4TR6A

Crystal structure of dna polymerase sliding clamp from bacillus subtilis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
380
structure length
380
Chain Sequence
SHMKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Modes of Peptide Binding onto Replicative Sliding Clamps from Various Bacterial Origins.
pubmed doi rcsb
molecule keywords DNA polymerase III subunit beta
molecule tags Dna binding protein
source organism Bacillus subtilis
total genus 91
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00712 DNA_pol3_beta DNA polymerase III beta subunit, N-terminal domain
A PF02767 DNA_pol3_beta_2 DNA polymerase III beta subunit, central domain
A PF02768 DNA_pol3_beta_3 DNA polymerase III beta subunit, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.150.10 Alpha Beta Roll DNA Polymerase III; Chain A, domain 2 DNA Polymerase III, subunit A, domain 2 4tr6A01
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 4tr6A02
4MJPA 1PLRA 3RB9A 5IY4A 1IZ4A 1GE8A 3G65A 3QSBA 3F1VA 2ZVLA 3L0XA 2IJXA 3GGRA 4TRTA 4OVFA 5DA7A 4K74A 1IZ5A 2ZVKA 4MJRA 1JQJA 3FDSD 4TR7A 2IO4A 1U7BA 5AUJA 4RKIA 2ZVMA 3AIXA 2ZVWA 3AIZC 4PNUA 3G65B 3QSBB 4L6PA 2IZOB 3HI8A 2IX2C 3GGRB 3T0PA 2NTIC 3AIZA 4HK1A 2AVTA 2HIIC 2OD8A 1T6LA 5AH4A 3TBLA 1VPKA 3D1GA 2IO4B 3GPMA 2NTIA 2Z0LA 5AGUA 4K3QA 4S3IA 3V62B 3U5ZF 3AIXB 1UL1A 2ZVVA 5CFKA 1RXMA 1SXJF 3Q4JA 2HIKC 4TR8A 4K3PA 3I2MX 4N94A 5FRQA 2POLA 4K3LA 2NTIB 4YHRA 4OVHA 3P91A 1B77A 1W60A 5AGVA 4K3MA 4OVGA 3LX1A 3V60B 1B8HA 3BEPA 2IX2A 3IFVA 3D1FA 4K3RA 2HIIA 3L0WA 3K4XA 4PNWA 5DAIA 3LX2A 2XURA 2AWAA 4N96A 3A2FB 1UNNA 5IWDA 1VYMA 2HIKB 1PLQA 3A1JC 3P87A 1ISQA 5H0TA 4N95A 5A6DA 5IXAA 4CS5A 1MMIA 3PWEA 4N9AA 3G65C 1VYJA 4L60A 2IX2B 3A1JA 3V61B 3VKXA 2IZOC 1CZDA 2HIKA 3U61F 3GGRC 3U60F 2HIIB 1RWZA 4TSZA 5JNED 5AH2A 4N98A 5E0UA 3Q4LA 4K3OA 5E0TA 3WGWA 4MJQA 1RXZA 3GPNA 3P16A 1AXCA 1U76A 3D1EA 4D2GA 3Q4KA 4N99A 1YYPA 3A1JB 4ZTDA 4K3SA 5FVEA 3P83A 5E0VA 5HACA 4PNVA 4RJFA 5B7OA 4N97A 3PGEB 3FDSC 1JQLA 3F1WA 1OK7A 3L10A 1DMLA 3HSLX 4K3KA 1UD9A 4TR6A
chains in the Genus database with same CATH superfamily
4MJPA 1PLRA 3RB9A 5IY4A 1IZ4A 1GE8A 3G65A 3PGEA 3QSBA 3F1VA 2ZVLA 3L0XA 2IJXA 3GGRA 4TRTA 4OVFA 5DA7A 4K74A 1IZ5A 3L10B 2ZVKA 4MJRA 1JQJA 3FDSD 4TR7A 2IO4A 1U7BA 5AUJA 4RKIA 2ZVMA 3AIXA 2ZVWA 3AIZC 4PNUA 3G65B 3QSBB 4L6PA 2IZOB 3HI8A 3L0XB 2IX2C 3GGRB 3T0PA 2NTIC 3AIZA 4HK1A 2AVTA 2HIIC 2OD8A 1T6LA 5AH4A 3TBLA 1VPKA 3D1GA 2IO4B 3GPMA 2NTIA 2Z0LA 5AGUA 4K3QA 4S3IA 3V62B 3U5ZF 3AIXB 1UL1A 2ZVVA 5CFKA 1RXMA 1SXJF 3Q4JA 2HIKC 4TR8A 4K3PA 3I2MX 4N94A 5FRQA 2POLA 4K3LA 2NTIB 4YHRA 4OVHA 3P91A 1B77A 1W60A 5AGVA 4K3MA 3L0WB 4OVGA 3LX1A 3V60B 1B8HA 3BEPA 2IX2A 3IFVA 3D1FA 4K3RA 2HIIA 3L0WA 3K4XA 4PNWA 5DAIA 3LX2A 2XURA 2AWAA 4N96A 3A2FB 1UNNA 5IWDA 1VYMA 2HIKB 1PLQA 3A1JC 3P87A 1ISQA 5H0TA 4N95A 5A6DA 5IXAA 4CS5A 1MMIA 3PWEA 4N9AA 3G65C 1VYJA 4L60A 2IX2B 3A1JA 3V61B 3VKXA 2IZOC 1CZDA 2HIKA 3U61F 3GGRC 3U60F 2HIIB 1RWZA 4TSZA 5JNED 5AH2A 4N98A 5E0UA 3Q4LA 4K3OA 5E0TA 3WGWA 4MJQA 1RXZA 3GPNA 3P16A 1AXCA 1U76A 3D1EA 4D2GA 3Q4KA 4N99A 1YYPA 3A1JB 4ZTDA 4K3SA 5FVEA 3P83A 5E0VA 5HACA 4PNVA 4RJFA 5B7OA 4N97A 3PGEB 3FDSC 1JQLA 3F1WA 1OK7A 3L10A 1DMLA 3HSLX 4K3KA 1UD9A 4TR6A
chains in the Genus database with same CATH topology
4MJPA 1PLRA 3RB9A 5IY4A 1IZ4A 1GE8A 3G65A 3QSBA 3F1VA 2ZVLA 3L0XA 2IJXA 3GGRA 4TRTA 4OVFA 5DA7A 4K74A 1IZ5A 2ZVKA 4MJRA 1JQJA 3FDSD 4TR7A 2IO4A 1U7BA 5AUJA 4RKIA 2ZVMA 3AIXA 2ZVWA 3AIZC 4PNUA 3G65B 3QSBB 4L6PA 2IZOB 3HI8A 2IX2C 3GGRB 3T0PA 2NTIC 3AIZA 4HK1A 2AVTA 2HIIC 2OD8A 1T6LA 5AH4A 3TBLA 1VPKA 3D1GA 2IO4B 3GPMA 2NTIA 2Z0LA 5AGUA 4K3QA 4S3IA 3V62B 3U5ZF 3AIXB 1UL1A 2ZVVA 5CFKA 1RXMA 1SXJF 3Q4JA 2HIKC 4TR8A 4K3PA 3I2MX 4N94A 5FRQA 2POLA 4K3LA 2NTIB 4YHRA 4OVHA 3P91A 1B77A 1W60A 5AGVA 4K3MA 4OVGA 3LX1A 3V60B 1B8HA 3BEPA 2IX2A 3IFVA 3D1FA 4K3RA 2HIIA 3L0WA 3K4XA 4PNWA 5DAIA 3LX2A 2XURA 2AWAA 4N96A 3A2FB 1UNNA 5IWDA 1VYMA 2HIKB 1PLQA 3A1JC 3P87A 1ISQA 5H0TA 4N95A 5A6DA 5IXAA 4CS5A 1MMIA 3PWEA 4N9AA 3G65C 1VYJA 4L60A 2IX2B 3A1JA 3V61B 3VKXA 2IZOC 1CZDA 2HIKA 3U61F 3GGRC 3U60F 2HIIB 1RWZA 4TSZA 5JNED 5AH2A 4N98A 5E0UA 3Q4LA 4K3OA 5E0TA 3WGWA 4MJQA 1RXZA 3GPNA 3P16A 1AXCA 1U76A 3D1EA 4D2GA 3Q4KA 4N99A 1YYPA 3A1JB 4ZTDA 4K3SA 5FVEA 3P83A 5E0VA 5HACA 4PNVA 4RJFA 5B7OA 4N97A 3PGEB 3FDSC 1JQLA 3F1WA 1OK7A 3L10A 1DMLA 3HSLX 4K3KA 1UD9A 4TR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJP A;  1PLR A;  3RB9 A;  5IY4 A;  1IZ4 A;  1GE8 A;  3G65 A;  3QSB A;  3F1V A;  2ZVL A;  3L0X A;  2IJX A;  3GGR A;  4TRT A;  4OVF A;  5DA7 A;  4K74 A;  1IZ5 A;  2ZVK A;  4MJR A;  1JQJ A;  3FDS D;  4TR7 A;  2IO4 A;  1U7B A;  5AUJ A;  4RKI A;  2ZVM A;  3AIX A;  2ZVW A;  3AIZ C;  4PNU A;  3G65 B;  3QSB B;  4L6P A;  2IZO B;  3HI8 A;  2IX2 C;  3GGR B;  3T0P A;  2NTI C;  3AIZ A;  4HK1 A;  2AVT A;  2HII C;  2OD8 A;  1T6L A;  5AH4 A;  3TBL A;  1VPK A;  3D1G A;  2IO4 B;  3GPM A;  2NTI A;  2Z0L A;  5AGU A;  4K3Q A;  4S3I A;  3V62 B;  3U5Z F;  3AIX B;  1UL1 A;  2ZVV A;  5CFK A;  1RXM A;  1SXJ F;  3Q4J A;  2HIK C;  4TR8 A;  4K3P A;  3I2M X;  4N94 A;  5FRQ A;  2POL A;  4K3L A;  2NTI B;  4YHR A;  4OVH A;  3P91 A;  1B77 A;  1W60 A;  5AGV A;  4K3M A;  4OVG A;  3LX1 A;  3V60 B;  1B8H A;  3BEP A;  2IX2 A;  3IFV A;  3D1F A;  4K3R A;  2HII A;  3L0W A;  3K4X A;  4PNW A;  5DAI A;  3LX2 A;  2XUR A;  2AWA A;  4N96 A;  3A2F B;  1UNN A;  5IWD A;  1VYM A;  2HIK B;  1PLQ A;  3A1J C;  3P87 A;  1ISQ A;  5H0T A;  4N95 A;  5A6D A;  5IXA A;  4CS5 A;  1MMI A;  3PWE A;  4N9A A;  3G65 C;  1VYJ A;  4L60 A;  2IX2 B;  3A1J A;  3V61 B;  3VKX A;  2IZO C;  1CZD A;  2HIK A;  3U61 F;  3GGR C;  3U60 F;  2HII B;  1RWZ A;  4TSZ A;  5JNE D;  5AH2 A;  4N98 A;  5E0U A;  3Q4L A;  4K3O A;  5E0T A;  3WGW A;  4MJQ A;  1RXZ A;  3GPN A;  3P16 A;  1AXC A;  1U76 A;  3D1E A;  4D2G A;  3Q4K A;  4N99 A;  1YYP A;  3A1J B;  4ZTD A;  4K3S A;  5FVE A;  3P83 A;  5E0V A;  5HAC A;  4PNV A;  4RJF A;  5B7O A;  4N97 A;  3PGE B;  3FDS C;  1JQL A;  3F1W A;  1OK7 A;  3L10 A;  1DML A;  3HSL X;  4K3K A;  1UD9 A;  4TR6 A; 
#chains in the Genus database with same CATH topology
 4MJP A;  1PLR A;  3RB9 A;  5IY4 A;  1IZ4 A;  1GE8 A;  3G65 A;  3PGE A;  3QSB A;  3F1V A;  2ZVL A;  3L0X A;  2IJX A;  3GGR A;  4TRT A;  4OVF A;  5DA7 A;  4K74 A;  1IZ5 A;  3L10 B;  2ZVK A;  4MJR A;  1JQJ A;  3FDS D;  4TR7 A;  2IO4 A;  1U7B A;  5AUJ A;  4RKI A;  2ZVM A;  3AIX A;  2ZVW A;  3AIZ C;  4PNU A;  3G65 B;  3QSB B;  4L6P A;  2IZO B;  3HI8 A;  3L0X B;  2IX2 C;  3GGR B;  3T0P A;  2NTI C;  3AIZ A;  4HK1 A;  2AVT A;  2HII C;  2OD8 A;  1T6L A;  5AH4 A;  3TBL A;  1VPK A;  3D1G A;  2IO4 B;  3GPM A;  2NTI A;  2Z0L A;  5AGU A;  4K3Q A;  4S3I A;  3V62 B;  3U5Z F;  3AIX B;  1UL1 A;  2ZVV A;  5CFK A;  1RXM A;  1SXJ F;  3Q4J A;  2HIK C;  4TR8 A;  4K3P A;  3I2M X;  4N94 A;  5FRQ A;  2POL A;  4K3L A;  2NTI B;  4YHR A;  4OVH A;  3P91 A;  1B77 A;  1W60 A;  5AGV A;  4K3M A;  3L0W B;  4OVG A;  3LX1 A;  3V60 B;  1B8H A;  3BEP A;  2IX2 A;  3IFV A;  3D1F A;  4K3R A;  2HII A;  3L0W A;  3K4X A;  4PNW A;  5DAI A;  3LX2 A;  2XUR A;  2AWA A;  4N96 A;  3A2F B;  1UNN A;  5IWD A;  1VYM A;  2HIK B;  1PLQ A;  3A1J C;  3P87 A;  1ISQ A;  5H0T A;  4N95 A;  5A6D A;  5IXA A;  4CS5 A;  1MMI A;  3PWE A;  4N9A A;  3G65 C;  1VYJ A;  4L60 A;  2IX2 B;  3A1J A;  3V61 B;  3VKX A;  2IZO C;  1CZD A;  2HIK A;  3U61 F;  3GGR C;  3U60 F;  2HII B;  1RWZ A;  4TSZ A;  5JNE D;  5AH2 A;  4N98 A;  5E0U A;  3Q4L A;  4K3O A;  5E0T A;  3WGW A;  4MJQ A;  1RXZ A;  3GPN A;  3P16 A;  1AXC A;  1U76 A;  3D1E A;  4D2G A;  3Q4K A;  4N99 A;  1YYP A;  3A1J B;  4ZTD A;  4K3S A;  5FVE A;  3P83 A;  5E0V A;  5HAC A;  4PNV A;  4RJF A;  5B7O A;  4N97 A;  3PGE B;  3FDS C;  1JQL A;  3F1W A;  1OK7 A;  3L10 A;  1DML A;  3HSL X;  4K3K A;  1UD9 A;  4TR6 A; 
#chains in the Genus database with same CATH homology
 4MJP A;  1PLR A;  3RB9 A;  5IY4 A;  1IZ4 A;  1GE8 A;  3G65 A;  3QSB A;  3F1V A;  2ZVL A;  3L0X A;  2IJX A;  3GGR A;  4TRT A;  4OVF A;  5DA7 A;  4K74 A;  1IZ5 A;  2ZVK A;  4MJR A;  1JQJ A;  3FDS D;  4TR7 A;  2IO4 A;  1U7B A;  5AUJ A;  4RKI A;  2ZVM A;  3AIX A;  2ZVW A;  3AIZ C;  4PNU A;  3G65 B;  3QSB B;  4L6P A;  2IZO B;  3HI8 A;  2IX2 C;  3GGR B;  3T0P A;  2NTI C;  3AIZ A;  4HK1 A;  2AVT A;  2HII C;  2OD8 A;  1T6L A;  5AH4 A;  3TBL A;  1VPK A;  3D1G A;  2IO4 B;  3GPM A;  2NTI A;  2Z0L A;  5AGU A;  4K3Q A;  4S3I A;  3V62 B;  3U5Z F;  3AIX B;  1UL1 A;  2ZVV A;  5CFK A;  1RXM A;  1SXJ F;  3Q4J A;  2HIK C;  4TR8 A;  4K3P A;  3I2M X;  4N94 A;  5FRQ A;  2POL A;  4K3L A;  2NTI B;  4YHR A;  4OVH A;  3P91 A;  1B77 A;  1W60 A;  5AGV A;  4K3M A;  4OVG A;  3LX1 A;  3V60 B;  1B8H A;  3BEP A;  2IX2 A;  3IFV A;  3D1F A;  4K3R A;  2HII A;  3L0W A;  3K4X A;  4PNW A;  5DAI A;  3LX2 A;  2XUR A;  2AWA A;  4N96 A;  3A2F B;  1UNN A;  5IWD A;  1VYM A;  2HIK B;  1PLQ A;  3A1J C;  3P87 A;  1ISQ A;  5H0T A;  4N95 A;  5A6D A;  5IXA A;  4CS5 A;  1MMI A;  3PWE A;  4N9A A;  3G65 C;  1VYJ A;  4L60 A;  2IX2 B;  3A1J A;  3V61 B;  3VKX A;  2IZO C;  1CZD A;  2HIK A;  3U61 F;  3GGR C;  3U60 F;  2HII B;  1RWZ A;  4TSZ A;  5JNE D;  5AH2 A;  4N98 A;  5E0U A;  3Q4L A;  4K3O A;  5E0T A;  3WGW A;  4MJQ A;  1RXZ A;  3GPN A;  3P16 A;  1AXC A;  1U76 A;  3D1E A;  4D2G A;  3Q4K A;  4N99 A;  1YYP A;  3A1J B;  4ZTD A;  4K3S A;  5FVE A;  3P83 A;  5E0V A;  5HAC A;  4PNV A;  4RJF A;  5B7O A;  4N97 A;  3PGE B;  3FDS C;  1JQL A;  3F1W A;  1OK7 A;  3L10 A;  1DML A;  3HSL X;  4K3K A;  1UD9 A;  4TR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...