4TRXA

High-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution.
pubmed doi rcsb
molecule keywords THIOREDOXIN
molecule tags Electron transport
source organism Homo sapiens
total genus 19
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1990-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4trxA00
1TTZA 4ZB8A 2AHEA 3ERWA 3GUSA 3IR4A 2WFCA 2PUKC 3BCKA 1TKDB 4MPFA 3FR6A 3HJMA 4K8MA 4Q5FA 1BX9A 3LWAA 4O32A 4EKZA 4NAXA 4K6XA 2B5XA 1F3AA 5ABRA 1EP8A 1NHOA 3M1GA 5F8BA 2A2SA 2CVDA 3ZIVA 3BD2A 2F8FA 1TJDA 4N30A 1BJXA 3PR8A 3TKSC 2TIRA 1DBYA 5E4WA 1FW1A 3F9UA 1S3CA 1B4QA 4F9ZA 4O92A 4AJ8A 1O73A 1I5GA 1NW2A 1MTCA 2L6CA 3ZVJD 4OFNA 3UJ1A 2YANA 1W89A 2X8HA 1EV9A 3UBLA 2X8GA 3IK9A 1JZDA 4I2TA 2REMA 1QGVA 3BJ5A 1XW9A 1K0MA 2YP6A 1LU4A 1ZYEA 2C3NA 2TRXA 5IM9A 4OCEA 4YAPA 3GIXA 1IYIA 3IV4A 3CTFA 4V2LA 2H75A 1PA3A 4JE1A 2DJ1A 1F3BA 3HKRA 5DAKB 3LYPA 1Z9HA 4G19A 4HS1A 4GQFA 1TP9A 2OACA 1YDKA 1TRUA 3QAWA 1FAAA 4K0GA 3NIVA 1GTIA 5ID2A 2MBTA 4P3YB 4FH8A 2H1AA 1XOAA 2ES7A 2DJ0A 3QAGA 4AJ6A 3L9SA 1F37A 5D8IA 4XS4A 1SK1A 4F82A 3LEFA 4MZBA 2MBSA 3CRTA 1TW9A 2AAWA 3FZ5A 5F05A 4ID0A 2RUFA 5DALA 5D9VA 2M46A 4OCFA 2H1BA 2GQLA 3ZIJA 4TXVA 3A2XA 5D9WA 2IL3A 2XBIA 1VF4A 1H75A 1SK0A 9GSSA 4TVEA 2WRTA 5CO3A 3EINA 2C0GA 1HD2A 2QC7A 4ZL8A 1DE2A 5HFKA 5ECRB 3HY2A 3ME8A 4YAVA 5JCUA 2VCWA 4WXTA 1VF2A 5ECQB 3IA1A 2H71A 3WGEA 5IO2A 2P0GA 4MP4A 1XCCA 1ZGNA 1FOVA 3GKNA 1YKAA 2C0FA 3KH9A 2F8AA 2B5EA 3Q18A 3G7JA 1PX7A 3APQA 3TKPA 2H0GA 1V57A 5ECHB 5D9XA 3M9KA 1EOHA 5KN2A 4Q5QA 5AISA 4I97A 3P90A 2K8SA 1A24A 11GSA 2VLUA 1GSEA 2R6KA 5GSSA 4BWSA 2O7KA 4MF7A 5FT3A 3H8QA 4KGIA 3UIWA 2DMMA 3LSZA 4ML1A 1GSFA 3TRXA 3GN3A 1XFLA 4OD7A 3D4MA 4XCSA 4BVXA 1T1VA 5KEJA 4KW6A 2DJKA 5ECMB 2IFQA 1JFUA 4O5RA 4JU5A 2HYXA 4HJ2A 3GKXA 2H66A 4KAEA 3V1WA 4ACSA 2FWHA 3KD0A 1AIUA 3IC4A 4DSSB 5CYYA 1GH2A 1GSQA 2LRTA 1FG4A 1R4WA 3CSJA 3KMOA 2FUG2 2IMKA 7GSSA 3ZLPA 3MNGA 4LMWA 1V2AA 1K3YA 3EE2A 4EUYA 10GSA 4BWQA 2WZ9A 3GV1A 3HVVA 4FYBA 3KXOA 4EDZA 1TI3A 3ISOA 5KN1A 4KDUA 5D93A 3G7IA 2GZPA 1THXA 1ZYQB 1R7HA 5DCGA 4LA1A 4DEJA 1EOGA 1BYEA 8GSSA 1AQVA 3RHCA 3F0IA 3H4KA 3GA4A 1GNEA 1PSQA 2RUEA 4FYUA 3CRUA 2H6XA 2XBQA 2VCVA 1WP0A 2FWFA 1X9WB 5ELGA 3UAPA 2DIZA 5ECKB 1TI1A 2OA7A 2AJQB 3UBKA 1V98A 4PUAA 1FB6A 1ON4A 5B8AA 1TK8B 1MEKA 3GH6A 4KSOA 3TKSE 5J3RA 1VF3A 2LV3A 4K7OA 3FW2A 3QCPA 4ZB9A 2YV9A 1BAYA 2V6OA 4HDEA 1G6YA 3ZRDA 3HCZA 1BEDA 5DBQA 6GSYA 2HRFA 3LYKA 3GTUB 4GSNA 4EF0A 4LL1B 1X5DA 4ZBBA 3U5RE 3DWVA 2DSAA 3KGKA 2OE0A 4TXOA 2AUVA 2MMAA 4ECBA 2P5RA 2VL3A 2J23A 3D22A 3APOA 1Y6EA 3KTBA 1X0RA 2DJJA 5G1KA 2BMXA 1GSSA 3D4TA 3QFBC 3KM6A 4HQSA 2N5FA 1XWCA 2GSSA 2PVQA 3GL5A 3M9JA 1SKSB 4I6XA 1UVZA 1A2MA 5CRGA 2CV4A 1PN9A 3E0UA 3GYKA 2KLXA 1J0FA 4J2FA 4GCIA 3EMPA 3WT1A 2OE1A 3HJPA 1PL2A 2AYTA 5ELAA 1K3LA 4V1Ag 18GSA 3F4TA 2PVOC 2IMIA 4XTSA 2RIIA 1EZKA 5J9CA 3QD9A 3VI7A 1DE1A 1N2AA 3TJBA 2C3QA 4L5OA 5J5NA 4MF5A 4TR3A 1MDIA 3FEUA 3WD6A 4Z7XA 1RW1A 1G7EA 4EL1A 2FCHA 3DEXA 1TDIA 2WJUA 3LGCA 4AJ7A 2I9HA 3F3QA 4OO4A 4MH2A 2C3TA 2L59A 4XRDA 1TOFA 2GS3A 4IJIA 5A4UA 5IQYA 3TGZA 3QPMA 4MJBA 2E2GA 3WGDA 4PQIA 5DVBA 1AW9A 5DQSA 1R5PA 3H1NA 2VCZA 1PX6A 4IBPA 1EEJA 2YOIA 1YF0A 3TDGA 5B6MA 1AAZA 1A0RP 2PBJA 2IMFA 2LKUA 20GSA 1GSUA 4OWYA 5IMFA 1K0DA 1GNWA 4I2UA 1BG5A 1ACVA 3C71A 3GSTA 2YWOA 2JL4A 3VWWA 2B5YA 6GSTA 5IOXA 5ECSA 5JCWA 4K7NA 1UA5A 4WF4A 4HU9A 2YJ7A 4HZ2A 5CRHA 1TK0B 1PGTA 1WPIA 3C73A 5ID2B 5IMZA 4IGJA 2AV4A 2E0QA 2M80A 5DDLA 2IIYA 4L8EA 4G2EA 2IWTA 3TJKA 5L71A 5HQPA 4WKWA 3M3MA 2E2MA 1GP1A 4XS4B 3CSIA 3D5JA 3L4NA 4HUAA 3GURA 1OC9A 2Z9SA 1OC3A 3FZAA 2L5LA 3DGQA 4MK3A 2YCDA 3F6FA 5A4WA 4TKYA 3FRCA 1DUGA 3DKSA 1S3DA 5HR1A 1M99A 4WETA 4XRAA 4XHMA 1O85A 4JEDA 1A2JA 2ZUPA 4IJ3A 4K0NA 2A4VA 3AY8A 4KCEA 2GQKA 2OBKA 2GTUA 1V58A 2JU5A 4PXOA 2LQOA 2LTKA 1SJIA 2YWIA 2NTOA 5IO0A 1TRWA 2YN1A 1GUHA 2HXKA 5HFIA 5C04A 4POLA 5C00A 2O8VB 4K9ZA 4WBJA 4XS1A 5AIXA 1Z7RA 3VK9A 4MABA 4ECCA 1TU7A 2X99A 4GSTA 4TR0A 3LG6A 2YZUA 2PERA 4DSQA 1Z3EA 1O6JA 4TR1B 5LD0A 2TRCP 3I6AA 1ABAA 4TW5A 1WIKA 2H19A 2HZEA 1PRXA 4IS0A 2GDRA 1QUWA 3IAM2 1GLPA 3WYWA 1XWGA 3NOFA 2WCIA 3L0HA 3CMIA 5EVOA 1WOUA 3VURA 5GAND 2PWJA 1R26A 4CDOA 2DLXA 4F0CA 3TKQA 2NBSA 2IFQB 2GGTA 1AUCA 1YY7A 4NV2A 5ECLB 1G7OA 4LMVA 1GWCA 3GFKA 1ML6A 3F4RA 3DRNA 1ERUA 2FY6A 4AF2A 1SK2A 4BL7A 2BTOT 1J08A 1XWBA 2FD3A 1CQHA 4IELA 2CT6A 5F0GA 3TRQA 1ERWA 1U87A 4ZB6A 5IPGA 3TB2A 6GSXA 3C1SA 3BOAA 3D0ZA 1K0NA 1GLQA 4PGTA 2CX3A 1SENA 2HT9A 4MPGA 3ZVJA 3TOUA 1B8XA 3CXGA 2P31A 4L0WA 3UVTA 1VRSD 3ZL5A 2GSTA 2JSYA 3IOSA 1VF1A 1SKRB 1ERVA 3LQ7A 1E6BA 2VAFA 4KX4A 3ME7A 1X5CA 2YNXA 2C1YA 5CRWA 3WGXA 2B3SA 3EC3A 4CW9A 3IHQA 2VD0A 5E59A 5ENUA 1K3OA 3MSZA 1O8XA 1SD8A 1G6WA 2CVBA 2ZCTA 4PQ1A 5D96A 2QGVA 2C4JA 2FLSA 3IPZA 3QR6A 2KUCA 3RAZA 1ST9A 3E9JB 3N9JA 2ON5A 4JBBA 3ZZXA 4BVYA 5HR2A 4F03A 1GULA 2B6MA 2NPBA 1QFNA 4KE3A 1F6MC 4V1Ap 1YJ6A 4IQ1A 1EWXA 1E2YA 22GSA 2OKAA 2K8VA 1TU8A 4KNDA 2YWMA 3ZYWA 1OVNA 1O7UA 3A5WA 3JCML 2IMEA 1GL8A 4YQVA 4RUVA 3L9UA 4EVMA 2H76A 2FNOA 1RQMA 1T4YA 1JZOA 3FKFA 1V40A 3EURA 2XHFA 1T7PB 5JWQB 1K0BA 4IVFA 5B8BA 2VCQA 4O7HA 1M9AA 2GLRA 3QDNA 3HXSA 4HEA2 5IMCA 5DAKA 1O8WA 2GT5A 3SWLA 3FK8A 1M0UA 2CX4A 4HZ4A 4NV5A 1TRSA 4E8HA 1YEPA 1ZMAA 1SKWB 4LL4B 1KTEA 4OMVA 1A8YA 4PNFA 1YEXA 4D73B 5COHA 5CRDA 2MMNA 5A5KA 3NZNA 4F2IA 3KMNA 5HFGA 1LBKA 1Z5YE 1M2DA 2LRCA 2IPAA 3TKRA 4POKA 2H74A 2R37A 2MMZA 5H5QA 1A0FA 1XIYA 4LLRA 4ZXGA 2HFDA 4ISDA 2BJXA 1C72A 1T4ZA 1YQ1A 2FHEA 1F2EA 2AB6A 3C8EA 4MJCA 1VGLA 2HLSA 5D73A 2MZCA 3UMAA 3HHVA 4WR5A 2IMDA 2VUPA 2R2JA 1K0CA 3Q6OA 2DJ2A 1EGRA 5IMVA 1M2BA 3ZTLA 2CVKA 1LJRA 3W6GA 2VLTA 1V9WA 2VL2A 1KBNA 4FYCA 3Q19A 4ZILA 1HNAA 3TJJA 4MCUA 3GNJA 2H72A 2FWEA 3RPNA 5HR0A 1FB0A 1QK8A 4HU7A 2L4QA 4QL9A 2PU9C 3IDVA 3O6TA 5AGYA 4NHZA 1WE0A 2R4VA 3U6VA 3KJYA 5IPHA 1OAZA 2OADA 1NHYA 3RHBA 2EIRA 2LJKA 1USBA 2ON7A 4MA9A 3US3A 3VWXA 3DVXA 4G9HA 3HJOA 3KP9A 3EYTA 1PKWA 5IIZA 5FHIA 2VCXA 3F8UA 1URMA 4EC0A 3LORA 2C0DA 2VCTA 1M7TA 2DJ3A 5H5RA 3IE3A 4YH2A 2NVLA 3PINA 1ZCPA 4E8EA 4X43A 3P8WA 4RI7A 4K1FA 3BCIA 4I8BA 2WULA 4DSSA 3CYNA 3KP8A 2R3XA 3FHKA 3F63A 5CAXA 3HA9A 2DIYA 2H73A 3L78A 1PD21 1JLVA 2YJHA 5EL8A 4MJAA 2H6ZA 1XWKA 1FHEA 2EC4A 2O85A 2PN8A 2WDUA 2J9HA 2WB9A 4ILFA 1U3AA 3LJRA 5D9TA 2EIQA 5AIVA 3WT2A 5GSTA 5J9BA 1XBSA 4IW9A 2HE3A 4I5QA 2LSTA 3QOUA 4KA0A 3QFAC 4WR4A 2K6VA 13GSA 1U88A 2GVPA 3GKMA 3W8JA 4GXZA 1JLWA 2V32A 16GSA 2HZEB 3P7XA 4IN0A 1NSWA 4ZBDA 2A2RA 1EEMA 3QAVA 4XIHA 4TRXA 4ZBAA 5ECNB 1S3AA 1CQGA 1XVWA 4WBRD 1O81A 5JCGA 5G1LA 2GQMA 3RPPA 5IMDA 1FVJA 3FYGA 3VFIA 1OKTA 3PH9A 2KP1A 4K7IA 5DJMA 3VI5A 3IAS2 3ERFA 1SJ6A 3GTUA 1XW5A 12GSA 3W8SA 2JACA 1MD3A 2I1UA 4PX1A 4ZIJA 1SD9A 3TUEA 3FZ9A 2O87A 2G2QA 5DALB 4NWYA 1KNGA 1SU9A 3ZMLA 2B1KA 1HNCA 5G5FA 2GSQA 4NPBA 4GTUA 3ZFLA 1GUKA 2C0EA 3GX8A 1BQ7A 3VLNA 2N5BA 3FZ4A 2F51A 4L5LA 2VM1A 2GZYA 4XS6A 2CQ9A 1F9MA 1SL2B 3RDWA 3TJFA 2LEGA 2EIOA 2CA8A 3CSHA 2JSZA 4PNGA 2ALBA 3D6IA 4IP6A 19GSA 1B9XC 2PMTA 1Q4JA 3LXZA 4AGSA 2V6KA 1ZZYA 2QKEA 4PQHA 1XZOA 2GZZA 1GRXA 4K2DA 2LJAA 4POMA 1IYHA 1A8LA 4N10A 1XXUA 5B6NA 2V1MA 1B48A 3HVSA 2WS2A 1SL1B 1HQOA 5EPFA 3UEMA 2KP2A 2CZ2A 2LNSA 1Y25A 1AQWA 2F9SA 1EGOA 1B9YC 5HR3A 3TRPA 3GH9A 2JZSA 3KH7A 2VL2C 2N5AA 2VD1A 3HVXA 3MAKA 1XPVA 3EWLA 2H8LA 3GRXA 2M72A 4MDCA 3SBCA 1JZRA 3VWVA 1YKCA 5B7CA 1EP7A 4HJMA 3IBHA 3ZFBA 4TOPA 4V2MA 3G9BA 2D2ZA 4RQRA 2K18A 2LUSA 1GTUA 2LS5A 4X0XA 3DXBA 3ERGA 2YWNA 1X9MB 3R2QA 4L0UA 3GSSA 3ZREA 3GMFA 5ECPB 3EU3A 2I81A 4OFTA 1ILOA 2XC2A 3EU4A 2FWGA 2I3YA 4EDYA 1U3IA 2R5GA 1FVKA 2C8UA 3M8NA 1K0AA 4CHSA 4QL7A 2VM2A 4TR4A 3Q74A 1WJKA 3J7Yb 1B4PA 2DMLA 6GSSA 4MF6A 3P2AA 2L5OA 2PGTA 1ZOFA 4J57E 1X5EA 1K0OA 2L6DA 4RI6A 4HOJA 1SYRA 1MDJA 1MD4A 5LNKe 2K9FA 3KCMA 1SYXA 2HSHA 4NMUA 2HZFA 3H79A 3RBTA 4JZQA 1EV4A 1FO5A 2H70A 3MWHA 1Z6NA 3LXTA 4IHUA 4IP1A 4GF0A 3F6DA 4ULXA 4V2NA 1QXHA 3KIJA 4HQZA 3A2WA 3KTLA 2ZNMA 3HZ4A 4ZL9A 3ZITA 2H1GA 3TCOA 2LQQA 2HRNA 3GX0A 1Q98A 4MMMA 1I9DA 1UN2A 3J7Yk 1AC1A 5DJLA 3IRAA 1XOBA 3CBUA 4TXOB 4TR1A 1GUMA 4N0VA 4IQAA 3E3EA 3ED3A 1OE7A 2FGXA 5JWOB 4GQCA 4ECIA 4OO5A 3G7YA 1W4VA 5FWGA 5INYA 3FR3A 3KEBA 3M0FA 1OKDA 2XPDA 2RM6A 2B1LA 5CNWA 5JWRB 6GSWA 4FIWA 4GSSA 1T8EB 2OJLA 1WMJA 5IOWA 5IMAA 1N8JA 2H6YA 3S9FA 1M2AA 1TRVA 6GSUA 2YV7A 5ECOB 4RQXA 3VPTA 1GSDA 3ZMKA 2JADA 1HYUA 1A2LA 1G0TA 4Q5RA 4KDYA 1T3BA 4DVCA 2GSRA 5A4VA 4MZCA 3I9V2 1GTBA 2E7PA 3UARA 1TXXA 2C80A 4X1UA 4J56E 1DSBA 4HI7A 2H1DA 1PL1A 3I43A 4MZWA 2DC5A 2XPEA 4MJEA 1PKZA 1PQNA 2FA8A 1H4OA 3IXRA 4EO3A 5F06A 2P5QA 4JR4A 4ZL7A 2HSYA 1X9SB 3TKSA 3O76A 14GSA 2JZTA 3TJGA 3EVIA 4Q5NA 3N5OA 3A3TA 4KUNA 1J9BA 1ZL9A 2RM5A 2KOKA 2X64A 3C1RA 1NM3A 3UOMA 5F07A 4KCAA 2HI7A 3FY7A 3DVWA 2IN3A 4KSMA 2F3MA 1OYJA 3OR5A 4KB3A 3LFLA 1JHBA 2KHPA 4KH7A 1XW6A 5GAPD 2H30A 2G0FA 3DIEA 4GWRA 2GT6A 2FA4A 1SL0B 3O3TA 1AQXA 3DYRA 3EMXA 5G31A 4F0BA 1OC9B 5G5EA 3DMLA 1ERTA 1U6TA 3TOTA 3F4SA 2LJRA 1Z6MA 5G2ZA 2H0HA 1AXDA 5H5SA 1QMVA 2YZHA 1R5AA 3F3RA 2WGRA 3PGTA 1OC8A 4G10A 4MH3A 4N0ZA 5J41A 1OE8A 1Z7PA 4WF5A 2OE3A 4PURA 2VIMA 3HYPA 5ECIB 4POBA 1JZWA 1YZXA 5CREA 3KZQA 2B7JA 2H0IA 4GRFA 2X8CA 2H01A 1UC7A 2YPMA 2LRNA 4QQ7A 4KDXA 5EY6A 5KN0A 4MLYA 4D73A 2QSIA 3APSA 4JRRA 1KEBA 3H93A 1XWAA 2L4CA 3GL3A 1QQ2A 4JR6A 2RLIA 5CP1A 5KN3A 2CZ3A 3QMXA 2CAQA 4NXIA 2CAIA 4N11A 2DBCA 3IK7A 4EE0A 2VL9A 4DSRA 2PPTA 2O89A 2V41A 4YQMA 3D21A 5GZZB 2VLVA 3K8NA 3GKKA 1RK4A 4NHWA 1WRYA 1HNBA 2IJYA 1XVQA 1MDKA 4PUFC 3C7MA 4BPYA 2L57A 5AN1A 3MDKA 4TN8A 3BBYA 17GSA 2HNLA 1TK5B 2JZRA 1WWJA 5DCHA 3UVHA 3L9VA 4FO5A 4ECJA 1M9BA 4EXJA 2NDOA 3HDCA 1T00A 1PMTA 5G30A 4IKHA 2VOCA 3FR9A 4GLTA 4ML6A 3VWUA 1THOA 2OBIA 3VPQA 2B7KA 4H86A 2MYGA 3HZ8A 4BA7A 5J4UA 5DQYA 3DD3A 4WEYA 3I69A 2MMOA 1YF1A 1GTAA 3UL3A 4YQUA 2V2GA 3GHAA 3A2VA 1GSYA 4OFMA 6GSVA 1A23A 2LNTA 2I4AA 2VO4A 5LCZA 3CTGA 3HD5A 1SJZA
chains in the Genus database with same CATH superfamily
1TTZA 4ZB8A 2AHEA 3ERWA 3GUSA 3IR4A 2WFCA 2PUKC 3BCKA 1TKDB 4MPFA 3FR6A 3HJMA 4K8MA 4Q5FA 1BX9A 3LWAA 4O32A 4EKZA 4NAXA 4K6XA 2B5XA 1F3AA 5ABRA 1EP8A 1NHOA 3M1GA 5F8BA 2A2SA 2CVDA 3ZIVA 3BD2A 2F8FA 1TJDA 4N30A 3EPTA 1BJXA 3PR8A 4BVYB 3TKSC 2TIRA 1DBYA 5E4WA 1FW1A 3F9UA 1S3CA 1B4QA 4F9ZA 4O92A 4AJ8A 1O73A 1I5GA 1NW2A 1MTCA 2L6CA 3ZVJD 4OFNA 3UJ1A 2YANA 1W89A 2X8HA 1EV9A 3UBLA 2X8GA 3IK9A 4CY8A 1JZDA 4I2TA 2REMA 1QGVA 3BJ5A 1XW9A 1K0MA 2YP6A 1LU4A 1ZYEA 2C3NA 2TRXA 5IM9A 4K5RA 4OCEA 4YAPA 3GIXA 1IYIA 3IV4A 3CTFA 4V2LA 2H75A 1PA3A 4JE1A 2DJ1A 1F3BA 3HKRA 5DAKB 3LYPA 1Z9HA 4G19A 4HS1A 4GQFA 1TP9A 2OACA 1YDKA 1TRUA 3QAWA 1FAAA 4K0GA 3NIVA 1GTIA 5ID2A 2MBTA 4P3YB 4FH8A 2H1AA 1XOAA 2ES7A 2DJ0A 3IHGA 3QAGA 3PPUA 4AJ6A 3L9SA 1F37A 5D8IA 4XS4A 1SK1A 4F82A 3LEFA 4MZBA 2MBSA 3CRTA 1TW9A 2AAWA 3FZ5A 5F05A 4ID0A 2RUFA 5DALA 5D9VA 2M46A 4OCFA 2H1BA 2GQLA 3ZIJA 4TXVA 3A2XA 5D9WA 2IL3A 2XBIA 1VF4A 1H75A 1SK0A 4EIPA 9GSSA 4TVEA 2WRTA 5CO3A 3EINA 2C0GA 1HD2A 2QC7A 4ZL8A 1DE2A 5HFKA 5ECRB 3HY2A 3ME8A 4YAVA 5JCUA 2VCWA 4WXTA 1VF2A 5ECQB 3IA1A 2H71A 3WGEA 5IO2A 2P0GA 4MP4A 1XCCA 1ZGNA 1FOVA 3GKNA 1YKAA 2C0FA 3KH9A 2F8AA 2B5EA 3Q18A 3G7JA 2R0GA 1PX7A 3APQA 3TKPA 2H0GA 1V57A 5ECHB 5D9XA 3M9KA 1EOHA 5KN2A 4Q5QA 5AISA 4I97A 3P90A 2K8SA 1A24A 11GSA 2VLUA 1GSEA 2R6KA 5GSSA 4BWSA 2O7KA 4MF7A 5FT3A 3H8QA 4KGIA 3UIWA 2DMMA 3LSZA 3HVNA 4ML1A 1GSFA 3TRXA 3GN3A 1XFLA 4OD7A 3D4MA 4XCSA 4BVXA 1T1VA 5KEJA 4KW6A 2DJKA 5ECMB 2IFQA 1JFUA 4O5RA 4JU5A 2HYXA 4HJ2A 3GKXA 1PN0A 2H66A 4KAEA 3V1WA 4ACSA 2FWHA 3KD0A 1AIUA 4A5PA 3IC4A 4DSSB 5CYYA 1GH2A 1GSQA 2LRTA 1FG4A 1R4WA 3CSJA 3KMOA 1ZYPA 2FUG2 2IMKA 7GSSA 3ZLPA 3MNGA 4LMWA 1V2AA 1K3YA 3EE2A 4EUYA 10GSA 4BWQA 2WZ9A 3GV1A 3HVVA 4FYBA 3KXOA 4O5UA 4EDZA 1TI3A 3ISOA 5KN1A 4KDUA 5D93A 3G7IA 2GZPA 1THXA 1ZYQB 1R7HA 5DCGA 4LA1A 4DEJA 1EOGA 1BYEA 8GSSA 1AQVA 3RHCA 3F0IA 3H4KA 3GA4A 1GNEA 1PSQA 2RUEA 4FYUA 3CRUA 2H6XA 2XBQA 4FQUA 2VCVA 1WP0A 2FWFA 1X9WB 5ELGA 3UAPA 2DIZA 5ECKB 1TI1A 2OA7A 2AJQB 3UBKA 1V98A 4PUAA 1FB6A 1ON4A 5B8AA 1TK8B 1MEKA 3GH6A 4KSOA 3TKSE 5J3RA 1VF3A 2LV3A 4K7OA 3FW2A 3QCPA 4ZB9A 2YV9A 1BAYA 2V6OA 4HDEA 1G6YA 3ZRDA 3HCZA 1BEDA 5DBQA 6GSYA 2HRFA 3LYKA 3GTUB 4GSNA 4EF0A 4LL1B 1X5DA 4ZBBA 3U5RE 3DWVA 2DSAA 3KGKA 2OE0A 2R0CA 2UZ8A 4TXOA 2AUVA 2MMAA 4ECBA 2P5RA 2VL3A 2J23A 3D22A 3APOA 1Y6EA 3KTBA 1X0RA 2DJJA 5G1KA 2BMXA 1GSSA 3D4TA 3QFBC 3KM6A 4HQSA 2N5FA 1XWCA 2GSSA 2PVQA 3GL5A 3M9JA 1SKSB 4I6XA 1UVZA 1A2MA 5CRGA 2CV4A 1PN9A 3E0UA 3GYKA 2KLXA 1J0FA 4J2FA 4GCIA 3EMPA 3WT1A 2OE1A 3HJPA 1PL2A 2AYTA 5ELAA 1K3LA 4V1Ag 18GSA 3F4TA 2PVOC 2IMIA 4XTSA 2RIIA 1EZKA 5J9CA 3QD9A 3VI7A 1DE1A 1N2AA 3TJBA 4Z2TA 2C3QA 4L5OA 5J5NA 4MF5A 1ZYNA 2HRKA 4TR3A 1MDIA 3FEUA 3WD6A 4Z7XA 4X4JA 1RW1A 1G7EA 2HSMA 3A5IA 4EL1A 2FCHA 3DEXA 1TDIA 4Z2UA 2WJUA 3LGCA 4AJ7A 2I9HA 3F3QA 4OO4A 4MH2A 2C3TA 2L59A 4XRDA 2A2PA 1TOFA 2GS3A 4IJIA 5A4UA 5IQYA 3TGZA 3QPMA 4MJBA 2E2GA 3WGDA 4PQIA 5DVBA 1AW9A 5DQSA 1R5PA 3MYDA 3H1NA 2VCZA 1PX6A 4IBPA 1EEJA 2YOIA 1YF0A 3TDGA 5B6MA 1AAZA 1A0RP 2PBJA 2IMFA 2LKUA 20GSA 1GSUA 4OWYA 5IMFA 1K0DA 1GNWA 4I2UA 1BG5A 1ACVA 3C71A 3GSTA 2YWOA 2JL4A 3VWWA 2B5YA 6GSTA 5IOXA 5ECSA 5JCWA 4K7NA 1UA5A 4WF4A 4HU9A 2YJ7A 4HZ2A 5CRHA 1TK0B 4MNNA 1PGTA 1WPIA 3C73A 5ID2B 5IMZA 4IGJA 2AV4A 2E0QA 2M80A 5DDLA 2IIYA 4L8EA 4G2EA 3CQFA 2IWTA 3TJKA 5L71A 5HQPA 4WKWA 3M3MA 2E2MA 1GP1A 4XS4B 3CSIA 3D5JA 3L4NA 4HUAA 3GURA 1OC9A 2Z9SA 1OC3A 3FZAA 2L5LA 3DGQA 4MK3A 2YCDA 3F6FA 5A4WA 4TKYA 3FRCA 1DUGA 3DKSA 1S3DA 5HR1A 1M99A 4WETA 4XRAA 4XHMA 1O85A 4G0IA 4JEDA 1A2JA 2ZUPA 4IJ3A 4K0NA 2A4VA 3AY8A 4KCEA 2GQKA 2OBKA 2GTUA 1V58A 2JU5A 4PXOA 2LQOA 2LTKA 1SJIA 2YWIA 2NTOA 5IO0A 1TRWA 2YN1A 1GUHA 2HXKA 5HFIA 5C04A 4POLA 5C00A 2O8VB 4K9ZA 4WBJA 4XS1A 5AIXA 1Z7RA 3VK9A 4MABA 4ECCA 1TU7A 2X99A 4GSTA 4TR0A 3LG6A 2YZUA 2PERA 4DSQA 1Z3EA 1O6JA 4TR1B 5LD0A 4G0LA 2TRCP 3I6AA 1ABAA 4TW5A 1WIKA 2H19A 2HZEA 1PRXA 4IS0A 2GDRA 1QUWA 3IAM2 1GLPA 3WYWA 1XWGA 3NOFA 2WCIA 3L0HA 2QA2A 3CMIA 5EVOA 1WOUA 3VURA 5GAND 2PWJA 1R26A 4CDOA 2DLXA 4F0CA 3TKQA 2NBSA 2IFQB 2GGTA 1AUCA 3R3EA 1YY7A 2X4AA 4NV2A 5ECLB 1G7OA 4LMVA 1GWCA 3GFKA 1ML6A 3F4RA 3DRNA 1ERUA 2FY6A 4AF2A 1SK2A 4BL7A 2BTOT 1J08A 1XWBA 2FD3A 1CQHA 4ICYA 4IELA 2CT6A 5F0GA 3TRQA 1ERWA 1U87A 4ZB6A 5IPGA 3TB2A 6GSXA 3C1SA 3BOAA 3D0ZA 1K0NA 1GLQA 4PGTA 2CX3A 1SENA 2HT9A 4MPGA 3ZVJA 3TOUA 1B8XA 3CXGA 2P31A 4L0WA 3UVTA 1VRSD 3ZL5A 2GSTA 2JSYA 3IOSA 1VF1A 1SKRB 1ERVA 3LQ7A 1E6BA 2VAFA 4KX4A 3ME7A 1X5CA 2YNXA 2C1YA 5CRWA 3WGXA 2B3SA 3EC3A 4CW9A 3IHQA 2VD0A 5E59A 5ENUA 1K3OA 3MSZA 1O8XA 1SD8A 1G6WA 2CVBA 2ZCTA 4PQ1A 5D96A 2QGVA 2C4JA 2FLSA 3IPZA 3QR6A 2KUCA 3RAZA 1ST9A 3E9JB 3N9JA 2ON5A 4JBBA 3ZZXA 4BVYA 5HR2A 4F03A 1GULA 2B6MA 2NPBA 1QFNA 4KE3A 1F6MC 2DKIA 4V1Ap 1YJ6A 4IQ1A 1EWXA 1E2YA 22GSA 2OKAA 2K8VA 1TU8A 4KNDA 2YWMA 3ZYWA 1OVNA 1O7UA 3A5WA 3JCML 2IMEA 1GL8A 4YQVA 4RUVA 3L9UA 4EVMA 2H76A 2FNOA 1RQMA 1T4YA 1JZOA 3FKFA 1V40A 3EURA 2XHFA 1T7PB 5JWQB 1K0BA 4IVFA 5B8BA 2VCQA 4O7HA 1M9AA 2GLRA 3QDNA 3HXSA 4HEA2 5IMCA 5DAKA 1O8WA 2GT5A 3SWLA 3FK8A 1M0UA 2CX4A 4HZ4A 4NV5A 1TRSA 4E8HA 1YEPA 1ZMAA 1SKWB 4LL4B 1KTEA 4OMVA 1A8YA 4PNFA 1YEXA 4D73B 5COHA 5CRDA 2MMNA 5A5KA 3NZNA 4F2IA 5KOWA 3KMNA 5HFGA 1LBKA 1Z5YE 1M2DA 2LRCA 2IPAA 3TKRA 4POKA 2H74A 2R37A 2MMZA 5H5QA 1A0FA 1XIYA 4LLRA 4ZXGA 2HFDA 4ISDA 2BJXA 1C72A 1T4ZA 1YQ1A 2FHEA 1F2EA 2AB6A 3C8EA 4MJCA 1VGLA 2HLSA 5D73A 2MZCA 3UMAA 3HHVA 4WR5A 4CY6A 2IMDA 2VUPA 2R2JA 1K0CA 3Q6OA 2DJ2A 1EGRA 5IMVA 1M2BA 3ZTLA 2CVKA 1LJRA 3W6GA 2VLTA 1V9WA 2VL2A 1KBNA 4FYCA 3Q19A 4G0KA 4ZILA 1HNAA 3TJJA 4MCUA 3GNJA 2H72A 2FWEA 3RPNA 5HR0A 1FB0A 1QK8A 4HU7A 2L4QA 4QL9A 2PU9C 3IDVA 4USSA 3O6TA 5AGYA 4NHZA 1WE0A 2R4VA 3U6VA 3KJYA 5IPHA 1OAZA 2OADA 1NHYA 3RHBA 2EIRA 2LJKA 1USBA 2ON7A 4MA9A 3US3A 3VWXA 3DVXA 4K5SA 4G9HA 3HJOA 3KP9A 3EYTA 1PKWA 5IIZA 5FHIA 2VCXA 3F8UA 1URMA 4EC0A 3LORA 2C0DA 2VCTA 1M7TA 2DJ3A 5H5RA 3IE3A 4YH2A 2NVLA 3PINA 1ZCPA 4E8EA 4X43A 3P8WA 4RI7A 4K1FA 3BCIA 3FMWA 4I8BA 2WULA 4DSSA 3CYNA 3KP8A 2R3XA 3FHKA 3F63A 5CAXA 3HA9A 2DIYA 2H73A 3L78A 1PD21 1JLVA 2YJHA 5EL8A 4MJAA 2H6ZA 1XWKA 1FHEA 2EC4A 2O85A 2PN8A 2WDUA 2J9HA 2WB9A 4ILFA 1U3AA 3LJRA 5D9TA 2EIQA 5AIVA 3WT2A 5GSTA 5J9BA 1XBSA 4IW9A 2HE3A 4I5QA 2LSTA 3QOUA 4KA0A 3QFAC 4WR4A 2K6VA 13GSA 1U88A 2GVPA 3GKMA 3W8JA 4GXZA 1JLWA 2V32A 2R0PA 16GSA 2HZEB 3P7XA 4IN0A 1NSWA 4ZBDA 2A2RA 1EEMA 3QAVA 4XIHA 4TRXA 4ZBAA 5ECNB 1M3JA 1S3AA 1CQGA 1XVWA 4WBRD 1O81A 5JCGA 5G1LA 2GQMA 3RPPA 5IMDA 1FVJA 3FYGA 3VFIA 1OKTA 3PH9A 2KP1A 4K7IA 5DJMA 3VI5A 4YKFA 3IAS2 3ERFA 1SJ6A 3GTUA 1XW5A 12GSA 3W8SA 2JACA 1MD3A 3IC8A 2I1UA 4PX1A 4ZIJA 1SD9A 3TUEA 3FZ9A 2O87A 1FOHA 2G2QA 5DALB 4NWYA 1KNGA 1SU9A 3ZMLA 2B1KA 1HNCA 5G5FA 2GSQA 3LW9A 4NPBA 4GTUA 3ZFLA 1GUKA 2C0EA 3GX8A 1BQ7A 3VLNA 2N5BA 3FZ4A 2F51A 4L5LA 2VM1A 2GZYA 4XS6A 2CQ9A 1F9MA 1SL2B 3RDWA 3TJFA 2LEGA 2EIOA 2CA8A 3CSHA 2JSZA 4PNGA 2ALBA 3D6IA 4IP6A 19GSA 1B9XC 2PMTA 1Q4JA 4K2XA 3LXZA 4AGSA 2V6KA 1ZZYA 2QKEA 4PQHA 1XZOA 2GZZA 1GRXA 4K2DA 2LJAA 4POMA 1IYHA 1A8LA 4N10A 1XXUA 5B6NA 2V1MA 1B48A 3HVSA 2WS2A 1SL1B 1HQOA 5EPFA 3UEMA 2KP2A 2CZ2A 2LNSA 1Y25A 1AQWA 2F9SA 1EGOA 1B9YC 5HR3A 3TRPA 3GH9A 2JZSA 3KH7A 2VL2C 4Z2RA 2N5AA 2VD1A 3HVXA 2DKHA 3MAKA 1XPVA 3EWLA 4BVXB 2H8LA 3GRXA 2M72A 4MDCA 3SBCA 1JZRA 3VWVA 1YKCA 5B7CA 1EP7A 4HJMA 3IBHA 3ZFBA 4TOPA 4V2MA 3G9BA 2D2ZA 4RQRA 2K18A 2LUSA 2A4HA 1GTUA 2LS5A 4X0XA 3DXBA 3ERGA 2YWNA 1X9MB 3R2QA 4L0UA 3GSSA 3ZREA 3GMFA 5ECPB 3EU3A 2I81A 4OFTA 1ILOA 2XC2A 3EU4A 2FWGA 2I3YA 2HRAA 4EDYA 1U3IA 4O5QA 2R5GA 1FVKA 2C8UA 3M8NA 1K0AA 3MIXA 4CHSA 4QL7A 2VM2A 4TR4A 3Q74A 1WJKA 3J7Yb 1B4PA 2DMLA 6GSSA 4MF6A 3P2AA 2L5OA 4PTSA 2PGTA 1ZOFA 4J57E 1X5EA 1K0OA 2L6DA 4RI6A 4BIKA 4HOJA 1SYRA 1MDJA 1MD4A 5LNKe 2K9FA 1XG8A 3KCMA 1SYXA 2HSHA 4NMUA 2HZFA 3H79A 3RBTA 4JZQA 1EV4A 1FO5A 2H70A 3MWHA 2X49A 1Z6NA 3LXTA 4IHUA 4IP1A 5BMUA 4GF0A 3F6DA 4ULXA 4V2NA 1QXHA 3KIJA 4HQZA 3A2WA 3KTLA 2ZNMA 3HZ4A 4ZL9A 3ZITA 2H1GA 3TCOA 2LQQA 2HRNA 3GX0A 1Q98A 4MMMA 1I9DA 1UN2A 3J7Yk 1AC1A 5DJLA 3IRAA 1XOBA 3CBUA 4TXOB 4TR1A 1GUMA 4N0VA 4IQAA 3E3EA 3ED3A 1OE7A 2FGXA 5JWOB 4GQCA 4ECIA 4OO5A 3G7YA 1W4VA 5FWGA 5INYA 3FR3A 3KEBA 3M0FA 1OKDA 2XPDA 2RM6A 2B1LA 2QA1A 5CNWA 5JWRB 6GSWA 4FIWA 4GSSA 1T8EB 2OJLA 1WMJA 5IOWA 5IMAA 1N8JA 2H6YA 3S9FA 1M2AA 1TRVA 6GSUA 2YV7A 5ECOB 4RQXA 3VPTA 1GSDA 3ZMKA 1M3IA 2JADA 1HYUA 1A2LA 1G0TA 4Q5RA 4KDYA 1T3BA 4DVCA 2GSRA 5A4VA 4MZCA 3I9V2 1GTBA 2E7PA 3UARA 1TXXA 2C80A 4X1UA 4J56E 1DSBA 4HI7A 2H1DA 1PL1A 3I43A 4MZWA 2DC5A 2XPEA 4MJEA 1PKZA 1PQNA 2FA8A 1H4OA 3IXRA 4EO3A 5F06A 2P5QA 4JR4A 4ZL7A 2HSYA 1X9SB 3TKSA 3O76A 5KOXA 14GSA 2JZTA 3TJGA 3EVIA 4Q5NA 3N5OA 3A3TA 4KUNA 1J9BA 1ZL9A 2RM5A 2KOKA 2X64A 5BRTA 3C1RA 1NM3A 3UOMA 5F07A 4KCAA 2HI7A 3FY7A 3DVWA 2IN3A 4KSMA 2F3MA 1OYJA 3OR5A 4KB3A 3LFLA 1JHBA 2KHPA 4KH7A 1XW6A 5GAPD 2H30A 2G0FA 3DIEA 4GWRA 2GT6A 2FA4A 1SL0B 3O3TA 1AQXA 3DYRA 3EMXA 5G31A 4F0BA 1OC9B 5G5EA 3DMLA 4KF9A 4YKGA 1ERTA 1U6TA 3TOTA 3F4SA 2LJRA 1PFOA 1Z6MA 5G2ZA 2H0HA 1AXDA 5H5SA 1QMVA 2YZHA 1R5AA 3F3RA 2WGRA 3PGTA 1OC8A 4HSCX 4G10A 4MH3A 4N0ZA 5J41A 1OE8A 1Z7PA 4WF5A 2OE3A 4PURA 2VIMA 3HYPA 5ECIB 4POBA 1JZWA 1YZXA 5CREA 3KZQA 2B7JA 2H0IA 4GRFA 2X8CA 2H01A 1UC7A 2YPMA 2LRNA 4QQ7A 4KDXA 5EY6A 5KN0A 4MLYA 4D73A 2QSIA 3APSA 4JRRA 1KEBA 3H93A 1XWAA 2L4CA 3GL3A 1QQ2A 4JR6A 2RLIA 5CP1A 5KN3A 2CZ3A 3QMXA 2CAQA 4NXIA 2CAIA 4N11A 2DBCA 3IK7A 4EE0A 2VL9A 4DSRA 2PPTA 2O89A 2V41A 4YQMA 3D21A 5GZZB 2VLVA 3K8NA 3GKKA 1RK4A 4NHWA 1WRYA 1HNBA 2IJYA 1XVQA 1MDKA 4PUFC 3C7MA 4BPYA 2L57A 5AN1A 3MDKA 4TN8A 3BBYA 17GSA 2HNLA 1TK5B 2JZRA 1WWJA 5DCHA 3UVHA 3L9VA 4FO5A 4ECJA 1M9BA 4EXJA 2NDOA 3HDCA 4BL7B 1T00A 4EIQA 1PMTA 5G30A 4IKHA 2VOCA 1S3RA 3FR9A 4GLTA 4ML6A 3VWUA 1THOA 2OBIA 3VPQA 2B7KA 4H86A 2MYGA 3HZ8A 4BA7A 5J4UA 5DQYA 3DD3A 4WEYA 3I69A 2MMOA 1YF1A 1GTAA 3UL3A 4YQUA 2V2GA 3GHAA 3A2VA 1GSYA 4OFMA 6GSVA 1A23A 2LNTA 2I4AA 2VO4A 5LCZA 3CTGA 3HD5A 1SJZA
chains in the Genus database with same CATH topology
1TTZA 4ZB8A 2AHEA 3ERWA 3GUSA 3IR4A 2WFCA 2PUKC 3BCKA 1TKDB 4MPFA 3FR6A 3HJMA 4K8MA 4Q5FA 1BX9A 3LWAA 4O32A 4EKZA 4NAXA 4K6XA 2B5XA 1F3AA 5ABRA 1EP8A 1NHOA 3M1GA 5F8BA 2A2SA 2CVDA 3ZIVA 3BD2A 2F8FA 1TJDA 4N30A 3EPTA 1BJXA 3PR8A 4BVYB 3TKSC 2TIRA 1DBYA 5E4WA 1FW1A 3F9UA 1S3CA 1B4QA 4F9ZA 4O92A 4AJ8A 1O73A 1I5GA 1NW2A 1MTCA 2L6CA 3ZVJD 4OFNA 3UJ1A 2YANA 1W89A 2X8HA 1EV9A 3UBLA 2X8GA 3IK9A 4CY8A 1JZDA 4I2TA 2REMA 1QGVA 3BJ5A 1XW9A 1K0MA 2YP6A 1LU4A 1ZYEA 2C3NA 2TRXA 5IM9A 4K5RA 4OCEA 4YAPA 3GIXA 1IYIA 3IV4A 3CTFA 4V2LA 2H75A 1PA3A 4JE1A 2DJ1A 1F3BA 3HKRA 5DAKB 3LYPA 1Z9HA 4G19A 4HS1A 4GQFA 1TP9A 2OACA 1YDKA 1TRUA 3QAWA 1FAAA 4K0GA 3NIVA 1GTIA 5ID2A 2MBTA 4P3YB 4FH8A 2H1AA 1XOAA 2ES7A 2DJ0A 3IHGA 3QAGA 3PPUA 4AJ6A 3L9SA 1F37A 5D8IA 4XS4A 1SK1A 4F82A 3LEFA 4MZBA 2MBSA 3CRTA 1TW9A 2AAWA 3FZ5A 5F05A 4ID0A 2RUFA 5DALA 5D9VA 2M46A 4OCFA 2H1BA 2GQLA 3ZIJA 4TXVA 3A2XA 5D9WA 2IL3A 2XBIA 1VF4A 1H75A 1SK0A 4EIPA 9GSSA 4TVEA 2WRTA 5CO3A 3EINA 2C0GA 1HD2A 2QC7A 4ZL8A 1DE2A 5HFKA 5ECRB 3HY2A 3ME8A 4YAVA 5JCUA 2VCWA 4WXTA 1VF2A 5ECQB 3IA1A 2H71A 3WGEA 5IO2A 2P0GA 4MP4A 1XCCA 1ZGNA 1FOVA 3GKNA 1YKAA 2C0FA 3KH9A 2F8AA 2B5EA 3Q18A 3G7JA 2R0GA 1PX7A 3APQA 3TKPA 2H0GA 1V57A 5ECHB 5D9XA 3M9KA 1EOHA 5KN2A 4Q5QA 5AISA 4I97A 3P90A 2K8SA 1A24A 11GSA 2VLUA 1GSEA 2R6KA 5GSSA 4BWSA 2O7KA 4MF7A 5FT3A 3H8QA 4KGIA 3UIWA 2DMMA 3LSZA 4ML1A 1GSFA 3TRXA 3GN3A 1XFLA 4OD7A 3D4MA 4XCSA 4BVXA 1T1VA 5KEJA 4KW6A 2DJKA 5ECMB 2IFQA 1JFUA 4O5RA 4JU5A 2HYXA 4HJ2A 3GKXA 1PN0A 2H66A 4KAEA 3V1WA 4ACSA 2FWHA 3KD0A 1AIUA 4A5PA 3IC4A 4DSSB 5CYYA 1GH2A 1GSQA 2LRTA 1FG4A 1R4WA 3CSJA 3KMOA 1ZYPA 2FUG2 2IMKA 7GSSA 3ZLPA 3MNGA 4LMWA 1V2AA 1K3YA 3EE2A 4EUYA 10GSA 4BWQA 2WZ9A 3GV1A 3HVVA 4FYBA 3KXOA 4O5UA 4EDZA 1TI3A 3ISOA 5KN1A 4KDUA 5D93A 3G7IA 2GZPA 1THXA 1ZYQB 1R7HA 5DCGA 4LA1A 4DEJA 1EOGA 1BYEA 8GSSA 1AQVA 3RHCA 3F0IA 3H4KA 3GA4A 1GNEA 1PSQA 2RUEA 4FYUA 3CRUA 2H6XA 2XBQA 4FQUA 2VCVA 1WP0A 2FWFA 1X9WB 5ELGA 3UAPA 2DIZA 5ECKB 1TI1A 2OA7A 2AJQB 3UBKA 1V98A 4PUAA 1FB6A 1ON4A 5B8AA 1TK8B 1MEKA 3GH6A 4KSOA 3TKSE 5J3RA 1VF3A 2LV3A 4K7OA 3FW2A 3QCPA 4ZB9A 2YV9A 1BAYA 2V6OA 4HDEA 1G6YA 3ZRDA 3HCZA 1BEDA 5DBQA 6GSYA 2HRFA 3LYKA 3GTUB 4GSNA 4EF0A 4LL1B 1X5DA 4ZBBA 3U5RE 3DWVA 2DSAA 3KGKA 2OE0A 2R0CA 2UZ8A 4TXOA 2AUVA 2MMAA 4ECBA 2P5RA 2VL3A 2J23A 3D22A 3APOA 1Y6EA 3KTBA 1X0RA 2DJJA 5G1KA 2BMXA 1GSSA 3D4TA 3QFBC 3KM6A 4HQSA 2N5FA 1XWCA 2GSSA 2PVQA 3GL5A 3M9JA 1SKSB 4I6XA 1UVZA 1A2MA 5CRGA 2CV4A 1PN9A 3E0UA 3GYKA 2KLXA 1J0FA 4J2FA 4GCIA 3EMPA 3WT1A 2OE1A 3HJPA 1PL2A 2AYTA 5ELAA 1K3LA 4V1Ag 18GSA 3F4TA 2PVOC 2IMIA 4XTSA 2RIIA 1EZKA 5J9CA 3QD9A 3VI7A 1DE1A 1N2AA 3TJBA 4Z2TA 2C3QA 4L5OA 5J5NA 4MF5A 1ZYNA 2HRKA 4TR3A 1MDIA 3FEUA 3WD6A 4Z7XA 4X4JA 1RW1A 1G7EA 2HSMA 3A5IA 4EL1A 2FCHA 3DEXA 1TDIA 4Z2UA 2WJUA 3LGCA 4AJ7A 2I9HA 3F3QA 4OO4A 4MH2A 2C3TA 2L59A 4XRDA 2A2PA 1TOFA 2GS3A 4IJIA 5A4UA 5IQYA 3TGZA 3QPMA 4MJBA 2E2GA 3WGDA 4PQIA 5DVBA 1AW9A 5DQSA 1R5PA 3MYDA 3H1NA 2VCZA 1PX6A 4IBPA 1EEJA 2YOIA 1YF0A 3TDGA 5B6MA 1AAZA 1A0RP 2PBJA 2IMFA 2LKUA 20GSA 1GSUA 4OWYA 5IMFA 1K0DA 1GNWA 4I2UA 1BG5A 1ACVA 3C71A 3GSTA 2YWOA 2JL4A 3VWWA 2B5YA 6GSTA 5IOXA 5ECSA 5JCWA 4K7NA 1UA5A 4WF4A 4HU9A 2YJ7A 4HZ2A 5CRHA 1TK0B 4MNNA 1PGTA 1WPIA 3C73A 5ID2B 5IMZA 4IGJA 2AV4A 2E0QA 2M80A 5DDLA 2IIYA 4L8EA 4G2EA 2IWTA 3TJKA 5L71A 5HQPA 4WKWA 3M3MA 2E2MA 1GP1A 4XS4B 3CSIA 3D5JA 3L4NA 4HUAA 3GURA 1OC9A 2Z9SA 1OC3A 3FZAA 2L5LA 3DGQA 4MK3A 2YCDA 3F6FA 5A4WA 4TKYA 3FRCA 1DUGA 3DKSA 1S3DA 5HR1A 1M99A 4WETA 4XRAA 4XHMA 1O85A 4G0IA 4JEDA 1A2JA 2ZUPA 4IJ3A 4K0NA 2A4VA 3AY8A 4KCEA 2GQKA 2OBKA 2GTUA 1V58A 2JU5A 4PXOA 2LQOA 2LTKA 1SJIA 2YWIA 2NTOA 5IO0A 1TRWA 2YN1A 1GUHA 2HXKA 5HFIA 5C04A 4POLA 5C00A 2O8VB 4K9ZA 4WBJA 4XS1A 5AIXA 1Z7RA 3VK9A 4MABA 4ECCA 1TU7A 2X99A 4GSTA 4TR0A 3LG6A 2YZUA 2PERA 4DSQA 1Z3EA 1O6JA 4TR1B 5LD0A 4G0LA 2TRCP 3I6AA 1ABAA 4TW5A 1WIKA 2H19A 2HZEA 1PRXA 4IS0A 2GDRA 1QUWA 3IAM2 1GLPA 3WYWA 1XWGA 3NOFA 2WCIA 3L0HA 2QA2A 3CMIA 5EVOA 1WOUA 3VURA 5GAND 2PWJA 1R26A 4CDOA 2DLXA 4F0CA 3TKQA 2NBSA 2IFQB 2GGTA 1AUCA 3R3EA 1YY7A 2X4AA 4NV2A 5ECLB 1G7OA 4LMVA 1GWCA 3GFKA 1ML6A 3F4RA 3DRNA 1ERUA 2FY6A 4AF2A 1SK2A 4BL7A 2BTOT 1J08A 1XWBA 2FD3A 1CQHA 4ICYA 4IELA 2CT6A 5F0GA 3TRQA 1ERWA 1U87A 4ZB6A 5IPGA 3TB2A 6GSXA 3C1SA 3BOAA 3D0ZA 1K0NA 1GLQA 4PGTA 2CX3A 1SENA 2HT9A 4MPGA 3ZVJA 3TOUA 1B8XA 3CXGA 2P31A 4L0WA 3UVTA 1VRSD 3ZL5A 2GSTA 2JSYA 3IOSA 1VF1A 1SKRB 1ERVA 3LQ7A 1E6BA 2VAFA 4KX4A 3ME7A 1X5CA 2YNXA 2C1YA 5CRWA 3WGXA 2B3SA 3EC3A 4CW9A 3IHQA 2VD0A 5E59A 5ENUA 1K3OA 3MSZA 1O8XA 1SD8A 1G6WA 2CVBA 2ZCTA 4PQ1A 5D96A 2QGVA 2C4JA 2FLSA 3IPZA 3QR6A 2KUCA 3RAZA 1ST9A 3E9JB 3N9JA 2ON5A 4JBBA 3ZZXA 4BVYA 5HR2A 4F03A 1GULA 2B6MA 2NPBA 1QFNA 4KE3A 1F6MC 2DKIA 4V1Ap 1YJ6A 4IQ1A 1EWXA 1E2YA 22GSA 2OKAA 2K8VA 1TU8A 4KNDA 2YWMA 3ZYWA 1OVNA 1O7UA 3A5WA 3JCML 2IMEA 1GL8A 4YQVA 4RUVA 3L9UA 4EVMA 2H76A 2FNOA 1RQMA 1T4YA 1JZOA 3FKFA 1V40A 3EURA 2XHFA 1T7PB 5JWQB 1K0BA 4IVFA 5B8BA 2VCQA 4O7HA 1M9AA 2GLRA 3QDNA 3HXSA 4HEA2 5IMCA 5DAKA 1O8WA 2GT5A 3SWLA 3FK8A 1M0UA 2CX4A 4HZ4A 4NV5A 1TRSA 4E8HA 1YEPA 1ZMAA 1SKWB 4LL4B 1KTEA 4OMVA 1A8YA 4PNFA 1YEXA 4D73B 5COHA 5CRDA 2MMNA 5A5KA 3NZNA 4F2IA 5KOWA 3KMNA 5HFGA 1LBKA 1Z5YE 1M2DA 2LRCA 2IPAA 3TKRA 4POKA 2H74A 2R37A 2MMZA 5H5QA 1A0FA 1XIYA 4LLRA 4ZXGA 2HFDA 4ISDA 2BJXA 1C72A 1T4ZA 1YQ1A 2FHEA 1F2EA 2AB6A 3C8EA 4MJCA 1VGLA 2HLSA 5D73A 2MZCA 3UMAA 3HHVA 4WR5A 4CY6A 2IMDA 2VUPA 2R2JA 1K0CA 3Q6OA 2DJ2A 1EGRA 5IMVA 1M2BA 3ZTLA 2CVKA 1LJRA 3W6GA 2VLTA 1V9WA 2VL2A 1KBNA 4FYCA 3Q19A 4G0KA 4ZILA 1HNAA 3TJJA 4MCUA 3GNJA 2H72A 2FWEA 3RPNA 5HR0A 1FB0A 1QK8A 4HU7A 2L4QA 4QL9A 2PU9C 3IDVA 4USSA 3O6TA 5AGYA 4NHZA 1WE0A 2R4VA 3U6VA 3KJYA 5IPHA 1OAZA 2OADA 1NHYA 3RHBA 2EIRA 2LJKA 1USBA 2ON7A 4MA9A 3US3A 3VWXA 3DVXA 4K5SA 4G9HA 3HJOA 3KP9A 3EYTA 1PKWA 5IIZA 5FHIA 2VCXA 3F8UA 1URMA 4EC0A 3LORA 2C0DA 2VCTA 1M7TA 2DJ3A 5H5RA 3IE3A 4YH2A 2NVLA 3PINA 1ZCPA 4E8EA 4X43A 3P8WA 4RI7A 4K1FA 3BCIA 3FMWA 4I8BA 2WULA 4DSSA 3CYNA 3KP8A 2R3XA 3FHKA 3F63A 5CAXA 3HA9A 2DIYA 2H73A 3L78A 1PD21 1JLVA 2YJHA 5EL8A 4MJAA 2H6ZA 1XWKA 1FHEA 2EC4A 2O85A 2PN8A 2WDUA 2J9HA 2WB9A 4ILFA 1U3AA 3LJRA 5D9TA 2EIQA 5AIVA 3WT2A 5GSTA 5J9BA 1XBSA 4IW9A 2HE3A 4I5QA 2LSTA 3QOUA 4KA0A 3QFAC 4WR4A 2K6VA 13GSA 1U88A 2GVPA 3GKMA 3W8JA 4GXZA 1JLWA 2V32A 2R0PA 16GSA 2HZEB 3P7XA 4IN0A 1NSWA 4ZBDA 2A2RA 1EEMA 3QAVA 4XIHA 4TRXA 4ZBAA 5ECNB 1S3AA 1CQGA 1XVWA 4WBRD 1O81A 5JCGA 5G1LA 2GQMA 3RPPA 5IMDA 1FVJA 3FYGA 3VFIA 1OKTA 3PH9A 2KP1A 4K7IA 5DJMA 3VI5A 4YKFA 3IAS2 3ERFA 1SJ6A 3GTUA 1XW5A 12GSA 3W8SA 2JACA 1MD3A 3IC8A 2I1UA 4PX1A 4ZIJA 1SD9A 3TUEA 3FZ9A 2O87A 1FOHA 2G2QA 5DALB 4NWYA 1KNGA 1SU9A 3ZMLA 2B1KA 1HNCA 5G5FA 2GSQA 3LW9A 4NPBA 4GTUA 3ZFLA 1GUKA 2C0EA 3GX8A 1BQ7A 3VLNA 2N5BA 3FZ4A 2F51A 4L5LA 2VM1A 2GZYA 4XS6A 2CQ9A 1F9MA 1SL2B 3RDWA 3TJFA 2LEGA 2EIOA 2CA8A 3CSHA 2JSZA 4PNGA 2ALBA 3D6IA 4IP6A 19GSA 1B9XC 2PMTA 1Q4JA 4K2XA 3LXZA 4AGSA 2V6KA 1ZZYA 2QKEA 4PQHA 1XZOA 2GZZA 1GRXA 4K2DA 2LJAA 4POMA 1IYHA 1A8LA 4N10A 1XXUA 5B6NA 2V1MA 1B48A 3HVSA 2WS2A 1SL1B 1HQOA 5EPFA 3UEMA 2KP2A 2CZ2A 2LNSA 1Y25A 1AQWA 2F9SA 1EGOA 1B9YC 5HR3A 3TRPA 3GH9A 2JZSA 3KH7A 2VL2C 4Z2RA 2N5AA 2VD1A 3HVXA 2DKHA 3MAKA 1XPVA 3EWLA 4BVXB 2H8LA 3GRXA 2M72A 4MDCA 3SBCA 1JZRA 3VWVA 1YKCA 5B7CA 1EP7A 4HJMA 3IBHA 3ZFBA 4TOPA 4V2MA 3G9BA 2D2ZA 4RQRA 2K18A 2LUSA 2A4HA 1GTUA 2LS5A 4X0XA 3DXBA 3ERGA 2YWNA 1X9MB 3R2QA 4L0UA 3GSSA 3ZREA 3GMFA 5ECPB 3EU3A 2I81A 4OFTA 1ILOA 2XC2A 3EU4A 2FWGA 2I3YA 2HRAA 4EDYA 1U3IA 4O5QA 2R5GA 1FVKA 2C8UA 3M8NA 1K0AA 3MIXA 4CHSA 4QL7A 2VM2A 4TR4A 3Q74A 1WJKA 3J7Yb 1B4PA 2DMLA 6GSSA 4MF6A 3P2AA 2L5OA 4PTSA 2PGTA 1ZOFA 4J57E 1X5EA 1K0OA 2L6DA 4RI6A 4HOJA 1SYRA 1MDJA 1MD4A 5LNKe 2K9FA 3KCMA 1SYXA 2HSHA 4NMUA 2HZFA 3H79A 3RBTA 4JZQA 1EV4A 1FO5A 2H70A 3MWHA 2X49A 1Z6NA 3LXTA 4IHUA 4IP1A 5BMUA 4GF0A 3F6DA 4ULXA 4V2NA 1QXHA 3KIJA 4HQZA 3A2WA 3KTLA 2ZNMA 3HZ4A 4ZL9A 3ZITA 2H1GA 3TCOA 2LQQA 2HRNA 3GX0A 1Q98A 4MMMA 1I9DA 1UN2A 3J7Yk 1AC1A 5DJLA 3IRAA 1XOBA 3CBUA 4TXOB 4TR1A 1GUMA 4N0VA 4IQAA 3E3EA 3ED3A 1OE7A 2FGXA 5JWOB 4GQCA 4ECIA 4OO5A 3G7YA 1W4VA 5FWGA 5INYA 3FR3A 3KEBA 3M0FA 1OKDA 2XPDA 2RM6A 2B1LA 2QA1A 5CNWA 5JWRB 6GSWA 4FIWA 4GSSA 1T8EB 2OJLA 1WMJA 5IOWA 5IMAA 1N8JA 2H6YA 3S9FA 1M2AA 1TRVA 6GSUA 2YV7A 5ECOB 4RQXA 3VPTA 1GSDA 3ZMKA 2JADA 1HYUA 1A2LA 1G0TA 4Q5RA 4KDYA 1T3BA 4DVCA 2GSRA 5A4VA 4MZCA 3I9V2 1GTBA 2E7PA 3UARA 1TXXA 2C80A 4X1UA 4J56E 1DSBA 4HI7A 2H1DA 1PL1A 3I43A 4MZWA 2DC5A 2XPEA 4MJEA 1PKZA 1PQNA 2FA8A 1H4OA 3IXRA 4EO3A 5F06A 2P5QA 4JR4A 4ZL7A 2HSYA 1X9SB 3TKSA 3O76A 5KOXA 14GSA 2JZTA 3TJGA 3EVIA 4Q5NA 3N5OA 3A3TA 4KUNA 1J9BA 1ZL9A 2RM5A 2KOKA 2X64A 5BRTA 3C1RA 1NM3A 3UOMA 5F07A 4KCAA 2HI7A 3FY7A 3DVWA 2IN3A 4KSMA 2F3MA 1OYJA 3OR5A 4KB3A 3LFLA 1JHBA 2KHPA 4KH7A 1XW6A 5GAPD 2H30A 2G0FA 3DIEA 4GWRA 2GT6A 2FA4A 1SL0B 3O3TA 1AQXA 3DYRA 3EMXA 5G31A 4F0BA 1OC9B 5G5EA 3DMLA 4KF9A 4YKGA 1ERTA 1U6TA 3TOTA 3F4SA 2LJRA 1Z6MA 5G2ZA 2H0HA 1AXDA 5H5SA 1QMVA 2YZHA 1R5AA 3F3RA 2WGRA 3PGTA 1OC8A 4G10A 4MH3A 4N0ZA 5J41A 1OE8A 1Z7PA 4WF5A 2OE3A 4PURA 2VIMA 3HYPA 5ECIB 4POBA 1JZWA 1YZXA 5CREA 3KZQA 2B7JA 2H0IA 4GRFA 2X8CA 2H01A 1UC7A 2YPMA 2LRNA 4QQ7A 4KDXA 5EY6A 5KN0A 4MLYA 4D73A 2QSIA 3APSA 4JRRA 1KEBA 3H93A 1XWAA 2L4CA 3GL3A 1QQ2A 4JR6A 2RLIA 5CP1A 5KN3A 2CZ3A 3QMXA 2CAQA 4NXIA 2CAIA 4N11A 2DBCA 3IK7A 4EE0A 2VL9A 4DSRA 2PPTA 2O89A 2V41A 4YQMA 3D21A 5GZZB 2VLVA 3K8NA 3GKKA 1RK4A 4NHWA 1WRYA 1HNBA 2IJYA 1XVQA 1MDKA 4PUFC 3C7MA 4BPYA 2L57A 5AN1A 3MDKA 4TN8A 3BBYA 17GSA 2HNLA 1TK5B 2JZRA 1WWJA 5DCHA 3UVHA 3L9VA 4FO5A 4ECJA 1M9BA 4EXJA 2NDOA 3HDCA 4BL7B 1T00A 4EIQA 1PMTA 5G30A 4IKHA 2VOCA 3FR9A 4GLTA 4ML6A 3VWUA 1THOA 2OBIA 3VPQA 2B7KA 4H86A 2MYGA 3HZ8A 4BA7A 5J4UA 5DQYA 3DD3A 4WEYA 3I69A 2MMOA 1YF1A 1GTAA 3UL3A 4YQUA 2V2GA 3GHAA 3A2VA 1GSYA 4OFMA 6GSVA 1A23A 2LNTA 2I4AA 2VO4A 5LCZA 3CTGA 3HD5A 1SJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTZ A;  4ZB8 A;  2AHE A;  3ERW A;  3GUS A;  3IR4 A;  2WFC A;  2PUK C;  3BCK A;  1TKD B;  4MPF A;  3FR6 A;  3HJM A;  4K8M A;  4Q5F A;  1BX9 A;  3LWA A;  4O32 A;  4EKZ A;  4NAX A;  4K6X A;  2B5X A;  1F3A A;  5ABR A;  1EP8 A;  1NHO A;  3M1G A;  5F8B A;  2A2S A;  2CVD A;  3ZIV A;  3BD2 A;  2F8F A;  1TJD A;  4N30 A;  1BJX A;  3PR8 A;  3TKS C;  2TIR A;  1DBY A;  5E4W A;  1FW1 A;  3F9U A;  1S3C A;  1B4Q A;  4F9Z A;  4O92 A;  4AJ8 A;  1O73 A;  1I5G A;  1NW2 A;  1MTC A;  2L6C A;  3ZVJ D;  4OFN A;  3UJ1 A;  2YAN A;  1W89 A;  2X8H A;  1EV9 A;  3UBL A;  2X8G A;  3IK9 A;  1JZD A;  4I2T A;  2REM A;  1QGV A;  3BJ5 A;  1XW9 A;  1K0M A;  2YP6 A;  1LU4 A;  1ZYE A;  2C3N A;  2TRX A;  5IM9 A;  4OCE A;  4YAP A;  3GIX A;  1IYI A;  3IV4 A;  3CTF A;  4V2L A;  2H75 A;  1PA3 A;  4JE1 A;  2DJ1 A;  1F3B A;  3HKR A;  5DAK B;  3LYP A;  1Z9H A;  4G19 A;  4HS1 A;  4GQF A;  1TP9 A;  2OAC A;  1YDK A;  1TRU A;  3QAW A;  1FAA A;  4K0G A;  3NIV A;  1GTI A;  5ID2 A;  2MBT A;  4P3Y B;  4FH8 A;  2H1A A;  1XOA A;  2ES7 A;  2DJ0 A;  3QAG A;  4AJ6 A;  3L9S A;  1F37 A;  5D8I A;  4XS4 A;  1SK1 A;  4F82 A;  3LEF A;  4MZB A;  2MBS A;  3CRT A;  1TW9 A;  2AAW A;  3FZ5 A;  5F05 A;  4ID0 A;  2RUF A;  5DAL A;  5D9V A;  2M46 A;  4OCF A;  2H1B A;  2GQL A;  3ZIJ A;  4TXV A;  3A2X A;  5D9W A;  2IL3 A;  2XBI A;  1VF4 A;  1H75 A;  1SK0 A;  9GSS A;  4TVE A;  2WRT A;  5CO3 A;  3EIN A;  2C0G A;  1HD2 A;  2QC7 A;  4ZL8 A;  1DE2 A;  5HFK A;  5ECR B;  3HY2 A;  3ME8 A;  4YAV A;  5JCU A;  2VCW A;  4WXT A;  1VF2 A;  5ECQ B;  3IA1 A;  2H71 A;  3WGE A;  5IO2 A;  2P0G A;  4MP4 A;  1XCC A;  1ZGN A;  1FOV A;  3GKN A;  1YKA A;  2C0F A;  3KH9 A;  2F8A A;  2B5E A;  3Q18 A;  3G7J A;  1PX7 A;  3APQ A;  3TKP A;  2H0G A;  1V57 A;  5ECH B;  5D9X A;  3M9K A;  1EOH A;  5KN2 A;  4Q5Q A;  5AIS A;  4I97 A;  3P90 A;  2K8S A;  1A24 A;  11GS A;  2VLU A;  1GSE A;  2R6K A;  5GSS A;  4BWS A;  2O7K A;  4MF7 A;  5FT3 A;  3H8Q A;  4KGI A;  3UIW A;  2DMM A;  3LSZ A;  4ML1 A;  1GSF A;  3TRX A;  3GN3 A;  1XFL A;  4OD7 A;  3D4M A;  4XCS A;  4BVX A;  1T1V A;  5KEJ A;  4KW6 A;  2DJK A;  5ECM B;  2IFQ A;  1JFU A;  4O5R A;  4JU5 A;  2HYX A;  4HJ2 A;  3GKX A;  2H66 A;  4KAE A;  3V1W A;  4ACS A;  2FWH A;  3KD0 A;  1AIU A;  3IC4 A;  4DSS B;  5CYY A;  1GH2 A;  1GSQ A;  2LRT A;  1FG4 A;  1R4W A;  3CSJ A;  3KMO A;  2FUG 2;  2IMK A;  7GSS A;  3ZLP A;  3MNG A;  4LMW A;  1V2A A;  1K3Y A;  3EE2 A;  4EUY A;  10GS A;  4BWQ A;  2WZ9 A;  3GV1 A;  3HVV A;  4FYB A;  3KXO A;  4EDZ A;  1TI3 A;  3ISO A;  5KN1 A;  4KDU A;  5D93 A;  3G7I A;  2GZP A;  1THX A;  1ZYQ B;  1R7H A;  5DCG A;  4LA1 A;  4DEJ A;  1EOG A;  1BYE A;  8GSS A;  1AQV A;  3RHC A;  3F0I A;  3H4K A;  3GA4 A;  1GNE A;  1PSQ A;  2RUE A;  4FYU A;  3CRU A;  2H6X A;  2XBQ A;  2VCV A;  1WP0 A;  2FWF A;  1X9W B;  5ELG A;  3UAP A;  2DIZ A;  5ECK B;  1TI1 A;  2OA7 A;  2AJQ B;  3UBK A;  1V98 A;  4PUA A;  1FB6 A;  1ON4 A;  5B8A A;  1TK8 B;  1MEK A;  3GH6 A;  4KSO A;  3TKS E;  5J3R A;  1VF3 A;  2LV3 A;  4K7O A;  3FW2 A;  3QCP A;  4ZB9 A;  2YV9 A;  1BAY A;  2V6O A;  4HDE A;  1G6Y A;  3ZRD A;  3HCZ A;  1BED A;  5DBQ A;  6GSY A;  2HRF A;  3LYK A;  3GTU B;  4GSN A;  4EF0 A;  4LL1 B;  1X5D A;  4ZBB A;  3U5R E;  3DWV A;  2DSA A;  3KGK A;  2OE0 A;  4TXO A;  2AUV A;  2MMA A;  4ECB A;  2P5R A;  2VL3 A;  2J23 A;  3D22 A;  3APO A;  1Y6E A;  3KTB A;  1X0R A;  2DJJ A;  5G1K A;  2BMX A;  1GSS A;  3D4T A;  3QFB C;  3KM6 A;  4HQS A;  2N5F A;  1XWC A;  2GSS A;  2PVQ A;  3GL5 A;  3M9J A;  1SKS B;  4I6X A;  1UVZ A;  1A2M A;  5CRG A;  2CV4 A;  1PN9 A;  3E0U A;  3GYK A;  2KLX A;  1J0F A;  4J2F A;  4GCI A;  3EMP A;  3WT1 A;  2OE1 A;  3HJP A;  1PL2 A;  2AYT A;  5ELA A;  1K3L A;  4V1A g;  18GS A;  3F4T A;  2PVO C;  2IMI A;  4XTS A;  2RII A;  1EZK A;  5J9C A;  3QD9 A;  3VI7 A;  1DE1 A;  1N2A A;  3TJB A;  2C3Q A;  4L5O A;  5J5N A;  4MF5 A;  4TR3 A;  1MDI A;  3FEU A;  3WD6 A;  4Z7X A;  1RW1 A;  1G7E A;  4EL1 A;  2FCH A;  3DEX A;  1TDI A;  2WJU A;  3LGC A;  4AJ7 A;  2I9H A;  3F3Q A;  4OO4 A;  4MH2 A;  2C3T A;  2L59 A;  4XRD A;  1TOF A;  2GS3 A;  4IJI A;  5A4U A;  5IQY A;  3TGZ A;  3QPM A;  4MJB A;  2E2G A;  3WGD A;  4PQI A;  5DVB A;  1AW9 A;  5DQS A;  1R5P A;  3H1N A;  2VCZ A;  1PX6 A;  4IBP A;  1EEJ A;  2YOI A;  1YF0 A;  3TDG A;  5B6M A;  1AAZ A;  1A0R P;  2PBJ A;  2IMF A;  2LKU A;  20GS A;  1GSU A;  4OWY A;  5IMF A;  1K0D A;  1GNW A;  4I2U A;  1BG5 A;  1ACV A;  3C71 A;  3GST A;  2YWO A;  2JL4 A;  3VWW A;  2B5Y A;  6GST A;  5IOX A;  5ECS A;  5JCW A;  4K7N A;  1UA5 A;  4WF4 A;  4HU9 A;  2YJ7 A;  4HZ2 A;  5CRH A;  1TK0 B;  1PGT A;  1WPI A;  3C73 A;  5ID2 B;  5IMZ A;  4IGJ A;  2AV4 A;  2E0Q A;  2M80 A;  5DDL A;  2IIY A;  4L8E A;  4G2E A;  2IWT A;  3TJK A;  5L71 A;  5HQP A;  4WKW A;  3M3M A;  2E2M A;  1GP1 A;  4XS4 B;  3CSI A;  3D5J A;  3L4N A;  4HUA A;  3GUR A;  1OC9 A;  2Z9S A;  1OC3 A;  3FZA A;  2L5L A;  3DGQ A;  4MK3 A;  2YCD A;  3F6F A;  5A4W A;  4TKY A;  3FRC A;  1DUG A;  3DKS A;  1S3D A;  5HR1 A;  1M99 A;  4WET A;  4XRA A;  4XHM A;  1O85 A;  4JED A;  1A2J A;  2ZUP A;  4IJ3 A;  4K0N A;  2A4V A;  3AY8 A;  4KCE A;  2GQK A;  2OBK A;  2GTU A;  1V58 A;  2JU5 A;  4PXO A;  2LQO A;  2LTK A;  1SJI A;  2YWI A;  2NTO A;  5IO0 A;  1TRW A;  2YN1 A;  1GUH A;  2HXK A;  5HFI A;  5C04 A;  4POL A;  5C00 A;  2O8V B;  4K9Z A;  4WBJ A;  4XS1 A;  5AIX A;  1Z7R A;  3VK9 A;  4MAB A;  4ECC A;  1TU7 A;  2X99 A;  4GST A;  4TR0 A;  3LG6 A;  2YZU A;  2PER A;  4DSQ A;  1Z3E A;  1O6J A;  4TR1 B;  5LD0 A;  2TRC P;  3I6A A;  1ABA A;  4TW5 A;  1WIK A;  2H19 A;  2HZE A;  1PRX A;  4IS0 A;  2GDR A;  1QUW A;  3IAM 2;  1GLP A;  3WYW A;  1XWG A;  3NOF A;  2WCI A;  3L0H A;  3CMI A;  5EVO A;  1WOU A;  3VUR A;  5GAN D;  2PWJ A;  1R26 A;  4CDO A;  2DLX A;  4F0C A;  3TKQ A;  2NBS A;  2IFQ B;  2GGT A;  1AUC A;  1YY7 A;  4NV2 A;  5ECL B;  1G7O A;  4LMV A;  1GWC A;  3GFK A;  1ML6 A;  3F4R A;  3DRN A;  1ERU A;  2FY6 A;  4AF2 A;  1SK2 A;  4BL7 A;  2BTO T;  1J08 A;  1XWB A;  2FD3 A;  1CQH A;  4IEL A;  2CT6 A;  5F0G A;  3TRQ A;  1ERW A;  1U87 A;  4ZB6 A;  5IPG A;  3TB2 A;  6GSX A;  3C1S A;  3BOA A;  3D0Z A;  1K0N A;  1GLQ A;  4PGT A;  2CX3 A;  1SEN A;  2HT9 A;  4MPG A;  3ZVJ A;  3TOU A;  1B8X A;  3CXG A;  2P31 A;  4L0W A;  3UVT A;  1VRS D;  3ZL5 A;  2GST A;  2JSY A;  3IOS A;  1VF1 A;  1SKR B;  1ERV A;  3LQ7 A;  1E6B A;  2VAF A;  4KX4 A;  3ME7 A;  1X5C A;  2YNX A;  2C1Y A;  5CRW A;  3WGX A;  2B3S A;  3EC3 A;  4CW9 A;  3IHQ A;  2VD0 A;  5E59 A;  5ENU A;  1K3O A;  3MSZ A;  1O8X A;  1SD8 A;  1G6W A;  2CVB A;  2ZCT A;  4PQ1 A;  5D96 A;  2QGV A;  2C4J A;  2FLS A;  3IPZ A;  3QR6 A;  2KUC A;  3RAZ A;  1ST9 A;  3E9J B;  3N9J A;  2ON5 A;  4JBB A;  3ZZX A;  4BVY A;  5HR2 A;  4F03 A;  1GUL A;  2B6M A;  2NPB A;  1QFN A;  4KE3 A;  1F6M C;  4V1A p;  1YJ6 A;  4IQ1 A;  1EWX A;  1E2Y A;  22GS A;  2OKA A;  2K8V A;  1TU8 A;  4KND A;  2YWM A;  3ZYW A;  1OVN A;  1O7U A;  3A5W A;  3JCM L;  2IME A;  1GL8 A;  4YQV A;  4RUV A;  3L9U A;  4EVM A;  2H76 A;  2FNO A;  1RQM A;  1T4Y A;  1JZO A;  3FKF A;  1V40 A;  3EUR A;  2XHF A;  1T7P B;  5JWQ B;  1K0B A;  4IVF A;  5B8B A;  2VCQ A;  4O7H A;  1M9A A;  2GLR A;  3QDN A;  3HXS A;  4HEA 2;  5IMC A;  5DAK A;  1O8W A;  2GT5 A;  3SWL A;  3FK8 A;  1M0U A;  2CX4 A;  4HZ4 A;  4NV5 A;  1TRS A;  4E8H A;  1YEP A;  1ZMA A;  1SKW B;  4LL4 B;  1KTE A;  4OMV A;  1A8Y A;  4PNF A;  1YEX A;  4D73 B;  5COH A;  5CRD A;  2MMN A;  5A5K A;  3NZN A;  4F2I A;  3KMN A;  5HFG A;  1LBK A;  1Z5Y E;  1M2D A;  2LRC A;  2IPA A;  3TKR A;  4POK A;  2H74 A;  2R37 A;  2MMZ A;  5H5Q A;  1A0F A;  1XIY A;  4LLR A;  4ZXG A;  2HFD A;  4ISD A;  2BJX A;  1C72 A;  1T4Z A;  1YQ1 A;  2FHE A;  1F2E A;  2AB6 A;  3C8E A;  4MJC A;  1VGL A;  2HLS A;  5D73 A;  2MZC A;  3UMA A;  3HHV A;  4WR5 A;  2IMD A;  2VUP A;  2R2J A;  1K0C A;  3Q6O A;  2DJ2 A;  1EGR A;  5IMV A;  1M2B A;  3ZTL A;  2CVK A;  1LJR A;  3W6G A;  2VLT A;  1V9W A;  2VL2 A;  1KBN A;  4FYC A;  3Q19 A;  4ZIL A;  1HNA A;  3TJJ A;  4MCU A;  3GNJ A;  2H72 A;  2FWE A;  3RPN A;  5HR0 A;  1FB0 A;  1QK8 A;  4HU7 A;  2L4Q A;  4QL9 A;  2PU9 C;  3IDV A;  3O6T A;  5AGY A;  4NHZ A;  1WE0 A;  2R4V A;  3U6V A;  3KJY A;  5IPH A;  1OAZ A;  2OAD A;  1NHY A;  3RHB A;  2EIR A;  2LJK A;  1USB A;  2ON7 A;  4MA9 A;  3US3 A;  3VWX A;  3DVX A;  4G9H A;  3HJO A;  3KP9 A;  3EYT A;  1PKW A;  5IIZ A;  5FHI A;  2VCX A;  3F8U A;  1URM A;  4EC0 A;  3LOR A;  2C0D A;  2VCT A;  1M7T A;  2DJ3 A;  5H5R A;  3IE3 A;  4YH2 A;  2NVL A;  3PIN A;  1ZCP A;  4E8E A;  4X43 A;  3P8W A;  4RI7 A;  4K1F A;  3BCI A;  4I8B A;  2WUL A;  4DSS A;  3CYN A;  3KP8 A;  2R3X A;  3FHK A;  3F63 A;  5CAX A;  3HA9 A;  2DIY A;  2H73 A;  3L78 A;  1PD2 1;  1JLV A;  2YJH A;  5EL8 A;  4MJA A;  2H6Z A;  1XWK A;  1FHE A;  2EC4 A;  2O85 A;  2PN8 A;  2WDU A;  2J9H A;  2WB9 A;  4ILF A;  1U3A A;  3LJR A;  5D9T A;  2EIQ A;  5AIV A;  3WT2 A;  5GST A;  5J9B A;  1XBS A;  4IW9 A;  2HE3 A;  4I5Q A;  2LST A;  3QOU A;  4KA0 A;  3QFA C;  4WR4 A;  2K6V A;  13GS A;  1U88 A;  2GVP A;  3GKM A;  3W8J A;  4GXZ A;  1JLW A;  2V32 A;  16GS A;  2HZE B;  3P7X A;  4IN0 A;  1NSW A;  4ZBD A;  2A2R A;  1EEM A;  3QAV A;  4XIH A;  4TRX A;  4ZBA A;  5ECN B;  1S3A A;  1CQG A;  1XVW A;  4WBR D;  1O81 A;  5JCG A;  5G1L A;  2GQM A;  3RPP A;  5IMD A;  1FVJ A;  3FYG A;  3VFI A;  1OKT A;  3PH9 A;  2KP1 A;  4K7I A;  5DJM A;  3VI5 A;  3IAS 2;  3ERF A;  1SJ6 A;  3GTU A;  1XW5 A;  12GS A;  3W8S A;  2JAC A;  1MD3 A;  2I1U A;  4PX1 A;  4ZIJ A;  1SD9 A;  3TUE A;  3FZ9 A;  2O87 A;  2G2Q A;  5DAL B;  4NWY A;  1KNG A;  1SU9 A;  3ZML A;  2B1K A;  1HNC A;  5G5F A;  2GSQ A;  4NPB A;  4GTU A;  3ZFL A;  1GUK A;  2C0E A;  3GX8 A;  1BQ7 A;  3VLN A;  2N5B A;  3FZ4 A;  2F51 A;  4L5L A;  2VM1 A;  2GZY A;  4XS6 A;  2CQ9 A;  1F9M A;  1SL2 B;  3RDW A;  3TJF A;  2LEG A;  2EIO A;  2CA8 A;  3CSH A;  2JSZ A;  4PNG A;  2ALB A;  3D6I A;  4IP6 A;  19GS A;  1B9X C;  2PMT A;  1Q4J A;  3LXZ A;  4AGS A;  2V6K A;  1ZZY A;  2QKE A;  4PQH A;  1XZO A;  2GZZ A;  1GRX A;  4K2D A;  2LJA A;  4POM A;  1IYH A;  1A8L A;  4N10 A;  1XXU A;  5B6N A;  2V1M A;  1B48 A;  3HVS A;  2WS2 A;  1SL1 B;  1HQO A;  5EPF A;  3UEM A;  2KP2 A;  2CZ2 A;  2LNS A;  1Y25 A;  1AQW A;  2F9S A;  1EGO A;  1B9Y C;  5HR3 A;  3TRP A;  3GH9 A;  2JZS A;  3KH7 A;  2VL2 C;  2N5A A;  2VD1 A;  3HVX A;  3MAK A;  1XPV A;  3EWL A;  2H8L A;  3GRX A;  2M72 A;  4MDC A;  3SBC A;  1JZR A;  3VWV A;  1YKC A;  5B7C A;  1EP7 A;  4HJM A;  3IBH A;  3ZFB A;  4TOP A;  4V2M A;  3G9B A;  2D2Z A;  4RQR A;  2K18 A;  2LUS A;  1GTU A;  2LS5 A;  4X0X A;  3DXB A;  3ERG A;  2YWN A;  1X9M B;  3R2Q A;  4L0U A;  3GSS A;  3ZRE A;  3GMF A;  5ECP B;  3EU3 A;  2I81 A;  4OFT A;  1ILO A;  2XC2 A;  3EU4 A;  2FWG A;  2I3Y A;  4EDY A;  1U3I A;  2R5G A;  1FVK A;  2C8U A;  3M8N A;  1K0A A;  4CHS A;  4QL7 A;  2VM2 A;  4TR4 A;  3Q74 A;  1WJK A;  3J7Y b;  1B4P A;  2DML A;  6GSS A;  4MF6 A;  3P2A A;  2L5O A;  2PGT A;  1ZOF A;  4J57 E;  1X5E A;  1K0O A;  2L6D A;  4RI6 A;  4HOJ A;  1SYR A;  1MDJ A;  1MD4 A;  5LNK e;  2K9F A;  3KCM A;  1SYX A;  2HSH A;  4NMU A;  2HZF A;  3H79 A;  3RBT A;  4JZQ A;  1EV4 A;  1FO5 A;  2H70 A;  3MWH A;  1Z6N A;  3LXT A;  4IHU A;  4IP1 A;  4GF0 A;  3F6D A;  4ULX A;  4V2N A;  1QXH A;  3KIJ A;  4HQZ A;  3A2W A;  3KTL A;  2ZNM A;  3HZ4 A;  4ZL9 A;  3ZIT A;  2H1G A;  3TCO A;  2LQQ A;  2HRN A;  3GX0 A;  1Q98 A;  4MMM A;  1I9D A;  1UN2 A;  3J7Y k;  1AC1 A;  5DJL A;  3IRA A;  1XOB A;  3CBU A;  4TXO B;  4TR1 A;  1GUM A;  4N0V A;  4IQA A;  3E3E A;  3ED3 A;  1OE7 A;  2FGX A;  5JWO B;  4GQC A;  4ECI A;  4OO5 A;  3G7Y A;  1W4V A;  5FWG A;  5INY A;  3FR3 A;  3KEB A;  3M0F A;  1OKD A;  2XPD A;  2RM6 A;  2B1L A;  5CNW A;  5JWR B;  6GSW A;  4FIW A;  4GSS A;  1T8E B;  2OJL A;  1WMJ A;  5IOW A;  5IMA A;  1N8J A;  2H6Y A;  3S9F A;  1M2A A;  1TRV A;  6GSU A;  2YV7 A;  5ECO B;  4RQX A;  3VPT A;  1GSD A;  3ZMK A;  2JAD A;  1HYU A;  1A2L A;  1G0T A;  4Q5R A;  4KDY A;  1T3B A;  4DVC A;  2GSR A;  5A4V A;  4MZC A;  3I9V 2;  1GTB A;  2E7P A;  3UAR A;  1TXX A;  2C80 A;  4X1U A;  4J56 E;  1DSB A;  4HI7 A;  2H1D A;  1PL1 A;  3I43 A;  4MZW A;  2DC5 A;  2XPE A;  4MJE A;  1PKZ A;  1PQN A;  2FA8 A;  1H4O A;  3IXR A;  4EO3 A;  5F06 A;  2P5Q A;  4JR4 A;  4ZL7 A;  2HSY A;  1X9S B;  3TKS A;  3O76 A;  14GS A;  2JZT A;  3TJG A;  3EVI A;  4Q5N A;  3N5O A;  3A3T A;  4KUN A;  1J9B A;  1ZL9 A;  2RM5 A;  2KOK A;  2X64 A;  3C1R A;  1NM3 A;  3UOM A;  5F07 A;  4KCA A;  2HI7 A;  3FY7 A;  3DVW A;  2IN3 A;  4KSM A;  2F3M A;  1OYJ A;  3OR5 A;  4KB3 A;  3LFL A;  1JHB A;  2KHP A;  4KH7 A;  1XW6 A;  5GAP D;  2H30 A;  2G0F A;  3DIE A;  4GWR A;  2GT6 A;  2FA4 A;  1SL0 B;  3O3T A;  1AQX A;  3DYR A;  3EMX A;  5G31 A;  4F0B A;  1OC9 B;  5G5E A;  3DML A;  1ERT A;  1U6T A;  3TOT A;  3F4S A;  2LJR A;  1Z6M A;  5G2Z A;  2H0H A;  1AXD A;  5H5S A;  1QMV A;  2YZH A;  1R5A A;  3F3R A;  2WGR A;  3PGT A;  1OC8 A;  4G10 A;  4MH3 A;  4N0Z A;  5J41 A;  1OE8 A;  1Z7P A;  4WF5 A;  2OE3 A;  4PUR A;  2VIM A;  3HYP A;  5ECI B;  4POB A;  1JZW A;  1YZX A;  5CRE A;  3KZQ A;  2B7J A;  2H0I A;  4GRF A;  2X8C A;  2H01 A;  1UC7 A;  2YPM A;  2LRN A;  4QQ7 A;  4KDX A;  5EY6 A;  5KN0 A;  4MLY A;  4D73 A;  2QSI A;  3APS A;  4JRR A;  1KEB A;  3H93 A;  1XWA A;  2L4C A;  3GL3 A;  1QQ2 A;  4JR6 A;  2RLI A;  5CP1 A;  5KN3 A;  2CZ3 A;  3QMX A;  2CAQ A;  4NXI A;  2CAI A;  4N11 A;  2DBC A;  3IK7 A;  4EE0 A;  2VL9 A;  4DSR A;  2PPT A;  2O89 A;  2V41 A;  4YQM A;  3D21 A;  5GZZ B;  2VLV A;  3K8N A;  3GKK A;  1RK4 A;  4NHW A;  1WRY A;  1HNB A;  2IJY A;  1XVQ A;  1MDK A;  4PUF C;  3C7M A;  4BPY A;  2L57 A;  5AN1 A;  3MDK A;  4TN8 A;  3BBY A;  17GS A;  2HNL A;  1TK5 B;  2JZR A;  1WWJ A;  5DCH A;  3UVH A;  3L9V A;  4FO5 A;  4ECJ A;  1M9B A;  4EXJ A;  2NDO A;  3HDC A;  1T00 A;  1PMT A;  5G30 A;  4IKH A;  2VOC A;  3FR9 A;  4GLT A;  4ML6 A;  3VWU A;  1THO A;  2OBI A;  3VPQ A;  2B7K A;  4H86 A;  2MYG A;  3HZ8 A;  4BA7 A;  5J4U A;  5DQY A;  3DD3 A;  4WEY A;  3I69 A;  2MMO A;  1YF1 A;  1GTA A;  3UL3 A;  4YQU A;  2V2G A;  3GHA A;  3A2V A;  1GSY A;  4OFM A;  6GSV A;  1A23 A;  2LNT A;  2I4A A;  2VO4 A;  5LCZ A;  3CTG A;  3HD5 A;  1SJZ A; 
#chains in the Genus database with same CATH topology
 1TTZ A;  4ZB8 A;  2AHE A;  3ERW A;  3GUS A;  3IR4 A;  2WFC A;  2PUK C;  3BCK A;  1TKD B;  4MPF A;  3FR6 A;  3HJM A;  4K8M A;  4Q5F A;  1BX9 A;  3LWA A;  4O32 A;  4EKZ A;  4NAX A;  4K6X A;  2B5X A;  1F3A A;  5ABR A;  1EP8 A;  1NHO A;  3M1G A;  5F8B A;  2A2S A;  2CVD A;  3ZIV A;  3BD2 A;  2F8F A;  1TJD A;  4N30 A;  3EPT A;  1BJX A;  3PR8 A;  4BVY B;  3TKS C;  2TIR A;  1DBY A;  5E4W A;  1FW1 A;  3F9U A;  1S3C A;  1B4Q A;  4F9Z A;  4O92 A;  4AJ8 A;  1O73 A;  1I5G A;  1NW2 A;  1MTC A;  2L6C A;  3ZVJ D;  4OFN A;  3UJ1 A;  2YAN A;  1W89 A;  2X8H A;  1EV9 A;  3UBL A;  2X8G A;  3IK9 A;  4CY8 A;  1JZD A;  4I2T A;  2REM A;  1QGV A;  3BJ5 A;  1XW9 A;  1K0M A;  2YP6 A;  1LU4 A;  1ZYE A;  2C3N A;  2TRX A;  5IM9 A;  4K5R A;  4OCE A;  4YAP A;  3GIX A;  1IYI A;  3IV4 A;  3CTF A;  4V2L A;  2H75 A;  1PA3 A;  4JE1 A;  2DJ1 A;  1F3B A;  3HKR A;  5DAK B;  3LYP A;  1Z9H A;  4G19 A;  4HS1 A;  4GQF A;  1TP9 A;  2OAC A;  1YDK A;  1TRU A;  3QAW A;  1FAA A;  4K0G A;  3NIV A;  1GTI A;  5ID2 A;  2MBT A;  4P3Y B;  4FH8 A;  2H1A A;  1XOA A;  2ES7 A;  2DJ0 A;  3IHG A;  3QAG A;  3PPU A;  4AJ6 A;  3L9S A;  1F37 A;  5D8I A;  4XS4 A;  1SK1 A;  4F82 A;  3LEF A;  4MZB A;  2MBS A;  3CRT A;  1TW9 A;  2AAW A;  3FZ5 A;  5F05 A;  4ID0 A;  2RUF A;  5DAL A;  5D9V A;  2M46 A;  4OCF A;  2H1B A;  2GQL A;  3ZIJ A;  4TXV A;  3A2X A;  5D9W A;  2IL3 A;  2XBI A;  1VF4 A;  1H75 A;  1SK0 A;  4EIP A;  9GSS A;  4TVE A;  2WRT A;  5CO3 A;  3EIN A;  2C0G A;  1HD2 A;  2QC7 A;  4ZL8 A;  1DE2 A;  5HFK A;  5ECR B;  3HY2 A;  3ME8 A;  4YAV A;  5JCU A;  2VCW A;  4WXT A;  1VF2 A;  5ECQ B;  3IA1 A;  2H71 A;  3WGE A;  5IO2 A;  2P0G A;  4MP4 A;  1XCC A;  1ZGN A;  1FOV A;  3GKN A;  1YKA A;  2C0F A;  3KH9 A;  2F8A A;  2B5E A;  3Q18 A;  3G7J A;  2R0G A;  1PX7 A;  3APQ A;  3TKP A;  2H0G A;  1V57 A;  5ECH B;  5D9X A;  3M9K A;  1EOH A;  5KN2 A;  4Q5Q A;  5AIS A;  4I97 A;  3P90 A;  2K8S A;  1A24 A;  11GS A;  2VLU A;  1GSE A;  2R6K A;  5GSS A;  4BWS A;  2O7K A;  4MF7 A;  5FT3 A;  3H8Q A;  4KGI A;  3UIW A;  2DMM A;  3LSZ A;  3HVN A;  4ML1 A;  1GSF A;  3TRX A;  3GN3 A;  1XFL A;  4OD7 A;  3D4M A;  4XCS A;  4BVX A;  1T1V A;  5KEJ A;  4KW6 A;  2DJK A;  5ECM B;  2IFQ A;  1JFU A;  4O5R A;  4JU5 A;  2HYX A;  4HJ2 A;  3GKX A;  1PN0 A;  2H66 A;  4KAE A;  3V1W A;  4ACS A;  2FWH A;  3KD0 A;  1AIU A;  4A5P A;  3IC4 A;  4DSS B;  5CYY A;  1GH2 A;  1GSQ A;  2LRT A;  1FG4 A;  1R4W A;  3CSJ A;  3KMO A;  1ZYP A;  2FUG 2;  2IMK A;  7GSS A;  3ZLP A;  3MNG A;  4LMW A;  1V2A A;  1K3Y A;  3EE2 A;  4EUY A;  10GS A;  4BWQ A;  2WZ9 A;  3GV1 A;  3HVV A;  4FYB A;  3KXO A;  4O5U A;  4EDZ A;  1TI3 A;  3ISO A;  5KN1 A;  4KDU A;  5D93 A;  3G7I A;  2GZP A;  1THX A;  1ZYQ B;  1R7H A;  5DCG A;  4LA1 A;  4DEJ A;  1EOG A;  1BYE A;  8GSS A;  1AQV A;  3RHC A;  3F0I A;  3H4K A;  3GA4 A;  1GNE A;  1PSQ A;  2RUE A;  4FYU A;  3CRU A;  2H6X A;  2XBQ A;  4FQU A;  2VCV A;  1WP0 A;  2FWF A;  1X9W B;  5ELG A;  3UAP A;  2DIZ A;  5ECK B;  1TI1 A;  2OA7 A;  2AJQ B;  3UBK A;  1V98 A;  4PUA A;  1FB6 A;  1ON4 A;  5B8A A;  1TK8 B;  1MEK A;  3GH6 A;  4KSO A;  3TKS E;  5J3R A;  1VF3 A;  2LV3 A;  4K7O A;  3FW2 A;  3QCP A;  4ZB9 A;  2YV9 A;  1BAY A;  2V6O A;  4HDE A;  1G6Y A;  3ZRD A;  3HCZ A;  1BED A;  5DBQ A;  6GSY A;  2HRF A;  3LYK A;  3GTU B;  4GSN A;  4EF0 A;  4LL1 B;  1X5D A;  4ZBB A;  3U5R E;  3DWV A;  2DSA A;  3KGK A;  2OE0 A;  2R0C A;  2UZ8 A;  4TXO A;  2AUV A;  2MMA A;  4ECB A;  2P5R A;  2VL3 A;  2J23 A;  3D22 A;  3APO A;  1Y6E A;  3KTB A;  1X0R A;  2DJJ A;  5G1K A;  2BMX A;  1GSS A;  3D4T A;  3QFB C;  3KM6 A;  4HQS A;  2N5F A;  1XWC A;  2GSS A;  2PVQ A;  3GL5 A;  3M9J A;  1SKS B;  4I6X A;  1UVZ A;  1A2M A;  5CRG A;  2CV4 A;  1PN9 A;  3E0U A;  3GYK A;  2KLX A;  1J0F A;  4J2F A;  4GCI A;  3EMP A;  3WT1 A;  2OE1 A;  3HJP A;  1PL2 A;  2AYT A;  5ELA A;  1K3L A;  4V1A g;  18GS A;  3F4T A;  2PVO C;  2IMI A;  4XTS A;  2RII A;  1EZK A;  5J9C A;  3QD9 A;  3VI7 A;  1DE1 A;  1N2A A;  3TJB A;  4Z2T A;  2C3Q A;  4L5O A;  5J5N A;  4MF5 A;  1ZYN A;  2HRK A;  4TR3 A;  1MDI A;  3FEU A;  3WD6 A;  4Z7X A;  4X4J A;  1RW1 A;  1G7E A;  2HSM A;  3A5I A;  4EL1 A;  2FCH A;  3DEX A;  1TDI A;  4Z2U A;  2WJU A;  3LGC A;  4AJ7 A;  2I9H A;  3F3Q A;  4OO4 A;  4MH2 A;  2C3T A;  2L59 A;  4XRD A;  2A2P A;  1TOF A;  2GS3 A;  4IJI A;  5A4U A;  5IQY A;  3TGZ A;  3QPM A;  4MJB A;  2E2G A;  3WGD A;  4PQI A;  5DVB A;  1AW9 A;  5DQS A;  1R5P A;  3MYD A;  3H1N A;  2VCZ A;  1PX6 A;  4IBP A;  1EEJ A;  2YOI A;  1YF0 A;  3TDG A;  5B6M A;  1AAZ A;  1A0R P;  2PBJ A;  2IMF A;  2LKU A;  20GS A;  1GSU A;  4OWY A;  5IMF A;  1K0D A;  1GNW A;  4I2U A;  1BG5 A;  1ACV A;  3C71 A;  3GST A;  2YWO A;  2JL4 A;  3VWW A;  2B5Y A;  6GST A;  5IOX A;  5ECS A;  5JCW A;  4K7N A;  1UA5 A;  4WF4 A;  4HU9 A;  2YJ7 A;  4HZ2 A;  5CRH A;  1TK0 B;  4MNN A;  1PGT A;  1WPI A;  3C73 A;  5ID2 B;  5IMZ A;  4IGJ A;  2AV4 A;  2E0Q A;  2M80 A;  5DDL A;  2IIY A;  4L8E A;  4G2E A;  3CQF A;  2IWT A;  3TJK A;  5L71 A;  5HQP A;  4WKW A;  3M3M A;  2E2M A;  1GP1 A;  4XS4 B;  3CSI A;  3D5J A;  3L4N A;  4HUA A;  3GUR A;  1OC9 A;  2Z9S A;  1OC3 A;  3FZA A;  2L5L A;  3DGQ A;  4MK3 A;  2YCD A;  3F6F A;  5A4W A;  4TKY A;  3FRC A;  1DUG A;  3DKS A;  1S3D A;  5HR1 A;  1M99 A;  4WET A;  4XRA A;  4XHM A;  1O85 A;  4G0I A;  4JED A;  1A2J A;  2ZUP A;  4IJ3 A;  4K0N A;  2A4V A;  3AY8 A;  4KCE A;  2GQK A;  2OBK A;  2GTU A;  1V58 A;  2JU5 A;  4PXO A;  2LQO A;  2LTK A;  1SJI A;  2YWI A;  2NTO A;  5IO0 A;  1TRW A;  2YN1 A;  1GUH A;  2HXK A;  5HFI A;  5C04 A;  4POL A;  5C00 A;  2O8V B;  4K9Z A;  4WBJ A;  4XS1 A;  5AIX A;  1Z7R A;  3VK9 A;  4MAB A;  4ECC A;  1TU7 A;  2X99 A;  4GST A;  4TR0 A;  3LG6 A;  2YZU A;  2PER A;  4DSQ A;  1Z3E A;  1O6J A;  4TR1 B;  5LD0 A;  4G0L A;  2TRC P;  3I6A A;  1ABA A;  4TW5 A;  1WIK A;  2H19 A;  2HZE A;  1PRX A;  4IS0 A;  2GDR A;  1QUW A;  3IAM 2;  1GLP A;  3WYW A;  1XWG A;  3NOF A;  2WCI A;  3L0H A;  2QA2 A;  3CMI A;  5EVO A;  1WOU A;  3VUR A;  5GAN D;  2PWJ A;  1R26 A;  4CDO A;  2DLX A;  4F0C A;  3TKQ A;  2NBS A;  2IFQ B;  2GGT A;  1AUC A;  3R3E A;  1YY7 A;  2X4A A;  4NV2 A;  5ECL B;  1G7O A;  4LMV A;  1GWC A;  3GFK A;  1ML6 A;  3F4R A;  3DRN A;  1ERU A;  2FY6 A;  4AF2 A;  1SK2 A;  4BL7 A;  2BTO T;  1J08 A;  1XWB A;  2FD3 A;  1CQH A;  4ICY A;  4IEL A;  2CT6 A;  5F0G A;  3TRQ A;  1ERW A;  1U87 A;  4ZB6 A;  5IPG A;  3TB2 A;  6GSX A;  3C1S A;  3BOA A;  3D0Z A;  1K0N A;  1GLQ A;  4PGT A;  2CX3 A;  1SEN A;  2HT9 A;  4MPG A;  3ZVJ A;  3TOU A;  1B8X A;  3CXG A;  2P31 A;  4L0W A;  3UVT A;  1VRS D;  3ZL5 A;  2GST A;  2JSY A;  3IOS A;  1VF1 A;  1SKR B;  1ERV A;  3LQ7 A;  1E6B A;  2VAF A;  4KX4 A;  3ME7 A;  1X5C A;  2YNX A;  2C1Y A;  5CRW A;  3WGX A;  2B3S A;  3EC3 A;  4CW9 A;  3IHQ A;  2VD0 A;  5E59 A;  5ENU A;  1K3O A;  3MSZ A;  1O8X A;  1SD8 A;  1G6W A;  2CVB A;  2ZCT A;  4PQ1 A;  5D96 A;  2QGV A;  2C4J A;  2FLS A;  3IPZ A;  3QR6 A;  2KUC A;  3RAZ A;  1ST9 A;  3E9J B;  3N9J A;  2ON5 A;  4JBB A;  3ZZX A;  4BVY A;  5HR2 A;  4F03 A;  1GUL A;  2B6M A;  2NPB A;  1QFN A;  4KE3 A;  1F6M C;  2DKI A;  4V1A p;  1YJ6 A;  4IQ1 A;  1EWX A;  1E2Y A;  22GS A;  2OKA A;  2K8V A;  1TU8 A;  4KND A;  2YWM A;  3ZYW A;  1OVN A;  1O7U A;  3A5W A;  3JCM L;  2IME A;  1GL8 A;  4YQV A;  4RUV A;  3L9U A;  4EVM A;  2H76 A;  2FNO A;  1RQM A;  1T4Y A;  1JZO A;  3FKF A;  1V40 A;  3EUR A;  2XHF A;  1T7P B;  5JWQ B;  1K0B A;  4IVF A;  5B8B A;  2VCQ A;  4O7H A;  1M9A A;  2GLR A;  3QDN A;  3HXS A;  4HEA 2;  5IMC A;  5DAK A;  1O8W A;  2GT5 A;  3SWL A;  3FK8 A;  1M0U A;  2CX4 A;  4HZ4 A;  4NV5 A;  1TRS A;  4E8H A;  1YEP A;  1ZMA A;  1SKW B;  4LL4 B;  1KTE A;  4OMV A;  1A8Y A;  4PNF A;  1YEX A;  4D73 B;  5COH A;  5CRD A;  2MMN A;  5A5K A;  3NZN A;  4F2I A;  5KOW A;  3KMN A;  5HFG A;  1LBK A;  1Z5Y E;  1M2D A;  2LRC A;  2IPA A;  3TKR A;  4POK A;  2H74 A;  2R37 A;  2MMZ A;  5H5Q A;  1A0F A;  1XIY A;  4LLR A;  4ZXG A;  2HFD A;  4ISD A;  2BJX A;  1C72 A;  1T4Z A;  1YQ1 A;  2FHE A;  1F2E A;  2AB6 A;  3C8E A;  4MJC A;  1VGL A;  2HLS A;  5D73 A;  2MZC A;  3UMA A;  3HHV A;  4WR5 A;  4CY6 A;  2IMD A;  2VUP A;  2R2J A;  1K0C A;  3Q6O A;  2DJ2 A;  1EGR A;  5IMV A;  1M2B A;  3ZTL A;  2CVK A;  1LJR A;  3W6G A;  2VLT A;  1V9W A;  2VL2 A;  1KBN A;  4FYC A;  3Q19 A;  4G0K A;  4ZIL A;  1HNA A;  3TJJ A;  4MCU A;  3GNJ A;  2H72 A;  2FWE A;  3RPN A;  5HR0 A;  1FB0 A;  1QK8 A;  4HU7 A;  2L4Q A;  4QL9 A;  2PU9 C;  3IDV A;  4USS A;  3O6T A;  5AGY A;  4NHZ A;  1WE0 A;  2R4V A;  3U6V A;  3KJY A;  5IPH A;  1OAZ A;  2OAD A;  1NHY A;  3RHB A;  2EIR A;  2LJK A;  1USB A;  2ON7 A;  4MA9 A;  3US3 A;  3VWX A;  3DVX A;  4K5S A;  4G9H A;  3HJO A;  3KP9 A;  3EYT A;  1PKW A;  5IIZ A;  5FHI A;  2VCX A;  3F8U A;  1URM A;  4EC0 A;  3LOR A;  2C0D A;  2VCT A;  1M7T A;  2DJ3 A;  5H5R A;  3IE3 A;  4YH2 A;  2NVL A;  3PIN A;  1ZCP A;  4E8E A;  4X43 A;  3P8W A;  4RI7 A;  4K1F A;  3BCI A;  3FMW A;  4I8B A;  2WUL A;  4DSS A;  3CYN A;  3KP8 A;  2R3X A;  3FHK A;  3F63 A;  5CAX A;  3HA9 A;  2DIY A;  2H73 A;  3L78 A;  1PD2 1;  1JLV A;  2YJH A;  5EL8 A;  4MJA A;  2H6Z A;  1XWK A;  1FHE A;  2EC4 A;  2O85 A;  2PN8 A;  2WDU A;  2J9H A;  2WB9 A;  4ILF A;  1U3A A;  3LJR A;  5D9T A;  2EIQ A;  5AIV A;  3WT2 A;  5GST A;  5J9B A;  1XBS A;  4IW9 A;  2HE3 A;  4I5Q A;  2LST A;  3QOU A;  4KA0 A;  3QFA C;  4WR4 A;  2K6V A;  13GS A;  1U88 A;  2GVP A;  3GKM A;  3W8J A;  4GXZ A;  1JLW A;  2V32 A;  2R0P A;  16GS A;  2HZE B;  3P7X A;  4IN0 A;  1NSW A;  4ZBD A;  2A2R A;  1EEM A;  3QAV A;  4XIH A;  4TRX A;  4ZBA A;  5ECN B;  1M3J A;  1S3A A;  1CQG A;  1XVW A;  4WBR D;  1O81 A;  5JCG A;  5G1L A;  2GQM A;  3RPP A;  5IMD A;  1FVJ A;  3FYG A;  3VFI A;  1OKT A;  3PH9 A;  2KP1 A;  4K7I A;  5DJM A;  3VI5 A;  4YKF A;  3IAS 2;  3ERF A;  1SJ6 A;  3GTU A;  1XW5 A;  12GS A;  3W8S A;  2JAC A;  1MD3 A;  3IC8 A;  2I1U A;  4PX1 A;  4ZIJ A;  1SD9 A;  3TUE A;  3FZ9 A;  2O87 A;  1FOH A;  2G2Q A;  5DAL B;  4NWY A;  1KNG A;  1SU9 A;  3ZML A;  2B1K A;  1HNC A;  5G5F A;  2GSQ A;  3LW9 A;  4NPB A;  4GTU A;  3ZFL A;  1GUK A;  2C0E A;  3GX8 A;  1BQ7 A;  3VLN A;  2N5B A;  3FZ4 A;  2F51 A;  4L5L A;  2VM1 A;  2GZY A;  4XS6 A;  2CQ9 A;  1F9M A;  1SL2 B;  3RDW A;  3TJF A;  2LEG A;  2EIO A;  2CA8 A;  3CSH A;  2JSZ A;  4PNG A;  2ALB A;  3D6I A;  4IP6 A;  19GS A;  1B9X C;  2PMT A;  1Q4J A;  4K2X A;  3LXZ A;  4AGS A;  2V6K A;  1ZZY A;  2QKE A;  4PQH A;  1XZO A;  2GZZ A;  1GRX A;  4K2D A;  2LJA A;  4POM A;  1IYH A;  1A8L A;  4N10 A;  1XXU A;  5B6N A;  2V1M A;  1B48 A;  3HVS A;  2WS2 A;  1SL1 B;  1HQO A;  5EPF A;  3UEM A;  2KP2 A;  2CZ2 A;  2LNS A;  1Y25 A;  1AQW A;  2F9S A;  1EGO A;  1B9Y C;  5HR3 A;  3TRP A;  3GH9 A;  2JZS A;  3KH7 A;  2VL2 C;  4Z2R A;  2N5A A;  2VD1 A;  3HVX A;  2DKH A;  3MAK A;  1XPV A;  3EWL A;  4BVX B;  2H8L A;  3GRX A;  2M72 A;  4MDC A;  3SBC A;  1JZR A;  3VWV A;  1YKC A;  5B7C A;  1EP7 A;  4HJM A;  3IBH A;  3ZFB A;  4TOP A;  4V2M A;  3G9B A;  2D2Z A;  4RQR A;  2K18 A;  2LUS A;  2A4H A;  1GTU A;  2LS5 A;  4X0X A;  3DXB A;  3ERG A;  2YWN A;  1X9M B;  3R2Q A;  4L0U A;  3GSS A;  3ZRE A;  3GMF A;  5ECP B;  3EU3 A;  2I81 A;  4OFT A;  1ILO A;  2XC2 A;  3EU4 A;  2FWG A;  2I3Y A;  2HRA A;  4EDY A;  1U3I A;  4O5Q A;  2R5G A;  1FVK A;  2C8U A;  3M8N A;  1K0A A;  3MIX A;  4CHS A;  4QL7 A;  2VM2 A;  4TR4 A;  3Q74 A;  1WJK A;  3J7Y b;  1B4P A;  2DML A;  6GSS A;  4MF6 A;  3P2A A;  2L5O A;  4PTS A;  2PGT A;  1ZOF A;  4J57 E;  1X5E A;  1K0O A;  2L6D A;  4RI6 A;  4BIK A;  4HOJ A;  1SYR A;  1MDJ A;  1MD4 A;  5LNK e;  2K9F A;  1XG8 A;  3KCM A;  1SYX A;  2HSH A;  4NMU A;  2HZF A;  3H79 A;  3RBT A;  4JZQ A;  1EV4 A;  1FO5 A;  2H70 A;  3MWH A;  2X49 A;  1Z6N A;  3LXT A;  4IHU A;  4IP1 A;  5BMU A;  4GF0 A;  3F6D A;  4ULX A;  4V2N A;  1QXH A;  3KIJ A;  4HQZ A;  3A2W A;  3KTL A;  2ZNM A;  3HZ4 A;  4ZL9 A;  3ZIT A;  2H1G A;  3TCO A;  2LQQ A;  2HRN A;  3GX0 A;  1Q98 A;  4MMM A;  1I9D A;  1UN2 A;  3J7Y k;  1AC1 A;  5DJL A;  3IRA A;  1XOB A;  3CBU A;  4TXO B;  4TR1 A;  1GUM A;  4N0V A;  4IQA A;  3E3E A;  3ED3 A;  1OE7 A;  2FGX A;  5JWO B;  4GQC A;  4ECI A;  4OO5 A;  3G7Y A;  1W4V A;  5FWG A;  5INY A;  3FR3 A;  3KEB A;  3M0F A;  1OKD A;  2XPD A;  2RM6 A;  2B1L A;  2QA1 A;  5CNW A;  5JWR B;  6GSW A;  4FIW A;  4GSS A;  1T8E B;  2OJL A;  1WMJ A;  5IOW A;  5IMA A;  1N8J A;  2H6Y A;  3S9F A;  1M2A A;  1TRV A;  6GSU A;  2YV7 A;  5ECO B;  4RQX A;  3VPT A;  1GSD A;  3ZMK A;  1M3I A;  2JAD A;  1HYU A;  1A2L A;  1G0T A;  4Q5R A;  4KDY A;  1T3B A;  4DVC A;  2GSR A;  5A4V A;  4MZC A;  3I9V 2;  1GTB A;  2E7P A;  3UAR A;  1TXX A;  2C80 A;  4X1U A;  4J56 E;  1DSB A;  4HI7 A;  2H1D A;  1PL1 A;  3I43 A;  4MZW A;  2DC5 A;  2XPE A;  4MJE A;  1PKZ A;  1PQN A;  2FA8 A;  1H4O A;  3IXR A;  4EO3 A;  5F06 A;  2P5Q A;  4JR4 A;  4ZL7 A;  2HSY A;  1X9S B;  3TKS A;  3O76 A;  5KOX A;  14GS A;  2JZT A;  3TJG A;  3EVI A;  4Q5N A;  3N5O A;  3A3T A;  4KUN A;  1J9B A;  1ZL9 A;  2RM5 A;  2KOK A;  2X64 A;  5BRT A;  3C1R A;  1NM3 A;  3UOM A;  5F07 A;  4KCA A;  2HI7 A;  3FY7 A;  3DVW A;  2IN3 A;  4KSM A;  2F3M A;  1OYJ A;  3OR5 A;  4KB3 A;  3LFL A;  1JHB A;  2KHP A;  4KH7 A;  1XW6 A;  5GAP D;  2H30 A;  2G0F A;  3DIE A;  4GWR A;  2GT6 A;  2FA4 A;  1SL0 B;  3O3T A;  1AQX A;  3DYR A;  3EMX A;  5G31 A;  4F0B A;  1OC9 B;  5G5E A;  3DML A;  4KF9 A;  4YKG A;  1ERT A;  1U6T A;  3TOT A;  3F4S A;  2LJR A;  1PFO A;  1Z6M A;  5G2Z A;  2H0H A;  1AXD A;  5H5S A;  1QMV A;  2YZH A;  1R5A A;  3F3R A;  2WGR A;  3PGT A;  1OC8 A;  4HSC X;  4G10 A;  4MH3 A;  4N0Z A;  5J41 A;  1OE8 A;  1Z7P A;  4WF5 A;  2OE3 A;  4PUR A;  2VIM A;  3HYP A;  5ECI B;  4POB A;  1JZW A;  1YZX A;  5CRE A;  3KZQ A;  2B7J A;  2H0I A;  4GRF A;  2X8C A;  2H01 A;  1UC7 A;  2YPM A;  2LRN A;  4QQ7 A;  4KDX A;  5EY6 A;  5KN0 A;  4MLY A;  4D73 A;  2QSI A;  3APS A;  4JRR A;  1KEB A;  3H93 A;  1XWA A;  2L4C A;  3GL3 A;  1QQ2 A;  4JR6 A;  2RLI A;  5CP1 A;  5KN3 A;  2CZ3 A;  3QMX A;  2CAQ A;  4NXI A;  2CAI A;  4N11 A;  2DBC A;  3IK7 A;  4EE0 A;  2VL9 A;  4DSR A;  2PPT A;  2O89 A;  2V41 A;  4YQM A;  3D21 A;  5GZZ B;  2VLV A;  3K8N A;  3GKK A;  1RK4 A;  4NHW A;  1WRY A;  1HNB A;  2IJY A;  1XVQ A;  1MDK A;  4PUF C;  3C7M A;  4BPY A;  2L57 A;  5AN1 A;  3MDK A;  4TN8 A;  3BBY A;  17GS A;  2HNL A;  1TK5 B;  2JZR A;  1WWJ A;  5DCH A;  3UVH A;  3L9V A;  4FO5 A;  4ECJ A;  1M9B A;  4EXJ A;  2NDO A;  3HDC A;  4BL7 B;  1T00 A;  4EIQ A;  1PMT A;  5G30 A;  4IKH A;  2VOC A;  1S3R A;  3FR9 A;  4GLT A;  4ML6 A;  3VWU A;  1THO A;  2OBI A;  3VPQ A;  2B7K A;  4H86 A;  2MYG A;  3HZ8 A;  4BA7 A;  5J4U A;  5DQY A;  3DD3 A;  4WEY A;  3I69 A;  2MMO A;  1YF1 A;  1GTA A;  3UL3 A;  4YQU A;  2V2G A;  3GHA A;  3A2V A;  1GSY A;  4OFM A;  6GSV A;  1A23 A;  2LNT A;  2I4A A;  2VO4 A;  5LCZ A;  3CTG A;  3HD5 A;  1SJZ A; 
#chains in the Genus database with same CATH homology
 1TTZ A;  4ZB8 A;  2AHE A;  3ERW A;  3GUS A;  3IR4 A;  2WFC A;  2PUK C;  3BCK A;  1TKD B;  4MPF A;  3FR6 A;  3HJM A;  4K8M A;  4Q5F A;  1BX9 A;  3LWA A;  4O32 A;  4EKZ A;  4NAX A;  4K6X A;  2B5X A;  1F3A A;  5ABR A;  1EP8 A;  1NHO A;  3M1G A;  5F8B A;  2A2S A;  2CVD A;  3ZIV A;  3BD2 A;  2F8F A;  1TJD A;  4N30 A;  3EPT A;  1BJX A;  3PR8 A;  4BVY B;  3TKS C;  2TIR A;  1DBY A;  5E4W A;  1FW1 A;  3F9U A;  1S3C A;  1B4Q A;  4F9Z A;  4O92 A;  4AJ8 A;  1O73 A;  1I5G A;  1NW2 A;  1MTC A;  2L6C A;  3ZVJ D;  4OFN A;  3UJ1 A;  2YAN A;  1W89 A;  2X8H A;  1EV9 A;  3UBL A;  2X8G A;  3IK9 A;  4CY8 A;  1JZD A;  4I2T A;  2REM A;  1QGV A;  3BJ5 A;  1XW9 A;  1K0M A;  2YP6 A;  1LU4 A;  1ZYE A;  2C3N A;  2TRX A;  5IM9 A;  4K5R A;  4OCE A;  4YAP A;  3GIX A;  1IYI A;  3IV4 A;  3CTF A;  4V2L A;  2H75 A;  1PA3 A;  4JE1 A;  2DJ1 A;  1F3B A;  3HKR A;  5DAK B;  3LYP A;  1Z9H A;  4G19 A;  4HS1 A;  4GQF A;  1TP9 A;  2OAC A;  1YDK A;  1TRU A;  3QAW A;  1FAA A;  4K0G A;  3NIV A;  1GTI A;  5ID2 A;  2MBT A;  4P3Y B;  4FH8 A;  2H1A A;  1XOA A;  2ES7 A;  2DJ0 A;  3IHG A;  3QAG A;  3PPU A;  4AJ6 A;  3L9S A;  1F37 A;  5D8I A;  4XS4 A;  1SK1 A;  4F82 A;  3LEF A;  4MZB A;  2MBS A;  3CRT A;  1TW9 A;  2AAW A;  3FZ5 A;  5F05 A;  4ID0 A;  2RUF A;  5DAL A;  5D9V A;  2M46 A;  4OCF A;  2H1B A;  2GQL A;  3ZIJ A;  4TXV A;  3A2X A;  5D9W A;  2IL3 A;  2XBI A;  1VF4 A;  1H75 A;  1SK0 A;  4EIP A;  9GSS A;  4TVE A;  2WRT A;  5CO3 A;  3EIN A;  2C0G A;  1HD2 A;  2QC7 A;  4ZL8 A;  1DE2 A;  5HFK A;  5ECR B;  3HY2 A;  3ME8 A;  4YAV A;  5JCU A;  2VCW A;  4WXT A;  1VF2 A;  5ECQ B;  3IA1 A;  2H71 A;  3WGE A;  5IO2 A;  2P0G A;  4MP4 A;  1XCC A;  1ZGN A;  1FOV A;  3GKN A;  1YKA A;  2C0F A;  3KH9 A;  2F8A A;  2B5E A;  3Q18 A;  3G7J A;  2R0G A;  1PX7 A;  3APQ A;  3TKP A;  2H0G A;  1V57 A;  5ECH B;  5D9X A;  3M9K A;  1EOH A;  5KN2 A;  4Q5Q A;  5AIS A;  4I97 A;  3P90 A;  2K8S A;  1A24 A;  11GS A;  2VLU A;  1GSE A;  2R6K A;  5GSS A;  4BWS A;  2O7K A;  4MF7 A;  5FT3 A;  3H8Q A;  4KGI A;  3UIW A;  2DMM A;  3LSZ A;  4ML1 A;  1GSF A;  3TRX A;  3GN3 A;  1XFL A;  4OD7 A;  3D4M A;  4XCS A;  4BVX A;  1T1V A;  5KEJ A;  4KW6 A;  2DJK A;  5ECM B;  2IFQ A;  1JFU A;  4O5R A;  4JU5 A;  2HYX A;  4HJ2 A;  3GKX A;  1PN0 A;  2H66 A;  4KAE A;  3V1W A;  4ACS A;  2FWH A;  3KD0 A;  1AIU A;  4A5P A;  3IC4 A;  4DSS B;  5CYY A;  1GH2 A;  1GSQ A;  2LRT A;  1FG4 A;  1R4W A;  3CSJ A;  3KMO A;  1ZYP A;  2FUG 2;  2IMK A;  7GSS A;  3ZLP A;  3MNG A;  4LMW A;  1V2A A;  1K3Y A;  3EE2 A;  4EUY A;  10GS A;  4BWQ A;  2WZ9 A;  3GV1 A;  3HVV A;  4FYB A;  3KXO A;  4O5U A;  4EDZ A;  1TI3 A;  3ISO A;  5KN1 A;  4KDU A;  5D93 A;  3G7I A;  2GZP A;  1THX A;  1ZYQ B;  1R7H A;  5DCG A;  4LA1 A;  4DEJ A;  1EOG A;  1BYE A;  8GSS A;  1AQV A;  3RHC A;  3F0I A;  3H4K A;  3GA4 A;  1GNE A;  1PSQ A;  2RUE A;  4FYU A;  3CRU A;  2H6X A;  2XBQ A;  4FQU A;  2VCV A;  1WP0 A;  2FWF A;  1X9W B;  5ELG A;  3UAP A;  2DIZ A;  5ECK B;  1TI1 A;  2OA7 A;  2AJQ B;  3UBK A;  1V98 A;  4PUA A;  1FB6 A;  1ON4 A;  5B8A A;  1TK8 B;  1MEK A;  3GH6 A;  4KSO A;  3TKS E;  5J3R A;  1VF3 A;  2LV3 A;  4K7O A;  3FW2 A;  3QCP A;  4ZB9 A;  2YV9 A;  1BAY A;  2V6O A;  4HDE A;  1G6Y A;  3ZRD A;  3HCZ A;  1BED A;  5DBQ A;  6GSY A;  2HRF A;  3LYK A;  3GTU B;  4GSN A;  4EF0 A;  4LL1 B;  1X5D A;  4ZBB A;  3U5R E;  3DWV A;  2DSA A;  3KGK A;  2OE0 A;  2R0C A;  2UZ8 A;  4TXO A;  2AUV A;  2MMA A;  4ECB A;  2P5R A;  2VL3 A;  2J23 A;  3D22 A;  3APO A;  1Y6E A;  3KTB A;  1X0R A;  2DJJ A;  5G1K A;  2BMX A;  1GSS A;  3D4T A;  3QFB C;  3KM6 A;  4HQS A;  2N5F A;  1XWC A;  2GSS A;  2PVQ A;  3GL5 A;  3M9J A;  1SKS B;  4I6X A;  1UVZ A;  1A2M A;  5CRG A;  2CV4 A;  1PN9 A;  3E0U A;  3GYK A;  2KLX A;  1J0F A;  4J2F A;  4GCI A;  3EMP A;  3WT1 A;  2OE1 A;  3HJP A;  1PL2 A;  2AYT A;  5ELA A;  1K3L A;  4V1A g;  18GS A;  3F4T A;  2PVO C;  2IMI A;  4XTS A;  2RII A;  1EZK A;  5J9C A;  3QD9 A;  3VI7 A;  1DE1 A;  1N2A A;  3TJB A;  4Z2T A;  2C3Q A;  4L5O A;  5J5N A;  4MF5 A;  1ZYN A;  2HRK A;  4TR3 A;  1MDI A;  3FEU A;  3WD6 A;  4Z7X A;  4X4J A;  1RW1 A;  1G7E A;  2HSM A;  3A5I A;  4EL1 A;  2FCH A;  3DEX A;  1TDI A;  4Z2U A;  2WJU A;  3LGC A;  4AJ7 A;  2I9H A;  3F3Q A;  4OO4 A;  4MH2 A;  2C3T A;  2L59 A;  4XRD A;  2A2P A;  1TOF A;  2GS3 A;  4IJI A;  5A4U A;  5IQY A;  3TGZ A;  3QPM A;  4MJB A;  2E2G A;  3WGD A;  4PQI A;  5DVB A;  1AW9 A;  5DQS A;  1R5P A;  3MYD A;  3H1N A;  2VCZ A;  1PX6 A;  4IBP A;  1EEJ A;  2YOI A;  1YF0 A;  3TDG A;  5B6M A;  1AAZ A;  1A0R P;  2PBJ A;  2IMF A;  2LKU A;  20GS A;  1GSU A;  4OWY A;  5IMF A;  1K0D A;  1GNW A;  4I2U A;  1BG5 A;  1ACV A;  3C71 A;  3GST A;  2YWO A;  2JL4 A;  3VWW A;  2B5Y A;  6GST A;  5IOX A;  5ECS A;  5JCW A;  4K7N A;  1UA5 A;  4WF4 A;  4HU9 A;  2YJ7 A;  4HZ2 A;  5CRH A;  1TK0 B;  4MNN A;  1PGT A;  1WPI A;  3C73 A;  5ID2 B;  5IMZ A;  4IGJ A;  2AV4 A;  2E0Q A;  2M80 A;  5DDL A;  2IIY A;  4L8E A;  4G2E A;  2IWT A;  3TJK A;  5L71 A;  5HQP A;  4WKW A;  3M3M A;  2E2M A;  1GP1 A;  4XS4 B;  3CSI A;  3D5J A;  3L4N A;  4HUA A;  3GUR A;  1OC9 A;  2Z9S A;  1OC3 A;  3FZA A;  2L5L A;  3DGQ A;  4MK3 A;  2YCD A;  3F6F A;  5A4W A;  4TKY A;  3FRC A;  1DUG A;  3DKS A;  1S3D A;  5HR1 A;  1M99 A;  4WET A;  4XRA A;  4XHM A;  1O85 A;  4G0I A;  4JED A;  1A2J A;  2ZUP A;  4IJ3 A;  4K0N A;  2A4V A;  3AY8 A;  4KCE A;  2GQK A;  2OBK A;  2GTU A;  1V58 A;  2JU5 A;  4PXO A;  2LQO A;  2LTK A;  1SJI A;  2YWI A;  2NTO A;  5IO0 A;  1TRW A;  2YN1 A;  1GUH A;  2HXK A;  5HFI A;  5C04 A;  4POL A;  5C00 A;  2O8V B;  4K9Z A;  4WBJ A;  4XS1 A;  5AIX A;  1Z7R A;  3VK9 A;  4MAB A;  4ECC A;  1TU7 A;  2X99 A;  4GST A;  4TR0 A;  3LG6 A;  2YZU A;  2PER A;  4DSQ A;  1Z3E A;  1O6J A;  4TR1 B;  5LD0 A;  4G0L A;  2TRC P;  3I6A A;  1ABA A;  4TW5 A;  1WIK A;  2H19 A;  2HZE A;  1PRX A;  4IS0 A;  2GDR A;  1QUW A;  3IAM 2;  1GLP A;  3WYW A;  1XWG A;  3NOF A;  2WCI A;  3L0H A;  2QA2 A;  3CMI A;  5EVO A;  1WOU A;  3VUR A;  5GAN D;  2PWJ A;  1R26 A;  4CDO A;  2DLX A;  4F0C A;  3TKQ A;  2NBS A;  2IFQ B;  2GGT A;  1AUC A;  3R3E A;  1YY7 A;  2X4A A;  4NV2 A;  5ECL B;  1G7O A;  4LMV A;  1GWC A;  3GFK A;  1ML6 A;  3F4R A;  3DRN A;  1ERU A;  2FY6 A;  4AF2 A;  1SK2 A;  4BL7 A;  2BTO T;  1J08 A;  1XWB A;  2FD3 A;  1CQH A;  4ICY A;  4IEL A;  2CT6 A;  5F0G A;  3TRQ A;  1ERW A;  1U87 A;  4ZB6 A;  5IPG A;  3TB2 A;  6GSX A;  3C1S A;  3BOA A;  3D0Z A;  1K0N A;  1GLQ A;  4PGT A;  2CX3 A;  1SEN A;  2HT9 A;  4MPG A;  3ZVJ A;  3TOU A;  1B8X A;  3CXG A;  2P31 A;  4L0W A;  3UVT A;  1VRS D;  3ZL5 A;  2GST A;  2JSY A;  3IOS A;  1VF1 A;  1SKR B;  1ERV A;  3LQ7 A;  1E6B A;  2VAF A;  4KX4 A;  3ME7 A;  1X5C A;  2YNX A;  2C1Y A;  5CRW A;  3WGX A;  2B3S A;  3EC3 A;  4CW9 A;  3IHQ A;  2VD0 A;  5E59 A;  5ENU A;  1K3O A;  3MSZ A;  1O8X A;  1SD8 A;  1G6W A;  2CVB A;  2ZCT A;  4PQ1 A;  5D96 A;  2QGV A;  2C4J A;  2FLS A;  3IPZ A;  3QR6 A;  2KUC A;  3RAZ A;  1ST9 A;  3E9J B;  3N9J A;  2ON5 A;  4JBB A;  3ZZX A;  4BVY A;  5HR2 A;  4F03 A;  1GUL A;  2B6M A;  2NPB A;  1QFN A;  4KE3 A;  1F6M C;  2DKI A;  4V1A p;  1YJ6 A;  4IQ1 A;  1EWX A;  1E2Y A;  22GS A;  2OKA A;  2K8V A;  1TU8 A;  4KND A;  2YWM A;  3ZYW A;  1OVN A;  1O7U A;  3A5W A;  3JCM L;  2IME A;  1GL8 A;  4YQV A;  4RUV A;  3L9U A;  4EVM A;  2H76 A;  2FNO A;  1RQM A;  1T4Y A;  1JZO A;  3FKF A;  1V40 A;  3EUR A;  2XHF A;  1T7P B;  5JWQ B;  1K0B A;  4IVF A;  5B8B A;  2VCQ A;  4O7H A;  1M9A A;  2GLR A;  3QDN A;  3HXS A;  4HEA 2;  5IMC A;  5DAK A;  1O8W A;  2GT5 A;  3SWL A;  3FK8 A;  1M0U A;  2CX4 A;  4HZ4 A;  4NV5 A;  1TRS A;  4E8H A;  1YEP A;  1ZMA A;  1SKW B;  4LL4 B;  1KTE A;  4OMV A;  1A8Y A;  4PNF A;  1YEX A;  4D73 B;  5COH A;  5CRD A;  2MMN A;  5A5K A;  3NZN A;  4F2I A;  5KOW A;  3KMN A;  5HFG A;  1LBK A;  1Z5Y E;  1M2D A;  2LRC A;  2IPA A;  3TKR A;  4POK A;  2H74 A;  2R37 A;  2MMZ A;  5H5Q A;  1A0F A;  1XIY A;  4LLR A;  4ZXG A;  2HFD A;  4ISD A;  2BJX A;  1C72 A;  1T4Z A;  1YQ1 A;  2FHE A;  1F2E A;  2AB6 A;  3C8E A;  4MJC A;  1VGL A;  2HLS A;  5D73 A;  2MZC A;  3UMA A;  3HHV A;  4WR5 A;  4CY6 A;  2IMD A;  2VUP A;  2R2J A;  1K0C A;  3Q6O A;  2DJ2 A;  1EGR A;  5IMV A;  1M2B A;  3ZTL A;  2CVK A;  1LJR A;  3W6G A;  2VLT A;  1V9W A;  2VL2 A;  1KBN A;  4FYC A;  3Q19 A;  4G0K A;  4ZIL A;  1HNA A;  3TJJ A;  4MCU A;  3GNJ A;  2H72 A;  2FWE A;  3RPN A;  5HR0 A;  1FB0 A;  1QK8 A;  4HU7 A;  2L4Q A;  4QL9 A;  2PU9 C;  3IDV A;  4USS A;  3O6T A;  5AGY A;  4NHZ A;  1WE0 A;  2R4V A;  3U6V A;  3KJY A;  5IPH A;  1OAZ A;  2OAD A;  1NHY A;  3RHB A;  2EIR A;  2LJK A;  1USB A;  2ON7 A;  4MA9 A;  3US3 A;  3VWX A;  3DVX A;  4K5S A;  4G9H A;  3HJO A;  3KP9 A;  3EYT A;  1PKW A;  5IIZ A;  5FHI A;  2VCX A;  3F8U A;  1URM A;  4EC0 A;  3LOR A;  2C0D A;  2VCT A;  1M7T A;  2DJ3 A;  5H5R A;  3IE3 A;  4YH2 A;  2NVL A;  3PIN A;  1ZCP A;  4E8E A;  4X43 A;  3P8W A;  4RI7 A;  4K1F A;  3BCI A;  3FMW A;  4I8B A;  2WUL A;  4DSS A;  3CYN A;  3KP8 A;  2R3X A;  3FHK A;  3F63 A;  5CAX A;  3HA9 A;  2DIY A;  2H73 A;  3L78 A;  1PD2 1;  1JLV A;  2YJH A;  5EL8 A;  4MJA A;  2H6Z A;  1XWK A;  1FHE A;  2EC4 A;  2O85 A;  2PN8 A;  2WDU A;  2J9H A;  2WB9 A;  4ILF A;  1U3A A;  3LJR A;  5D9T A;  2EIQ A;  5AIV A;  3WT2 A;  5GST A;  5J9B A;  1XBS A;  4IW9 A;  2HE3 A;  4I5Q A;  2LST A;  3QOU A;  4KA0 A;  3QFA C;  4WR4 A;  2K6V A;  13GS A;  1U88 A;  2GVP A;  3GKM A;  3W8J A;  4GXZ A;  1JLW A;  2V32 A;  2R0P A;  16GS A;  2HZE B;  3P7X A;  4IN0 A;  1NSW A;  4ZBD A;  2A2R A;  1EEM A;  3QAV A;  4XIH A;  4TRX A;  4ZBA A;  5ECN B;  1S3A A;  1CQG A;  1XVW A;  4WBR D;  1O81 A;  5JCG A;  5G1L A;  2GQM A;  3RPP A;  5IMD A;  1FVJ A;  3FYG A;  3VFI A;  1OKT A;  3PH9 A;  2KP1 A;  4K7I A;  5DJM A;  3VI5 A;  4YKF A;  3IAS 2;  3ERF A;  1SJ6 A;  3GTU A;  1XW5 A;  12GS A;  3W8S A;  2JAC A;  1MD3 A;  3IC8 A;  2I1U A;  4PX1 A;  4ZIJ A;  1SD9 A;  3TUE A;  3FZ9 A;  2O87 A;  1FOH A;  2G2Q A;  5DAL B;  4NWY A;  1KNG A;  1SU9 A;  3ZML A;  2B1K A;  1HNC A;  5G5F A;  2GSQ A;  3LW9 A;  4NPB A;  4GTU A;  3ZFL A;  1GUK A;  2C0E A;  3GX8 A;  1BQ7 A;  3VLN A;  2N5B A;  3FZ4 A;  2F51 A;  4L5L A;  2VM1 A;  2GZY A;  4XS6 A;  2CQ9 A;  1F9M A;  1SL2 B;  3RDW A;  3TJF A;  2LEG A;  2EIO A;  2CA8 A;  3CSH A;  2JSZ A;  4PNG A;  2ALB A;  3D6I A;  4IP6 A;  19GS A;  1B9X C;  2PMT A;  1Q4J A;  4K2X A;  3LXZ A;  4AGS A;  2V6K A;  1ZZY A;  2QKE A;  4PQH A;  1XZO A;  2GZZ A;  1GRX A;  4K2D A;  2LJA A;  4POM A;  1IYH A;  1A8L A;  4N10 A;  1XXU A;  5B6N A;  2V1M A;  1B48 A;  3HVS A;  2WS2 A;  1SL1 B;  1HQO A;  5EPF A;  3UEM A;  2KP2 A;  2CZ2 A;  2LNS A;  1Y25 A;  1AQW A;  2F9S A;  1EGO A;  1B9Y C;  5HR3 A;  3TRP A;  3GH9 A;  2JZS A;  3KH7 A;  2VL2 C;  4Z2R A;  2N5A A;  2VD1 A;  3HVX A;  2DKH A;  3MAK A;  1XPV A;  3EWL A;  4BVX B;  2H8L A;  3GRX A;  2M72 A;  4MDC A;  3SBC A;  1JZR A;  3VWV A;  1YKC A;  5B7C A;  1EP7 A;  4HJM A;  3IBH A;  3ZFB A;  4TOP A;  4V2M A;  3G9B A;  2D2Z A;  4RQR A;  2K18 A;  2LUS A;  2A4H A;  1GTU A;  2LS5 A;  4X0X A;  3DXB A;  3ERG A;  2YWN A;  1X9M B;  3R2Q A;  4L0U A;  3GSS A;  3ZRE A;  3GMF A;  5ECP B;  3EU3 A;  2I81 A;  4OFT A;  1ILO A;  2XC2 A;  3EU4 A;  2FWG A;  2I3Y A;  2HRA A;  4EDY A;  1U3I A;  4O5Q A;  2R5G A;  1FVK A;  2C8U A;  3M8N A;  1K0A A;  3MIX A;  4CHS A;  4QL7 A;  2VM2 A;  4TR4 A;  3Q74 A;  1WJK A;  3J7Y b;  1B4P A;  2DML A;  6GSS A;  4MF6 A;  3P2A A;  2L5O A;  4PTS A;  2PGT A;  1ZOF A;  4J57 E;  1X5E A;  1K0O A;  2L6D A;  4RI6 A;  4HOJ A;  1SYR A;  1MDJ A;  1MD4 A;  5LNK e;  2K9F A;  3KCM A;  1SYX A;  2HSH A;  4NMU A;  2HZF A;  3H79 A;  3RBT A;  4JZQ A;  1EV4 A;  1FO5 A;  2H70 A;  3MWH A;  2X49 A;  1Z6N A;  3LXT A;  4IHU A;  4IP1 A;  5BMU A;  4GF0 A;  3F6D A;  4ULX A;  4V2N A;  1QXH A;  3KIJ A;  4HQZ A;  3A2W A;  3KTL A;  2ZNM A;  3HZ4 A;  4ZL9 A;  3ZIT A;  2H1G A;  3TCO A;  2LQQ A;  2HRN A;  3GX0 A;  1Q98 A;  4MMM A;  1I9D A;  1UN2 A;  3J7Y k;  1AC1 A;  5DJL A;  3IRA A;  1XOB A;  3CBU A;  4TXO B;  4TR1 A;  1GUM A;  4N0V A;  4IQA A;  3E3E A;  3ED3 A;  1OE7 A;  2FGX A;  5JWO B;  4GQC A;  4ECI A;  4OO5 A;  3G7Y A;  1W4V A;  5FWG A;  5INY A;  3FR3 A;  3KEB A;  3M0F A;  1OKD A;  2XPD A;  2RM6 A;  2B1L A;  2QA1 A;  5CNW A;  5JWR B;  6GSW A;  4FIW A;  4GSS A;  1T8E B;  2OJL A;  1WMJ A;  5IOW A;  5IMA A;  1N8J A;  2H6Y A;  3S9F A;  1M2A A;  1TRV A;  6GSU A;  2YV7 A;  5ECO B;  4RQX A;  3VPT A;  1GSD A;  3ZMK A;  2JAD A;  1HYU A;  1A2L A;  1G0T A;  4Q5R A;  4KDY A;  1T3B A;  4DVC A;  2GSR A;  5A4V A;  4MZC A;  3I9V 2;  1GTB A;  2E7P A;  3UAR A;  1TXX A;  2C80 A;  4X1U A;  4J56 E;  1DSB A;  4HI7 A;  2H1D A;  1PL1 A;  3I43 A;  4MZW A;  2DC5 A;  2XPE A;  4MJE A;  1PKZ A;  1PQN A;  2FA8 A;  1H4O A;  3IXR A;  4EO3 A;  5F06 A;  2P5Q A;  4JR4 A;  4ZL7 A;  2HSY A;  1X9S B;  3TKS A;  3O76 A;  5KOX A;  14GS A;  2JZT A;  3TJG A;  3EVI A;  4Q5N A;  3N5O A;  3A3T A;  4KUN A;  1J9B A;  1ZL9 A;  2RM5 A;  2KOK A;  2X64 A;  5BRT A;  3C1R A;  1NM3 A;  3UOM A;  5F07 A;  4KCA A;  2HI7 A;  3FY7 A;  3DVW A;  2IN3 A;  4KSM A;  2F3M A;  1OYJ A;  3OR5 A;  4KB3 A;  3LFL A;  1JHB A;  2KHP A;  4KH7 A;  1XW6 A;  5GAP D;  2H30 A;  2G0F A;  3DIE A;  4GWR A;  2GT6 A;  2FA4 A;  1SL0 B;  3O3T A;  1AQX A;  3DYR A;  3EMX A;  5G31 A;  4F0B A;  1OC9 B;  5G5E A;  3DML A;  4KF9 A;  4YKG A;  1ERT A;  1U6T A;  3TOT A;  3F4S A;  2LJR A;  1Z6M A;  5G2Z A;  2H0H A;  1AXD A;  5H5S A;  1QMV A;  2YZH A;  1R5A A;  3F3R A;  2WGR A;  3PGT A;  1OC8 A;  4G10 A;  4MH3 A;  4N0Z A;  5J41 A;  1OE8 A;  1Z7P A;  4WF5 A;  2OE3 A;  4PUR A;  2VIM A;  3HYP A;  5ECI B;  4POB A;  1JZW A;  1YZX A;  5CRE A;  3KZQ A;  2B7J A;  2H0I A;  4GRF A;  2X8C A;  2H01 A;  1UC7 A;  2YPM A;  2LRN A;  4QQ7 A;  4KDX A;  5EY6 A;  5KN0 A;  4MLY A;  4D73 A;  2QSI A;  3APS A;  4JRR A;  1KEB A;  3H93 A;  1XWA A;  2L4C A;  3GL3 A;  1QQ2 A;  4JR6 A;  2RLI A;  5CP1 A;  5KN3 A;  2CZ3 A;  3QMX A;  2CAQ A;  4NXI A;  2CAI A;  4N11 A;  2DBC A;  3IK7 A;  4EE0 A;  2VL9 A;  4DSR A;  2PPT A;  2O89 A;  2V41 A;  4YQM A;  3D21 A;  5GZZ B;  2VLV A;  3K8N A;  3GKK A;  1RK4 A;  4NHW A;  1WRY A;  1HNB A;  2IJY A;  1XVQ A;  1MDK A;  4PUF C;  3C7M A;  4BPY A;  2L57 A;  5AN1 A;  3MDK A;  4TN8 A;  3BBY A;  17GS A;  2HNL A;  1TK5 B;  2JZR A;  1WWJ A;  5DCH A;  3UVH A;  3L9V A;  4FO5 A;  4ECJ A;  1M9B A;  4EXJ A;  2NDO A;  3HDC A;  4BL7 B;  1T00 A;  4EIQ A;  1PMT A;  5G30 A;  4IKH A;  2VOC A;  3FR9 A;  4GLT A;  4ML6 A;  3VWU A;  1THO A;  2OBI A;  3VPQ A;  2B7K A;  4H86 A;  2MYG A;  3HZ8 A;  4BA7 A;  5J4U A;  5DQY A;  3DD3 A;  4WEY A;  3I69 A;  2MMO A;  1YF1 A;  1GTA A;  3UL3 A;  4YQU A;  2V2G A;  3GHA A;  3A2V A;  1GSY A;  4OFM A;  6GSV A;  1A23 A;  2LNT A;  2I4A A;  2VO4 A;  5LCZ A;  3CTG A;  3HD5 A;  1SJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...