2C4JA 2K18A 4I6XA 4LL4B 2ZCTA 3ERGA 3H79A 1EP7A 4TR1A 2WZ9A 1GULA 2IFQB 5FHIA 4GQCA 1BX9A 2CZ3A 1U3IA 1K3LA 3VWVA 3DIEA 2H66A 2TIRA 1M2AA 3VPTA 4IBPA 2R0CA 4L0UA 3FKFA 4BPYA 5IIZA 4EO3A 4EVMA 2C0DA 2OACA 4N10A 4BA7A 1G6WA 3CSHA 22GSA 1J9BA 4NHWA 2PMTA 1YY7A 2ZNMA 4MJEA 2F9SA 3D5JA 2GZZA 4CDOA 4NV2A 1I9DA 3APQA 5KN1A 5ID2A 4KSMA 5ECKB 3TRXA 4TW5A 3P90A 2CZ2A 3A5WA 3RHCA 1O73A 4DVCA 1B9XC 2JU5A 2VIMA 4FQUA 4BWQA 4LMVA 1YKAA 3JCML 2WCIA 4POLA 1GSDA 2H70A 1SK0A 2HSYA 4J2FA 2XBIA 1MDJA 2DC5A 4O7HA 1ACVA 5HFGA 3F4TA 3E0UA 2PERA 3GKNA 4POBA 5JWRB 4IVFA 3L9SA 4PTSA 1AQXA 1O8WA 1MDIA 5ECNB 2V2GA 2CAQA 1WMJA 1AAZA 5CRHA 3DRNA 3FMWA 2H0HA 4MPFA 5IO0A 2LS5A 4G0LA 4CY6A 1GUHA 3UOMA 4BL7A 2LJKA 3TJJA 4PQHA 4TR1B 1GUKA 5HFIA 3TJGA 6GSSA 5H5QA 1Y6EA 2VL9A 3TDGA 3HJMA 2N5AA 3UEMA 4GWRA 5IMVA 4HUAA 1GSUA 3IXRA 3ZREA 1XWGA 2DMMA 1SYRA 2QC7A 1X9SB 1LBKA 4WBRD 2VCTA 5KN2A 3ZFLA 2TRXA 2K9FA 3IK7A 2PVOC 2DJ0A 3UBLA 4FO5A 4OMVA 3RBTA 4FH8A 4EIQA 1BQ7A 2H6YA 2MMAA 2AHEA 2CV4A 5IMFA 1GH2A 4MNNA 1GLPA 3QPMA 2GZPA 1V9WA 3HXSA 3CSIA 3GKKA 2CA8A 3KM6A 1VGLA 2X64A 1EWXA 1BYEA 4NXIA 1VRSD 4NHZA 1SKWB 2RM6A 3HZ8A 3UARA 1X9MB 1DE1A 4MJBA 2P31A 3VWXA 17GSA 2FA4A 1S3RA 3TKRA 1FHEA 2C0GA 4F0CA 4O32A 3TJKA 5J3RA 2DIZA 2V1MA 4IELA 1XVQA 2H73A 3AY8A 2VLUA 1S3AA 3BOAA 4MLYA 2H6ZA 3TKSA 5ABRA 2GQKA 5IO2A 1Q4JA 2R0GA 4XHMA 2HSMA 2FNOA 1KEBA 3QD9A 3IBHA 1R5AA 3L9VA 4BIKA 3C1RA 1B8XA 4L8EA 4BL7B 1MEKA 4V2NA 4OWYA 3IR4A 2OE0A 3LORA 1T1VA 2IJYA 5JCGA 2DJ2A 3D6IA 18GSA 3WD6A 2MZCA 4KGIA 3LEFA 5IOXA 2JZTA 1PA3A 2X8HA 3WGDA 3OR5A 4TKYA 3VWWA 2FWEA 5J41A 3DKSA 5AIXA 3SBCA 2V41A 2HLSA 3GV1A 2V6OA 2IPAA 3NZNA 1XOAA 1EZKA 4OFMA 2GTUA 2LUSA 3U6VA 2I3YA 1ZL9A 13GSA 1QQ2A 1PFOA 2PN8A 2YV7A 4MPGA 4JZQA 4YH2A 4J56E 4KA0A 3F9UA 2OA7A 1Z9HA 1XXUA 3LXTA 5ECQB 1FVKA 2YZUA 1H75A 3D4MA 3F3RA 2H74A 4OFTA 2CVDA 4KDUA 7GSSA 2H30A 3A5IA 2C80A 4XS4A 3TUEA 2O89A 4AJ7A 1TJDA 2XPDA 5IPGA 5D73A 1URMA 2OBKA 3FZ5A 3PINA 4YQUA 4IN0A 5AISA 3HDCA 4ID0A 1DSBA 3SWLA 1XIYA 2VCWA 5H5SA 1K3YA 2O7KA 2C8UA 5KN0A 4FYBA 3W8SA 5B8AA 1R7HA 3TKSC 5G31A 2LRTA 4K9ZA 2TRCP 2LTKA 5DALA 5F8BA 2H0GA 2PBJA 5KOWA 1EOGA 2LNTA 1SJ6A 1FVJA 3HD5A 4EC0A 2R4VA 3KJYA 2I81A 2F3MA 4JEDA 5G30A 3QR6A 3ERWA 4USSA 4KB3A 2HYXA 2MMOA 2YWNA 2C0EA 4XS1A 1M99A 1A8LA 2P5QA 4IQ1A 3GYKA 2DJKA 3ZFBA 2FA8A 4IKHA 3LYKA 4ISDA 2M46A 3O3TA 2AAWA 3HHVA 2HT9A 3FYGA 2R37A 2J9HA 6GSWA 4LL1B 5JWOB 1PKZA 1M2DA 1IYIA 1O6JA 4K7NA 3FZAA 1K0CA 1FB0A 1F3AA 2DIYA 2B5YA 4IJIA 2PVQA 4O5QA 3KH9A 4HEA2 1YF1A 4IS0A 2L5OA 4KCAA 1KNGA 4GXZA 2H72A 2A2RA 4EXJA 3GTUB 3LQ7A 3L4NA 4KE3A 4X43A 3EC3A 1EEMA 2B6MA 4KX4A 2PUKC 3MWHA 5BRTA 3ZIJA 4BVYA 1A2MA 2B7KA 4N0ZA 2ZUPA 3GL3A 5CRDA 1MD3A 2RUFA 3M9JA 3IRAA 4YAVA 3CBUA 5D8IA 4O5RA 1GTUA 1PMTA 4FYCA 2IIYA 4L0WA 4YAPA 2PPTA 3H4KA 3L0HA 3KTBA 5DJLA 4XIHA 5CREA 3HCZA 4TXOA 3P2AA 3IOSA 5KN3A 3GNJA 1T8EB 2AB6A 5ECRB 4HQSA 1RK4A 2KP1A 4O5UA 2VL2A 3GX0A 2OADA 4EF0A 1TTZA 3GUSA 4Z2TA 2L6CA 1WE0A 4PX1A 4I2UA 3FZ4A 3IHQA 2B1KA 5IPHA 2C1YA 3MDKA 4RI6A 1RQMA 4PNFA 1SK2A 5B8BA 9GSSA 3C71A 3FR9A 1G6YA 4JBBA 3KCMA 1XOBA 3H1NA 4POMA 2IMKA 4PQIA 4EDZA 1TDIA 5B6MA 1BAYA 4PQ1A 1TI1A 1XW5A 3LW9A 3M9KA 4TR0A 1PQNA 2H75A 4D73B 1V57A 5GAPD 3WT2A 4PUAA 1WPIA 2NVLA 3HKRA 3L78A 1A2LA 3ZITA 2IWTA 3F0IA 2CVKA 3Q18A 5INYA 5ECLB 1NHOA 3MYDA 1FOVA 3KD0A 5DBQA 1PX6A 5CYYA 2GZYA 5D9VA 2LKUA 1TW9A 3IHGA 2IMFA 2CQ9A 4BVYB 1M2BA 3KTLA 2WS2A 2YANA 3CQFA 2QSIA 1A23A 4WKWA 4IW9A 2FD3A 1Y25A 3GRXA 1OKTA 4AJ6A 3TB2A 1YJ6A 2K6VA 2L4CA 3KP8A 3K8NA 4WR5A 2HRKA 1VF2A 3U5RE 4XTSA 1F3BA 2AJQB 2E2GA 3QAWA 1GSSA 2VL2C 1ZGNA 4X1UA 1B4PA 1N8JA 5IMCA 1LU4A 3FZ9A 3QMXA 1ERTA 5ECIB 4ACSA 2I9HA 5ECHB 4GTUA 4RUVA 3GX8A 1E2YA 1EV9A 2L59A 5JCUA 1X5EA 2FWFA 5BMUA 3KP9A 2GLRA 1X5CA 3G7JA 3LSZA 3S9FA 4HSCX 4IQAA 3Q19A 4JR4A 1T3BA 2EC4A 2YPMA 3IPZA 4ZBBA 2DSAA 3ZYWA 3NIVA 4HZ4A 4CW9A 2C3QA 4MF5A 3APSA 1SK1A 1OKDA 3GL5A 3ME7A 5ELAA 3HA9A 1M9BA 3HVSA 4GLTA 5CP1A 3GN3A 2F51A 5ECPB 2L5LA 1XWAA 3GSSA 4K7OA 1GTIA 2JADA 2P5RA 4RQRA 2VCQA 5A4UA 3WT1A 2LRNA 5IMZA 1SKSB 3HVVA 4BVXA 1SJZA 4JRRA 4OO5A 3HJOA 3RHBA 11GSA 3QAGA 1ERUA 3V1WA 1QFNA 5EY6A 1FO5A 2WULA 5CAXA 3GHAA 3VI7A 2REMA 2DJ3A 1G0TA 4P3YB 1ILOA 2ES7A 5IOWA 4KW6A 4J57E 4HDEA 1PSQA 2RIIA 3HVXA 4HJ2A 3UVHA 1BG5A 2B7JA 1TRUA 3J7Yb 4L5OA 2IMEA 5ID2B 1MDKA 2I1UA 5H5RA 1TU8A 5DQYA 1SU9A 1A24A 2E7PA 1ZYNA 3QDNA 1EV4A 4MZBA 1TRWA 2CT6A 3N9JA 3H93A 2L6DA 1G7EA 1W89A 2H0IA 3FR3A 1K0DA 2BJXA 4MK3A 1Z5YE 1CQHA 2HRNA 3DWVA 2I4AA 1TKDB 3DD3A 1JZDA 5DVBA 5HR1A 2IMIA 3VI5A 3RAZA 3PH9A 1XG8A 4K5RA 2AYTA 1OVNA 1HNAA 5FWGA 3EWLA 2LEGA 2JSYA 2JACA 2PWJA 2YN1A 3A3TA 5AIVA 2C0FA 1AQWA 1USBA 4LMWA 1SKRB 3EVIA 1XW6A 1ML6A 3ED3A 4V2MA 2LQOA 3BBYA 4HQZA 2CX4A 4HOJA 5E4WA 1FW1A 1PL1A 1Z3EA 2DBCA 3M0FA 3ZMKA 5LD0A 2PU9C 5E59A 6GSVA 3IE3A 1BJXA 3DVWA 4I8BA 3Q6OA 4I2TA 4K2DA 4IP6A 2RUEA 2VM2A 1HNCA 3ZVJA 2IN3A 2KOKA 4XS6A 1DUGA 1ZMAA 3ZL5A 3HZ4A 2LJAA 3VK9A 2MMZA 3HJPA 1SL0B 2N5FA 2GQMA 1S3CA 2VD1A 4X4JA 1TK8B 2FHEA 1V2AA 4MF6A 1Z7RA 3IC8A 1K0AA 3HY2A 4TR3A 1M3IA 3IAS2 3GIXA 1HYUA 3UBKA 2F8FA 1OE8A 1H4OA 3VPQA 3QCPA 1WRYA 2ON7A 3FEUA 4DSSA 4Z7XA 2WDUA 2ON5A 2YJHA 4LA1A 4ZB8A 1XBSA 3KMOA 2GDRA 1QUWA 4EL1A 1JHBA 2R2JA 5DDLA 1K0BA 1R26A 3P8WA 3US3A 1K0OA 2R6KA 1QK8A 3EYTA 2VCVA 3G9BA 3KGKA 4V1Ag 3CTGA 1TK0B 3EPTA 3FY7A 4OFNA 2IMDA 1GP1A 4GF0A 3FW2A 1NHYA 4KSOA 8GSSA 3EINA 3F6DA 3DEXA 4GSTA 10GSA 3D0ZA 1XPVA 2OE1A 4MH2A 2YWOA 1GNEA 4ZXGA 1UA5A 1ZYPA 4AGSA 1WP0A 12GSA 4NWYA 3I69A 3F4RA 5J4UA 4DSQA 3FRCA 1PRXA 2XBQA 3NOFA 5AGYA 3UAPA 3BCIA 1JFUA 4WETA 1S3DA 2NBSA 4F03A 1YF0A 4HU9A 1OAZA 1GUMA 2LV3A 19GSA 4GSNA 5JCWA 5LNKe 4KAEA 1TU7A 3DMLA 5ECSA 2AV4A 3LYPA 5D96A 5D9WA 3LGCA 3D4TA 3ISOA 1OC3A 3TJFA 2KP2A 2L57A 3UJ1A 3LG6A 3KEBA 1AUCA 1VF4A 1X0RA 3E9JB 3BD2A 3EURA 3QAVA 4HJMA 2UZ8A 4RQXA 2G0FA 2VO4A 1GRXA 3C1SA 1XWBA 1O81A 1YQ1A 3IK9A 3WGEA 3BJ5A 3F3QA 5A4WA 3N5OA 6GSUA 1WJKA 4ECCA 4F0BA 1JLVA 3LFLA 5ECMB 3ZZXA 5B7CA 4DSSB 4TRXA 5G1LA 5IM9A 1GLQA 5F06A 4NV5A 2YP6A 4N11A 1XZOA 2R5GA 1YEPA 2ALBA 3EU4A 4I97A 4MH3A 3GFKA 1Z7PA 3GH9A 1KBNA 4ZL9A 5HQPA 3IV4A 4GCIA 4XS4B 1PL2A 2IL3A 1PN9A 4EIPA 1W4VA 4Z2RA 4PNGA 1EEJA 1KTEA 3Q74A 3G7IA 1ZYQB 4MDCA 1MD4A 1NM3A 1ZCPA 5IQYA 1ZOFA 1IYHA 4G0KA 1K0NA 3KIJA 4YQMA 2X99A 5DALB 4ZBAA 1R5PA 1U88A 4ZB9A 2OE3A 2NTOA 4ILFA 2XPEA 4KF9A 1XWCA 1SYXA 4TR4A 1UC7A 3GMFA 1FB6A 1ERVA 2F8AA 2GVPA 2KUCA 3QFBC 3A2XA 4ZB6A 2FWHA 3APOA 2YOIA 3EMXA 2HRFA 4F9ZA 2E0QA 3MSZA 1SD8A 1V58A 4ULXA 3I6AA 5EL8A 4MZWA 2RLIA 2LJRA 4KNDA 1TI3A 1V40A 2HI7A 2L4QA 5D93A 4K1FA 1GTBA 3LJRA 2GSTA 3KXOA 4AJ8A 3M3MA 2G2QA 2VL3A 5ELGA 4A5PA 1N2AA 4GRFA 2CVBA 6GSYA 1UN2A 2DJ1A 4ML6A 2B3SA 3QFAC 4X0XA 6GSXA 2EIQA 5CRWA 2XHFA 5KEJA 3TJBA 4ZIJA 2CX3A 2X8GA 2VLVA 1AQVA 2GSRA 1JLWA 2VM1A 3F4SA 4MA9A 1FOHA 4O92A 2QA2A 4ZBDA 1GSQA 1A0RP 1GNWA 5LCZA 2X4AA 3E3EA 4TXOB 2VCXA 3ZTLA 3C7MA 3GSTA 3UMAA 5KOXA 2HXKA 1U6TA 1HNBA 1EOHA 3LWAA 5F05A 2YV9A 3BCKA 5A5KA 2RM5A 3O76A 4N30A 1T7PB 2MBTA 2B1LA 1M9AA 5DJMA 2R0PA 4LLRA 5IMAA 4TOPA 5L71A 4QQ7A 4OCEA 3IC4A 3VFIA 1JZOA 1BEDA 4TN8A 2H8LA 3CYNA 5DQSA 3FK8A 3VLNA 1O7UA 2H71A 3ZLPA 1PKWA 2H76A 2VOCA 2JZRA 3M1GA 2O87A 1ABAA 1OE7A 5GAND 3CRTA 2FUG2 2MYGA 1PN0A 4Q5QA 2HNLA 1SL1B 3TKQA 1TRVA 4Z2UA 2WGRA 2FWGA 3ZVJD 3TCOA 20GSA 3TGZA 3F8UA 2X49A 2JZSA 4KH7A 4JR6A 2WJUA 2GSQA 3MIXA 2MMNA 4Q5FA 4V2LA 1OC8A 2LRCA 4K2XA 4WF5A 1M3JA 1TP9A 4WXTA 4K5SA 2V6KA 4ECBA 2GGTA 1GWCA 4IP1A 4MZCA 1XW9A 1JZWA 2HZEA 4KUNA 4MABA 5G5FA 3HVNA 1JZRA 1EGRA 2JSZA 4IGJA 2XC2A 3P7XA 4QL9A 5ECOB 5B6NA 1C72A 1YZXA 4WEYA 1GL8A 1XCCA 3QOUA 1XVWA 1T4ZA 4NPBA 1SL2B 2P0GA 4K7IA 3O6TA 4TXVA 1UVZA 2M72A 4Q5RA 2YWMA 2HFDA 5AN1A 4GQFA 4K8MA 4WR4A 2GQLA 2H6XA 1WWJA 1YKCA 2K8VA 5GZZB 2LSTA 2WRTA 2FCHA 3DVXA 3VURA 3TRQA 1GSYA 5COHA 1THXA 5HFKA 1PX7A 4KDYA 1E6BA 5F07A 3M8NA 2DKHA 1V98A 3RPPA 2VLTA 1DE2A 2C3TA 1FAAA 4GSSA 3PR8A 4Q5NA 5C00A 1OYJA 1A2JA 4QL7A 4ECIA 4PUFC 4V1Ap 1AC1A 1K3OA 2OBIA 4EUYA 5EVOA 2H1AA 2DLXA 5DCGA 1WOUA 1LJRA 4JU5A 2MBSA 1QMVA 3EU3A 2NDOA 4CY8A 3RDWA 4K6XA 3D22A 5G5EA 3TKPA 3IA1A 2LNSA 4FIWA 4BVXB 3KMNA 4E8EA 5HR3A 4ZL8A 3CMIA 2HZEB 5CRGA 1RW1A 3ME8A 1QGVA 1SENA 4E8HA 2YCDA 2J23A 2GSSA 2HE3A 14GSA 1I5GA 1GSEA 3EE2A 3L9UA 3IDVA 2KHPA 5G1KA 2DMLA 5D9TA 1K0MA 4MF7A 4HZ2A 4BWSA 1U87A 4ECJA 3CSJA 3WGXA 5FT3A 3GKXA 4YKGA 2BTOT 1HQOA 4MJAA 3TOUA 4I5QA 1ZZYA 1EP8A 2QGVA 5DAKA 5J9CA 3TOTA 1XWKA 5ENUA 1PD21 2M80A 2H01A 3F6FA 4F82A 2EIOA 4N0VA 2YZHA 2A4VA 1R4WA 3LXZA 1M0UA 1ON4A 5F0GA 2B5EA 3W8JA 2A2PA 1A0FA 1B4QA 3F63A 1Q98A 3MAKA 1AW9A 2FLSA 1PGTA 4TVEA 3GTUA 4JE1A 3GKMA 1A8YA 4MJCA 2O85A 1VF1A 3R3EA 3EMPA 4DSRA 2GS3A 1O8XA 4HU7A 3TKSE 3IAM2 3H8QA 3DYRA 3KH7A 4ZILA 3A2VA 4NAXA 2WB9A 2X8CA 3J7Yk 4KCEA 3CXGA 4K0GA 2H1BA 2VAFA 4EDYA 1SJIA 3A2WA 3HYPA 4XRDA 1F6MC 4G10A 4EKZA 2HSHA 3GURA 3R2QA 2D2ZA 1TRSA 2PGTA 2DJJA 1FG4A 2A2SA 2GT5A 1X5DA 2VD0A 5HR2A 2AUVA 5GSSA 4F2IA 3UL3A 3G7YA 2E2MA 1AXDA 1O85A 1OC9A 5C04A 4DEJA 2KLXA 1J0FA 2NPBA 16GSA 4FYUA 4MP4A 1CQGA 4G2EA 4ML1A
chains in the Genus database with same CATH topology
2EIRA 2HRAA 1SD9A 3GH6A 4XRAA 2JL4A 2V32A 3UVTA 4G0IA 2OJLA 1Z6NA 2YJ7A 6GSTA 3PGTA 2K8SA 5DAKB 4HS1A 3CRUA 4POKA 4ICYA 3UIWA 4K0NA 4D73A 1G7OA 1NW2A 5G2ZA 2Z9SA 1X9WB 4G9HA 1ST9A 1YEXA 5A4VA 4PXOA 5JWQB 1GSFA 5IMDA 5J9BA 3FHKA 2VUPA 1YDKA 5CO3A 1F2EA 4YKFA 2B5XA 1TOFA 1Z6MA 3ZMLA 4H86A 2LQQA 1NSWA 3CTFA 1XFLA 2O8VB 3PPUA 1J08A 1MTCA 4AF2A 3C73A 2IFQA 2GT6A 2FGXA 1WIKA 4IJ3A 3ZRDA 1B9YC 4G19A 1QXHA 5HR0A 2OKAA 1TXXA 2WFCA 4EE0A 2QA1A 1AIUA 2DKIA 1TK5B 4IHUA 3ERFA 3MNGA 4OD7A 2BMXA 2VCZA 2C3NA 2H1DA 1T00A 1ZYEA 5EPFA 1F9MA 4OO4A 3WYWA 2YNXA 3C8EA 4WF4A 1EGOA 1HD2A 2HZFA 3DXBA 3ZIVA 4WBJA 1OC9B 1THOA 1U3AA 5D9XA 3GA4A 1VF3A 3RPNA 1GTAA 2CAIA 2FY6A 4OCFA 4YQVA 1DBYA 4L5LA 3I9V2 4KDXA 4RI7A 3KZQA 2QKEA 2A4HA 2H19A 1T4YA 1F37A 4PGTA 5CNWA 5J5NA 4XCSA 1B48A 2R3XA 3W6GA 3D21A 4HI7A 4NMUA 2YWIA 3I43A 5DCHA 4ZL7A 4MCUA 5GSTA 1M7TA 3FR6A 2H1GA 4PURA 4CHSA 2N5BA 3TRPA 3VWUA 1ERWA 4MMMA 3DGQA 2C4JA 2K18A 4I6XA 4LL4B 2ZCTA 3ERGA 3H79A 1EP7A 4TR1A 2WZ9A 1GULA 2IFQB 5FHIA 4GQCA 1BX9A 2CZ3A 1U3IA 1K3LA 3VWVA 3DIEA 2H66A 2TIRA 1M2AA 3VPTA 4IBPA 2R0CA 4L0UA 3FKFA 4BPYA 5IIZA 4EO3A 4EVMA 2C0DA 2OACA 4N10A 4BA7A 1G6WA 3CSHA 22GSA 1J9BA 4NHWA 2PMTA 1YY7A 2ZNMA 4MJEA 2F9SA 3D5JA 2GZZA 4CDOA 4NV2A 1I9DA 3APQA 5KN1A 5ID2A 4KSMA 5ECKB 3TRXA 4TW5A 3P90A 2CZ2A 3A5WA 3RHCA 1O73A 4DVCA 1B9XC 2JU5A 2VIMA 4FQUA 4BWQA 4LMVA 1YKAA 3JCML 2WCIA 4POLA 1GSDA 2H70A 1SK0A 2HSYA 4J2FA 2XBIA 1MDJA 2DC5A 4O7HA 1ACVA 5HFGA 3F4TA 3E0UA 2PERA 3GKNA 4POBA 5JWRB 4IVFA 3L9SA 4PTSA 1AQXA 1O8WA 1MDIA 5ECNB 2V2GA 2CAQA 1WMJA 1AAZA 5CRHA 3DRNA 3FMWA 2H0HA 4MPFA 5IO0A 2LS5A 4G0LA 4CY6A 1GUHA 3UOMA 4BL7A 2LJKA 3TJJA 4PQHA 4TR1B 1GUKA 5HFIA 3TJGA 6GSSA 5H5QA 1Y6EA 2VL9A 3TDGA 3HJMA 2N5AA 3UEMA 4GWRA 5IMVA 4HUAA 1GSUA 3IXRA 3ZREA 1XWGA 2DMMA 1SYRA 2QC7A 1X9SB 1LBKA 4WBRD 2VCTA 5KN2A 3ZFLA 2TRXA 2K9FA 3IK7A 2PVOC 2DJ0A 3UBLA 4FO5A 4OMVA 3RBTA 4FH8A 4EIQA 1BQ7A 2H6YA 2MMAA 2AHEA 2CV4A 5IMFA 1GH2A 4MNNA 1GLPA 3QPMA 2GZPA 1V9WA 3HXSA 3CSIA 3GKKA 2CA8A 3KM6A 1VGLA 2X64A 1EWXA 1BYEA 4NXIA 1VRSD 4NHZA 1SKWB 2RM6A 3HZ8A 3UARA 1X9MB 1DE1A 4MJBA 2P31A 3VWXA 17GSA 2FA4A 3TKRA 1FHEA 2C0GA 4F0CA 4O32A 3TJKA 5J3RA 2DIZA 2V1MA 4IELA 1XVQA 2H73A 3AY8A 2VLUA 1S3AA 3BOAA 4MLYA 2H6ZA 3TKSA 5ABRA 2GQKA 5IO2A 1Q4JA 2R0GA 4XHMA 2HSMA 2FNOA 1KEBA 3QD9A 3IBHA 1R5AA 3L9VA 3C1RA 1B8XA 4L8EA 4BL7B 1MEKA 4V2NA 4OWYA 3IR4A 2OE0A 3LORA 1T1VA 2IJYA 5JCGA 2DJ2A 3D6IA 18GSA 3WD6A 2MZCA 4KGIA 3LEFA 5IOXA 2JZTA 1PA3A 2X8HA 3WGDA 3OR5A 4TKYA 3VWWA 2FWEA 5J41A 3DKSA 5AIXA 3SBCA 2V41A 2HLSA 3GV1A 2V6OA 2IPAA 3NZNA 1XOAA 1EZKA 4OFMA 2GTUA 2LUSA 3U6VA 2I3YA 1ZL9A 13GSA 1QQ2A 2PN8A 2YV7A 4MPGA 4JZQA 4YH2A 4J56E 4KA0A 3F9UA 2OA7A 1Z9HA 1XXUA 3LXTA 5ECQB 1FVKA 2YZUA 1H75A 3D4MA 3F3RA 2H74A 4OFTA 2CVDA 4KDUA 7GSSA 2H30A 3A5IA 2C80A 4XS4A 3TUEA 2O89A 4AJ7A 1TJDA 2XPDA 5IPGA 5D73A 1URMA 2OBKA 3FZ5A 3PINA 4YQUA 4IN0A 5AISA 3HDCA 4ID0A 1DSBA 3SWLA 1XIYA 2VCWA 5H5SA 1K3YA 2O7KA 2C8UA 5KN0A 4FYBA 3W8SA 5B8AA 1R7HA 3TKSC 5G31A 2LRTA 4K9ZA 2TRCP 2LTKA 5DALA 5F8BA 2H0GA 2PBJA 5KOWA 1EOGA 2LNTA 1SJ6A 1FVJA 3HD5A 4EC0A 2R4VA 3KJYA 2I81A 2F3MA 4JEDA 5G30A 3QR6A 3ERWA 4USSA 4KB3A 2HYXA 2MMOA 2YWNA 2C0EA 4XS1A 1M99A 1A8LA 2P5QA 4IQ1A 3GYKA 2DJKA 3ZFBA 2FA8A 4IKHA 3LYKA 4ISDA 2M46A 3O3TA 2AAWA 3HHVA 2HT9A 3FYGA 2R37A 2J9HA 6GSWA 4LL1B 5JWOB 1PKZA 1M2DA 1IYIA 1O6JA 4K7NA 3FZAA 1K0CA 1FB0A 1F3AA 2DIYA 2B5YA 4IJIA 2PVQA 4O5QA 3KH9A 4HEA2 1YF1A 4IS0A 2L5OA 4KCAA 1KNGA 4GXZA 2H72A 2A2RA 4EXJA 3GTUB 3LQ7A 3L4NA 4KE3A 4X43A 3EC3A 1EEMA 2B6MA 4KX4A 2PUKC 3MWHA 5BRTA 3ZIJA 4BVYA 1A2MA 2B7KA 4N0ZA 2ZUPA 3GL3A 5CRDA 1MD3A 2RUFA 3M9JA 3IRAA 4YAVA 3CBUA 5D8IA 4O5RA 1GTUA 1PMTA 4FYCA 2IIYA 4L0WA 4YAPA 2PPTA 3H4KA 3L0HA 3KTBA 5DJLA 4XIHA 5CREA 3HCZA 4TXOA 3P2AA 3IOSA 5KN3A 3GNJA 1T8EB 2AB6A 5ECRB 4HQSA 1RK4A 2KP1A 4O5UA 2VL2A 3GX0A 2OADA 4EF0A 1TTZA 3GUSA 4Z2TA 2L6CA 1WE0A 4PX1A 4I2UA 3FZ4A 3IHQA 2B1KA 5IPHA 2C1YA 3MDKA 4RI6A 1RQMA 4PNFA 1SK2A 5B8BA 9GSSA 3C71A 3FR9A 1G6YA 4JBBA 3KCMA 1XOBA 3H1NA 4POMA 2IMKA 4PQIA 4EDZA 1TDIA 5B6MA 1BAYA 4PQ1A 1TI1A 1XW5A 3LW9A 3M9KA 4TR0A 1PQNA 2H75A 4D73B 1V57A 5GAPD 3WT2A 4PUAA 1WPIA 2NVLA 3HKRA 3L78A 1A2LA 3ZITA 2IWTA 3F0IA 2CVKA 3Q18A 5INYA 5ECLB 1NHOA 3MYDA 1FOVA 3KD0A 5DBQA 1PX6A 5CYYA 2GZYA 5D9VA 2LKUA 1TW9A 3IHGA 2IMFA 2CQ9A 4BVYB 1M2BA 3KTLA 2WS2A 2YANA 2QSIA 1A23A 4WKWA 4IW9A 2FD3A 1Y25A 3GRXA 1OKTA 4AJ6A 3TB2A 1YJ6A 2K6VA 2L4CA 3KP8A 3K8NA 4WR5A 2HRKA 1VF2A 3U5RE 4XTSA 1F3BA 2AJQB 2E2GA 3QAWA 1GSSA 2VL2C 1ZGNA 4X1UA 1B4PA 1N8JA 5IMCA 1LU4A 3FZ9A 3QMXA 1ERTA 5ECIB 4ACSA 2I9HA 5ECHB 4GTUA 4RUVA 3GX8A 1E2YA 1EV9A 2L59A 5JCUA 1X5EA 2FWFA 5BMUA 3KP9A 2GLRA 1X5CA 3G7JA 3LSZA 3S9FA 4IQAA 3Q19A 4JR4A 1T3BA 2EC4A 2YPMA 3IPZA 4ZBBA 2DSAA 3ZYWA 3NIVA 4HZ4A 4CW9A 2C3QA 4MF5A 3APSA 1SK1A 1OKDA 3GL5A 3ME7A 5ELAA 3HA9A 1M9BA 3HVSA 4GLTA 5CP1A 3GN3A 2F51A 5ECPB 2L5LA 1XWAA 3GSSA 4K7OA 1GTIA 2JADA 2P5RA 4RQRA 2VCQA 5A4UA 3WT1A 2LRNA 5IMZA 1SKSB 3HVVA 4BVXA 1SJZA 4JRRA 4OO5A 3HJOA 3RHBA 11GSA 3QAGA 1ERUA 3V1WA 1QFNA 5EY6A 1FO5A 2WULA 5CAXA 3GHAA 3VI7A 2REMA 2DJ3A 1G0TA 4P3YB 1ILOA 2ES7A 5IOWA 4KW6A 4J57E 4HDEA 1PSQA 2RIIA 3HVXA 4HJ2A 3UVHA 1BG5A 2B7JA 1TRUA 3J7Yb 4L5OA 2IMEA 5ID2B 1MDKA 2I1UA 5H5RA 1TU8A 5DQYA 1SU9A 1A24A 2E7PA 1ZYNA 3QDNA 1EV4A 4MZBA 1TRWA 2CT6A 3N9JA 3H93A 2L6DA 1G7EA 1W89A 2H0IA 3FR3A 1K0DA 2BJXA 4MK3A 1Z5YE 1CQHA 2HRNA 3DWVA 2I4AA 1TKDB 3DD3A 1JZDA 5DVBA 5HR1A 2IMIA 3VI5A 3RAZA 3PH9A 4K5RA 2AYTA 1OVNA 1HNAA 5FWGA 3EWLA 2LEGA 2JSYA 2JACA 2PWJA 2YN1A 3A3TA 5AIVA 2C0FA 1AQWA 1USBA 4LMWA 1SKRB 3EVIA 1XW6A 1ML6A 3ED3A 4V2MA 2LQOA 3BBYA 4HQZA 2CX4A 4HOJA 5E4WA 1FW1A 1PL1A 1Z3EA 2DBCA 3M0FA 3ZMKA 5LD0A 2PU9C 5E59A 6GSVA 3IE3A 1BJXA 3DVWA 4I8BA 3Q6OA 4I2TA 4K2DA 4IP6A 2RUEA 2VM2A 1HNCA 3ZVJA 2IN3A 2KOKA 4XS6A 1DUGA 1ZMAA 3ZL5A 3HZ4A 2LJAA 3VK9A 2MMZA 3HJPA 1SL0B 2N5FA 2GQMA 1S3CA 2VD1A 4X4JA 1TK8B 2FHEA 1V2AA 4MF6A 1Z7RA 3IC8A 1K0AA 3HY2A 4TR3A 3GIXA 3IAS2 1HYUA 3UBKA 2F8FA 1OE8A 1H4OA 3VPQA 3QCPA 1WRYA 2ON7A 3FEUA 4DSSA 4Z7XA 2WDUA 2ON5A 2YJHA 4LA1A 4ZB8A 1XBSA 3KMOA 2GDRA 1QUWA 4EL1A 1JHBA 2R2JA 5DDLA 1K0BA 1R26A 3P8WA 3US3A 1K0OA 2R6KA 1QK8A 3EYTA 2VCVA 3G9BA 3KGKA 4V1Ag 3CTGA 1TK0B 3EPTA 3FY7A 4OFNA 2IMDA 1GP1A 4GF0A 3FW2A 1NHYA 4KSOA 8GSSA 3EINA 3F6DA 3DEXA 4GSTA 10GSA 3D0ZA 1XPVA 2OE1A 4MH2A 2YWOA 1GNEA 4ZXGA 1UA5A 1ZYPA 4AGSA 1WP0A 12GSA 4NWYA 3I69A 3F4RA 5J4UA 4DSQA 3FRCA 1PRXA 2XBQA 3NOFA 5AGYA 3UAPA 3BCIA 1JFUA 4WETA 1S3DA 2NBSA 4F03A 1YF0A 4HU9A 1OAZA 1GUMA 2LV3A 19GSA 4GSNA 5JCWA 5LNKe 4KAEA 1TU7A 3DMLA 5ECSA 2AV4A 3LYPA 5D96A 5D9WA 3LGCA 3D4TA 3ISOA 1OC3A 3TJFA 2KP2A 2L57A 3UJ1A 3LG6A 3KEBA 1AUCA 1VF4A 1X0RA 3E9JB 3BD2A 3EURA 3QAVA 4HJMA 2UZ8A 4RQXA 2G0FA 2VO4A 1GRXA 3C1SA 1XWBA 1O81A 1YQ1A 3IK9A 3WGEA 3BJ5A 3F3QA 5A4WA 3N5OA 6GSUA 1WJKA 4ECCA 4F0BA 1JLVA 3LFLA 5ECMB 3ZZXA 5B7CA 4DSSB 4TRXA 5G1LA 5IM9A 1GLQA 5F06A 4NV5A 2YP6A 4N11A 1XZOA 2R5GA 1YEPA 2ALBA 3EU4A 4I97A 4MH3A 3GFKA 1Z7PA 3GH9A 1KBNA 4ZL9A 5HQPA 3IV4A 4GCIA 4XS4B 1PL2A 2IL3A 1PN9A 4EIPA 1W4VA 4Z2RA 4PNGA 1EEJA 1KTEA 3Q74A 3G7IA 1ZYQB 4MDCA 1MD4A 1NM3A 1ZCPA 5IQYA 1ZOFA 1IYHA 4G0KA 1K0NA 3KIJA 4YQMA 2X99A 5DALB 4ZBAA 1R5PA 1U88A 4ZB9A 2OE3A 2NTOA 4ILFA 2XPEA 4KF9A 1XWCA 1SYXA 4TR4A 1UC7A 3GMFA 1FB6A 1ERVA 2F8AA 2GVPA 2KUCA 3QFBC 3A2XA 4ZB6A 2FWHA 3APOA 2YOIA 3EMXA 2HRFA 4F9ZA 2E0QA 3MSZA 1SD8A 1V58A 4ULXA 3I6AA 5EL8A 4MZWA 2RLIA 2LJRA 4KNDA 1TI3A 1V40A 2HI7A 2L4QA 5D93A 4K1FA 1GTBA 3LJRA 2GSTA 3KXOA 4AJ8A 3M3MA 2G2QA 2VL3A 5ELGA 4A5PA 1N2AA 4GRFA 2CVBA 6GSYA 1UN2A 2DJ1A 4ML6A 2B3SA 3QFAC 4X0XA 6GSXA 2EIQA 5CRWA 2XHFA 5KEJA 3TJBA 4ZIJA 2CX3A 2X8GA 2VLVA 1AQVA 2GSRA 1JLWA 2VM1A 3F4SA 4MA9A 1FOHA 4O92A 2QA2A 4ZBDA 1GSQA 1A0RP 1GNWA 5LCZA 2X4AA 3E3EA 4TXOB 2VCXA 3ZTLA 3C7MA 3GSTA 3UMAA 5KOXA 2HXKA 1U6TA 1HNBA 1EOHA 3LWAA 5F05A 2YV9A 3BCKA 5A5KA 2RM5A 3O76A 4N30A 1T7PB 2MBTA 2B1LA 1M9AA 5DJMA 2R0PA 4LLRA 5IMAA 4TOPA 5L71A 4QQ7A 4OCEA 3IC4A 3VFIA 1JZOA 1BEDA 4TN8A 2H8LA 3CYNA 5DQSA 3FK8A 3VLNA 1O7UA 2H71A 3ZLPA 1PKWA 2H76A 2VOCA 2JZRA 3M1GA 2O87A 1ABAA 1OE7A 5GAND 3CRTA 2FUG2 2MYGA 1PN0A 4Q5QA 2HNLA 1SL1B 3TKQA 1TRVA 4Z2UA 2WGRA 2FWGA 3ZVJD 3TCOA 20GSA 3TGZA 3F8UA 2X49A 2JZSA 4KH7A 4JR6A 2WJUA 2GSQA 3MIXA 2MMNA 4Q5FA 4V2LA 1OC8A 2LRCA 4K2XA 4WF5A 1TP9A 4WXTA 4K5SA 2V6KA 4ECBA 2GGTA 1GWCA 4IP1A 4MZCA 1XW9A 1JZWA 2HZEA 4KUNA 4MABA 5G5FA 1JZRA 1EGRA 2JSZA 4IGJA 2XC2A 3P7XA 4QL9A 5ECOB 5B6NA 1C72A 1YZXA 4WEYA 1GL8A 1XCCA 3QOUA 1XVWA 1T4ZA 4NPBA 1SL2B 2P0GA 4K7IA 3O6TA 4TXVA 1UVZA 2M72A 4Q5RA 2YWMA 2HFDA 5AN1A 4GQFA 4K8MA 4WR4A 2GQLA 2H6XA 1WWJA 1YKCA 2K8VA 5GZZB 2LSTA 2WRTA 2FCHA 3DVXA 3VURA 3TRQA 1GSYA 5COHA 1THXA 5HFKA 1PX7A 4KDYA 1E6BA 5F07A 3M8NA 2DKHA 1V98A 3RPPA 2VLTA 1DE2A 2C3TA 1FAAA 4GSSA 3PR8A 4Q5NA 5C00A 1OYJA 1A2JA 4QL7A 4ECIA 4PUFC 4V1Ap 1AC1A 1K3OA 2OBIA 4EUYA 5EVOA 2H1AA 2DLXA 5DCGA 1WOUA 1LJRA 4JU5A 2MBSA 1QMVA 3EU3A 2NDOA 4CY8A 3RDWA 4K6XA 3D22A 5G5EA 3TKPA 3IA1A 2LNSA 4FIWA 4BVXB 3KMNA 4E8EA 5HR3A 4ZL8A 3CMIA 2HZEB 5CRGA 1RW1A 3ME8A 1QGVA 1SENA 4E8HA 2YCDA 2J23A 2GSSA 2HE3A 14GSA 1I5GA 1GSEA 3EE2A 3L9UA 3IDVA 2KHPA 5G1KA 2DMLA 5D9TA 1K0MA 4MF7A 4HZ2A 4BWSA 1U87A 4ECJA 3CSJA 3WGXA 5FT3A 3GKXA 4YKGA 2BTOT 1HQOA 4MJAA 3TOUA 4I5QA 1ZZYA 1EP8A 2QGVA 5DAKA 5J9CA 3TOTA 1XWKA 5ENUA 1PD21 2M80A 2H01A 3F6FA 4F82A 2EIOA 4N0VA 2YZHA 2A4VA 1R4WA 3LXZA 1M0UA 1ON4A 5F0GA 2B5EA 3W8JA 2A2PA 1A0FA 1B4QA 3F63A 1Q98A 3MAKA 1AW9A 2FLSA 1PGTA 4TVEA 3GTUA 4JE1A 3GKMA 1A8YA 4MJCA 2O85A 1VF1A 3R3EA 3EMPA 4DSRA 2GS3A 1O8XA 4HU7A 3TKSE 3IAM2 3H8QA 3DYRA 3KH7A 4ZILA 3A2VA 4NAXA 2WB9A 2X8CA 3J7Yk 4KCEA 3CXGA 4K0GA 2H1BA 2VAFA 4EDYA 1SJIA 3A2WA 3HYPA 4XRDA 1F6MC 4G10A 4EKZA 2HSHA 3GURA 3R2QA 2D2ZA 1TRSA 2PGTA 2DJJA 1FG4A 2A2SA 2GT5A 1X5DA 2VD0A 5HR2A 2AUVA 5GSSA 4F2IA 3UL3A 3G7YA 2E2MA 1AXDA 1O85A 1OC9A 5C04A 4DEJA 2KLXA 1J0FA 2NPBA 16GSA 4FYUA 4MP4A 1CQGA 4G2EA 4ML1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIR A;  1SD9 A;  3GH6 A;  4XRA A;  2JL4 A;  2V32 A;  3UVT A;  2OJL A;  1Z6N A;  2YJ7 A;  6GST A;  3PGT A;  2K8S A;  5DAK B;  4HS1 A;  3CRU A;  4POK A;  3UIW A;  4K0N A;  4D73 A;  1G7O A;  1NW2 A;  5G2Z A;  2Z9S A;  1X9W B;  4G9H A;  1ST9 A;  1YEX A;  5A4V A;  4PXO A;  5JWQ B;  1GSF A;  5IMD A;  5J9B A;  3FHK A;  2VUP A;  1YDK A;  5CO3 A;  1F2E A;  2B5X A;  1TOF A;  1Z6M A;  3ZML A;  4H86 A;  2LQQ A;  1NSW A;  3CTF A;  1XFL A;  2O8V B;  1J08 A;  1MTC A;  4AF2 A;  3C73 A;  2IFQ A;  2GT6 A;  2FGX A;  1WIK A;  4IJ3 A;  3ZRD A;  1B9Y C;  4G19 A;  1QXH A;  5HR0 A;  2OKA A;  1TXX A;  2WFC A;  4EE0 A;  1AIU A;  1TK5 B;  4IHU A;  3ERF A;  3MNG A;  4OD7 A;  2BMX A;  2VCZ A;  2C3N A;  2H1D A;  1T00 A;  1ZYE A;  5EPF A;  1F9M A;  4OO4 A;  3WYW A;  2YNX A;  3C8E A;  4WF4 A;  1EGO A;  1HD2 A;  2HZF A;  3DXB A;  3ZIV A;  4WBJ A;  1OC9 B;  1THO A;  1U3A A;  5D9X A;  3GA4 A;  1VF3 A;  3RPN A;  1GTA A;  2CAI A;  2FY6 A;  4OCF A;  4YQV A;  1DBY A;  4L5L A;  3I9V 2;  4KDX A;  4RI7 A;  3KZQ A;  2QKE A;  2H19 A;  1T4Y A;  1F37 A;  4PGT A;  5CNW A;  5J5N A;  4XCS A;  1B48 A;  2R3X A;  3W6G A;  3D21 A;  4HI7 A;  4NMU A;  2YWI A;  3I43 A;  5DCH A;  4ZL7 A;  4MCU A;  5GST A;  1M7T A;  3FR6 A;  2H1G A;  4PUR A;  4CHS A;  2N5B A;  3TRP A;  3VWU A;  1ERW A;  4MMM A;  3DGQ A;  2C4J A;  2K18 A;  4I6X A;  4LL4 B;  2ZCT A;  3ERG A;  3H79 A;  1EP7 A;  4TR1 A;  2WZ9 A;  1GUL A;  2IFQ B;  5FHI A;  4GQC A;  1BX9 A;  2CZ3 A;  1U3I A;  1K3L A;  3VWV A;  3DIE A;  2H66 A;  2TIR A;  1M2A A;  3VPT A;  4IBP A;  4L0U A;  3FKF A;  4BPY A;  5IIZ A;  4EO3 A;  4EVM A;  2C0D A;  2OAC A;  4N10 A;  4BA7 A;  1G6W A;  3CSH A;  22GS A;  1J9B A;  4NHW A;  2PMT A;  1YY7 A;  2ZNM A;  4MJE A;  2F9S A;  3D5J A;  2GZZ A;  4CDO A;  4NV2 A;  1I9D A;  3APQ A;  5KN1 A;  5ID2 A;  4KSM A;  5ECK B;  3TRX A;  4TW5 A;  3P90 A;  2CZ2 A;  3A5W A;  3RHC A;  1O73 A;  4DVC A;  1B9X C;  2JU5 A;  2VIM A;  4BWQ A;  4LMV A;  1YKA A;  3JCM L;  2WCI A;  4POL A;  1GSD A;  2H70 A;  1SK0 A;  2HSY A;  4J2F A;  2XBI A;  1MDJ A;  2DC5 A;  4O7H A;  1ACV A;  5HFG A;  3F4T A;  3E0U A;  2PER A;  3GKN A;  4POB A;  5JWR B;  4IVF A;  3L9S A;  1AQX A;  1O8W A;  1MDI A;  5ECN B;  2V2G A;  2CAQ A;  1WMJ A;  1AAZ A;  5CRH A;  3DRN A;  2H0H A;  4MPF A;  5IO0 A;  2LS5 A;  1GUH A;  3UOM A;  4BL7 A;  2LJK A;  3TJJ A;  4PQH A;  4TR1 B;  1GUK A;  5HFI A;  3TJG A;  6GSS A;  5H5Q A;  1Y6E A;  2VL9 A;  3TDG A;  3HJM A;  2N5A A;  3UEM A;  4GWR A;  5IMV A;  4HUA A;  1GSU A;  3IXR A;  3ZRE A;  1XWG A;  2DMM A;  1SYR A;  2QC7 A;  1X9S B;  1LBK A;  4WBR D;  2VCT A;  5KN2 A;  3ZFL A;  2TRX A;  2K9F A;  3IK7 A;  2PVO C;  2DJ0 A;  3UBL A;  4FO5 A;  4OMV A;  3RBT A;  4FH8 A;  1BQ7 A;  2H6Y A;  2MMA A;  2AHE A;  2CV4 A;  5IMF A;  1GH2 A;  1GLP A;  3QPM A;  2GZP A;  1V9W A;  3HXS A;  3CSI A;  3GKK A;  2CA8 A;  3KM6 A;  1VGL A;  2X64 A;  1EWX A;  1BYE A;  4NXI A;  1VRS D;  4NHZ A;  1SKW B;  2RM6 A;  3HZ8 A;  3UAR A;  1X9M B;  1DE1 A;  4MJB A;  2P31 A;  3VWX A;  17GS A;  2FA4 A;  3TKR A;  1FHE A;  2C0G A;  4F0C A;  4O32 A;  3TJK A;  5J3R A;  2DIZ A;  2V1M A;  4IEL A;  1XVQ A;  2H73 A;  3AY8 A;  2VLU A;  1S3A A;  3BOA A;  4MLY A;  2H6Z A;  3TKS A;  5ABR A;  2GQK A;  5IO2 A;  1Q4J A;  4XHM A;  2FNO A;  1KEB A;  3QD9 A;  3IBH A;  1R5A A;  3L9V A;  3C1R A;  1B8X A;  4L8E A;  1MEK A;  4V2N A;  4OWY A;  3IR4 A;  2OE0 A;  3LOR A;  1T1V A;  2IJY A;  5JCG A;  2DJ2 A;  3D6I A;  18GS A;  3WD6 A;  2MZC A;  4KGI A;  3LEF A;  5IOX A;  2JZT A;  1PA3 A;  2X8H A;  3WGD A;  3OR5 A;  4TKY A;  3VWW A;  2FWE A;  5J41 A;  3DKS A;  5AIX A;  3SBC A;  2V41 A;  2HLS A;  3GV1 A;  2V6O A;  2IPA A;  3NZN A;  1XOA A;  1EZK A;  4OFM A;  2GTU A;  2LUS A;  3U6V A;  2I3Y A;  1ZL9 A;  13GS A;  1QQ2 A;  2PN8 A;  2YV7 A;  4MPG A;  4JZQ A;  4YH2 A;  4J56 E;  4KA0 A;  3F9U A;  2OA7 A;  1Z9H A;  1XXU A;  3LXT A;  5ECQ B;  1FVK A;  2YZU A;  1H75 A;  3D4M A;  3F3R A;  2H74 A;  4OFT A;  2CVD A;  4KDU A;  7GSS A;  2H30 A;  2C80 A;  4XS4 A;  3TUE A;  2O89 A;  4AJ7 A;  1TJD A;  2XPD A;  5IPG A;  5D73 A;  1URM A;  2OBK A;  3FZ5 A;  3PIN A;  4YQU A;  4IN0 A;  5AIS A;  3HDC A;  4ID0 A;  1DSB A;  3SWL A;  1XIY A;  2VCW A;  5H5S A;  1K3Y A;  2O7K A;  2C8U A;  5KN0 A;  4FYB A;  3W8S A;  5B8A A;  1R7H A;  3TKS C;  5G31 A;  2LRT A;  4K9Z A;  2TRC P;  2LTK A;  5DAL A;  5F8B A;  2H0G A;  2PBJ A;  1EOG A;  2LNT A;  1SJ6 A;  1FVJ A;  3HD5 A;  4EC0 A;  2R4V A;  3KJY A;  2I81 A;  2F3M A;  4JED A;  5G30 A;  3QR6 A;  3ERW A;  4KB3 A;  2HYX A;  2MMO A;  2YWN A;  2C0E A;  4XS1 A;  1M99 A;  1A8L A;  2P5Q A;  4IQ1 A;  3GYK A;  2DJK A;  3ZFB A;  2FA8 A;  4IKH A;  3LYK A;  4ISD A;  2M46 A;  3O3T A;  2AAW A;  3HHV A;  2HT9 A;  3FYG A;  2R37 A;  2J9H A;  6GSW A;  4LL1 B;  5JWO B;  1PKZ A;  1M2D A;  1IYI A;  1O6J A;  4K7N A;  3FZA A;  1K0C A;  1FB0 A;  1F3A A;  2DIY A;  2B5Y A;  4IJI A;  2PVQ A;  3KH9 A;  4HEA 2;  1YF1 A;  4IS0 A;  2L5O A;  4KCA A;  1KNG A;  4GXZ A;  2H72 A;  2A2R A;  4EXJ A;  3GTU B;  3LQ7 A;  3L4N A;  4KE3 A;  4X43 A;  3EC3 A;  1EEM A;  2B6M A;  4KX4 A;  2PUK C;  3MWH A;  3ZIJ A;  4BVY A;  1A2M A;  2B7K A;  4N0Z A;  2ZUP A;  3GL3 A;  5CRD A;  1MD3 A;  2RUF A;  3M9J A;  3IRA A;  4YAV A;  3CBU A;  5D8I A;  1GTU A;  1PMT A;  4FYC A;  4O5R A;  2IIY A;  4L0W A;  4YAP A;  2PPT A;  3H4K A;  3L0H A;  3KTB A;  5DJL A;  4XIH A;  5CRE A;  3HCZ A;  4TXO A;  3P2A A;  3IOS A;  5KN3 A;  3GNJ A;  1T8E B;  2AB6 A;  5ECR B;  4HQS A;  1RK4 A;  2KP1 A;  2VL2 A;  3GX0 A;  2OAD A;  4EF0 A;  1TTZ A;  3GUS A;  2L6C A;  1WE0 A;  4PX1 A;  4I2U A;  3FZ4 A;  3IHQ A;  2B1K A;  5IPH A;  2C1Y A;  3MDK A;  4RI6 A;  1RQM A;  4PNF A;  1SK2 A;  5B8B A;  9GSS A;  3C71 A;  3FR9 A;  1G6Y A;  4JBB A;  3KCM A;  1XOB A;  3H1N A;  4POM A;  2IMK A;  4PQI A;  4EDZ A;  1TDI A;  5B6M A;  1BAY A;  4PQ1 A;  1TI1 A;  1XW5 A;  3M9K A;  4TR0 A;  1PQN A;  2H75 A;  4D73 B;  1V57 A;  5GAP D;  3WT2 A;  4PUA A;  1WPI A;  2NVL A;  3HKR A;  3L78 A;  1A2L A;  3ZIT A;  2IWT A;  3F0I A;  2CVK A;  3Q18 A;  5INY A;  5ECL B;  1NHO A;  1FOV A;  3KD0 A;  5DBQ A;  1PX6 A;  5CYY A;  2GZY A;  5D9V A;  2LKU A;  1TW9 A;  2IMF A;  2CQ9 A;  1M2B A;  3KTL A;  2WS2 A;  2YAN A;  2QSI A;  1A23 A;  4WKW A;  4IW9 A;  2FD3 A;  1Y25 A;  3GRX A;  1OKT A;  4AJ6 A;  3TB2 A;  1YJ6 A;  2K6V A;  2L4C A;  3KP8 A;  3K8N A;  4WR5 A;  1VF2 A;  3U5R E;  4XTS A;  1F3B A;  2AJQ B;  2E2G A;  3QAW A;  1GSS A;  2VL2 C;  1ZGN A;  4X1U A;  1B4P A;  1N8J A;  5IMC A;  1LU4 A;  3FZ9 A;  3QMX A;  1ERT A;  5ECI B;  4ACS A;  5ECH B;  2I9H A;  4GTU A;  4RUV A;  3GX8 A;  1E2Y A;  1EV9 A;  2L59 A;  5JCU A;  1X5E A;  2FWF A;  3KP9 A;  2GLR A;  1X5C A;  3G7J A;  3LSZ A;  3S9F A;  4IQA A;  3Q19 A;  4JR4 A;  1T3B A;  2EC4 A;  2YPM A;  3IPZ A;  4ZBB A;  2DSA A;  3ZYW A;  3NIV A;  4HZ4 A;  4CW9 A;  2C3Q A;  4MF5 A;  3APS A;  1SK1 A;  1OKD A;  3GL5 A;  3ME7 A;  5ELA A;  3HA9 A;  1M9B A;  3HVS A;  4GLT A;  5CP1 A;  3GN3 A;  2F51 A;  5ECP B;  2L5L A;  1XWA A;  3GSS A;  4K7O A;  1GTI A;  2JAD A;  2P5R A;  4RQR A;  2VCQ A;  5A4U A;  3WT1 A;  2LRN A;  5IMZ A;  1SKS B;  3HVV A;  4BVX A;  1SJZ A;  4JRR A;  4OO5 A;  3HJO A;  3RHB A;  11GS A;  3QAG A;  1ERU A;  3V1W A;  1QFN A;  5EY6 A;  1FO5 A;  2WUL A;  5CAX A;  3GHA A;  3VI7 A;  2REM A;  2DJ3 A;  1G0T A;  4P3Y B;  1ILO A;  2ES7 A;  5IOW A;  4KW6 A;  4J57 E;  4HDE A;  1PSQ A;  2RII A;  3HVX A;  4HJ2 A;  3UVH A;  1BG5 A;  2B7J A;  1TRU A;  3J7Y b;  4L5O A;  2IME A;  5ID2 B;  1MDK A;  2I1U A;  5H5R A;  1TU8 A;  5DQY A;  1SU9 A;  1A24 A;  2E7P A;  3QDN A;  1EV4 A;  4MZB A;  1TRW A;  2CT6 A;  3N9J A;  3H93 A;  2L6D A;  1G7E A;  1W89 A;  2H0I A;  3FR3 A;  1K0D A;  2BJX A;  4MK3 A;  1Z5Y E;  1CQH A;  2HRN A;  3DWV A;  2I4A A;  1TKD B;  3DD3 A;  1JZD A;  5DVB A;  5HR1 A;  2IMI A;  3VI5 A;  3RAZ A;  3PH9 A;  2AYT A;  1OVN A;  1HNA A;  5FWG A;  3EWL A;  2LEG A;  2JSY A;  2JAC A;  2PWJ A;  2YN1 A;  3A3T A;  5AIV A;  2C0F A;  1AQW A;  1USB A;  4LMW A;  1SKR B;  3EVI A;  1XW6 A;  1ML6 A;  3ED3 A;  4V2M A;  2LQO A;  3BBY A;  4HQZ A;  2CX4 A;  4HOJ A;  5E4W A;  1FW1 A;  1PL1 A;  1Z3E A;  2DBC A;  3M0F A;  3ZMK A;  5LD0 A;  2PU9 C;  5E59 A;  6GSV A;  3IE3 A;  1BJX A;  3DVW A;  4I8B A;  3Q6O A;  4I2T A;  4K2D A;  4IP6 A;  2RUE A;  2VM2 A;  1HNC A;  3ZVJ A;  2IN3 A;  2KOK A;  4XS6 A;  1DUG A;  1ZMA A;  3ZL5 A;  3HZ4 A;  2LJA A;  3VK9 A;  2MMZ A;  3HJP A;  1SL0 B;  2N5F A;  2GQM A;  1S3C A;  2VD1 A;  1TK8 B;  2FHE A;  1V2A A;  4MF6 A;  1Z7R A;  1K0A A;  3HY2 A;  4TR3 A;  3GIX A;  3IAS 2;  1HYU A;  3UBK A;  2F8F A;  1OE8 A;  1H4O A;  3VPQ A;  3QCP A;  1WRY A;  2ON7 A;  3FEU A;  4DSS A;  4Z7X A;  2WDU A;  2ON5 A;  2YJH A;  4LA1 A;  4ZB8 A;  1XBS A;  3KMO A;  2GDR A;  1QUW A;  4EL1 A;  1JHB A;  2R2J A;  5DDL A;  1K0B A;  1R26 A;  3P8W A;  3US3 A;  1K0O A;  2R6K A;  1QK8 A;  3EYT A;  2VCV A;  3G9B A;  3KGK A;  4V1A g;  3CTG A;  1TK0 B;  3FY7 A;  4OFN A;  2IMD A;  1GP1 A;  4GF0 A;  3FW2 A;  1NHY A;  4KSO A;  8GSS A;  3EIN A;  3F6D A;  3DEX A;  4GST A;  10GS A;  3D0Z A;  1XPV A;  2OE1 A;  4MH2 A;  2YWO A;  1GNE A;  4ZXG A;  1UA5 A;  4AGS A;  1WP0 A;  12GS A;  4NWY A;  3I69 A;  3F4R A;  5J4U A;  4DSQ A;  3FRC A;  1PRX A;  2XBQ A;  3NOF A;  5AGY A;  3UAP A;  3BCI A;  1JFU A;  4WET A;  1S3D A;  2NBS A;  4F03 A;  1YF0 A;  4HU9 A;  1OAZ A;  1GUM A;  2LV3 A;  19GS A;  4GSN A;  5JCW A;  5LNK e;  4KAE A;  1TU7 A;  3DML A;  5ECS A;  2AV4 A;  3LYP A;  5D96 A;  5D9W A;  3LGC A;  3D4T A;  3ISO A;  1OC3 A;  3TJF A;  2KP2 A;  2L57 A;  3UJ1 A;  3LG6 A;  3KEB A;  1AUC A;  1VF4 A;  1X0R A;  3E9J B;  3BD2 A;  3EUR A;  3QAV A;  4HJM A;  4RQX A;  2G0F A;  2VO4 A;  1GRX A;  3C1S A;  1XWB A;  1O81 A;  1YQ1 A;  3IK9 A;  3WGE A;  3BJ5 A;  3F3Q A;  5A4W A;  3N5O A;  6GSU A;  1WJK A;  4ECC A;  4F0B A;  1JLV A;  3LFL A;  5ECM B;  3ZZX A;  5B7C A;  4DSS B;  4TRX A;  5G1L A;  5IM9 A;  1GLQ A;  5F06 A;  4NV5 A;  2YP6 A;  4N11 A;  1XZO A;  2R5G A;  1YEP A;  2ALB A;  3EU4 A;  4I97 A;  4MH3 A;  3GFK A;  1Z7P A;  3GH9 A;  1KBN A;  4ZL9 A;  5HQP A;  3IV4 A;  4GCI A;  4XS4 B;  1PL2 A;  2IL3 A;  1PN9 A;  1W4V A;  4PNG A;  1EEJ A;  1KTE A;  3Q74 A;  3G7I A;  1ZYQ B;  4MDC A;  1MD4 A;  1NM3 A;  1ZCP A;  5IQY A;  1ZOF A;  1IYH A;  1K0N A;  3KIJ A;  4YQM A;  2X99 A;  5DAL B;  4ZBA A;  1R5P A;  1U88 A;  4ZB9 A;  2OE3 A;  2NTO A;  4ILF A;  2XPE A;  1XWC A;  1SYX A;  4TR4 A;  1UC7 A;  3GMF A;  1FB6 A;  1ERV A;  2F8A A;  2GVP A;  2KUC A;  3QFB C;  3A2X A;  4ZB6 A;  2FWH A;  3APO A;  2YOI A;  3EMX A;  2HRF A;  4F9Z A;  2E0Q A;  3MSZ A;  1SD8 A;  1V58 A;  4ULX A;  3I6A A;  5EL8 A;  4MZW A;  2RLI A;  2LJR A;  4KND A;  1TI3 A;  1V40 A;  2HI7 A;  2L4Q A;  5D93 A;  4K1F A;  1GTB A;  3LJR A;  2GST A;  3KXO A;  4AJ8 A;  3M3M A;  2G2Q A;  2VL3 A;  5ELG A;  1N2A A;  4GRF A;  2CVB A;  6GSY A;  1UN2 A;  2DJ1 A;  4ML6 A;  2B3S A;  3QFA C;  4X0X A;  6GSX A;  2EIQ A;  5CRW A;  2XHF A;  5KEJ A;  3TJB A;  4ZIJ A;  2CX3 A;  2X8G A;  2VLV A;  1AQV A;  2GSR A;  1JLW A;  2VM1 A;  3F4S A;  4MA9 A;  4O92 A;  4ZBD A;  1GSQ A;  1A0R P;  1GNW A;  5LCZ A;  3E3E A;  4TXO B;  2VCX A;  3ZTL A;  3C7M A;  3GST A;  3UMA A;  2HXK A;  1U6T A;  1HNB A;  1EOH A;  3LWA A;  5F05 A;  2YV9 A;  3BCK A;  5A5K A;  2RM5 A;  3O76 A;  4N30 A;  1T7P B;  2MBT A;  2B1L A;  1M9A A;  5DJM A;  4LLR A;  5IMA A;  4TOP A;  5L71 A;  4QQ7 A;  4OCE A;  3IC4 A;  3VFI A;  1JZO A;  1BED A;  4TN8 A;  2H8L A;  3CYN A;  5DQS A;  3FK8 A;  3VLN A;  1O7U A;  2H71 A;  3ZLP A;  1PKW A;  2H76 A;  2VOC A;  2JZR A;  3M1G A;  2O87 A;  1ABA A;  1OE7 A;  5GAN D;  3CRT A;  2FUG 2;  2MYG A;  4Q5Q A;  2HNL A;  1SL1 B;  3TKQ A;  1TRV A;  2WGR A;  2FWG A;  3ZVJ D;  3TCO A;  20GS A;  3TGZ A;  3F8U A;  2JZS A;  4KH7 A;  4JR6 A;  2WJU A;  2GSQ A;  2MMN A;  4Q5F A;  4V2L A;  1OC8 A;  2LRC A;  4WF5 A;  1TP9 A;  4WXT A;  2V6K A;  4ECB A;  2GGT A;  1GWC A;  4IP1 A;  4MZC A;  1XW9 A;  1JZW A;  2HZE A;  4KUN A;  4MAB A;  5G5F A;  1JZR A;  1EGR A;  2JSZ A;  4IGJ A;  2XC2 A;  3P7X A;  4QL9 A;  5ECO B;  5B6N A;  1C72 A;  1YZX A;  4WEY A;  1GL8 A;  1XCC A;  3QOU A;  1XVW A;  1T4Z A;  4NPB A;  1SL2 B;  2P0G A;  4K7I A;  3O6T A;  4TXV A;  1UVZ A;  2M72 A;  4Q5R A;  2YWM A;  2HFD A;  5AN1 A;  4GQF A;  4K8M A;  4WR4 A;  2GQL A;  2H6X A;  1WWJ A;  1YKC A;  2K8V A;  5GZZ B;  2LST A;  2WRT A;  2FCH A;  3DVX A;  3VUR A;  3TRQ A;  1GSY A;  5COH A;  1THX A;  5HFK A;  1PX7 A;  4KDY A;  1E6B A;  5F07 A;  3M8N A;  1V98 A;  3RPP A;  2VLT A;  1DE2 A;  2C3T A;  1FAA A;  4GSS A;  3PR8 A;  4Q5N A;  5C00 A;  1OYJ A;  1A2J A;  4QL7 A;  4ECI A;  4PUF C;  4V1A p;  1AC1 A;  1K3O A;  2OBI A;  4EUY A;  5EVO A;  2H1A A;  2DLX A;  5DCG A;  1WOU A;  1LJR A;  4JU5 A;  2MBS A;  1QMV A;  3EU3 A;  2NDO A;  3RDW A;  4K6X A;  3D22 A;  5G5E A;  3TKP A;  3IA1 A;  2LNS A;  4FIW A;  3KMN A;  4E8E A;  5HR3 A;  4ZL8 A;  3CMI A;  2HZE B;  5CRG A;  1RW1 A;  3ME8 A;  1QGV A;  1SEN A;  4E8H A;  2YCD A;  2J23 A;  2GSS A;  2HE3 A;  14GS A;  1I5G A;  1GSE A;  3EE2 A;  3L9U A;  3IDV A;  2KHP A;  5G1K A;  2DML A;  5D9T A;  1K0M A;  4MF7 A;  4HZ2 A;  4BWS A;  1U87 A;  4ECJ A;  3CSJ A;  3WGX A;  5FT3 A;  3GKX A;  2BTO T;  1HQO A;  4MJA A;  3TOU A;  4I5Q A;  1ZZY A;  1EP8 A;  2QGV A;  5DAK A;  5J9C A;  3TOT A;  1XWK A;  5ENU A;  1PD2 1;  2M80 A;  2H01 A;  3F6F A;  4F82 A;  2EIO A;  4N0V A;  2YZH A;  2A4V A;  1R4W A;  3LXZ A;  1M0U A;  1ON4 A;  5F0G A;  2B5E A;  3W8J A;  1A0F A;  1B4Q A;  3F63 A;  1Q98 A;  3MAK A;  1AW9 A;  2FLS A;  1PGT A;  4TVE A;  3GTU A;  4JE1 A;  3GKM A;  1A8Y A;  4MJC A;  2O85 A;  1VF1 A;  3EMP A;  4DSR A;  2GS3 A;  1O8X A;  4HU7 A;  3TKS E;  3IAM 2;  3H8Q A;  3DYR A;  3KH7 A;  4ZIL A;  3A2V A;  4NAX A;  2WB9 A;  2X8C A;  3J7Y k;  4KCE A;  3CXG A;  4K0G A;  2H1B A;  2VAF A;  4EDY A;  1SJI A;  3A2W A;  3HYP A;  4XRD A;  1F6M C;  4G10 A;  4EKZ A;  2HSH A;  3GUR A;  3R2Q A;  2D2Z A;  1TRS A;  2PGT A;  2DJJ A;  1FG4 A;  2A2S A;  2GT5 A;  1X5D A;  2VD0 A;  5HR2 A;  2AUV A;  5GSS A;  4F2I A;  3UL3 A;  3G7Y A;  2E2M A;  1AXD A;  1O85 A;  1OC9 A;  5C04 A;  4DEJ A;  2KLX A;  1J0F A;  2NPB A;  16GS A;  4FYU A;  4MP4 A;  1CQG A;  4G2E A;  4ML1 A; 
#chains in the Genus database with same CATH topology
 2EIR A;  2HRA A;  1SD9 A;  3GH6 A;  4XRA A;  2JL4 A;  2V32 A;  3UVT A;  4G0I A;  2OJL A;  1Z6N A;  2YJ7 A;  6GST A;  3PGT A;  2K8S A;  5DAK B;  4HS1 A;  3CRU A;  4POK A;  4ICY A;  3UIW A;  4K0N A;  4D73 A;  1G7O A;  1NW2 A;  5G2Z A;  2Z9S A;  1X9W B;  4G9H A;  1ST9 A;  1YEX A;  5A4V A;  4PXO A;  5JWQ B;  1GSF A;  5IMD A;  5J9B A;  3FHK A;  2VUP A;  1YDK A;  5CO3 A;  1F2E A;  4YKF A;  2B5X A;  1TOF A;  1Z6M A;  3ZML A;  4H86 A;  2LQQ A;  1NSW A;  3CTF A;  1XFL A;  2O8V B;  3PPU A;  1J08 A;  1MTC A;  4AF2 A;  3C73 A;  2IFQ A;  2GT6 A;  2FGX A;  1WIK A;  4IJ3 A;  3ZRD A;  1B9Y C;  4G19 A;  1QXH A;  5HR0 A;  2OKA A;  1TXX A;  2WFC A;  4EE0 A;  2QA1 A;  1AIU A;  2DKI A;  1TK5 B;  4IHU A;  3ERF A;  3MNG A;  4OD7 A;  2BMX A;  2VCZ A;  2C3N A;  2H1D A;  1T00 A;  1ZYE A;  5EPF A;  1F9M A;  4OO4 A;  3WYW A;  2YNX A;  3C8E A;  4WF4 A;  1EGO A;  1HD2 A;  2HZF A;  3DXB A;  3ZIV A;  4WBJ A;  1OC9 B;  1THO A;  1U3A A;  5D9X A;  3GA4 A;  1VF3 A;  3RPN A;  1GTA A;  2CAI A;  2FY6 A;  4OCF A;  4YQV A;  1DBY A;  4L5L A;  3I9V 2;  4KDX A;  4RI7 A;  3KZQ A;  2QKE A;  2A4H A;  2H19 A;  1T4Y A;  1F37 A;  4PGT A;  5CNW A;  5J5N A;  4XCS A;  1B48 A;  2R3X A;  3W6G A;  3D21 A;  4HI7 A;  4NMU A;  2YWI A;  3I43 A;  5DCH A;  4ZL7 A;  4MCU A;  5GST A;  1M7T A;  3FR6 A;  2H1G A;  4PUR A;  4CHS A;  2N5B A;  3TRP A;  3VWU A;  1ERW A;  4MMM A;  3DGQ A;  2C4J A;  2K18 A;  4I6X A;  4LL4 B;  2ZCT A;  3ERG A;  3H79 A;  1EP7 A;  4TR1 A;  2WZ9 A;  1GUL A;  2IFQ B;  5FHI A;  4GQC A;  1BX9 A;  2CZ3 A;  1U3I A;  1K3L A;  3VWV A;  3DIE A;  2H66 A;  2TIR A;  1M2A A;  3VPT A;  4IBP A;  2R0C A;  4L0U A;  3FKF A;  4BPY A;  5IIZ A;  4EO3 A;  4EVM A;  2C0D A;  2OAC A;  4N10 A;  4BA7 A;  1G6W A;  3CSH A;  22GS A;  1J9B A;  4NHW A;  2PMT A;  1YY7 A;  2ZNM A;  4MJE A;  2F9S A;  3D5J A;  2GZZ A;  4CDO A;  4NV2 A;  1I9D A;  3APQ A;  5KN1 A;  5ID2 A;  4KSM A;  5ECK B;  3TRX A;  4TW5 A;  3P90 A;  2CZ2 A;  3A5W A;  3RHC A;  1O73 A;  4DVC A;  1B9X C;  2JU5 A;  2VIM A;  4FQU A;  4BWQ A;  4LMV A;  1YKA A;  3JCM L;  2WCI A;  4POL A;  1GSD A;  2H70 A;  1SK0 A;  2HSY A;  4J2F A;  2XBI A;  1MDJ A;  2DC5 A;  4O7H A;  1ACV A;  5HFG A;  3F4T A;  3E0U A;  2PER A;  3GKN A;  4POB A;  5JWR B;  4IVF A;  3L9S A;  4PTS A;  1AQX A;  1O8W A;  1MDI A;  5ECN B;  2V2G A;  2CAQ A;  1WMJ A;  1AAZ A;  5CRH A;  3DRN A;  3FMW A;  2H0H A;  4MPF A;  5IO0 A;  2LS5 A;  4G0L A;  4CY6 A;  1GUH A;  3UOM A;  4BL7 A;  2LJK A;  3TJJ A;  4PQH A;  4TR1 B;  1GUK A;  5HFI A;  3TJG A;  6GSS A;  5H5Q A;  1Y6E A;  2VL9 A;  3TDG A;  3HJM A;  2N5A A;  3UEM A;  4GWR A;  5IMV A;  4HUA A;  1GSU A;  3IXR A;  3ZRE A;  1XWG A;  2DMM A;  1SYR A;  2QC7 A;  1X9S B;  1LBK A;  4WBR D;  2VCT A;  5KN2 A;  3ZFL A;  2TRX A;  2K9F A;  3IK7 A;  2PVO C;  2DJ0 A;  3UBL A;  4FO5 A;  4OMV A;  3RBT A;  4FH8 A;  4EIQ A;  1BQ7 A;  2H6Y A;  2MMA A;  2AHE A;  2CV4 A;  5IMF A;  1GH2 A;  4MNN A;  1GLP A;  3QPM A;  2GZP A;  1V9W A;  3HXS A;  3CSI A;  3GKK A;  2CA8 A;  3KM6 A;  1VGL A;  2X64 A;  1EWX A;  1BYE A;  4NXI A;  1VRS D;  4NHZ A;  1SKW B;  2RM6 A;  3HZ8 A;  3UAR A;  1X9M B;  1DE1 A;  4MJB A;  2P31 A;  3VWX A;  17GS A;  2FA4 A;  1S3R A;  3TKR A;  1FHE A;  2C0G A;  4F0C A;  4O32 A;  3TJK A;  5J3R A;  2DIZ A;  2V1M A;  4IEL A;  1XVQ A;  2H73 A;  3AY8 A;  2VLU A;  1S3A A;  3BOA A;  4MLY A;  2H6Z A;  3TKS A;  5ABR A;  2GQK A;  5IO2 A;  1Q4J A;  2R0G A;  4XHM A;  2HSM A;  2FNO A;  1KEB A;  3QD9 A;  3IBH A;  1R5A A;  3L9V A;  4BIK A;  3C1R A;  1B8X A;  4L8E A;  4BL7 B;  1MEK A;  4V2N A;  4OWY A;  3IR4 A;  2OE0 A;  3LOR A;  1T1V A;  2IJY A;  5JCG A;  2DJ2 A;  3D6I A;  18GS A;  3WD6 A;  2MZC A;  4KGI A;  3LEF A;  5IOX A;  2JZT A;  1PA3 A;  2X8H A;  3WGD A;  3OR5 A;  4TKY A;  3VWW A;  2FWE A;  5J41 A;  3DKS A;  5AIX A;  3SBC A;  2V41 A;  2HLS A;  3GV1 A;  2V6O A;  2IPA A;  3NZN A;  1XOA A;  1EZK A;  4OFM A;  2GTU A;  2LUS A;  3U6V A;  2I3Y A;  1ZL9 A;  13GS A;  1QQ2 A;  1PFO A;  2PN8 A;  2YV7 A;  4MPG A;  4JZQ A;  4YH2 A;  4J56 E;  4KA0 A;  3F9U A;  2OA7 A;  1Z9H A;  1XXU A;  3LXT A;  5ECQ B;  1FVK A;  2YZU A;  1H75 A;  3D4M A;  3F3R A;  2H74 A;  4OFT A;  2CVD A;  4KDU A;  7GSS A;  2H30 A;  3A5I A;  2C80 A;  4XS4 A;  3TUE A;  2O89 A;  4AJ7 A;  1TJD A;  2XPD A;  5IPG A;  5D73 A;  1URM A;  2OBK A;  3FZ5 A;  3PIN A;  4YQU A;  4IN0 A;  5AIS A;  3HDC A;  4ID0 A;  1DSB A;  3SWL A;  1XIY A;  2VCW A;  5H5S A;  1K3Y A;  2O7K A;  2C8U A;  5KN0 A;  4FYB A;  3W8S A;  5B8A A;  1R7H A;  3TKS C;  5G31 A;  2LRT A;  4K9Z A;  2TRC P;  2LTK A;  5DAL A;  5F8B A;  2H0G A;  2PBJ A;  5KOW A;  1EOG A;  2LNT A;  1SJ6 A;  1FVJ A;  3HD5 A;  4EC0 A;  2R4V A;  3KJY A;  2I81 A;  2F3M A;  4JED A;  5G30 A;  3QR6 A;  3ERW A;  4USS A;  4KB3 A;  2HYX A;  2MMO A;  2YWN A;  2C0E A;  4XS1 A;  1M99 A;  1A8L A;  2P5Q A;  4IQ1 A;  3GYK A;  2DJK A;  3ZFB A;  2FA8 A;  4IKH A;  3LYK A;  4ISD A;  2M46 A;  3O3T A;  2AAW A;  3HHV A;  2HT9 A;  3FYG A;  2R37 A;  2J9H A;  6GSW A;  4LL1 B;  5JWO B;  1PKZ A;  1M2D A;  1IYI A;  1O6J A;  4K7N A;  3FZA A;  1K0C A;  1FB0 A;  1F3A A;  2DIY A;  2B5Y A;  4IJI A;  2PVQ A;  4O5Q A;  3KH9 A;  4HEA 2;  1YF1 A;  4IS0 A;  2L5O A;  4KCA A;  1KNG A;  4GXZ A;  2H72 A;  2A2R A;  4EXJ A;  3GTU B;  3LQ7 A;  3L4N A;  4KE3 A;  4X43 A;  3EC3 A;  1EEM A;  2B6M A;  4KX4 A;  2PUK C;  3MWH A;  5BRT A;  3ZIJ A;  4BVY A;  1A2M A;  2B7K A;  4N0Z A;  2ZUP A;  3GL3 A;  5CRD A;  1MD3 A;  2RUF A;  3M9J A;  3IRA A;  4YAV A;  3CBU A;  5D8I A;  4O5R A;  1GTU A;  1PMT A;  4FYC A;  2IIY A;  4L0W A;  4YAP A;  2PPT A;  3H4K A;  3L0H A;  3KTB A;  5DJL A;  4XIH A;  5CRE A;  3HCZ A;  4TXO A;  3P2A A;  3IOS A;  5KN3 A;  3GNJ A;  1T8E B;  2AB6 A;  5ECR B;  4HQS A;  1RK4 A;  2KP1 A;  4O5U A;  2VL2 A;  3GX0 A;  2OAD A;  4EF0 A;  1TTZ A;  3GUS A;  4Z2T A;  2L6C A;  1WE0 A;  4PX1 A;  4I2U A;  3FZ4 A;  3IHQ A;  2B1K A;  5IPH A;  2C1Y A;  3MDK A;  4RI6 A;  1RQM A;  4PNF A;  1SK2 A;  5B8B A;  9GSS A;  3C71 A;  3FR9 A;  1G6Y A;  4JBB A;  3KCM A;  1XOB A;  3H1N A;  4POM A;  2IMK A;  4PQI A;  4EDZ A;  1TDI A;  5B6M A;  1BAY A;  4PQ1 A;  1TI1 A;  1XW5 A;  3LW9 A;  3M9K A;  4TR0 A;  1PQN A;  2H75 A;  4D73 B;  1V57 A;  5GAP D;  3WT2 A;  4PUA A;  1WPI A;  2NVL A;  3HKR A;  3L78 A;  1A2L A;  3ZIT A;  2IWT A;  3F0I A;  2CVK A;  3Q18 A;  5INY A;  5ECL B;  1NHO A;  3MYD A;  1FOV A;  3KD0 A;  5DBQ A;  1PX6 A;  5CYY A;  2GZY A;  5D9V A;  2LKU A;  1TW9 A;  3IHG A;  2IMF A;  2CQ9 A;  4BVY B;  1M2B A;  3KTL A;  2WS2 A;  2YAN A;  3CQF A;  2QSI A;  1A23 A;  4WKW A;  4IW9 A;  2FD3 A;  1Y25 A;  3GRX A;  1OKT A;  4AJ6 A;  3TB2 A;  1YJ6 A;  2K6V A;  2L4C A;  3KP8 A;  3K8N A;  4WR5 A;  2HRK A;  1VF2 A;  3U5R E;  4XTS A;  1F3B A;  2AJQ B;  2E2G A;  3QAW A;  1GSS A;  2VL2 C;  1ZGN A;  4X1U A;  1B4P A;  1N8J A;  5IMC A;  1LU4 A;  3FZ9 A;  3QMX A;  1ERT A;  5ECI B;  4ACS A;  2I9H A;  5ECH B;  4GTU A;  4RUV A;  3GX8 A;  1E2Y A;  1EV9 A;  2L59 A;  5JCU A;  1X5E A;  2FWF A;  5BMU A;  3KP9 A;  2GLR A;  1X5C A;  3G7J A;  3LSZ A;  3S9F A;  4HSC X;  4IQA A;  3Q19 A;  4JR4 A;  1T3B A;  2EC4 A;  2YPM A;  3IPZ A;  4ZBB A;  2DSA A;  3ZYW A;  3NIV A;  4HZ4 A;  4CW9 A;  2C3Q A;  4MF5 A;  3APS A;  1SK1 A;  1OKD A;  3GL5 A;  3ME7 A;  5ELA A;  3HA9 A;  1M9B A;  3HVS A;  4GLT A;  5CP1 A;  3GN3 A;  2F51 A;  5ECP B;  2L5L A;  1XWA A;  3GSS A;  4K7O A;  1GTI A;  2JAD A;  2P5R A;  4RQR A;  2VCQ A;  5A4U A;  3WT1 A;  2LRN A;  5IMZ A;  1SKS B;  3HVV A;  4BVX A;  1SJZ A;  4JRR A;  4OO5 A;  3HJO A;  3RHB A;  11GS A;  3QAG A;  1ERU A;  3V1W A;  1QFN A;  5EY6 A;  1FO5 A;  2WUL A;  5CAX A;  3GHA A;  3VI7 A;  2REM A;  2DJ3 A;  1G0T A;  4P3Y B;  1ILO A;  2ES7 A;  5IOW A;  4KW6 A;  4J57 E;  4HDE A;  1PSQ A;  2RII A;  3HVX A;  4HJ2 A;  3UVH A;  1BG5 A;  2B7J A;  1TRU A;  3J7Y b;  4L5O A;  2IME A;  5ID2 B;  1MDK A;  2I1U A;  5H5R A;  1TU8 A;  5DQY A;  1SU9 A;  1A24 A;  2E7P A;  1ZYN A;  3QDN A;  1EV4 A;  4MZB A;  1TRW A;  2CT6 A;  3N9J A;  3H93 A;  2L6D A;  1G7E A;  1W89 A;  2H0I A;  3FR3 A;  1K0D A;  2BJX A;  4MK3 A;  1Z5Y E;  1CQH A;  2HRN A;  3DWV A;  2I4A A;  1TKD B;  3DD3 A;  1JZD A;  5DVB A;  5HR1 A;  2IMI A;  3VI5 A;  3RAZ A;  3PH9 A;  1XG8 A;  4K5R A;  2AYT A;  1OVN A;  1HNA A;  5FWG A;  3EWL A;  2LEG A;  2JSY A;  2JAC A;  2PWJ A;  2YN1 A;  3A3T A;  5AIV A;  2C0F A;  1AQW A;  1USB A;  4LMW A;  1SKR B;  3EVI A;  1XW6 A;  1ML6 A;  3ED3 A;  4V2M A;  2LQO A;  3BBY A;  4HQZ A;  2CX4 A;  4HOJ A;  5E4W A;  1FW1 A;  1PL1 A;  1Z3E A;  2DBC A;  3M0F A;  3ZMK A;  5LD0 A;  2PU9 C;  5E59 A;  6GSV A;  3IE3 A;  1BJX A;  3DVW A;  4I8B A;  3Q6O A;  4I2T A;  4K2D A;  4IP6 A;  2RUE A;  2VM2 A;  1HNC A;  3ZVJ A;  2IN3 A;  2KOK A;  4XS6 A;  1DUG A;  1ZMA A;  3ZL5 A;  3HZ4 A;  2LJA A;  3VK9 A;  2MMZ A;  3HJP A;  1SL0 B;  2N5F A;  2GQM A;  1S3C A;  2VD1 A;  4X4J A;  1TK8 B;  2FHE A;  1V2A A;  4MF6 A;  1Z7R A;  3IC8 A;  1K0A A;  3HY2 A;  4TR3 A;  1M3I A;  3IAS 2;  3GIX A;  1HYU A;  3UBK A;  2F8F A;  1OE8 A;  1H4O A;  3VPQ A;  3QCP A;  1WRY A;  2ON7 A;  3FEU A;  4DSS A;  4Z7X A;  2WDU A;  2ON5 A;  2YJH A;  4LA1 A;  4ZB8 A;  1XBS A;  3KMO A;  2GDR A;  1QUW A;  4EL1 A;  1JHB A;  2R2J A;  5DDL A;  1K0B A;  1R26 A;  3P8W A;  3US3 A;  1K0O A;  2R6K A;  1QK8 A;  3EYT A;  2VCV A;  3G9B A;  3KGK A;  4V1A g;  3CTG A;  1TK0 B;  3EPT A;  3FY7 A;  4OFN A;  2IMD A;  1GP1 A;  4GF0 A;  3FW2 A;  1NHY A;  4KSO A;  8GSS A;  3EIN A;  3F6D A;  3DEX A;  4GST A;  10GS A;  3D0Z A;  1XPV A;  2OE1 A;  4MH2 A;  2YWO A;  1GNE A;  4ZXG A;  1UA5 A;  1ZYP A;  4AGS A;  1WP0 A;  12GS A;  4NWY A;  3I69 A;  3F4R A;  5J4U A;  4DSQ A;  3FRC A;  1PRX A;  2XBQ A;  3NOF A;  5AGY A;  3UAP A;  3BCI A;  1JFU A;  4WET A;  1S3D A;  2NBS A;  4F03 A;  1YF0 A;  4HU9 A;  1OAZ A;  1GUM A;  2LV3 A;  19GS A;  4GSN A;  5JCW A;  5LNK e;  4KAE A;  1TU7 A;  3DML A;  5ECS A;  2AV4 A;  3LYP A;  5D96 A;  5D9W A;  3LGC A;  3D4T A;  3ISO A;  1OC3 A;  3TJF A;  2KP2 A;  2L57 A;  3UJ1 A;  3LG6 A;  3KEB A;  1AUC A;  1VF4 A;  1X0R A;  3E9J B;  3BD2 A;  3EUR A;  3QAV A;  4HJM A;  2UZ8 A;  4RQX A;  2G0F A;  2VO4 A;  1GRX A;  3C1S A;  1XWB A;  1O81 A;  1YQ1 A;  3IK9 A;  3WGE A;  3BJ5 A;  3F3Q A;  5A4W A;  3N5O A;  6GSU A;  1WJK A;  4ECC A;  4F0B A;  1JLV A;  3LFL A;  5ECM B;  3ZZX A;  5B7C A;  4DSS B;  4TRX A;  5G1L A;  5IM9 A;  1GLQ A;  5F06 A;  4NV5 A;  2YP6 A;  4N11 A;  1XZO A;  2R5G A;  1YEP A;  2ALB A;  3EU4 A;  4I97 A;  4MH3 A;  3GFK A;  1Z7P A;  3GH9 A;  1KBN A;  4ZL9 A;  5HQP A;  3IV4 A;  4GCI A;  4XS4 B;  1PL2 A;  2IL3 A;  1PN9 A;  4EIP A;  1W4V A;  4Z2R A;  4PNG A;  1EEJ A;  1KTE A;  3Q74 A;  3G7I A;  1ZYQ B;  4MDC A;  1MD4 A;  1NM3 A;  1ZCP A;  5IQY A;  1ZOF A;  1IYH A;  4G0K A;  1K0N A;  3KIJ A;  4YQM A;  2X99 A;  5DAL B;  4ZBA A;  1R5P A;  1U88 A;  4ZB9 A;  2OE3 A;  2NTO A;  4ILF A;  2XPE A;  4KF9 A;  1XWC A;  1SYX A;  4TR4 A;  1UC7 A;  3GMF A;  1FB6 A;  1ERV A;  2F8A A;  2GVP A;  2KUC A;  3QFB C;  3A2X A;  4ZB6 A;  2FWH A;  3APO A;  2YOI A;  3EMX A;  2HRF A;  4F9Z A;  2E0Q A;  3MSZ A;  1SD8 A;  1V58 A;  4ULX A;  3I6A A;  5EL8 A;  4MZW A;  2RLI A;  2LJR A;  4KND A;  1TI3 A;  1V40 A;  2HI7 A;  2L4Q A;  5D93 A;  4K1F A;  1GTB A;  3LJR A;  2GST A;  3KXO A;  4AJ8 A;  3M3M A;  2G2Q A;  2VL3 A;  5ELG A;  4A5P A;  1N2A A;  4GRF A;  2CVB A;  6GSY A;  1UN2 A;  2DJ1 A;  4ML6 A;  2B3S A;  3QFA C;  4X0X A;  6GSX A;  2EIQ A;  5CRW A;  2XHF A;  5KEJ A;  3TJB A;  4ZIJ A;  2CX3 A;  2X8G A;  2VLV A;  1AQV A;  2GSR A;  1JLW A;  2VM1 A;  3F4S A;  4MA9 A;  1FOH A;  4O92 A;  2QA2 A;  4ZBD A;  1GSQ A;  1A0R P;  1GNW A;  5LCZ A;  2X4A A;  3E3E A;  4TXO B;  2VCX A;  3ZTL A;  3C7M A;  3GST A;  3UMA A;  5KOX A;  2HXK A;  1U6T A;  1HNB A;  1EOH A;  3LWA A;  5F05 A;  2YV9 A;  3BCK A;  5A5K A;  2RM5 A;  3O76 A;  4N30 A;  1T7P B;  2MBT A;  2B1L A;  1M9A A;  5DJM A;  2R0P A;  4LLR A;  5IMA A;  4TOP A;  5L71 A;  4QQ7 A;  4OCE A;  3IC4 A;  3VFI A;  1JZO A;  1BED A;  4TN8 A;  2H8L A;  3CYN A;  5DQS A;  3FK8 A;  3VLN A;  1O7U A;  2H71 A;  3ZLP A;  1PKW A;  2H76 A;  2VOC A;  2JZR A;  3M1G A;  2O87 A;  1ABA A;  1OE7 A;  5GAN D;  3CRT A;  2FUG 2;  2MYG A;  1PN0 A;  4Q5Q A;  2HNL A;  1SL1 B;  3TKQ A;  1TRV A;  4Z2U A;  2WGR A;  2FWG A;  3ZVJ D;  3TCO A;  20GS A;  3TGZ A;  3F8U A;  2X49 A;  2JZS A;  4KH7 A;  4JR6 A;  2WJU A;  2GSQ A;  3MIX A;  2MMN A;  4Q5F A;  4V2L A;  1OC8 A;  2LRC A;  4K2X A;  4WF5 A;  1M3J A;  1TP9 A;  4WXT A;  4K5S A;  2V6K A;  4ECB A;  2GGT A;  1GWC A;  4IP1 A;  4MZC A;  1XW9 A;  1JZW A;  2HZE A;  4KUN A;  4MAB A;  5G5F A;  3HVN A;  1JZR A;  1EGR A;  2JSZ A;  4IGJ A;  2XC2 A;  3P7X A;  4QL9 A;  5ECO B;  5B6N A;  1C72 A;  1YZX A;  4WEY A;  1GL8 A;  1XCC A;  3QOU A;  1XVW A;  1T4Z A;  4NPB A;  1SL2 B;  2P0G A;  4K7I A;  3O6T A;  4TXV A;  1UVZ A;  2M72 A;  4Q5R A;  2YWM A;  2HFD A;  5AN1 A;  4GQF A;  4K8M A;  4WR4 A;  2GQL A;  2H6X A;  1WWJ A;  1YKC A;  2K8V A;  5GZZ B;  2LST A;  2WRT A;  2FCH A;  3DVX A;  3VUR A;  3TRQ A;  1GSY A;  5COH A;  1THX A;  5HFK A;  1PX7 A;  4KDY A;  1E6B A;  5F07 A;  3M8N A;  2DKH A;  1V98 A;  3RPP A;  2VLT A;  1DE2 A;  2C3T A;  1FAA A;  4GSS A;  3PR8 A;  4Q5N A;  5C00 A;  1OYJ A;  1A2J A;  4QL7 A;  4ECI A;  4PUF C;  4V1A p;  1AC1 A;  1K3O A;  2OBI A;  4EUY A;  5EVO A;  2H1A A;  2DLX A;  5DCG A;  1WOU A;  1LJR A;  4JU5 A;  2MBS A;  1QMV A;  3EU3 A;  2NDO A;  4CY8 A;  3RDW A;  4K6X A;  3D22 A;  5G5E A;  3TKP A;  3IA1 A;  2LNS A;  4FIW A;  4BVX B;  3KMN A;  4E8E A;  5HR3 A;  4ZL8 A;  3CMI A;  2HZE B;  5CRG A;  1RW1 A;  3ME8 A;  1QGV A;  1SEN A;  4E8H A;  2YCD A;  2J23 A;  2GSS A;  2HE3 A;  14GS A;  1I5G A;  1GSE A;  3EE2 A;  3L9U A;  3IDV A;  2KHP A;  5G1K A;  2DML A;  5D9T A;  1K0M A;  4MF7 A;  4HZ2 A;  4BWS A;  1U87 A;  4ECJ A;  3CSJ A;  3WGX A;  5FT3 A;  3GKX A;  4YKG A;  2BTO T;  1HQO A;  4MJA A;  3TOU A;  4I5Q A;  1ZZY A;  1EP8 A;  2QGV A;  5DAK A;  5J9C A;  3TOT A;  1XWK A;  5ENU A;  1PD2 1;  2M80 A;  2H01 A;  3F6F A;  4F82 A;  2EIO A;  4N0V A;  2YZH A;  2A4V A;  1R4W A;  3LXZ A;  1M0U A;  1ON4 A;  5F0G A;  2B5E A;  3W8J A;  2A2P A;  1A0F A;  1B4Q A;  3F63 A;  1Q98 A;  3MAK A;  1AW9 A;  2FLS A;  1PGT A;  4TVE A;  3GTU A;  4JE1 A;  3GKM A;  1A8Y A;  4MJC A;  2O85 A;  1VF1 A;  3R3E A;  3EMP A;  4DSR A;  2GS3 A;  1O8X A;  4HU7 A;  3TKS E;  3IAM 2;  3H8Q A;  3DYR A;  3KH7 A;  4ZIL A;  3A2V A;  4NAX A;  2WB9 A;  2X8C A;  3J7Y k;  4KCE A;  3CXG A;  4K0G A;  2H1B A;  2VAF A;  4EDY A;  1SJI A;  3A2W A;  3HYP A;  4XRD A;  1F6M C;  4G10 A;  4EKZ A;  2HSH A;  3GUR A;  3R2Q A;  2D2Z A;  1TRS A;  2PGT A;  2DJJ A;  1FG4 A;  2A2S A;  2GT5 A;  1X5D A;  2VD0 A;  5HR2 A;  2AUV A;  5GSS A;  4F2I A;  3UL3 A;  3G7Y A;  2E2M A;  1AXD A;  1O85 A;  1OC9 A;  5C04 A;  4DEJ A;  2KLX A;  1J0F A;  2NPB A;  16GS A;  4FYU A;  4MP4 A;  1CQG A;  4G2E A;  4ML1 A; 
#chains in the Genus database with same CATH homology
 2EIR A;  2HRA A;  1SD9 A;  3GH6 A;  4XRA A;  2JL4 A;  2V32 A;  3UVT A;  4G0I A;  2OJL A;  1Z6N A;  2YJ7 A;  6GST A;  3PGT A;  2K8S A;  5DAK B;  4HS1 A;  3CRU A;  4POK A;  4ICY A;  3UIW A;  4K0N A;  4D73 A;  1G7O A;  1NW2 A;  5G2Z A;  2Z9S A;  1X9W B;  4G9H A;  1ST9 A;  1YEX A;  5A4V A;  4PXO A;  5JWQ B;  1GSF A;  5IMD A;  5J9B A;  3FHK A;  2VUP A;  1YDK A;  5CO3 A;  1F2E A;  4YKF A;  2B5X A;  1TOF A;  1Z6M A;  3ZML A;  4H86 A;  2LQQ A;  1NSW A;  3CTF A;  1XFL A;  2O8V B;  3PPU A;  1J08 A;  1MTC A;  4AF2 A;  3C73 A;  2IFQ A;  2GT6 A;  2FGX A;  1WIK A;  4IJ3 A;  3ZRD A;  1B9Y C;  4G19 A;  1QXH A;  5HR0 A;  2OKA A;  1TXX A;  2WFC A;  4EE0 A;  2QA1 A;  1AIU A;  2DKI A;  1TK5 B;  4IHU A;  3ERF A;  3MNG A;  4OD7 A;  2BMX A;  2VCZ A;  2C3N A;  2H1D A;  1T00 A;  1ZYE A;  5EPF A;  1F9M A;  4OO4 A;  3WYW A;  2YNX A;  3C8E A;  4WF4 A;  1EGO A;  1HD2 A;  2HZF A;  3DXB A;  3ZIV A;  4WBJ A;  1OC9 B;  1THO A;  1U3A A;  5D9X A;  3GA4 A;  1VF3 A;  3RPN A;  1GTA A;  2CAI A;  2FY6 A;  4OCF A;  4YQV A;  1DBY A;  4L5L A;  3I9V 2;  4KDX A;  4RI7 A;  3KZQ A;  2QKE A;  2A4H A;  2H19 A;  1T4Y A;  1F37 A;  4PGT A;  5CNW A;  5J5N A;  4XCS A;  1B48 A;  2R3X A;  3W6G A;  3D21 A;  4HI7 A;  4NMU A;  2YWI A;  3I43 A;  5DCH A;  4ZL7 A;  4MCU A;  5GST A;  1M7T A;  3FR6 A;  2H1G A;  4PUR A;  4CHS A;  2N5B A;  3TRP A;  3VWU A;  1ERW A;  4MMM A;  3DGQ A;  2C4J A;  2K18 A;  4I6X A;  4LL4 B;  2ZCT A;  3ERG A;  3H79 A;  1EP7 A;  4TR1 A;  2WZ9 A;  1GUL A;  2IFQ B;  5FHI A;  4GQC A;  1BX9 A;  2CZ3 A;  1U3I A;  1K3L A;  3VWV A;  3DIE A;  2H66 A;  2TIR A;  1M2A A;  3VPT A;  4IBP A;  2R0C A;  4L0U A;  3FKF A;  4BPY A;  5IIZ A;  4EO3 A;  4EVM A;  2C0D A;  2OAC A;  4N10 A;  4BA7 A;  1G6W A;  3CSH A;  22GS A;  1J9B A;  4NHW A;  2PMT A;  1YY7 A;  2ZNM A;  4MJE A;  2F9S A;  3D5J A;  2GZZ A;  4CDO A;  4NV2 A;  1I9D A;  3APQ A;  5KN1 A;  5ID2 A;  4KSM A;  5ECK B;  3TRX A;  4TW5 A;  3P90 A;  2CZ2 A;  3A5W A;  3RHC A;  1O73 A;  4DVC A;  1B9X C;  2JU5 A;  2VIM A;  4FQU A;  4BWQ A;  4LMV A;  1YKA A;  3JCM L;  2WCI A;  4POL A;  1GSD A;  2H70 A;  1SK0 A;  2HSY A;  4J2F A;  2XBI A;  1MDJ A;  2DC5 A;  4O7H A;  1ACV A;  5HFG A;  3F4T A;  3E0U A;  2PER A;  3GKN A;  4POB A;  5JWR B;  4IVF A;  3L9S A;  4PTS A;  1AQX A;  1O8W A;  1MDI A;  5ECN B;  2V2G A;  2CAQ A;  1WMJ A;  1AAZ A;  5CRH A;  3DRN A;  3FMW A;  2H0H A;  4MPF A;  5IO0 A;  2LS5 A;  4G0L A;  4CY6 A;  1GUH A;  3UOM A;  4BL7 A;  2LJK A;  3TJJ A;  4PQH A;  4TR1 B;  1GUK A;  5HFI A;  3TJG A;  6GSS A;  5H5Q A;  1Y6E A;  2VL9 A;  3TDG A;  3HJM A;  2N5A A;  3UEM A;  4GWR A;  5IMV A;  4HUA A;  1GSU A;  3IXR A;  3ZRE A;  1XWG A;  2DMM A;  1SYR A;  2QC7 A;  1X9S B;  1LBK A;  4WBR D;  2VCT A;  5KN2 A;  3ZFL A;  2TRX A;  2K9F A;  3IK7 A;  2PVO C;  2DJ0 A;  3UBL A;  4FO5 A;  4OMV A;  3RBT A;  4FH8 A;  4EIQ A;  1BQ7 A;  2H6Y A;  2MMA A;  2AHE A;  2CV4 A;  5IMF A;  1GH2 A;  4MNN A;  1GLP A;  3QPM A;  2GZP A;  1V9W A;  3HXS A;  3CSI A;  3GKK A;  2CA8 A;  3KM6 A;  1VGL A;  2X64 A;  1EWX A;  1BYE A;  4NXI A;  1VRS D;  4NHZ A;  1SKW B;  2RM6 A;  3HZ8 A;  3UAR A;  1X9M B;  1DE1 A;  4MJB A;  2P31 A;  3VWX A;  17GS A;  2FA4 A;  3TKR A;  1FHE A;  2C0G A;  4F0C A;  4O32 A;  3TJK A;  5J3R A;  2DIZ A;  2V1M A;  4IEL A;  1XVQ A;  2H73 A;  3AY8 A;  2VLU A;  1S3A A;  3BOA A;  4MLY A;  2H6Z A;  3TKS A;  5ABR A;  2GQK A;  5IO2 A;  1Q4J A;  2R0G A;  4XHM A;  2HSM A;  2FNO A;  1KEB A;  3QD9 A;  3IBH A;  1R5A A;  3L9V A;  3C1R A;  1B8X A;  4L8E A;  4BL7 B;  1MEK A;  4V2N A;  4OWY A;  3IR4 A;  2OE0 A;  3LOR A;  1T1V A;  2IJY A;  5JCG A;  2DJ2 A;  3D6I A;  18GS A;  3WD6 A;  2MZC A;  4KGI A;  3LEF A;  5IOX A;  2JZT A;  1PA3 A;  2X8H A;  3WGD A;  3OR5 A;  4TKY A;  3VWW A;  2FWE A;  5J41 A;  3DKS A;  5AIX A;  3SBC A;  2V41 A;  2HLS A;  3GV1 A;  2V6O A;  2IPA A;  3NZN A;  1XOA A;  1EZK A;  4OFM A;  2GTU A;  2LUS A;  3U6V A;  2I3Y A;  1ZL9 A;  13GS A;  1QQ2 A;  2PN8 A;  2YV7 A;  4MPG A;  4JZQ A;  4YH2 A;  4J56 E;  4KA0 A;  3F9U A;  2OA7 A;  1Z9H A;  1XXU A;  3LXT A;  5ECQ B;  1FVK A;  2YZU A;  1H75 A;  3D4M A;  3F3R A;  2H74 A;  4OFT A;  2CVD A;  4KDU A;  7GSS A;  2H30 A;  3A5I A;  2C80 A;  4XS4 A;  3TUE A;  2O89 A;  4AJ7 A;  1TJD A;  2XPD A;  5IPG A;  5D73 A;  1URM A;  2OBK A;  3FZ5 A;  3PIN A;  4YQU A;  4IN0 A;  5AIS A;  3HDC A;  4ID0 A;  1DSB A;  3SWL A;  1XIY A;  2VCW A;  5H5S A;  1K3Y A;  2O7K A;  2C8U A;  5KN0 A;  4FYB A;  3W8S A;  5B8A A;  1R7H A;  3TKS C;  5G31 A;  2LRT A;  4K9Z A;  2TRC P;  2LTK A;  5DAL A;  5F8B A;  2H0G A;  2PBJ A;  5KOW A;  1EOG A;  2LNT A;  1SJ6 A;  1FVJ A;  3HD5 A;  4EC0 A;  2R4V A;  3KJY A;  2I81 A;  2F3M A;  4JED A;  5G30 A;  3QR6 A;  3ERW A;  4USS A;  4KB3 A;  2HYX A;  2MMO A;  2YWN A;  2C0E A;  4XS1 A;  1M99 A;  1A8L A;  2P5Q A;  4IQ1 A;  3GYK A;  2DJK A;  3ZFB A;  2FA8 A;  4IKH A;  3LYK A;  4ISD A;  2M46 A;  3O3T A;  2AAW A;  3HHV A;  2HT9 A;  3FYG A;  2R37 A;  2J9H A;  6GSW A;  4LL1 B;  5JWO B;  1PKZ A;  1M2D A;  1IYI A;  1O6J A;  4K7N A;  3FZA A;  1K0C A;  1FB0 A;  1F3A A;  2DIY A;  2B5Y A;  4IJI A;  2PVQ A;  4O5Q A;  3KH9 A;  4HEA 2;  1YF1 A;  4IS0 A;  2L5O A;  4KCA A;  1KNG A;  4GXZ A;  2H72 A;  2A2R A;  4EXJ A;  3GTU B;  3LQ7 A;  3L4N A;  4KE3 A;  4X43 A;  3EC3 A;  1EEM A;  2B6M A;  4KX4 A;  2PUK C;  3MWH A;  5BRT A;  3ZIJ A;  4BVY A;  1A2M A;  2B7K A;  4N0Z A;  2ZUP A;  3GL3 A;  5CRD A;  1MD3 A;  2RUF A;  3M9J A;  3IRA A;  4YAV A;  3CBU A;  5D8I A;  4O5R A;  1GTU A;  1PMT A;  4FYC A;  2IIY A;  4L0W A;  4YAP A;  2PPT A;  3H4K A;  3L0H A;  3KTB A;  5DJL A;  4XIH A;  5CRE A;  3HCZ A;  4TXO A;  3P2A A;  3IOS A;  5KN3 A;  3GNJ A;  1T8E B;  2AB6 A;  5ECR B;  4HQS A;  1RK4 A;  2KP1 A;  4O5U A;  2VL2 A;  3GX0 A;  2OAD A;  4EF0 A;  1TTZ A;  3GUS A;  4Z2T A;  2L6C A;  1WE0 A;  4PX1 A;  4I2U A;  3FZ4 A;  3IHQ A;  2B1K A;  5IPH A;  2C1Y A;  3MDK A;  4RI6 A;  1RQM A;  4PNF A;  1SK2 A;  5B8B A;  9GSS A;  3C71 A;  3FR9 A;  1G6Y A;  4JBB A;  3KCM A;  1XOB A;  3H1N A;  4POM A;  2IMK A;  4PQI A;  4EDZ A;  1TDI A;  5B6M A;  1BAY A;  4PQ1 A;  1TI1 A;  1XW5 A;  3LW9 A;  3M9K A;  4TR0 A;  1PQN A;  2H75 A;  4D73 B;  1V57 A;  5GAP D;  3WT2 A;  4PUA A;  1WPI A;  2NVL A;  3HKR A;  3L78 A;  1A2L A;  3ZIT A;  2IWT A;  3F0I A;  2CVK A;  3Q18 A;  5INY A;  5ECL B;  1NHO A;  3MYD A;  1FOV A;  3KD0 A;  5DBQ A;  1PX6 A;  5CYY A;  2GZY A;  5D9V A;  2LKU A;  1TW9 A;  3IHG A;  2IMF A;  2CQ9 A;  4BVY B;  1M2B A;  3KTL A;  2WS2 A;  2YAN A;  2QSI A;  1A23 A;  4WKW A;  4IW9 A;  2FD3 A;  1Y25 A;  3GRX A;  1OKT A;  4AJ6 A;  3TB2 A;  1YJ6 A;  2K6V A;  2L4C A;  3KP8 A;  3K8N A;  4WR5 A;  2HRK A;  1VF2 A;  3U5R E;  4XTS A;  1F3B A;  2AJQ B;  2E2G A;  3QAW A;  1GSS A;  2VL2 C;  1ZGN A;  4X1U A;  1B4P A;  1N8J A;  5IMC A;  1LU4 A;  3FZ9 A;  3QMX A;  1ERT A;  5ECI B;  4ACS A;  2I9H A;  5ECH B;  4GTU A;  4RUV A;  3GX8 A;  1E2Y A;  1EV9 A;  2L59 A;  5JCU A;  1X5E A;  2FWF A;  5BMU A;  3KP9 A;  2GLR A;  1X5C A;  3G7J A;  3LSZ A;  3S9F A;  4IQA A;  3Q19 A;  4JR4 A;  1T3B A;  2EC4 A;  2YPM A;  3IPZ A;  4ZBB A;  2DSA A;  3ZYW A;  3NIV A;  4HZ4 A;  4CW9 A;  2C3Q A;  4MF5 A;  3APS A;  1SK1 A;  1OKD A;  3GL5 A;  3ME7 A;  5ELA A;  3HA9 A;  1M9B A;  3HVS A;  4GLT A;  5CP1 A;  3GN3 A;  2F51 A;  5ECP B;  2L5L A;  1XWA A;  3GSS A;  4K7O A;  1GTI A;  2JAD A;  2P5R A;  4RQR A;  2VCQ A;  5A4U A;  3WT1 A;  2LRN A;  5IMZ A;  1SKS B;  3HVV A;  4BVX A;  1SJZ A;  4JRR A;  4OO5 A;  3HJO A;  3RHB A;  11GS A;  3QAG A;  1ERU A;  3V1W A;  1QFN A;  5EY6 A;  1FO5 A;  2WUL A;  5CAX A;  3GHA A;  3VI7 A;  2REM A;  2DJ3 A;  1G0T A;  4P3Y B;  1ILO A;  2ES7 A;  5IOW A;  4KW6 A;  4J57 E;  4HDE A;  1PSQ A;  2RII A;  3HVX A;  4HJ2 A;  3UVH A;  1BG5 A;  2B7J A;  1TRU A;  3J7Y b;  4L5O A;  2IME A;  5ID2 B;  1MDK A;  2I1U A;  5H5R A;  1TU8 A;  5DQY A;  1SU9 A;  1A24 A;  2E7P A;  1ZYN A;  3QDN A;  1EV4 A;  4MZB A;  1TRW A;  2CT6 A;  3N9J A;  3H93 A;  2L6D A;  1G7E A;  1W89 A;  2H0I A;  3FR3 A;  1K0D A;  2BJX A;  4MK3 A;  1Z5Y E;  1CQH A;  2HRN A;  3DWV A;  2I4A A;  1TKD B;  3DD3 A;  1JZD A;  5DVB A;  5HR1 A;  2IMI A;  3VI5 A;  3RAZ A;  3PH9 A;  4K5R A;  2AYT A;  1OVN A;  1HNA A;  5FWG A;  3EWL A;  2LEG A;  2JSY A;  2JAC A;  2PWJ A;  2YN1 A;  3A3T A;  5AIV A;  2C0F A;  1AQW A;  1USB A;  4LMW A;  1SKR B;  3EVI A;  1XW6 A;  1ML6 A;  3ED3 A;  4V2M A;  2LQO A;  3BBY A;  4HQZ A;  2CX4 A;  4HOJ A;  5E4W A;  1FW1 A;  1PL1 A;  1Z3E A;  2DBC A;  3M0F A;  3ZMK A;  5LD0 A;  2PU9 C;  5E59 A;  6GSV A;  3IE3 A;  1BJX A;  3DVW A;  4I8B A;  3Q6O A;  4I2T A;  4K2D A;  4IP6 A;  2RUE A;  2VM2 A;  1HNC A;  3ZVJ A;  2IN3 A;  2KOK A;  4XS6 A;  1DUG A;  1ZMA A;  3ZL5 A;  3HZ4 A;  2LJA A;  3VK9 A;  2MMZ A;  3HJP A;  1SL0 B;  2N5F A;  2GQM A;  1S3C A;  2VD1 A;  4X4J A;  1TK8 B;  2FHE A;  1V2A A;  4MF6 A;  1Z7R A;  3IC8 A;  1K0A A;  3HY2 A;  4TR3 A;  3GIX A;  3IAS 2;  1HYU A;  3UBK A;  2F8F A;  1OE8 A;  1H4O A;  3VPQ A;  3QCP A;  1WRY A;  2ON7 A;  3FEU A;  4DSS A;  4Z7X A;  2WDU A;  2ON5 A;  2YJH A;  4LA1 A;  4ZB8 A;  1XBS A;  3KMO A;  2GDR A;  1QUW A;  4EL1 A;  1JHB A;  2R2J A;  5DDL A;  1K0B A;  1R26 A;  3P8W A;  3US3 A;  1K0O A;  2R6K A;  1QK8 A;  3EYT A;  2VCV A;  3G9B A;  3KGK A;  4V1A g;  3CTG A;  1TK0 B;  3EPT A;  3FY7 A;  4OFN A;  2IMD A;  1GP1 A;  4GF0 A;  3FW2 A;  1NHY A;  4KSO A;  8GSS A;  3EIN A;  3F6D A;  3DEX A;  4GST A;  10GS A;  3D0Z A;  1XPV A;  2OE1 A;  4MH2 A;  2YWO A;  1GNE A;  4ZXG A;  1UA5 A;  1ZYP A;  4AGS A;  1WP0 A;  12GS A;  4NWY A;  3I69 A;  3F4R A;  5J4U A;  4DSQ A;  3FRC A;  1PRX A;  2XBQ A;  3NOF A;  5AGY A;  3UAP A;  3BCI A;  1JFU A;  4WET A;  1S3D A;  2NBS A;  4F03 A;  1YF0 A;  4HU9 A;  1OAZ A;  1GUM A;  2LV3 A;  19GS A;  4GSN A;  5JCW A;  5LNK e;  4KAE A;  1TU7 A;  3DML A;  5ECS A;  2AV4 A;  3LYP A;  5D96 A;  5D9W A;  3LGC A;  3D4T A;  3ISO A;  1OC3 A;  3TJF A;  2KP2 A;  2L57 A;  3UJ1 A;  3LG6 A;  3KEB A;  1AUC A;  1VF4 A;  1X0R A;  3E9J B;  3BD2 A;  3EUR A;  3QAV A;  4HJM A;  2UZ8 A;  4RQX A;  2G0F A;  2VO4 A;  1GRX A;  3C1S A;  1XWB A;  1O81 A;  1YQ1 A;  3IK9 A;  3WGE A;  3BJ5 A;  3F3Q A;  5A4W A;  3N5O A;  6GSU A;  1WJK A;  4ECC A;  4F0B A;  1JLV A;  3LFL A;  5ECM B;  3ZZX A;  5B7C A;  4DSS B;  4TRX A;  5G1L A;  5IM9 A;  1GLQ A;  5F06 A;  4NV5 A;  2YP6 A;  4N11 A;  1XZO A;  2R5G A;  1YEP A;  2ALB A;  3EU4 A;  4I97 A;  4MH3 A;  3GFK A;  1Z7P A;  3GH9 A;  1KBN A;  4ZL9 A;  5HQP A;  3IV4 A;  4GCI A;  4XS4 B;  1PL2 A;  2IL3 A;  1PN9 A;  4EIP A;  1W4V A;  4Z2R A;  4PNG A;  1EEJ A;  1KTE A;  3Q74 A;  3G7I A;  1ZYQ B;  4MDC A;  1MD4 A;  1NM3 A;  1ZCP A;  5IQY A;  1ZOF A;  1IYH A;  4G0K A;  1K0N A;  3KIJ A;  4YQM A;  2X99 A;  5DAL B;  4ZBA A;  1R5P A;  1U88 A;  4ZB9 A;  2OE3 A;  2NTO A;  4ILF A;  2XPE A;  4KF9 A;  1XWC A;  1SYX A;  4TR4 A;  1UC7 A;  3GMF A;  1FB6 A;  1ERV A;  2F8A A;  2GVP A;  2KUC A;  3QFB C;  3A2X A;  4ZB6 A;  2FWH A;  3APO A;  2YOI A;  3EMX A;  2HRF A;  4F9Z A;  2E0Q A;  3MSZ A;  1SD8 A;  1V58 A;  4ULX A;  3I6A A;  5EL8 A;  4MZW A;  2RLI A;  2LJR A;  4KND A;  1TI3 A;  1V40 A;  2HI7 A;  2L4Q A;  5D93 A;  4K1F A;  1GTB A;  3LJR A;  2GST A;  3KXO A;  4AJ8 A;  3M3M A;  2G2Q A;  2VL3 A;  5ELG A;  4A5P A;  1N2A A;  4GRF A;  2CVB A;  6GSY A;  1UN2 A;  2DJ1 A;  4ML6 A;  2B3S A;  3QFA C;  4X0X A;  6GSX A;  2EIQ A;  5CRW A;  2XHF A;  5KEJ A;  3TJB A;  4ZIJ A;  2CX3 A;  2X8G A;  2VLV A;  1AQV A;  2GSR A;  1JLW A;  2VM1 A;  3F4S A;  4MA9 A;  1FOH A;  4O92 A;  2QA2 A;  4ZBD A;  1GSQ A;  1A0R P;  1GNW A;  5LCZ A;  2X4A A;  3E3E A;  4TXO B;  2VCX A;  3ZTL A;  3C7M A;  3GST A;  3UMA A;  5KOX A;  2HXK A;  1U6T A;  1HNB A;  1EOH A;  3LWA A;  5F05 A;  2YV9 A;  3BCK A;  5A5K A;  2RM5 A;  3O76 A;  4N30 A;  1T7P B;  2MBT A;  2B1L A;  1M9A A;  5DJM A;  2R0P A;  4LLR A;  5IMA A;  4TOP A;  5L71 A;  4QQ7 A;  4OCE A;  3IC4 A;  3VFI A;  1JZO A;  1BED A;  4TN8 A;  2H8L A;  3CYN A;  5DQS A;  3FK8 A;  3VLN A;  1O7U A;  2H71 A;  3ZLP A;  1PKW A;  2H76 A;  2VOC A;  2JZR A;  3M1G A;  2O87 A;  1ABA A;  1OE7 A;  5GAN D;  3CRT A;  2FUG 2;  2MYG A;  1PN0 A;  4Q5Q A;  2HNL A;  1SL1 B;  3TKQ A;  1TRV A;  4Z2U A;  2WGR A;  2FWG A;  3ZVJ D;  3TCO A;  20GS A;  3TGZ A;  3F8U A;  2X49 A;  2JZS A;  4KH7 A;  4JR6 A;  2WJU A;  2GSQ A;  3MIX A;  2MMN A;  4Q5F A;  4V2L A;  1OC8 A;  2LRC A;  4K2X A;  4WF5 A;  1TP9 A;  4WXT A;  4K5S A;  2V6K A;  4ECB A;  2GGT A;  1GWC A;  4IP1 A;  4MZC A;  1XW9 A;  1JZW A;  2HZE A;  4KUN A;  4MAB A;  5G5F A;  1JZR A;  1EGR A;  2JSZ A;  4IGJ A;  2XC2 A;  3P7X A;  4QL9 A;  5ECO B;  5B6N A;  1C72 A;  1YZX A;  4WEY A;  1GL8 A;  1XCC A;  3QOU A;  1XVW A;  1T4Z A;  4NPB A;  1SL2 B;  2P0G A;  4K7I A;  3O6T A;  4TXV A;  1UVZ A;  2M72 A;  4Q5R A;  2YWM A;  2HFD A;  5AN1 A;  4GQF A;  4K8M A;  4WR4 A;  2GQL A;  2H6X A;  1WWJ A;  1YKC A;  2K8V A;  5GZZ B;  2LST A;  2WRT A;  2FCH A;  3DVX A;  3VUR A;  3TRQ A;  1GSY A;  5COH A;  1THX A;  5HFK A;  1PX7 A;  4KDY A;  1E6B A;  5F07 A;  3M8N A;  2DKH A;  1V98 A;  3RPP A;  2VLT A;  1DE2 A;  2C3T A;  1FAA A;  4GSS A;  3PR8 A;  4Q5N A;  5C00 A;  1OYJ A;  1A2J A;  4QL7 A;  4ECI A;  4PUF C;  4V1A p;  1AC1 A;  1K3O A;  2OBI A;  4EUY A;  5EVO A;  2H1A A;  2DLX A;  5DCG A;  1WOU A;  1LJR A;  4JU5 A;  2MBS A;  1QMV A;  3EU3 A;  2NDO A;  4CY8 A;  3RDW A;  4K6X A;  3D22 A;  5G5E A;  3TKP A;  3IA1 A;  2LNS A;  4FIW A;  4BVX B;  3KMN A;  4E8E A;  5HR3 A;  4ZL8 A;  3CMI A;  2HZE B;  5CRG A;  1RW1 A;  3ME8 A;  1QGV A;  1SEN A;  4E8H A;  2YCD A;  2J23 A;  2GSS A;  2HE3 A;  14GS A;  1I5G A;  1GSE A;  3EE2 A;  3L9U A;  3IDV A;  2KHP A;  5G1K A;  2DML A;  5D9T A;  1K0M A;  4MF7 A;  4HZ2 A;  4BWS A;  1U87 A;  4ECJ A;  3CSJ A;  3WGX A;  5FT3 A;  3GKX A;  4YKG A;  2BTO T;  1HQO A;  4MJA A;  3TOU A;  4I5Q A;  1ZZY A;  1EP8 A;  2QGV A;  5DAK A;  5J9C A;  3TOT A;  1XWK A;  5ENU A;  1PD2 1;  2M80 A;  2H01 A;  3F6F A;  4F82 A;  2EIO A;  4N0V A;  2YZH A;  2A4V A;  1R4W A;  3LXZ A;  1M0U A;  1ON4 A;  5F0G A;  2B5E A;  3W8J A;  2A2P A;  1A0F A;  1B4Q A;  3F63 A;  1Q98 A;  3MAK A;  1AW9 A;  2FLS A;  1PGT A;  4TVE A;  3GTU A;  4JE1 A;  3GKM A;  1A8Y A;  4MJC A;  2O85 A;  1VF1 A;  3R3E A;  3EMP A;  4DSR A;  2GS3 A;  1O8X A;  4HU7 A;  3TKS E;  3IAM 2;  3H8Q A;  3DYR A;  3KH7 A;  4ZIL A;  3A2V A;  4NAX A;  2WB9 A;  2X8C A;  3J7Y k;  4KCE A;  3CXG A;  4K0G A;  2H1B A;  2VAF A;  4EDY A;  1SJI A;  3A2W A;  3HYP A;  4XRD A;  1F6M C;  4G10 A;  4EKZ A;  2HSH A;  3GUR A;  3R2Q A;  2D2Z A;  1TRS A;  2PGT A;  2DJJ A;  1FG4 A;  2A2S A;  2GT5 A;  1X5D A;  2VD0 A;  5HR2 A;  2AUV A;  5GSS A;  4F2I A;  3UL3 A;  3G7Y A;  2E2M A;  1AXD A;  1O85 A;  1OC9 A;  5C04 A;  4DEJ A;  2KLX A;  1J0F A;  2NPB A;  16GS A;  4FYU A;  4MP4 A;  1CQG A;  4G2E A;  4ML1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...