4TSCH

Structure of a lysozyme antibody complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
206
Chain Sequence
b'QVQLVESGGGLVQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGRGDSIDYWGKGTLVTVSSASTKGPSVFPLAPSSAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
molecule tags Immune system/hydrolase
source organism Homo sapiens
publication title Structure of a lysozyme antibody complex
rcsb
total genus 37
structure length 206
sequence length 218
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tscH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tscH01
3QQ3B 3QWRD 2EC8A 1AH1A 1OAYH 4LCUA 4R97C 3HFML 3MUZ1 1NCDL 5CIPH 1SYVA 4G3YL 4J4PC 4LKCB 4LNVA 5HVGB 4P2QB 2VWEC 4XNMA 1QACA 3UCRA 2LAAA 5HD8C 1AD0A 2DL2A 3EO1A 1CGVA 3P4NB 4L9LC 5F89A 3VWJA 4KU1A 4NCC1 4NDMA 2FB4L 4K2UH 1ULVA 2DAVA 3EDEA 5C0CD 4IRZH 3WLBB 1J05B 2X4QB 4H8WH 2YR3A 4JM2A 5J6HA 2P5EE 5IBLD 4QYOA 5HHQA 3VH8A 4QEGA 15C8H 5ID0A 4MXWL 4XAWH 5IESH 4OZGB 5LVEA 4J4PA 5DMGC 3QCTL 2WINA 1PDKA 3NCYP 1BVKA 1UXSB 1OAYL 2YC1B 5GGQL 2DS4A 1RJLA 4LCWB 3NACL 4G5ZH 4PJ8C 5JIKA 1IILE 4HHAB 4OM0L 4GG6B 4C4KT 4KZEL 1F58H 4OF6A 5GXBB 4AENA 3BP7A 3BYYA 1DEEB 3OXRA 4R4ND 4MHHG 3QCTH 4DUXA 4U1KB 1FLRL 3NPSC 1JJUA 1A1OA 4RGND 3GSOA 2E5EA 2F58L 3KXFD 3HE7C 4FQQB 1KCLA 3LKOB 4FZ8L 3RVXD 1SEQL 5I1IL 5FOBB 4Q9QH 3L3DA 4ZUVA 2R4RH 1KFAL 5HYEA 2NMSA 2R9HD 3MFGB 4OCNC 3V4UH 3EYFB 1A5FL 2HKHH 2H3NA 2KKQA 4OCXL 5FECB 3QWOA 4X99B 4N0YL 3SDDC 5CZVL 3KPSD 2ITDA 3MRNB 4HH9A 5I71C 1TZIB 1ZHNA 4G43A 4L3CA 2R0WL 4XMLL 2ZNXA 4MJ6B 5JXED 4YHIA 3U4AA 3P9LA 4XVUD 2A77H 3IDIB 3VJ6A 3FT4B 5HY9B 3K1KC 4KUZL 1J05A 4M6MH 1IQWL 5J6GA 4DKEH 5DRWA 1I8LC 3W5MA 1I1AC 5ICXA 2ZWLT 3GSNH 1ZS8A 3GUTA 4YE4L 4HSQA 4P3CL 5JPMA 3DROB 4ZPTA 3PWNA 5IFHH 2EEBA 3HR5A 2YD4A 4PD4K 5BOZG 3F65A 5DEZA 4K3EH 3C8HA 2YN5A 4KI5E 4H25B 4MJID 5IB5B 3ZE0E 3S34L 1YUHA 3P30H 1P4IL 1WLHA 1RU9H 3E8UL 3K8MA 2FHCA 3IETB 5IEHA 4HWBA 1HI6A 5DMKA 3J8F7 3MZTA 5D7IE 3NN8B 4RQQB 4AEEA 1KTDB 3FFCA 4BH7B 3SQBA 2VB5A 4QLRA 1N0LA 2ERJB 3ZSSA 3IF1B 3QEUA 4K94H 4YHML 1OP9A 1YEGH 3AREA 4OCMC 1WT5A 3HR6A 2X4RB 3DV6A 3D39B 4F9LC 4GRMB 4HWNA 1DUZA 2MPAH 2VOTA 2UVEA 3P9LB 3ZE2F 5CLWA 1MCKA 1JNLH 3VFOA 3BZFA 3BQUB 2QSCL 4HF5H 4GW5B 2E8YA 3L9RA 1P6AB 2CMRH 4BSVA 3QUYA 4GKNB 4F8QA 3P4NA 4AIOA 1F2XK 4KMLB 4P2OC 1MCCA 3VRJB 4NZUH 1IKFL 4Y4KD 2PYED 1CLCA 2YA0A 3HAEA 4TUOB 4ONGL 1SM3L 2EH7H 4CVUA 4YPJA 1QYGL 4JFXA 1FFNB 4MD4B 2Q6WB 2R0LH 2GT9A 3MBEA 1ZSDB 4QHUB 2ED8A 2XPGA 3CU7A 4QRSB 2XTLA 3F6IA 2NYYD 4OV6F 3SDXF 4JZNB 1B0RA 4WUUD 5D1XC 3L5XH 3FOMB 4S1QL 4Y5YA 5IM7A 3D69A 3IDJB 5ESAB 1TZGL 2LABA 3MUY1 4OBSA 4XPAL 1F3RB 1U92B 5D70L 3I6KA 5JQHC 1CF8H 2NZ9C 2CKBA 2FO4A 3MGTB 1BQHG 3ZKMC 4XC3L 1YEKL 3HMWL 1RZFH 3QA3A 3N1MC 4KJYB 4MX7A 5EORL 1KPUB 3SDXE 1S7UA 4MAYB 1BD2D 2GJZA 3BN3B 5GRZA 1HQ4B 1YEEH 1MQKH 4O2EB 2Z92B 3TJHD 1KB5L 3SKJH 5D1XA 2EXYC 3WFHB 1BGXL 1AGEA 4Q9RH 5DZOA 5E2VH 3QUZA 1KIRA 3DMMD 4HIEB 3TYGL 4ONHA 5L7XL 1I8MB 4NUGH 4Y1AE 3GJFA 1P5VA 4QXTB 3U30C 1BFVH 1LK3H 3DX7A 2EO1A 3SO5A 2XWJA 3QULB 5IUSA 5DLMH 1R3LA 4X6CF 1AIFB 3H9SD 1AJ7H 5LCVL 3T2NH 2R8SL 3O4LD 1T6WA 4OLUH 4L8DB 3UMTA 1F3DH 1VSCA 3KYAA 4ODBD 5I66A 4HXBH 1NMBH 1WBZA 5BQ7B 3HNVL 1P6FA 2XY2A 3OAUL 3TN0A 2X4OA 4JM4H 4UV4L 2W0FB 3AFLA 1OF2A 5F7KC 3DXAE 2V2WB 3ILPA 1W72B 5DJDA 2PF6A 3ULVL 1ADQL 2VTFA 5GIRA 2BHZA 3PWJA 1VEMA 1S3KL 2QADC 4YXHH 1MQ8A 1IFHH 4E0RB 1A1MA 1CD8A 5J11B 1BQSA 2VDMH 3PGDB 1R6VA 3H0TA 2H9GA 2JJWA 3U2SA 1K4DA 1QO3A 4BH7A 3NZHH 1U58B 4JO4L 3WFCH 3PL6D 1B88A 5DUBA 1A6WH 5E99H 5D93C 1ZK9A 3PJSB 1N4XL 3WIHA 1FDLL 4ODTH 3VXME 2FX7L 1S9VA 3ZDXE 4D2NA 4QCIB 3E6HA 3S36X 1G9ML 4Z7VF 5DI8B 1OT1A 4OUOA 5HI4C 5F8RC 5I15L 1R3HB 3GJFH 4OCWL 3SGDI 1A4JA 3MUHL 3UC0H 3WL9A 1NKOA 1U6AH 4NT6A 1CXEA 5F88B 2D31A 5HI3C 4JGMA 5IFJA 4PJ9D 1S7RB 2VXSL 4ZXBA 3MV9D 3F12B 3QUMA 2B1HL 5D2NA 4OD3L 4PB0L 2HT3D 4AJ0A 1G9MC 4CU8A 3O6MH 3PWVB 1LEKB 4RX4A 1DQQA 4M02A 3S37L 3PHQA 1R3IH 1I3GH 5CD3A 1TITA 3VDBA 1A21A 1MFCH 5DK2A 2IPTH 5IJKC 2CDFB 4CU6A 2XTJE 4PP2A 2KH2B 3DNKA 2MCG1 3PP3H 1I8KA 2YZ1A 3D48R 5DSCA 2VABA 3CMOH 4HKJA 3LRHA 1N4XH 1J1XH 1YPZF 4WCYL 2H9GB 3ARRA 2CUIA 4ZSOE 2QTEA 5C0DB 1NAML 4OFKA 1WZLA 4JAMB 1KULA 1JGVL 4NO0A 3RIAK 5KSAA 1KIPA 3W0WD 2EDHA 4X6DE 4LBEB 4N1HB 4HIXH 4NRYB 2EDYA 3B2UD 4ZXBB 5DD0L 2DF3A 2VDQH 1YECL 3ECBA 1QFWM 3DI3B 4XX1E 3HPJA 5F88A 3QEQD 5HPMA 3TIEB 4RWYL 4HC1A 4I9WE 3O2WH 1XFPA 5IBUG 4LGPB 4QYOB 2ZPKH 5J1AA 1NMBL 3QDHA 3I50L 3MV8D 1JTOA 4LVHB 5DUMH 1IZKA 1RZKH 2W0PA 3B9KB 4OCSH 5C2BL 4WJ5A 1N6VA 1LO2H 2R8SH 5CGMA 1DBAL 4HV8B 5I75C 3O3EA 3NZHL 3OJVC 1XF1A 3RGVB 4EN3A 1PZUB 3KYNA 4TRPH 1ORSB 1FNSL 4K07A 3HG1D 2FD6H 3VI3F 1FIGL 2G2RA 5ETUB 4F15B 2CQVA 3NMEA 1M7IA 4HS8H 3HE6B 4GLRI 5K9QI 3MLSH 3A6BL 2NY1D 3QJHA 3PQYA 4EI6A 1XF4A 1RMFL 3QEQE 3ZHKA 3N85L 2VXUH 1I1AB 1IEBA 2XOTA 4J3TA 1CXIA 3BZFB 1DQMH 4DCQA 5JORA 3HB3C 2VE6A 4GW4B 4Z7WE 5EORH 2OTUB 2P5WB 3H9HA 4LLUA 4KQ3L 1MJUH 2H45A 4OQ1A 5GGVL 2HJKB 4N8CH 3BWAA 5IP4A 5HPMB 1MF2H 4CW1A 4P4KC 4JQVC 4CADA 5LWYH 1UH2A 3EJZC 2PXYC 5DC0A 2G60H 5AYQA 1P4BL 3LKPA 4QXGL 3W81A 4ZFOA 4S1QH 1AC0A 5HYIA 3PDOA 5DLML 3IYLW 4S0SD 4MQ7A 4LRNH 4ORGA 4OSUH 4UB0H 3EAKA 4JFFE 1CG9A 4JLRB 5IT2L 1T7YA 3VXSD 5CZXD 1LDPL 3Q6FA 5KG9A 3BPLB 1WIPA 5GJTH 1GAFH 5F71A 1WZ1L 3GIZL 5F3HB 3PWUA 2V7NA 2ADIB 5EBLA 5BO1H 5C8JA 5KSVB 1MFNA 4JM2C 3A0OA 3U83A 12E8L 4PJXA 4YNYA 1KPRB 3MLUL 5MEQB 3MRIA 3RWCA 3OJMB 1UB5A 2HKFL 5HHOD 3GUTB 3VXTA 3B2UC 3HMXL 3CXDL 3IKCA 3FN0H 3KJ6L 1HXMA 2HFFA 3G04B 1DFBH 5E2UL 4KQ4H 3TN0C 1XIWA 3EGSA 4GQPH 1CF8L 2AK4A 1MCNA 4AG4L 1J8HD 4UAOC 1K3ZA 1DQQB 3MV7B 3G5XA 5ISZA 5TQ2H 2VXQH 1ZA3A 3IFOB 2YPKB 2Y6SD 1CFTB 4ZTOH 1DN0B 3DV6B 2V2WA 5FYKL 4GG8B 1NQBA 2YK1H 5D1ZB 1S8DA 2H32A 3UAJC 4HFWA 2AJ3A 1U2HA 3JZ7A 3GRWL 3O8XD 3P40A 3Q1SH 4K55A 3U7YH 4WEBH 1P84K 1K9TA 3DO7B 2AJXL 1V8HA 5FOBA 5DZLA 1ED3A 3RNKA 4LBEA 1MI5D 5IROA 2NY6D 4LSPL 2JK5B 3TO4B 1NAKL 1SM3H 4GRWE 1QFUH 4AH2B 4ZO6A 2X4QA 1RUKH 2R29L 1QSVA 5DVKA 4L5FH 3ARFC 1A3RH 3C5ZA 5FYJD 2YSSB 4M3JA 1M1SA 3KYMB 1I3UA 2WIIA 5HDBE 3ARQA 1NGWB 4Y4FD 4PD4J 4JZJC 2P5EA 4WO4A 3MRPA 1HH6A 2ZCLL 3P11H 1DTUA 2QQKL 1TPXB 5HHOA 5CZKA 2DWDB 5IMOA 3QIWD 1NDMB 4MSWA 4PLNC 1KXTB 2GQHA 1FN4A 3I02B 4MA7H 5GIRB 3QO0B 3B6SA 4AQ1B 4TNWK 1T5WB 2A83A 4L3EB 5HHVL 2PW1A 2DIBA 2NQCA 4V1DE 4TVPL 2IANA 4F9PC 5GGRY 3FOMA 5IM7B 4J4PD 4PYHA 1PSKL 1EDQA 4XH2A 1HQRA 4EKXA 3SDYH 2H32H 1X5JA 2J1KA 3KJ4C 3MJ9L 1RJYA 4POZC 1NEZG 2HN7A 5GHWH 3ARDD 2IALA 4NN7B 2FZ3B 4Y5VC 2KZ1B 4RAUA 2FH8A 1ONQB 1Z6JT 3TNMA 5DFVC 1NGQH 2JJTA 5FGCB 2GW5A 4WEUD 1NMCB 3BRFA 1JHKL 2KL6A 1RJCA 3S6CA 1ZXQA 4XPFH 3L6FA 4UQ2A 2D9CA 2EC9U 4HS3A 1N7ML 2FECI 3ALWA 1MHPL 4PJFE 2JELH 1NCBL 3ARBD 3P3YA 2SEBA 4PJ8D 3BGFC 3CX5J 3SGEH 1U93B 1U3YA 3QEQA 4HBCH 4FG6D 5JPNB 2ZCKH 2APBA 3ISWA 3UZVB 4P46D 1PEZA 2J3SA 2XA8L 3HE7D 4FFWC 4X5LA 1MPAL 3UTSB 1DBMH 2VRAA 1YJDH 5CBAA 1F3JB 3BDXA 2EDKA 1Q72H 3MO1B 4YDKL 4NO5A 5ACMA 4HZLB 3MRLA 5C6WH 4DAGL 5EFIB 5DD6B 1NFIB 1A1OB 1C5DB 3EOTL 4ZUUB 1I4FA 4X8XA 1QBLL 4S1RL 1U3ZA 3NACH 3JTSB 4HUVA 3C60D 3OB0K 3TZVC 4F7PA 4TUKH 1OGTA 4HPOH 3IJSB 1PEWA 2BSSA 5ANMA 4R26L 1UJ3A 5GGUA 3FRUA 3MYJA 3BZ4A 4XNZC 5CSZA 3BKYL 5F44A 1Q9KA 5FK9A 5C0CB 5DC4B 2DLGA 2OTWA 2R56L 4X6BA 5KZCB 1NBQA 4O00A 3FQWB 4PB9H 2WQRA 3FONA 4Y19D 4D9LH 3BX7C 2R2HB 2FB4H 3R8BB 2XZAL 3BO8B 4P5TD 4RAVA 2BXYA 1G7HA 3LEXA 4QF1B 1M05A 4HBCL 4G8GB 3JWOH 1V3MA 1IGCL 1DQDH 1KEMH 3MLXL 3BKJH 5GGRA 3SGEI 1AC6A 2HFGH 1S7RA 5F1KC 2DQJL 2FJFA 3NPZB 1T83A 1IQDA 5HVFB 4DEPC 3S5LG 2IH1B 3I6GB 1RV6X 5AG8A 4G9FE 4XCEA 1AR1C 3PE9A 1TJHL 3ELAT 1UG9A 4E42B 1VA9A 4N8VB 1HINH 1WGOA 5JLZB 1MJ8L 1LD9B 1J86A 1WVZA 4OLVH 1NFIA 5T1LB 3MV9E 4PJIA 1JZ5A 4ODXA 5I1AA 4LIQE 1YY8B 1SJHA 4R0LA 1KC5H 2OQJA 3MV01 3WS6A 4LLAA 4P46C 3H9YA 4RGOH 4H88L 4M5ZL 1MH5A 1YYLL 2A9MH 3GHEH 3TCXA 1AKJA 4GG6A 2FATL 3JV4A 1LO4H 4AEHL 4AEIH 1AI1H 1OSPH 4PRAA 4H5SA 5AZ2H 4NKMA 5TF1H 3GGWA 3X11A 4PY8J 2JIXD 4HZAA 3GSXA 3C2AL 5EC2B 2CKBH 1J7VR 2UV3A 1KIPB 3T4AB 5M95B 5GGTL 1BAFL 2CIIB 1BX2B 5DJYB 4XCNA 1X5LA 1B9ZA 5EU6B 3SDAB 3V8OA 1J8HE 3KYOA 2Q76A 4UU9A 5FCUH 4LLDB 3WN5C 2X4OB 4YHZL 5L88L 1XGPA 4EUPA 3I2CL 2ITCA 3MRKB 4K9EH 4R7NB 4F3FB 2WLYA 4YEFA 1NCNA 3BP5A 5C0FA 5J9PA 5T1LA 4YHLL 5C0BD 3FCTB 3RY4A 1SY6L 3U4EA 3L95A 1UVQB 3RBGA 1YNLH 4WEMB 1HSBB 4L5FL 3VFVA 4I3SL 3HNTL 3LS4L 3MXVL 3KPQA 5C09A 5GSVA 5C08D 5FA3A 1CTNA 3Q3GA 5EOTB 3O3BA 4RDQG 4NZRL 3U1SL 4IOSD 1HEZA 1BZ9B 1DSFH 5DWUL 1A7QL 4NN7C 4NKMB 3TVMD 5TE7H 4XNYL 1CE1L 2DQCL 3SQOH 3U0WH 2AJYL 3U7YL 4NN6C 2YKLH 1QHPA 1CIDA 3L3OA 3MLZL 3BQUD 2ERJC 4UT9L 5HGBA 5MENB 3WNKA 2OTUA 1BBDH 2AEQH 5DHVB 4XTRD 3ZKNC 5J89A 2DQIL 3VFNA 2GITB 2RJMA 3RGHA 1C12B 2R1WB 1L7TL 1Y0LB 5CP7A 1Z2KA 3VXMB 3PWLA 4KDWA 3LVEA 2L0DA 1KEGH 2F9BT 3VFPB 4YX2L 2CLZB 1ACZA 2ESVB 1GGCH 4X6BB 1AD0B 2Z31C 4JHWH 4HIEA 5K93A 4DKAA 1BJ8A 1OPGL 1E4KC 4JPKL 4L8DA 3BEVB 4PJ5A 4O2FB 5IW3A 4N68A 5DVLA 4OF5A 5C8JB 3BH9A 1ADQA 1AO7E 2ATKB 2Z93B 4OIAA 4OZFB 4OZHF 3BO8A 1WZ1H 3GIZH 1GAFL 4HK0B 2P7TB 4Z7NE 1W8OA 3SY0A 2VLRA 3FQXB 5FYKU 3K81A 1ZHLB 2PTUA 4ZAKA 4N9GA 3GMMA 5C08A 1DBJH 3QO1B 5DURB 1YNKL 2BCKA 2AV7B 4NQEA 1ZLWK 5EUOA 4U6XA 3EUUA 1Q1JL 3TVMA 3OJ2C 2XFXA 2G75B 3CK0H 3PL6B 5T3ZE 3LZFH 3LN9A 3FZUD 5GJSH 4G7VH 1G6RA 5F6IB 1IBGL 4LPVA 2W1NA 3P0VH 1DQML 4Y1AB 3MA9L 1C5BL 3VD3A 4ZYKB 3PQYB 2QKIA 4M62L 3Q2CA 2VAAA 4YHYC 1FGNL 4P99A 1AO7A 4XT1C 3QDJD 4JFYB 3UAJD 2ICWA 3A6BH 4FQXD 2WZPD 5C7XL 5BS0E 3FO2B 3G6JA 3BN9D 4HS8L 3G9AB 1EPFA 3ARYA 4XZUA 1DVFA 4LPWA 4XMKL 4RSVA 1VFOA 3U48A 2EXWC 2YUVA 1P9MC 1ZKAA 5LXGH 2B5IB 1ZA6A 4LSUL 1E4WL 2IADB 1JGDB 1T20B 2AERT 4YPGB 3V6OE 5HHNA 3VFOB 2V7HB 4MD0B 4M93C 2DM2A 1RZKL 4FNLL 5I0ZA 3NFSL 4UV7H 2AV7A 4Z78B 4J1UA 3R0NA 4I0KA 3WUWA 1KLGA 4U6TA 2MQ0A 5I1KL 4M5YL 3KHOA 2GUOB 4FMFA 4LVNB 3QG6B 4I3RH 5DQJA 4JHAL 4XPGH 3IB4A 5IR1B 4JY4A 3I02A 2B1AH 1FL6B 2EEDA 4HD9A 1DQJB 5DHXB 4LHJB 2C7UB 4BZ2L 5JZ7C 4OGYH 1EAPA 3P9MB 1HILA 4EI5A 4HG4K 4G8IA 1JGVH 1RIHH 4ZO7A 4TNVK 1CVRA 1EEZB 2P8LB 3W0WB 5EWIL 1NC4D 3VXOB 4OB5L 3TH4T 3DRTA 4HX1B 4KY1H 4KXZI 5DZNA 3UTTD 1AO7D 1HHGA 3T0EC 2HFEA 3WJLA 1RUAH 3H0TB 3SDCA 1HE7A 3TCLA 3MJ8A 3BPOC 4PJXF 1FFOB 3JVGA 4E5XB 4HWZA 2ICWI 5DA0B 1KBGL 1KTRL 1BQUA 2GITA 3HC3L 4HBQA 4NPYB 1NEZA 3GSWA 1CDUA 2DRUA 4YQXL 1MAJA 3RNKB 4F37F 4JFZL 3CDGB 2ITDB 5H37H 4OFDA 1HNFA 3CXHK 4MCYB 1BPVA 2WWMD 2PW2A 5F97E 2J2ZA 3ET9F 5EOQL 4N90D 1CFQA 3G5YB 2B0SH 2C1PA 4MNGA 1JRHL 5KAQF 1I3RB 3QNZB 1QLEL 1MHEA 2C1OA 2GJ6D 5I6XB 4NO3B 5C2UB 1A6UH 4HC1L 1KOAA 1TQBC 4M5YH 5F3BB 5CILL 5AAMA 4PGZA 2MKLC 3GMQB 1RZ8B 2ZKHH 3WFEH 3RZCD 1X4XA 3NFSH 1X5ZA 1TTFA 3QZWA 4Y4KA 4M7KL 1NFDF 2YC1A 2PYEA 4JO3L 3IDGB 3GFUA 1GZPA 3O2DA 1PG7X 4JDTL 1RK1B 3UTQA 5KVGH 1NCCH 4IRJD 2O26U 3TO4A 2VDML 2V9QA 3NCJH 3SGJC 4HUWB 2X4NA 1OCWH 1J8HA 2E9WA 5EOCJ 4JO1H 3TWCL 3O6LH 4TOYH 4KKLC 1ZLVH 1KYOK 5T1KA 4MDJA 1F6LL 4PJAB 2X4PB 5KTEL 1DL7L 1NGWA 4GKZA 5BV7B 2A1WL 2IJ0C 3RTQB 1INEL 3CDGA 3FFDA 1F6AB 4CVXA 4JFDB 2UY7A 3MCKB 4PJIF 4ODVL 4Q9BA 3LZFL 1SMOA 3WD5H 1YN6B 1S9WA 5D6CB 4GG6F 5CHNA 4MHHI 2VN7A 2DYPA 3KWWA 5D5MF 2AS5M 4WWKC 2C1OB 4F37K 4GAGH 4RISH 1A02N 3KR3L 5MEPA 2NXZC 4GJTB 4S1DC 5C6PB 1DBJL 1QA9B 1LK3L 4XAKD 4HQQH 5B38A 1JZ3A 2ZSVB 5I75B 5ICXB 1PX3A 3BWUC 1KLGB 3I3BA 1LO5A 3K3QA 4MLSA 3QI9A 5E2VL 3MRJA 3IU3A 4E0RA 1A9BB 3MV7A 5FGCE 1I7UB 1R5WA 2F74A 2IBZY 3D9AH 4PTUB 4U1GC 2EYRB 5IBTL 1FSKB 3OPZH 1TQBB 4K7PX 1H0DA 2FECL 4FQ1H 5BOPA 3O41B 5MHSE 3SDCC 3TO4D 4MB4A 2VDPH 3VD7A 2WP3O 1VGEH 4JHWL 2P24A 2CR3A 5E70A 3ARFD 3RI5K 4Y4HB 4ODWA 1ITBB 3MA7A 4G7YH 3VXOA 4XPAH 2YBRB 3A67H 5D71H 1TZGH 4UDTA 3CZFB 1BWWA 3C08L 4NQVA 3IJSA 2CDGB 4L4VA 1UWXH 2B4CC 1V7NL 2AVGA 2GSIB 1BBDL 1TJGL 3ULUH 4PG9A 5FKAB 3MLZH 5E8EA 1T4KB 4MZ3A 2ZCHL 2YA1A 2C4FU 1CGSH 4HG4J 3H6JA 1WIUA 5TE7L 2LVEA 4JPIA 1LO0H 3M1BA 2DQDH 5HHMB 3EOBA 2D0FA 2Q7NA 1KGCE 4ZUSB 1D5BB 3UTSA 5E6YA 2IGFH 3ECBB 3CMGA 1OD7A 2A74B 3N50A 4OAWA 4X9BA 3IDNB 3INUL 1FYHB 1JIBA 1WCQA 3SE9L 5C9JB 2Q3AA 3S3JA 3E0GA 5JOFA 4NNPH 3RX8A 3BUYA 2IAMC 2X41A 4I4WA 2NY4C 3S5LA 1Q9LB 3T0BA 1CZ8H 1MUJB 1F8TH 1N64H 3FB7A 3ARDC 4O5LL 5CAYB 8FABB 1YN7A 3UPAA 1NGXB 2NW3B 4JFEB 2EE2A 3MYJB 1DJSA 2ZJSH 5EO1A 4JFYA 5BRZE 1PQZA 1AP2B 3PNWA 2EH8H 1OAUH 1URLA 3RQ3A 4MLIA 2CLZA 1NJ9A 5B39G 1OGAB 2HN7B 4BQBA 3HZYA 1OARH 2VITB 3QQNA 5SWZB 4PJBA 5GSRA 5IF0A 2QQLL 4AEHH 5E8PB 4Z7UE 1FHGA 4N0UA 3MJ9A 4URTB 3TBYA 4CVXB 5BCAA 2AJZB 5EBMB 3MRGB 4FXKA 1AHWA 4JG1L 3V6BR 1OWWA 2O61B 3QDGD 4MDJB 5I74B 1F4XL 2FYYB 2WUBL 4XRCA 4EOWL 3TIDA 2C3WA 3RU8H 3PG2A 5J6GB 5SX5H 4PGBB 4MVBD 4CN4A 1T22A 3VFGL 1I9JL 1U93A 3VFWA 1FZKB 4CMHC 4X6EA 4TSBH 4K3DH 2DWDA 5IMOB 1I7ZB 5IEKB 5JHDA 3NABL 5D2NB 4X6DA 2A0LD 5CGTA 3MRPB 1FIEA 2PO6B 2Z0BA 1FNGB 1LEIB 1HZHH 1T5XA 4G8FA 2ZUSA 4ZUWB 1MIML 5DSCB 3MRIB 4I0PA 4PJIE 1GGBL 1J12A 1JGUL 1FRGH 4GS7C 3TT3L 1JYNA 3Q6GH 4G9DB 4Q9QL 3QXTA 4YDIH 5HXMA 5HDQH 1TVHA 5FHAL 1AD9B 1G7IB 1YY9D 4NKDB 1N6QL 4AENB 4XC1L 1XCQA 2PXYB 4GW1A 2LV4A 1X5HA 5DHYA 2BNQA 4G8GD 1I1CA 3IFNL 4QTIH 5EH1A 2H32B 2CIKB 3O6KL 1I9EA 4P23C 2AJ3B 3IDYB 1AHWB 4WGWB 4R2GD 2HVJB 5JHDE 1FORL 1F4AA 4O9HH 3ZYOA 5I8CA 4U6HA 4J2XA 1NFDE 2VLJD 4NWUH 4A2MA 2BNRE 3VG9C 4P0DA 5FKPB 3FCTA 4DKDC 3CUPA 3QH3A 3K4DA 2AABH 1OD9A 2X09A 2BDNH 4AM0A 5FHAH 4LLMA 4OCLC 5HGDB 1QFPA 1HHKB 2ATPB 4PV9B 4XVTL 3F7RA 1CLOL 2WSKA 1LDSA 1Q9WA 1YY8A 3C5SA 5E2TH 3QIUC 5HHME 4DQOL 3B5GA 4HV8A 4YO0B 2ZG2A 5JLZA 4U1SA 1WBYA 3RWIA 1MNUL 2V17L 1FL6A 3K7UA 4QOKD 1AXTL 4FOMA 5KSBE 5DD6A 3O2DH 1LWRA 2JB6B 3DVGA 1TTUA 5GZNC 2NY2D 4U1IA 2CGRL 5I6XC 2HJKA 2FX8L 4KVCH 1EO5A 3ULUD 3IFPB 3J7HA 1P5UA 4NUJA 3U7AA 1U3HC 2R23A 1T1XA 3ARFA 1BWMA 3VI3E 4ISVB 4P5MA 3ZTNL 5TJWK 3BQUA 2XQYG 4OIIL 2XWJB 3QULA 4IS6B 2AK4E 4PRBB 1UA6H 3FT3A 2AXGB 5ACZA 5I1GL 5FYKE 4DGIH 2V2XA 5AEAA 1UFUA 2KDGA 3D3VD 4IM8A 1QKZL 2AK1L 3VXQA 4XVSH 4OLWL 2C3VA 2J7LA 1RJZB 3W9DB 4X83A 2RGSA 5F3HA 1M71A 3GSUA 4IRSD 1GZQA 4DEPB 4LEOB 2X2YA 3G6JF 4MA8L 4JREC 3ROOA 2UWEF 1L0XA 2NNAB 1I9IH 4NNPL 3WNNA 4GRMA 1U8HB 4WFHE 4NFCA 4X0KA 4UIKH 1RZJH 3ZKQD 1GHFL 1G7LA 3IJYA 3KS0J 3V0VB 4XVJL 1B2WL 1T1YB 4JZOA 1J8HB 2AV1B 2BERA 1LO0L 3GMPB 3NVQA 4ZQKA 3TT1H 1ZLSL 2EDLA 4HLZG 3AM8C 3VWKC 4QCIA 1JPTL 3MX0A 4QRPB 3D18B 3BEVA 3MRNA 4HH9B 1VGKB 3BIKA 4PJCE 1S9YA 2B20A 2I9LB 2J4WH 4LCIL 4O02H 3QR2A 3HE6C 3C08H 2VXQL 2Y23A 2WIIB 4E41B 3T0EA 1N59B 5C0BB 1FH5H 1X5XA 2DMKA 3TEUA 1QR1B 4FQXA 5DA4A 2EYSB 4DGYL 5CIPA 1INDL 1KCUH 5E6IA 3STLB 1S7TA 4H25A 5IB5A 5DJ8B 3RFZC 1MRDL 5FKPA 1OAKH 4TPRH 4FQIL 4MXQC 3STZB 4KPHH 4Q6IB 2BSTA 5LBSL 1KSRA 1I3RA 4D0CB 1H8OA 1FNAA 4WHTA 2VXTH 3JV0A 1Y6NR 3UZEA 5E5MB 2JJVA 2R0KL 5FDWB 3V6ZB 5EIIB 1PVHA 3MR9A 5EOTA 2WINB 2CLVA 4F8TA 2A38A 1CGTA 4UILH 1AE6H 2DJUA 4ONFL 4NQUA 3EO9H 3RPIA 2XWBB 2F19H 1IM9D 3D25A 3L3HB 4L3ED 3FO9A 3HZYB 4I0PD 3JUZA 5IQ9A 4ETQB 5ESVA 3V5DA 1K6QH 4N8CL 1DBKH 2VZ1A 2IQ9H 5FECA 3JUYA 3HE7A 2V6HA 4TUJA 1MFEL 4JFHE 5IMMB 2MQCA 3P0GB 4M9OA 2XICA 3WXVL 4DZ8A 4CUCA 4NHUA 1S7VA 5D1ZC 3NBNA 3O45B 2IAMB 5KTEH 3GB7B 5ITBH 4WWID 1HDMA 1UENA 2FBJL 3G08A 4GRLD 3T0VA 4G8GA 3CU1A 3LDBC 3T8XA 5JW3L 1G7PA 5D2LA 1T22B 2EYTA 4C56E 2NXZB 1RFDH 1OAZH 4M4PA 4K8RD 3AGVA 1KCVH 2GIYA 4E9LA 5BVJA 3LHPL 1MELA 2ILLA 4PRHB 1XR9B 4GAJH 4L4JA 3V6ZA 5FDWA 4GXVL 4QGYA 1CICB 1P7QD 4JKMA 3DX9A 2E6PA 4NO0D 3DXAD 4YAQB 5DUML 1X5YA 3QUXC 5ISZB 4WI3A 2J8UA 1ZGLP 3GMNA 2VLKD 5F6HI 4EEEA 1IC7L 3MPCA 1EGJA 3THMH 3IXAA 1F2QA 1KN2L 2A9NL 4G8EB 2XQYK 3RDTD 2J5LB 1NC2D 5EZJA 4P4KD 5GS1C 3BRGC 4ESKA 5E8OB 5I1EH 2WWMC 5HGAA 1WAAE 3RL1B 4NQXA 1U91B 3QB7C 1IKNC 3O3UN 4NZJA 4GRWF 5JW5B 3DGGA 5CEYB 1X5KA 4PJ7E 2XN9D 5E9DE 4NKOA 1ZT7A 5D7IB 5LGHL 4KTEL 4IMLA 3BDYL 4DN3H 5A2FA 3NCEB 3GHBH 4RFEB 4OZGF 1MRCL 1F3DJ 5TDOB 2J6EA 4E41A 3IAPA 1U8LA 4BZYA 4P48A 4YGAB 2O61A 4LK4A 1ODAA 2IFFH 1QLRA 5GS1A 3FMGH 3WFDL 3DSNA 2PETA 2I27N 4A6YH 5BV7L 2ADIA 2O5ZH 3EYUL 4ZFFB 5SWSD 4YPGA 4DFIA 1QRND 4DQOH 1S78C 2XRAH 4X80L 1DVFC 1FGVH 3BAEL 4I2XA 5IVXA 4D0BB 3LH2L 4XCEB 1CWVA 3QG6A 5DQJB 4KHTH 4LHUA 1WAAA 4ELKB 1RJZA 1X44A 3CH1B 2FJGB 5IBLC 1X6NA 3UTTB 1IQDB 3I85A 8CGTA 3PABA 3A6OA 3QIBA 5FO7A 1F11A 4M7ZB 2AI0L 4W4OA 3TA3D 3RWFA 4AIZB 3L3GA 5GPRA 3RUGB 4Z18A 2F8OA 4LNRA 3KGRA 3BD5A 3VXSA 2H2PC 1INQA 1IGML 4NRYA 1FZJB 3PV6B 3SCMC 1TETH 4KVNL 1KPUA 4Q97A 2D2OA 2F8VA 3NIFF 3F6LA 4LLVA 4JO4H 1TZIA 5T5NG 4W6YB 1BJ1J 1UWEH 4NHUB 2BRQA 3QISA 3SCMB 5FF6A 5GGUB 4DOHE 1QOKA 1SYVB 2D7OA 1TCMA 4PJEA 4EN3C 4PRPA 3MBED 1K8DB 1QFWI 1ZT4B 4KK8C 4U7SA 2VL4A 3Q6GL 4JR9L 4XWGL 2GHWB 1JGUH 2AP2A 1H15B 4XP4L 5F7DB 3PWNB 1I1YB 1MHEB 3DIFB 4JM4L 3ARSA 2DM3A 1Q9WB 1D6VL 2BC4A 2H2SD 3PHOA 1FQ9C 3CK0L 2NY0B 4LMQI 1AR2A 5TDNB 5J12C 2W9LA 5CSBA 2IANB 5D7JD 1A2YB 1MLCB 1QSFB 5I2IB 4X6DB 4WHTB 5HVHB 2PW1B 3LD8B 4NM4H 3QIUD 5T3ZH 1ZGLA 7FABL 4IDJL 4L8CB 5DRXB 5BVPH 5HYJB 2BVPA 4I48B 5IG7A 4KROD 4H26A 3OKEB 1RZKC 1XGQB 4POZD 4Z76A 3QEHB 3UTQB 1HWHB 4U4BA 5T33L 5JW4R 1NL0L 5HI4D 5GRVK 1KELL 5E8OA 5KVEL 3TVMC 3V5HB 3VXSE 2GJJA 2JJTC 5KSBA 2OZ4L 2JKXA 1IGYB 4J23A 4XWOC 5MEND 3H42L 5EULV 2WQ8A 3D85A 1D5ZB 3O4LA 4X6DF 3BUTA 2IEPA 4RNRB 3C6SB 3ARBC 1OLZA 1ROWA 3FRPG 3RVUC 2OL3L 4H20L 2XQBL 4JKLA 4JKPL 3KDMA 1QFWH 1JYWA 2ZJSL 5F9WC 3DMMA 3MOAL 2VDKL 5D6DC 1T66D 1PD6A 1A2YA 2PO6A 3VI4E 2E7MA 5DJ2A 3LN5A 2FX9L 2VUYA 4MCYA 4J8RA 1QBML 2RHEA 2BY2A 1MUJA 4N90E 1X5AA 2YPKA 3MBEC 2EICA 5TDPB 5F9WB 4LSQH 1MHHB 3BUYB 1IC5L 4J3VA 4RZCA 5CWSB 1D6EA 1RSFA 3QUMH 5K9KA 2AXFB 2QSVA 4MGXA 3EJJX 5MEOB 5ALBL 4NRXB 4WI2A 1O0VA 4H5SB 4BSJA 4XB7A 3FHQA 1A7RL 1FYTA 1T89A 2KQNA 3WIFB 1IGIH 1W0VA 3MV8E 4V1DB 1PQZB 1L9MA 4TQEH 5D2NE 5FO7B 2H2SC 3FRUB 1IRAY 4V2BA 5C0CE 1JWUB 2YWYA 3QIBC 3LQZA 1I8LA 3EYQD 2F53B 4IEFB 1G9NC 3D18A 2WNGA 3O0RL 1GOFA 3SBWA 1MI5E 2VDKH 3UTTE 5JMOC 1H3PH 1CT8B 2YD3A 3SKMB 2AJVL 4WUKH 5D7LB 5AYUL 3SE4C 2FDBP 5BZDB 1EV2E 3QAZC 3HRZA 4OFVA 4NJAL 3PDOB 5H37G 4H20H 3ABZA 4NM8L 1K85A 3LS5H 1G7JA 3TBTB 1EBAA 3NFNB 4HS6B 5E2JA 1JGLL 4PJFF 1PGRB 4KRPC 4F7CA 1MIEH 3MODH 5I66B 3EOBB 4FQHA 2PO6D 1G1YA 3NA9H 5ALCL 4H88H 4OI9A 1CDHA 9CGTA 2DMBA 2QL1A 4OZFA 2QQNL 3CVHB 3B3IB 3DX6A 4UOW1 5KVDH 4ORZC 3VWJD 3N1FC 3IDUA 1Y6KR 3KPRB 4U1JA 1IAMA 4U6VH 4I0CC 7FABH 3D69B 4RMTA 1FO0L 2DI8A 3LPGA 4LARH 5C0EB 2PXYD 4OZHB 2MHAA 3FO1A 6FABH 4K8RH 3W0WA 2ZSVA 4UT6H 5D2LF 5ERWB 4NSKB 1FL5B 3K2MC 3H3PH 3OAYK 2L4OA 4MAYA 3WD5L 1NSNH 3HCVA 4K71C 4P5MB 1OW0A 1JZ4A 5GISL 1U3HB 1UM5L 3RTQC 3KHQA 4UTAL 1OP5H 4HIIB 3D39A 3LPFA 2L7JA 5CEZL 2FSEB 2ID5A 2CIKA 3FT2A 1BBJA 3V79C 2VR9A 3ESVF 2IFGA 5A16B 5T3ZD 2Q8BH 4OQTH 4IHOA 5DRWB 1IC4L 4HUXA 3ROLA 1U95A 2CDEA 1V7MH 4OGXL 5JPNA 1FLRH 3ULSA 1ND0A 1J10A 4IRJA 4JJ5A 5H35A 1A7NH 3PDGA 2HH0H 5L9DL 3UPCA 3WE6B 4F33B 4C56B 2YPLB 4R7NA 2P48B 3MFFB 1XCTB 3IDMA 1A14L 1YJDL 4CU7A 2BOCA 1UB6A 4IJ3B 2GJ6B 2NY2B 4ETYA 4U2ZA 4YUEH 5F1NA 3W2DH 5I1JL 3TPUA 4ZS6C 5F1IA 1OOAA 5CD5D 2OJEB 1J88A 3JVGC 4P2RE 1VEPA 4XH2B 4NUJB 3L3OB 4RMUA 5HGAB 5A2KH 4M1CC 4R7DA 2V5SA 3LKNB 2VYRE 2X7LA 4R2GB 3H9SE 4U33A 4OKVA 2MNUA 1A64A 1YJDC 3QCVL 4YQXH 2VLJB 3VRIB 5DD1L 2FSEA 1WV7T 4PPTA 5IMLA 4RGNB 2UWEE 1OTSC 1TJIH 4QXWA 5F7HA 2CR6A 3FT4A 4U49A 3CSBA 3G5ZA 1T7XA 1S7TB 1S9VB 1YN6A 3BDYH 2BVOB 4DN3L 1C1EH 3W82A 3GB7A 2NCMA 3P77A 1D5ZA 1L7IL 1MCIA 1FVEB 5LG1A 3I6GA 4AL8L 5INCA 3PGFL 3RTQD 1IAIH 1Q9OA 2X4UB 2YXFA 3H9ZA 4LSRL 4BFIB 5D7LE 1HXYB 5HGDA 4FXGA 3TNNA 5A3IC 1UWGL 2DTML 2R1XA 3P4LA 5EU6A 3SDAA 3EO0B 1KNOA 2A9NH 4C55A 5IGXH 3EFFA 3O6FB 2FNBA 2LTQC 4LOUC 5DJCB 2VIRB 2DQTL 2W07A 3CFJB 2P8MA 5HTSA 3LV3A 5F96H 5F7EH 3VFRB 1CFSB 1K4CB 4FQJL 1IAKB 1YMMB 3DGCR 1FZOB 1DQLL 4AMKL 1OSZA 3TA3C 2HT2C 1ZWIB 3RWEA 2HMID 4G9FD 4FQQA 2NR6C 2DL9A 3EKCA 1NFDB 4F58H 1B0GA 3EFDH 3OG4B 3HCVB 4G9DA 1IKNA 4QXUH 4GG6E 1Q8MA 1W2KT 5C7XH 1NAKH 1PZ5A 4OFIA 4HIHB 3CLFH 1CL7L 2FCBA 3GI8H 4KRMB 4L4TD 3DURA 2EKSB 5BMFH 3BKCH 4FQCH 4JDVA 4NJ9H 4PLOB 1U2CA 1UCTA 2GKIA 5KVFH 5DT1H 2O5XL 1G7QA 4RRPG 4PJAF 2APTA 5KSBF 1LEGB 3SJVE 4MNGE 4OFPA 4NDMB 4XBEL 2GUOA 1QSFA 1YYML 5I2IA 2D7TH 3MRHA 2Z4QA 1HHJB 4Z6AT 2C3VB 1M7IB 3BGMB 1IGFH 3JV4B 2BCKB 1YPZE 2A6JA 4PJAE 4NQDE 1KTLA 3MJGX 2VLRB 3FQXA 4R0LB 1BOGB 2MCPH 3QQ3A 4GQ9H 3QFJD 1I4FB 1PKQB 5BO1L 2IAMD 1NJ9B 1FBIH 4U1SB 1KENL 5DDHB 2EIDA 3VXRB 3IDXH 4FRWA 5TE4L 1JPGB 2B7DT 3KAAA 1AP2A 4OSUL 4UB0L 3LKSB 4JFDA 4OD1L 5K59F 4LLQB 4BK5A 4U1LB 3WNOA 5DUPL 1WFTA 5D1QC 1MCQA 4ZSOB 3MA7B 3CFKA 3O3AB 3V95A 5SWSE 1WAAF 3U9PL 4H0HB 4X98A 4LCYA 4XCYB 5IB2B 3ZKXC 2NR6D 1L0YA 3LMJH 3OKLB 3WEXA 4YXLL 1XF3A 2P7TA 3D39D 4KQ3H 4XMPH 4RAVB 2HMIC 4MWFB 5DT1L 1J1OH 4G6AD 3VCLA 4JCLA 4NQDA 1KJ3H 3U0WL 4YFDB 4KTDL 4POUB 1M6OA 4HS3B 4BQCA 5JA8B 4EI5C 2V9TA 4J6RL 5DS8B 3W11C 4P23A 1TVDA 1B2WH 1HYSD 5C0EA 4Y4FC 4Y4KB 1MVFA 5HVHC 2VABB 3IXAB 4NOFA 3Q3GB 4X9FA 1MCLA 1RZJL 2NY7L 5IB4A 5MEOA 4YHLH 3AC0A 4V2CB 4Z5RA 1EJOL 1KIQA 3QXAA 4XCFL 1UCBH 3DX8B 2Q6WA 2ICES 1F13A 1RZGB 1C12A 1T0NB 3UTPD 5K9OB 5SWSA 4F2MA 3BRDA 1LO2L 4HIJA 2DDQH 5T1MA 1JNHA 3K2UL 4NNYA 1N5AB 4KWUA 1A22B 2EKJA 3MR9B 1GRWA 2OXHA 4LASH 4NCDA 1P1ZA 3QWQB 1A7PH 4LU5L 5ESQB 2A73B 4ZDHA 5E5UB 3FQTA 3VGEA 4ALAH 1XF2A 2YPLE 3ES6B 4YHIB 2XV6B 5I1GH 2CXGA 2DQGH 3MGOA 4BA8A 1XGUB 4M43H 4I77H 4PLKD 4Y7MA 3V52H 3BE1H 1UYWH 3WMSA 4AEIL 3G9VA 4O2FA 1FFOA 2FL5A 4P3DB 3DECA 1BLNB 1SBBA 2FATH 4HEME 1CLYH 4RGOL 5TE6H 2EKSA 3U7WL 1RHHB 4JB9L 1MVUA 4JQXA 3P2TA 4JREB 4OLVL 4YFLF 3SJVB 4F57L 5MEPB 1MCRA 1HK6A 1LK2A 1LVEA 4M6AA 1ETZB 2E3VA 5J06A 1YZZA 1MCJA 5FA4A 2K9UA 4NO3A 4G42B 5FM8A 3UJJL 1O5DT 2VWEE 3V4PL 1HHHB 4JANA 1JF1B 2DLIA 1MNUH 2V17H 2WBJD 3X12A 4P4KB 1KG0B 1XZ0A 5DJZB 1A0QL 1JPSL 1YEJL 2K3TA 3BKJL 1GH7A 4DUWA 1DQDL 1OM3L 3KPSB 4ZD3H 3O3BB 5DXWA 3TZVA 3VXPA 1K4CA 3RAJL 1CLOH 1WZMA 4PG2C 1E4JA 3IFOA 5DJXA 2M1KA 1QBBA 3TJEL 2EE9A 1U6AL 4XXDA 2FRGP 2IG2H 4PY7A 5F9AC 3UC0L 2L7UA 4CN6A 5C07E 1KN4L 3RWJB 3SDXB 2COQA 4UTBL 2DQUH 4JFPA 4NQCB 4PR5A 4TTGA 4X99A 3VGHA 4ZFOL 4O9HL 3DBXA 4BZ1L 2R4SL 3M8OH 2G9HA 1KPRA 3LRGA 4MS8C 3VFTB 3QHZH 1TLKA 1EFXA 4LAJH 5D7JC 4WU7B 3FT3B 2LE9A 5D7JB 3BXNA 5H35B 4JY4B 5FM5O 5GQBA 5GRYA 2VO5A 1IC4H 2VQ1B 2HA1A 2MMXA 4PBWD 4PLKC 3CH8A 5EU5B 5C92A 1PKQE 4NC0B 1XT5A 3MROB 2R9HC 4M03A 3BP6B 1AY1L 1TQCC 5CEZH 4YDIL 1ADQH 2DB8A 5DO2C 5C0GA 3CFEA 1QSZA 3QUYD 1FC2D 1MFBL 4UTAH 3HC0B 4HWUA 3NCFB 2VSCA 43CAA 4GG8A 5K33A 3MV8B 1MAKA 4YBQD 5E8NA 4HIJB 1GCFA 5JORB 2NNAA 3CVHL 3RWDA 4WI6A 4GRWH 3WV0A 3WDJA 3DX8A 1OGAA 5KOVC 4PV8A 3RHWF 1C5DA 2VMFA 5E03A 1JHKH 1SEBA 5F7FA 2UZYB 4PREA 3GMRA 3C8KB 3RIAF 5FK9B 4QNPE 3HKFA 1MCOH 3G6JB 5IV2A 3AREC 3QUZD 2BSSB 1OAXH 3P4OB 2A6KA 5L7XH 2OSLB 1F4XH 2QQNH 3KPNA 2DIJA 3AS2A 4Q9RL 3MLTA 4OM1L 5C07A 4WO4D 4PBXA 4HFUH 5J13B 5D8JH 4EDXA 4X9IA 4S2SA 3IKKA 1EEYA 2GK2A 3B43A 35C8L 3KNBB 4LEXH 2OCFD 1PAMA 4H1LB 2ZZUT 3ZKXB 2FWOA 1UJ3C 2GSGB 2W38A 4NQDD 4JPIB 4OLEA 5HYJD 4MA7L 5FUZL 4KROB 3WHXA 3QAZB 3UYRH 4JANB 4D0CA 3LQAL 3EYQC 1OAQL 5C0NC 4OTXH 3VFSB 3E3QC 3CFJA 3L3JA 1GZQB 1XAUA 4MB5A 2ZCLH 4FS0A 3BOVA 2F5BL 1IGIL 3L7EB 3E2HC 3HC4L 4R4FL 3HZVA 2GTZA 4ODHH 2R15A 5DD5L 2X4PA 3IU4H 3HG1B 3GMRB 3QSKB 4LGSB 4RAUB 5D96C 5CINH 4NFBA 3LQAC 4ZFGH 2D3VA 2OJZL 1IM9B 4NZUL 4XP6H 5CJOL 5ITFB 4LSQL 5E7BA 1CL7I 5D7IA 2XZZA 2IQAA 3VGGA 4M6NH 4L4TE 3K8LA 2NY6C 3OKKA 4Z7NF 3R06A 1A6AB 5EO0A 1XGYH 1NLDL 3I75A 4MNQB 5I8CB 5IWLC 2BRRH 2MTPA 2YK1L 2UWEB 2JLLA 4JGUA 5JXAL 5L8JB 2P5WD 1VESA 2VLJE 3RY5A 5SX4I 3ARDA 4MQXD 4N1CA 4JKPH 5DYOB 2LU4A 3ZL4H 1FVEA 4OFYA 4AG4H 3ARGB 3K1DA 4C54A 1NFKA 5CEXB 2H41A 2VERN 4XP6L 1FL3B 2ADJA 4Y2DA 1U8PA 2DQHH 1HIMH 5D7KE 3SE3A 3HMXH 3WS3B 3BKML 2OZ4H 2HFFB 3S3SA 4K94C 2IH1A 3HC4H 4R4FH 2UUDH 5IFHL 5I74C 3QNYB 3QIWB 5JA9A 4MJ4A 1C8PA 3LKRA 3L5IA 3MCLH 2JCCB 4Y5XA 5D7LD 3MV9A 2WBJA 1DN0A 1OAQH 4QRPA 1JMZA 1QFHA 2VLMD 2Y9RT 4KFZC 5C0AE 2O93L 1U8JB 4FQLH 3G5XB 4HUNB 4M6ML 1XF2B 43C9A 4X4YB 2Z8RA 2ARJB 2F53E 4RISL 4ISVA 1IEHA 4S1DD 3MGTA 3TZVB 3VXPB 3MJ7B 2OMNA 3CVIL 1N59A 4ODVH 1VADA 3MXWH 3SGKC 4FQXC 35C8H 3O8XB 1JV5A 3OZ9L 2J8HA 4PJCA 2JCCF 1RURL 3QYCA 4XXCA 3DSFL 2CSPA 1H15A 3D87B 4YH6A 3SE8L 3O6LL 4OM1H 4TOYL 4F33A 1CR9H 4P5KA 4S2SB 1VERA 5I8EB 5MENE 1OCWL 2PCPB 5CEXA 3GNMH 3LY6A 3HPLA 4Y2DD 1A1NB 1EO7A 2EIEA 4FG6C 3MRKA 5CJ8A 3T0WA 1P53A 3TBSB 1R0AH 2J6EL 4UNTA 5FO8A 1NGXA 3NGBC 4TNWF 2GSGA 4X0KB 1EX0A 4W81A 5L6YH 3IFLH 3MRHB 5EZLA 4H26B 3B3IA 3DX6B 4NN5C 3HNSH 2WBKA 4MX7B 5IESL 3FTGA 1GGYA 4HKXA 2ZSWA 4BKLA 4PY7B 3QDAA 4K7PL 4LSSL 2R2EB 2QHRL 1DCLA 4YFLI 5F7WC 4HLJA 3U6RA 4XZUB 1AY1H 4CDGC 4Z7UA 3RAJH 1JWSB 2Z35A 5E08L 4UAOB 2VDNH 2EDNA 3PWPA 4ZAKC 1FGVL 3BAEH 5FHBL 1SEBB 3VWKA 4GUPA 4JFFB 1A0QH 1CGXA 1YEJH 1JZ8A 3EYUH 2PYEE 3W5NA 2C9AA 2Z31B 4DWHA 3ZYZA 3ALXA 1UQSA 5EB9A 3RGVD 4P5TC 5T3XD 3TV3L 2R23B 4LAQL 2RCSL 1CFNB 2IFFL 3OR6A 5HYSA 3P73A 4TN9A 3EBAA 4XPBH 3FQNB 1G9EA 3WO4B 4M6OH 5CLTA 3GSNA 4F7EB 5E1HB 3GHBL 4N5ED 5HYSG 4KTEH 4LGRB 1D9KA 4PGCB 3S98A 2DQFB 5DVMA 5TE6L 2BVTA 1XIWC 4HK0A 4XX1G 1BQLH 3WDIA 4YXKH 1S5IH 4G9FB 4YHNA 4OGYL 5L0QB 5I1EL 3BE1L 4YWGH 4HWBH 1MJJB 1GOGA 2VXSH 5MHSD 4I0PC 5EUOB 2WBJC 2YRLA 4GKOA 4H8WC 3RKDC 3LKRB 3IDJA 2X1QA 3PXJA 3B83A 4XPGL 4WENB 1RUPH 4LHUG 2Q8AL 1QSFD 5E1AB 1KTDA 3FFCB 3HE7B 3CC5B 2H6PA 3QNYA 4OCWH 4TUJB 5F9JB 2VLLA 4F7PB 4MVBC 1T2QL 4ETQA 5AD0A 5MERA 4HWEH 4ODUB 5I1CL 4ODTL 4F57H 5BXFA 3KJ4B 5DD3L 3V0WL 5AG9A 4M7JH 1UGNA 5F21B 2IPKB 3L5HA 4DKFL 1Q94B 1JV5B 1DLFL 2IH3B 3VRIA 3GZKA 2X89A 1EJOH 4GAJL 5HGHB 1IGJB 5JIPA 1A4KB 4CN1A 4KI5D 5T5NF 4NQSB 5IQ7H 4UU9B 5FGBC 4L3AA 4ZAKD 4JPWL 3RKPA 4KI5F 3ZE0F 4MS8D 5I17A 4L3EA 1II4E 3UJIL 1GGUA 1FN4B 3S88H 1SVCP 3AVEA 1C5BH 1MI5A 1S7QA 2C3HA 3T65A 4PGDB 4C83A 1NCWL 1O7SA 3JV6B 1DQTA 3B9EA 1JZ6A 4FXGB 1M4KA 1OF2B 4JHZA 1BECA 3BGFB 1K6QL 4YXLH 4QRUA 4PJ7A 5M7QA 5L2JB 1QEWB 5ISZE 2XTJB 2XN9E 4PUBH 5E9DD 3K46A 5GGSY 3V5KA 1C08A 3WS3A 1FFQA 4P23D 5IHZA 4NHCH 1SJHB 3TGXA 1OLLA 1A3LL 4JQIH 1BVLB 4U1MB 5TH2A 4WI8A 4QHMA 3L3HA 1XGTB 1RI8A 2NY7H 5CGYD 4XTRC 3IJHB 5DRXA 1T0MB 4PRHE 4R3SB 4X9HA 3MUGA 4HGKC 4HK3J 2DQEH 4KDTC 1E4KA 1T1WB 4KGLA 3V5HA 4W70A 2F53D 2IBZX 4BQ9A 3VW3L 4G6FD 4ZS7H 4YDLC 1S7WB 1B3JA 1UXWA 2BHUA 3T09A 3WFBH 1FVDA 4XC3H 5A2IH 1I1YA 5GSRB 3HUJA 3R8QA 2JIXB 4JFDE 3HS0B 5JQ6L 2ARJQ 5JUEL 3AS3A 3VXUA 4YX2H 5M94B 4GMTH 2VR4A 1DVFD 1Z5LB 5CMAA 5HJ3A 3FQWA 2PYFB 3KPLB 1L4IA 1V5JA 3LDBB 3WFBL 2XY1A 2R69H 5ESAA 2CD0A 5BQ7A 4KC3B 5CJQL 3QFJB 1MCFA 1KENH 1OP3K 4YNYB 1JNHB 4LCCC 5TGBA 2R0LL 5EZOL 3BKCL 2XA3A 1J87A 4ZO8A 4RGNC 3GI8L 1VKXB 1V3JA 5IB3B 3RWHB 4ZQKB 1KLFA 1BIIA 4NZTH 3EYSH 3SBWC 4NO2A 5GRVL 1YNLL 4DK6A 3V2AR 2UUDK 2ED7A 5CSGA 2J8OA 2V2TB 3EZJB 1KIRB 1S9KC 2XZCH 3HUJE 4KKAC 3ARGC 1RQ5A 4CADB 5CSZB 2R2BA 1P9MA 2CMRL 1JHTB 1HH9A 3EDKA 4Z0XB 5DD3H 5EO0B 1IE5A 4X7CC 5HHNB 4BSVB 4MD0A 1FFPB 1D5XB 4LHUD 2F5AH 1EGJL 2W60B 5DTFB 4UUJA 5FUCC 3OKLA 1RK0B 4Q6IC 1OB1A 2EECA 3B2VL 1QR1A 1X4YA 4BH8B 3AB0B 3VD5A 5A1AA 4PJ5B 2NY5H 3OF6D 4CVZA 4XBPA 3V0AC 1T1ZA 1UB5B 2ESVD 2DOCA 4ELMB 2P47B 3OB8A 5FB8B 5GS1B 4XP5L 1Q0YL 3DURB 4X7EC 1SBSL 3RGVA 4Z7OE 1J0IA 3QZWB 2Y72A 1IAIL 3K4AA 5FGBA 3DUHA 4QHUA 3AXLA 3VCLB 4JJHA 4X4ZA 3WIHL 4P2OA 3QXUA 2N7AA 5CS7A 1KC5L 5SX4H 2Y5TB 2FO4B 3PWVA 4GLRH 3DROA 5I1CH 3RVWC 3RL1A 2LU7A 5FYJH 3GO1H 3SEPA 1WQVT 1Z9LA 1R5VA 2A77L 5K9JL 3WHE1 2ORBH 1XMWA 4IMLB 1RUPL 1WBXA 1IT9H 1S7XA 5ID1B 1R24B 3ILQD 5GRJL 1FNHA 4HMEA 1CDCA 5DVNA 5E8DL 1XGTA 5F7MC 1S9WB 4N0YH 1PY9A 5ITFA 4DJMA 4WFEE 3RVTD 1A5FH 4JDVB 4AL8H 3WNLA 3QWOB 4FZ8H 5B39A 1UACL 2EZ0D 4S1SH 5BV7C 3QDJB 5J1TC 1QA9A 4PRPD 2R56H 1O7VA 4U6YA 3QUYC 2VAJA 3GMLB 2ESVA 3QUYB 4GKNA 3RL2A 1Z5LA 4WDIB 2FR4B 3WIIH 3I6LD 5CD3B 5T1LD 1TJIL 2EE6A 2J8UB 2JIXA 3QO0A 4P9HL 1FORH 1MCWM 1NMAH 3VFWB 3ZO0A 2VIRA 4D3CH 1S7SB 3EOTH 1T03H 2Y07H 2RR3A 1CE6A 3LKQA 5FHBH 4MXWH 4XAWL 3QRGL 1L6ZA 3MNWB 1N6QH 4U0RB 2DN7A 3W2DL 1PYWB 5I1JH 1DUYA 4K2UL 5KVMC 3HI6H 3TT3H 4Z7WA 4XP9L 5ENWA 4GRLC 4IIQC 4A2LA 1UM5H 2OM5A 4K7PH 3AAZB 4MCZB 1PW3A 5E9DA 5GISH 3T2QA 1YMMD 1DDHA 4KK5D 1HZHL 5C07B 1I9RL 1NSNL 3RJQB 5J7CC 4JRWA 4LLYB 2UZIH 3BPNC 2FJHA 5C0BE 3VXRE 5IVXF 4OGAC 5T1KB 1JWSA 2Z35B 4LVOB 1NC4B 3WFHA 5L6YL 5KS9E 1IAOA 1SJVA 3TPKA 1AO7B 2OP4L 4O2EA 3JWNC 4CJ1A 1OW0C 2FH6A 4K7FA 5KW9H 4PJDB 4NQDB 5DFWH 1KTKE 2BVEA 3GNML 1HDMB 5TPWL 4H0IA 1IM3A 1YEFL 1NLBH 1CVSC 2FYYA 4XRCB 3RVTC 3BSZL 2W9DL 4PGEA 3AU1A 4X6FA 5F6IC 4FP8L 3U0TA 3OJDA 4OI8A 1A7OH 3OZ9H 3ULVE 4FHBD 4X7SH 1UM4H 4FTVA 5C0GB 1KCSL 3DARA 4NN5B 3PUCA 3VXMD 2BNQE 3L95B 3SDDD 3CVIH 1MHCB 3WHE0 3C6LB 4PJEF 4P2OB 3EDJA 1F4WL 3F58H 2VZ3A 3GDBA 3RWIB 3JV5A 5AYUH 4FQLL 1H3PL 5B4MD 5JXAH 4JO2L 5LAXA 3CZFA 1FYTD 2UZXB 4LIQL 3CCHA 3SCMA 1ZHBA 1K4DB 5FF6B 1CU4H 4LQFH 1XGYL 4MMXC 1CQKA 4MJ5A 5B8CA 3NTCL 5E94A 2VZOA 3HZKB 5KG9B 5CJOH 3U0PA 4I13B 4TNVF 3ULSB 4L8BA 4WFFE 4GAYB 2ICEB 4PGBA 3ARFB 5GS0L 3OX8B 3QUXA 3UJTH 4PJDA 3TCLB 3QUML 5HI3D 5DD5H 3BZEA 1YEIH 4HJJH 5FFLA 5I8KH 1JPFB 2OSLA 4F9LA 1IGJA 3SOBL 3O4LE 2EDEA 3FB8B 4UBDD 4B5EA 4X8JA 5HYJE 4BK4A 3DVFA 4UQ3B 1CFNA 5D72L 1WJ3A 4OTXL 5FO9B 2E7HA 2DKUA 1V7NH 4HMCA 4D0BA 4Y1AD 4KAQL 5FUZH 5HDOA 1NGYA 1VKXA 1QQDA 3BXNB 1ZLUK 3L5WB 3TO2B 1ZOXA 4ZFFA 1Q0XL 5C0FB 2OL3H 4I8DA 1N6UA 2NY4D 4PRIB 3X17A 1A7RH 4MJIE 5I8KL 3V6FB 2AQ3A 2JB5H 3OGOE 1BVZA 4Z7UB 5L2JA 1U8HA 3H42H 1K5NB 5FOJA 4U1JB 4DTGH 4ZYKA 3TYFA 4G6JL 3D9AL 3S35X 4KH2A 1U8IA 3MLUH 4L8BB 5IVZB 1PX4A 1VDGA 4P4RA 4RIRA 4PTUA 2VZTA 1KELH 5KVEH 2ARJA 2CIIA 4L9DA 3S7GA 3T1FB 3MOQA 2DI7A 5EOCH 5GJTL 4PJ9A 3RVVC 3VA2C 1WSST 5C0CA 2X5PA 4JO2H 3UYRL 3LPWA 3FO2A 4GSDL 2HJFB 4ERSL 4P2RB 3TP4A 4Y4HD 3KPSE 1AXTH 4NNXB 4GAGL 1FPTH 4IOFC 4KTYA 5D93B 1ZTXL 1TFHA 2VQ1A 5E56A 5LGJA 4LHQB 4X7TB 4LPTA 5I8EA 1FFNA 3VXUB 4BQ6A 2HRPH 4TTDC 1IGTB 1YC8A 3IXTA 4Z95H 4K8RC 3TJHC 3H3KA 3AMLA 4F7MA 3RBSA 5EIIA 1LILA 2Q87A 3HZMB 3CDCA 2HWZH 3WIFA 3ZT5A 2LAGB 1CI5A 1LEIA 3DVGB 5D1ZA 5KSAD 1CFSA 4P2QE 2X4NB 1NCAH 1B6DA 5SWQB 4UIMA 3S35L 3FTGB 3RJDA 3NIDE 4NBYB 5F1IB 5C0RL 4M7LH 5KJRL 2V5TA 4JO3H 2WBJB 3C5ZC 1NMAL 4D3CL 2GJ6A 1EVTC 4JRYD 5KN5A 3PJSA 3QHFH 1IL1B 2XZQH 5CCKH 3WBDA 1IGYA 2BNQB 1X3DA 5J13C 4WU5B 3REVB 3PV7A 2AGJH 5GS2D 4XP4H 2X1WL 4WHCA 4XWGH 3RWJA 3SDXA 4WI7A 3CUPB 5CZXC 3U4BH 4P57A 5I1LB 2YUZA 4U1HB 1AGCA 3ES6A 1OGAD 1CXLA 3LH2H 3RZCB 1OGAE 4OD2B 3R1GH 1JNNH 1U3JA 3FQRA 4W4OC 2I07A 1CICA 4ZPVA 4EBQH 2VL5B 1F3JA 4YFEA 1ZHKB 1CK0L 4N1EA 1UEMA 1XR9A 5GGRB 3GKWH 3CIQA 4QKXB 5BW7A 1RUMH 5DJ6B 2PN5A 1IM3B 3HC3H 1J1XL 1DLHA 2ZUUA 2JJUA 2X10A 2PUQT 3FFCD 1EBPA 5F7DA 5EUKA 1U8OA 3G5VA 2EDOA 4MA1C 1J0HA 1D5MB 3PWJB 3N0PB 5E5RB 3QXWA 3V7MA 5F9OH 1KACB 3F8UB 4XCCL 3D85D 4CL7A 4H1LH 1J0JA 3S37H 3LN4A 4WU5A 4PB0H 4EXPX 1BFOA 4P2QD 3G6AA 3H7BB 4JFFD 3HMXA 5D1QD 1EEZA 2P8LA 3OXSA 4RGNE 4NQTA 5H2BB 4O51A 2OZ4A 1XR8A 2BX5A 1AXSB 2WANA 3QEGH 2W59A 5DFVD 1W8NA 2PR4L 4ALAL 4Q58C 5KSAC 2AQ2A 3ZKND 4NBXB 1MSPA 4X7DC 2ORBL 4MWFA 3OKNB 1WFUA 4X4XB 4YLQT 4OZ4B 5E6ID 4PJHE 4UDUA 5EZIL 1ZLUH 1GC1C 4I18C 4W4NA 3QUZB 1J1PL 3QPXL 2RFXA 4OT1H 1FDLH 5DMJB 1F6AA 2AEWA 1BF8A 1I85A 1KB5B 2AXJA 3P4MA 4ZFZB 3TM6A 3U7WH 3TBTA 4ZPVB 5E8PA 3BZEB 5BRZD 4QRSA 3CFCH 1E4WH 4TSAL 1UCBL 3BVNB 3B9AA 4X7TA 5E4EB 2B5IC 5D5ME 1SBSH 4JFOA 3VRLE 3HAEH 4WHDA 4M43L 1EHNA 1A6PA 5D9SB 2APVA 3FJTA 3MO1A 4P59L 4ZUTB 3H7BA 2HT4C 4M62H 5ITBL 3S96B 2YOCA 1RULH 5CJQH 4GXUN 1YEHH 1KLUA 5C86A 2R69L 2IQ9L 3EJYD 4U7MA 1DBKL 3KXFA 2X4SB 3BHBB 1FFPA 1UEYA 1W72L 1WICA 3NA4A 2DLTA 3MNZB 2DDQL 4MYWB 1QTYT 3U0PB 5DGRA 3UBXA 1NBYA 1AJ7L 5LCVH 1HQRB 4PJGF 3EO9L 2KPNA 2XZCL 3WLWC 1KB5A 5ADPH 4OD1H 4OLYL 3W0WE 4POYA 4ZS7L 1EERB 3OQ3B 4JDZA 5B3JE 4TSCH 2IADA 5EU5A 3I75B 4N5UA 4EVNA 1HHIA 2GT9B 2VXTL 2YEZA 5DI8A 2LU3A 5CKGA 2DQEL 2ATKA 2Z93A 2HJLB 3K0WA 4FQIH 2BJML 5ILTL 1J1OL 1DP0A 2FR4A 4XNUL 3MBXL 1YEKH 1IMHC 1I75A 3MRMB 1ZV5A 4B7IA 1GVIA 1T5XB 4G8FB 3CFIC 4Z7QF 3KLDA 3U9PH 5IKCA 5GS2H 3ARGD 1TZHA 3QFDB 2DBJA 4PJDF 2DLEA 4WWKB 2DQIH 2ZSWB 2IBBA 4ONFH 4Z76B 4JG0L 1U8OB 3PL6A 4XXDB 3L3JB 1MFAL 3IU3B 4YC2B 1FBIL 5EC2A 25C8L 4FFVD 1I1FA 5IIEA 5B8CB 4L8SB 3HHRB 2C4XA 3X11B 1F5WA 5IB2A 1DSFL 4GQ9L 3QQ4A 5DWUH 4DZ8B 4P59H 4PJAA 2DLHA 2MCPL 3BPCB 2D4DA 1JFQL 3OTTA 3PQYE 3HNTH 1UADC 3LKNA 2H1PL 1VHPA 4LKXA 4LFHD 2JE8A 4L9LB 1SY6A 5BJTB 3C5ZB 1YPZB 3KDMB 1YYMH 2BOBB 2YD8A 1OTUD 2WWKT 1TNNA 1HHIB 2YEZB 3GBNL 3NIFE 3V0WH 1HH6B 4OKDA 2XTJC 4Y16D 4JN1L 3IVKA 1J1PH 3QPXH 4OT1L 3C5JB 3F7YA 1NCWH 3ZE1E 2NZIA 1T2QH 4PV9A 1YEHL 3DPBA 3MNVA 1CE6B 3FB8A 3LKQB 4QO1A 5EZIH 1FV1B 1RZJC 1AGDB 4DW2L 3MRRA 3CDYA 4FQCL 1YC7A 1CICC 4FZEH 4E41D 5BMFL 2AEIT 3HI1A 5A2JH 1D6EB 2P8MB 3C2AH 4PGJA 1SHMA 2GI7A 4UIMB 3LRSA 2VDRL 3ILPB 5DJDB 4HGMA 1P4IH 2CLVB 3EFDL 1Z0MA 3S34H 4ZDHB 5D96B 5FYKD 4DKFH 1I9IL 4U1LA 4U1IB 4ZSOA 3L3DB 1MREL 4M7JL 2BNRB 2Q7YA 1CFTA 4HIIA 5GGSB 5E4IA 1DEDA 4P9ML 3MMEB 3UBXG 4M6OL 3DLQR 3IAQA 3UBXB 4XBGB 1GGTA 3CNKA 5MI0B 4HWEL 2AW2A 4QY8B 1JGDA 2VDLL 4RWHA 2JJSA 2R1YA 3KXFB 3O2DL 4MZ2A 4U1MA 5TH2B 3GMOA 4E5XA 5F93C 3DV4A 4JFFA 2CXKA 2Y1VA 5D1QA 3MSPA 3SPVB 2FGZA 5F7LB 3RDTB 5C0JA 4FFYH 4EBQL 3LB6C 4XMLH 5C08E 3ARZA 2GY5A 3MLXH 4P2RA 4XNMB 2Q76B 3ULUF 2XG4A 5TQ0H 4PRNA 3OJDB 2VLME 5D1XB 3VG0H 3RNQB 1S5HA 2A2QT 4PR5B 5IVOA 2P8PB 4AT6A 3H9SA 4L29A 1KXVC 1RK0A 3KPRE 3U4BL 1LEGA 2QHRH 3WO3B 1R3KB 4RA0C 2FX8H 3QIUA 1D5MA 2AABL 3HS0A 1CLZH 2EYSA 2RIKA 4Y16C 3VDCA 2AJSH 1B4JH 3RUGA 5ERWA 3KLSA 4BFGA 1F90L 4LVEA 3AS1A 4TUKL 4TVPD 5C07D 1I8IA 3TFKC 1N5AA 4AYFA 4PRIA 3JTSA 4HUVB 2J6EH 2DKMA 4LCWD 3CFBA 5IK3A 4MJ2A 1NCAL 2VITA 4EZMA 5D7SL 1V7ML 3AAZA 4X5WA 2ZOLB 3QJFB 4QY8A 5FV2A 2XNAB 4PRPB 3LQZB 3LAFA 3MLWH 4YUEL 3RWEB 4L1HA 2J8UF 2NY3C 4HPYL 1RIUL 2A6DA 5IB1A 3VRJA 4PJ9B 2AXGA 1CDBA 1TTGA 1OTSD 4NGHH 2XKNB 4B7LA 4RMVA 2OMBA 2XIDA 1XF3B 4Y88A 5CJXA 5J1AB 1N7MH 4OAWB 1E27B 5DJCA 3IFNH 3LB6D 3QFJA 2PYEB 1JCKA 3RX5A 4ZAKB 4L8SC 1CN4A 4XBPB 1UC6A 3MNVB 3WSQH 5KVDL 2NX5E 4OQTL 1HHKA 3X12B 1ACYL 3CJJA 5L8LB 3SE8H 3IETA 4JRXB 2OQJB 3HRPA 5I8OL 5ESVB 3NA9L 3DSFH 2QSTA 2CK0H 3OSKA 3VH8G 3KLHC 3LD8C 5SWSB 2I60L 2OX5A 1QRNB 1PSKH 2DKSA 5EBGA 1LEKA 1GIGL 1ZEAL 3ZKMD 3MRLB 2D4FA 5J0BA 1HIML 3GM8A 5I18H 4WUUB 2R2BB 1P4LA 2FIKB 3ZYIA 3FFDB 3NIDF 3PNWB 4HKZA 2G5BB 1EIBA 1P7KA 5DK3A 2G5RA 2HTKD 4UT6L 4TSBL 4MNHA 4X5XA 2MSPA 4WUKL 3WKNA 5IIEB 5HYQB 2OK0H 3ZMRA 4YGVB 2VLRE 4O5LH 4NYLB 3MGOB 2D03L 5D72H 1F8TL 2QBWA 4G6KL 2ZUWA 3OKKB 4UINL 1RY7B 4HT1H 1U91A 5E6IC 1IM9A 1PBYA 5HHOB 3FONB 5CIPB 2BNUB 5IBUB 3SKOA 1WWAX 5ALCH 1GSMA 4PGCA 3SE9H 2MQ3A 4X98B 1I7TB 2VH5L 2NY4B 4DTGL 1A3RL 5CINL 5GS0H 1OARL 3B9DA 4LPCA 5CMAB 1IC5H 2YPLA 1LE5A 3REWA 2NY1B 1FL3A 2F5BH 1U8PB 4N8VA 2X9YA 3ARXA 1Q0XH 1TCRA 4JVPA 3G6JE 3BMVA 4G6KH 4PJCF 5JW4N 1U8IB 2HLFD 1GL4B 3OF6A 1R5VB 2HT4D 5JTWA 1BJ1H 5CBAB 1CZ8L 2VLKE 2E6JA 4JM2F 4P4KA 3D2UA 4JCMA 1BFTA 3A67L 3MREB 3R06B 1TVBA 2GJZB 3PL6C 1AD9A 2IPKA 3BPNB 4KJPD 4PJBE 4DCQB 3WDHA 2BMKB 2W0KA 5I18L 4U1HA 4LVOC 4D8PA 5FGSA 3KJ6H 4X5WB 1CT8A 4FQ1L 3KLHD 3IU4L 3HZKA 3GJEA 3SDCB 5IBTH 1V3LA 2W65B 3O2VH 3AUVA 4MAYD 2RB8A 1U42A 3BSZH 4YHYB 1A3QA 4R90H 1YEFH 5DO2D 2AJZA 3FQNA 1AGEB 4H1LG 3UROR 5I30H 1AQKL 3T3MF 2P42B 5BVPL 3RDTA 5C0JB 4LHUB 4PGDA 3LQAH 2VLKB 4Y8AA 3WNMA 2PO6C 4GMSL 4I4WB 2OK0L 4QF1A 1PG7L 3OR7B 2XKNA 4Z7UF 2HT3C 2XXCB 3KR3H 2EE3A 1XEDA 4NWTH 1FYTE 4L29B 4LNRB 1JF5A 4D0DB 3NFPB 1NC2B 2YZ8A 3LN5B 4LEXL 1GIGH 1UM4L 2P24B 3OPZL 4N0CD 3T08A 2I60H 4MDIA 2AEPL 2XN9B 4CJ0A 3P9WB 3MJ7A 5SWZA 1XF5A 4ELMF 1NLBL 4FA8A 1SQ2N 1JI2A 1MCPH 3UO1L 1KCKA 5JIIA 3T77A 3NCJL 5HHOE 1TENA 2GSIA 3BPLC 3O8XC 2VLLB 1IEAA 2FEEL 5IV2B 1IAOB 4KDVA 3DYOA 4CMMA 4B53A 3C8KA 4LCUB 2V2XB 2O5YL 4OJFH 1MLBA 4FXLA 3OMZA 1U3HD 4KVNH 2ZKHL 3WFEL 4HUKB 5ICYA 4JRYE 4N8VG 4RWYH 2ADGB 3UTZA 4WFHD 4CDHA 5JPMB 1QLFA 2I24N 1QLRB 1MCSA 3L3IB 2QR0B 4PIRF 2UVFA 2OR9L 5C1MB 2B0SL 3BEWB 4JZNA 4NZDA 4D0DA 5F8QC 4PRHA 2E7CA 3VG0L 1KG0A 1XZ0B 4HKBB 4PJGA 4LSTL 3VRLF 2NX5B 4MD5A 1S7SA 1UWEL 5KVGL 1G7IA 4ZUUA 2O5ZL 5HDLA 1A9BA 1WWWX 3GSRB 4PJFA 4YO0A 3N9GH 5K9JH 4J3OC 1TDQA 3S37X 3WFDH 4P9HH 1AXSA 4WWKA 2HP4A 1F90H 4KJWC 4XHJC 5FUCE 1B4JL 1WEJL 2ICWB 4UTBH 1G1CA 4JZJA 1NCUA 5SWZE 4HJGA 1LNUB 2IMNA 2OBGA 4HC1H 4O4YH 4NQCA 4S1SL 1UACH 1I3GL 4UT7L 2DBLH 2IG2L 2UY6A 1KCRH 3QCUH 2X1XR 2EEAA 5EWIH 2R1WA 5CP7B 3VXMA 4PJDE 2D7QA 3PWLB 2EYTB 5BRZB 2VKXA 2QHLA 1T1XB 4KHTL 4KXZH 4PRPE 1JGEB 5JZ7D 1LO3L 1LQSR 3KPPB 4YHPA 2B1AL 2NY0D 4X7FC 3KPMB 3RA7H 1CFQB 1KV3A 3G5YA 5HYQA 2W91A 1AQDA 1U9KA 2DQFA 4UQ2B 1JPSH 3TNNB 4P46B 4OGZA 3ARBA 1BVKB 1UXSA 1ZT1B 5BV7H 2XKSA 5B39B 2H2PD 3L3IA 4A6YA 4LPXA 3WKMH 1IC7H 1JN6A 3GO1L 2B2XL 4HCRA 1EVUA 4L4TA 4QGTA 2FX7H 4ZNEE 4R4BB 1ETZA 4W6WB 2N4IA 5DR5H 3GBNH 5DEGB 3EGSB 4LEOA 1X5GA 1CFVH 3RRQA 3WIHH 2F54D 4XCFH 4XGZB 3S97C 4PJGE 4JZJB 4WI4A 4EXKA 1RIVH 4OF0A 3EYFA 4PJ7B 5EN2B 2PTVA 4KKAD 2NPLX 2OR7A 2BY3A 1JUFA 3V5DB 4C83B 1K2DB 1Q0YH 3WNPA 2XG5A 1JFQH 4NZTL 1HILB 4EI5B 5JW3H 1S3KH 1HQ4A 1MY5A 4YBQC 4S0TD 3DYPA 2BVPB 5KZCD 4Z8FL 4FZEL 4KKBD 4Y1AA 3OKYA 5EZOH 4KTDH 5SWQA 3THML 5DJXB 4DW2H 1TIUA 1G0YR 1MFAH 3D2UD 4I5BB 2BVQB 1A7PL 5L2KA 2CUHA 3O9WD 4GT7A 5ESQA 1CXKA 2A73A 1QNZH 3LKPB 3BISA 5IJVB 1X9QA 32C2B 3PHSA 2NZ9D 4F7EA 3KYMA 1UJ3B 1Y18A 1A6TA 5CBEA 3U9UA 5HHQB 1IVLA 5HYSB 5JUEH 3SGKA 3SY0B 4XB8A 3S36L 1QD0A 5C0AA 2P5WE 2V7NB 4X4XA 3ROOB 3G5ZB 1R3LB 4I2XB 2W92A 5IVXB 2BJMH 5ILTH 2H1PH 4QHLB 1OAZL 1WTGT 4LVNC 3VMNA 2Z8SA 4ZOCA 2C1PB 4OIBA 3WXWH 1RHHA 2DD8L 4M8QB 4Y4FB 2YN3A 3DMMC 2FJFB 1KTLB 1G7LB 4FFVC 3HAEG 1JWMA 1H3GA 1MQKL 4M7ZC 1G6VK 3BGMA 1LP9E 4KKLD 1KJVA 4R9HA 5JDSB 1NBZA 5IEKA 3ULVD 5GJSL 1IAKA 1FG2A 4JFOB 4PV8B 4JQIL 3X13A 2YXMA 4HKXB 5K9KB 1BJMA 4GBXA 4GKSB 5D70H 2AK4B 4R4NC 3ILQC 3RWDB 2BMKA 2YA2A 5IVZA 3EYVA 3QDGE 2Z8VC 5JW5A 1K5NA 2X6MA 3QI9C 1YA5A 3P4OA 5T1DH 3UPRB 5HGHA 2M8XA 3MTRA 5J4MA 5KVFL 1DANT 1ZHBB 4KHXL 4LPUA 2YKLL 4I18B 1ZLSH 1CE1H 2DQCH 3SQOL 5BZWA 1PZ5B 4YHKH 2PYFA 5EC1A 3BP4B 3CLFL 4JFEE 4TSCL 4JFXB 4Y89A 5C0IB 7CGTA 4PJ8A 2DYPB 3KWWB 4ONGH 5JHLL 3VWKB 5F1SA 3WFZA 5DURD 5IQ7L 3RKDD 2XYCA 4OLYH 1P2CB 2NTSP 2PKDA 1DLFH 4NHCL 4Y4HC 1S9XB 4XBEH 1FH5L 1NC2A 2W0LA 1F45A 3ARBB 3AMKA 2JJSC 3GK8H 5IMKB 3S5LB 1W72H 3SE3C 4ZMAT 1JNLL 5GZOD 1T5WA 3VI4F 3O11A 5F72S 1J5OH 1I7UA 1R5WB 2F74B 3OKEA 4XP1H 2ICWJ 5IROC 1TPXC 4NJ9L 3MRJB 5F96L 3EFFB 3O6FA 1P69B 5JOEA 1KGCD 1T2JA 3RWFB 4CNIB 1OY3B 2MHAB 1KF9B 3C60C 2Y06H 3C87A 1CIUA 4ZUTA 4WV1C 4XVJH 2YPVL 4HWBL 2DTMH 4AY0A 4KI5C 3SGDH 1GHFH 1Y6MR 2I9LA 5I73B 4WUUA 2E8ZA 4HUMB 3P77B 5JMRA 3BIAX 3ULVC 1CFVL 4R96B 5IFAL 1L7IH 4Y16B 5H94B 5E7FA 4JRYB 4P57B 4KK6D 4MNGB 4YGVA 4M7LT 5CEZE 5FCUL 4ZFZA 2ZUTA 4HH8A 1TJHH 1PY4A 4GKZB 3ARDB 4HULB 1OQOA 1K8DA 2B2XH 3RTQA 2IC2A 2VZSA 3CLEH 4L4VE 4LAQH 3WKML 5AUMA 4OLWH 4KK8D 4NOBA 3VFRA 4QTHA 1A8JH 3RZCA 2BSTB 3IS0X 3K74B 3UYPA 3CPLB 5HY9A 1KEML 5J57B 3O3DA 1UA6L 1B6UA 4OZFH 5SX5K 3X3GH 3O11B 3HI1B 4P49A 4WDIA 2CLRA 4OI7A 1LO4L 1CDYA 3VGBA 1H5BC 2HYMA 5IHLB 4Y2DC 5D5MB 3QIWA 5IWLA 1D9KB 3QCUL 4PB9L 3DRTB 2CRYA 2DBLL 2HLAB 2C26A 1U58A 4LSSH 4R8WL 4B0MM 3MLPA 2B8OT 3QIBB 1A14H 5B8CC 2GY7B 4NNYB 2XNAA 3W9EB 1WEJH 2XZQL 5CCKL 4HPOL 3GBMH 1JNJA 1BM3L 5DJ0A 1CK0H 5GGQH 2HVJA 4QTIL 3RY6A 4JZOB 4HK3N 2GAZA 3DTXB 3BI9X 1E4XL 1JNNL 3R1GL 3C60B 1Q72L 4OQTA 2ZG3A 3D0LA 4JKWA 1JMXA 1FJ1A 2EXYD 2RFXB 1DBML 1FAIL 3ARVA 4N0UB 4XVTH 2HWZL 5J56B 1UVQA 4IRZL 1DE4B 1FRGL 2PTTB 4APQB 4LSDA 5E6IB 3STLA 4G43B 4R0LC 4Z95L 5C0IA 4IJ3C 3X3FL 4GBXC 3TIDB 4AQOA 2HRPL 1ZLVK 2KBGA 3AXLB 2BZDA 2NTFA 2SEBB 1ZAGA 1WCBA 2A6IB 3MLVL 5IKCB 1S5HB 4P2CG 1WFNA 2Q3ZA 4OJFL 3IFLL 5JW4M 4RGMB 1BHGA 1BFSA 5INDB 4NKIH 1KUMA 2C7UA 4JQVA 3VGFA 1CGYA 1ZANL 4AEFA 2AXFA 4YDKH 4JM2D 5IR1A 4D8PB 4RIRB 4HZLA 2K7PA 5CP3H 4KJWD 4JFDD 2G5BA 3T0ED 3FT2B 3D0LB 5A16A 2AEPH 1JHTA 1HH9B 3FB5A 2VJXA 4G6JH 1NGPL 2GJ6E 4X9GA 1U8LB 3FO0H 3NIGF 5J3HD 1Z0NA 2P5WA 2JB5L 3PP3K 5LAXB 5DRNA 1NEZB 3KNBA 3WJJC 3MUGB 4NM8H 3IRZA 2N56A 4HDIB 2A74A 1MLBB 5DFTA 1CDIA 4ERSH 3EO1B 3B5TA 5EU4B 3OG6B 3VFGH 1I8MA 3X14A 3MLYH 4ELMA 4Z7WF 3D39E 4QRTB 4D9RE 2G2RB 4WO4B 5GZND 2VLRD 3MCLL 5C3LD 4YDJB 3TBVA 4CVZB 5FCSH 1HN1A 5FGRA 4ACPA 1JK8B 1MAML 1NUNB 5DRZB 4WUUE 2CLRB 3IGAA 5JO5A 3O2VL 3INUH 3QEHA 1YEIL 4HXAH 4N0RA 5ENWB 4AK1A 3X13B 3O3DB 1F6FB 1INQB 3UJTL 1BOYA 5FYLE 1QPPA 3MV8A 3V0VA 1JGLH 1TVBB 2B4CH 3L3GB 3VXUE 4ZOBA 4FTVE 1T3FB 2DQDL 2DJSA 3MCG1 4IBLT 2AJXH 2BK8A 1OAUL 4X6CB 3NTCH 1ITCA 1P4LB 2FIKA 3T3ME 3UXFA 4EUPG 2BVQA 3LEVL 5SV4A 4NO2B 4ELME 3DV4B 2YRPA 5FKAA 1N64L 4K23L 1E28B 1VEOA 5A40E 3FOLB 4KKBC 3VGAC 1NLDH 1FZMA 3CFBB 5F70A 3C09B 3EW3B 3PQYD 1U8QB 4L3CB 5ANME 2XQBH 1CGWA 4TQEL 5H8DA 4M6NL 4RFOL 4YZFE 2WIMA 4FQXB 2FHBA 5JIHA 5DYOA 3IDYC 1Q9OB 2X4UA 1J8KA 5IMMA 4MXVF 4CGTA 2VDPL 5E2UH 3U0TB 1NH6A 3GIVB 3SKOB 3UZQA 5J3HC 4DUVA 3DVNA 3VDAA 2YSSA 1H9VA 1QFUL 4PGEB 1AQDB 1M6OB 1EK3A 1R3KA 4RZCB 5CWSA 1HOCA 3B9KA