4TSCH

Structure of a lysozyme antibody complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
206
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGRGDSIDYWGKGTLVTVSSASTKGPSVFPLAPSSAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Structure of a lysozyme antibody complex
rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 37
structure length 206
sequence length 218
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tscH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tscH01
3WKML 3QDMA 5FECA 1AGDA 1FNEB 1NCAL 3IJSA 2A6KB 3U4AA 5ESQB 1I1FA 2DB8A 4DUWA 4PY7A 3ZDZE 15C8L 5DRWA 5JQ6H 4LSDA 3MJ8A 3QDJD 3ZKXC 5H8DA 5CEZE 3BUYB 4R4BA 4X99B 4N0RA 5CCKH 3EYOB 5MI0B 3RDTA 4IRSD 1Q94B 2OR8A 5EO0A 4PRHA 3WXVL 4MQXD 1QBLH 4OT1L 3HS0B 4LCYA 5ALBH 3MRNA 2DDQH 4E5XA 4Z78A 1E4XL 2DQCL 1YN7A 5GS3A 3WYRA 4OF6A 4F8QA 2CDEB 4J12A 3O4LD 4V1DE 5CBEA 5SWSD 5KSAD 2W0KA 4LOUC 3QI9A 4X7CC 3WUWA 4DGVH 4TUKH 1J12A 4OI8A 2WINA 4HWEH 3CD4A 4N1EA 4A6YL 1KUMA 4OJFL 3OJMB 4ODUB 2NX5A 3H3KA 1NANI 4GQPH 1U3JA 3UMTA 5EZOL 3Q1SH 4X6BB 2QADB 1T21A 5F71A 1JV5A 2Y23A 4ZUUA 1JK8A 2VDRL 5IR1A 3B4NA 1TDQA 3VI3E 3GSNH 4GRWH 1GZPB 3DSFL 5EULV 2EDEA 2YUVA 2DQFA 1BVLB 4MNQD 1UENA 3EOTH 5L6YL 4I3SH 1D5IL 4HGWA 2H32H 1PY9A 1VEOA 3MA7A 4A6YB 1WC7B 3N1FC 3MLYH 3UDWA 4HWBH 3UYPA 1YMMD 2DWDA 1QLFB 4KHTH 4Z95H 5HSFA 3SPVA 1K9TA 1MRDL 4PJXB 3D39B 3MV9B 3LN9A 3SO5A 4D3CL 5BRZB 4ODHH 5B4MC 1IQWH 4LCCA 5D93C 1BF8A 1D5ZA 2OQJA 1EXUB 3U6RB 2JJVA 2EYRB 1SM3L 2GEEA 4DN4H 3VFRA 5I6XC 1G7LB 4G6JH 3RRQA 2J8OA 4YHZH 3FCTA 1HNFA 4GAJH 2XTJE 4J4PA 5HHNB 1FAKT 3PGFH 1MELA 3REVA 3RX5A 3D0VA 4JEGB 2C3VA 4JRYD 4AT6A 1BJ8A 5LWYH 4APQA 3T4AA 1JGDB 1I7ZA 1DSFL 1JWUA 1ORQA 3GUTB 2OJZL 1QFWL 1S7TA 5TQ2H 4UUJB 5CSBA 3NACL 2FEDD 4J2XA 3BGFC 3SE4A 2GTZA 5CEYA 3PE9A 1S5HA 1WICA 3TVMB 1LMKA 1QNZL 5CSZA 2ZUWA 3BI9X 1ZHNB 2CIKA 4U7KA 3Q2CA 4OCSL 2HT4D 3EDKA 5D2NA 3D2UB 1KTLA 3OR6B 4FQ1L 3SN6N 4IOIB 4DCQB 5J56B 2BVTA 2Y7QA 2VZTA 3MLXL 3X14B 3P4LA 3QEHA 3SKOB 5J6HA 2HFTA 4WHTA 3KLHC 3SDAD 3VG0H 4BSVB 1DZBA 4LF3A 1AY1H 1JWSB 3MRQB 1RIVL 2KL6A 4EI6B 5TQ0L 1MCOH 1NUFA 1KXQE 5EU4B 3IDMA 4MVBC 5BMFH 3QDMB 5FECB 1AGDB 3KPQA 3PG2A 4CW1A 3IJSB 1MHHA 1G7MA 4KK6C 5F7DA 1GOHA 3WV0A 4BH7B 5JW4Q 4PY7B 3ARRA 1N4XH 4KTYA 2HP4A 5GGVL 1N59A 5DRWB 5IHUL 1VERA 1UB5A 1A9EA 3KPTA 3MJ8B 5MI0C 1ZLWK 3ECBA 4R4BB 3BWAA 3WFCH 5BVPH 3PWVA 2MWCA 2R0LH 4M7ZB 5EO0B 4PRHB 2FO4A 3DHMA 1MFBL 2RB8A 1T3FA 3ZT6A 4KDTC 4LCYB 3MRNB 4E5XB 5E2TH 1G6RL 2HFFA 1JTTA 2N7AA 4F57H 4Z78B 1YN7B 4JG0H 5CBEB 3RNKA 1ACZA 2E8ZA 3QI9B 3WUWB 3DJ9A 5D72L 2WINB 4P5MA 1DVFD 4P0DA 4U05A 4F80A 4QOKD 2NX5B 5GZND 3VMNA 2AK4E 3LHPH 2QADC 3CFIC 1D9KA 4NRXA 3P0VL 1TITA 2I26N 1T21B 2F58H 3S9DB 5IR1B 1JK8B 3LKNA 3H9SD 3O6KL 4GQ9L 4NM8L 2DQFB 2ITCA 1EX0A 3GSWA 2K7QA 1TQBB 4HGWB 4RA0C 4ZOBA 5JW4N 5I1JH 3MA7B 3G9AB 3QFDA 4OIIL 2CK0L 1P2CB 3HTLX 3SPVB 3GKWL 1IRAY 5F21B 5I19H 4MJ5A 5C0GA 4ZPVA 5JHDD 1KIPB 4OM1H 1F58L 2ITDA 1S78D 2YMXH 3PGDB 4FG6C 3QO1A 5AZ2H 3MFGB 3DUHA 4LCCB 2Z8VC 1D5ZB 1R3IL 2OQJB 3EYFA 4C56D 2P24A 4PUBH 5T3XL 2VXTH 4MJIE 3VFRB 3MRGA 5BW7A 3FCTB 2QQQA 4NC2B 1KB9J 4P3CL 3ALXA 3REVB 3D0VB 3TJEH 3CIQA 2C3VB 2H6PA 1DQQB 1TENA 2DMKA 2MOVA 3SJVA 5KS9A 1BHGA 1MCHA 4EI5A 1MCLA 4AT6B 4HDIA 1OF2A 5EO1B 1MPAL 1A0QL 5EU6D 2V9QA 4APQB 3T4AB 1I7ZB 1JWUB 1ORQB 5KVFH 1S7TB 4D9QE 3TVMC 1K8DA 3WIHA 2R9HC 3ZT7A 2QHRH 2GTZB 5CEYB 1S5HB 1OP3H 3W0WD 5CSZB 2W9EH 2C3XA 2V7HA 4LCIL 5GJSL 2CIKB 1ZA6A 4XVUD 5D2NB 4PJ8B 1KTLB 2ICWA 2YRLA 1G7JA 5EN2B 1LK3L 5HPOA 3MNWA 1RUQH 2Y7QB 4XPFL 3JWDC 3QEHB 4NCC1 3TYFA 4WHTB 3MODH 3FZUD 5J6HB 3LRSA 4LF3B 4LHUA 4PYGA 3KYNA 5EBLA 3CLEL 3SDDD 3QP3A 5FGRA 4KKAD 1T89A 3O2WL 2N7BA 2ZUXA 1Q9WA 4HT1L 4B5EA 3V7AE 3IDMB 3O6ML 2HG5A 4KZEL 2AJYL 1QLRA 3KPQB 2EDWA 4CW1B 4X4ME 1MHHB 1G7MB 1OVZA 4MLIA 4PB0L 4LSRH 3MV01 2FIKA 4PBXA 2P5WE 4YO0A 4UZGA 3FN3A 5IB2A 2E27H 1N59B 2VAAA 3FQRB 5TPWH 1UB5B 1A9EB 3TM6A 3U7YH 1B90A 4RFNB 3RDTC 3ECBB 4HC1A 4M7ZC 1QBBA 5DZLA 1HNGA 3BWAB 4RMRA 2EIBA 5I30H 3C5ZA 3PWVB 1INDL 1R3HA 3SOBL 2NYYC 3GJFH 3FFCB 4ODVH 2FO4B 3MNVA 4PRPD 1KTRL 1T3FB 4ENEC 1A5FL 2HFFB 3VH8B 3BMWA 3QI9C 2F5AH 3HE7A 3ULVL 4RMWA 3BYTA 5CMAA 1FNSL 1PG7X 3RNKB 2VXVL 3BP4B 4H20L 2XZQL 5FCUH 4P5MB 3DGCR 1J1OL 2QSCH 5IB4B 4M62L 3FHAA 3NCYS 3DGGA 5T3ZL 1I75A 4NRXB 5D71H 2F9BT 1JVKA 3LY6A 3MRHA 5F1NB 5D5MA 5I8KH 3PL6A 4HQQH 4NQXA 5EG6C 4XTRD 3LKNB 3U7WH 1FFOA 5F9AC 5F7NC 1TQBC 1SEBA 4FQHB 1T1XA 2ITCB 7FABL 4BZ2H 3UDWC 1TJIH 1RZ8A 1I1AA 1U8KA 1FZOA 2M8XA 1OWWA 4K3HA 3QFDB 4JREB 2YKLH 3BZ4A 3QRGL 2DKUA 5ITBH 2X89A 5F7KC 3KYAA 3EOBB 5KS9F 4DOHB 5DLMH 4LPTA 4MJ5B 4PD4J 3DXAB 3H3BC 4LCCC 5C0GB 1YEEH 4ZPVB 2X4PB 5DD5L 2ITDB 4Q9CA 3HNSH 1IVLA 3QO1B 4O5LL 4R2GD 3UTTE 3FMGH 2P24B 2FGWH 4MWFA 4WGVB 5I17A 4J4PC 5GGQH 1JNJA 5BOZG 3MRGB 2VYRE 3S4SA 4P4KD 1YMHA 2H6PB 4L1DA 1ZLUK 1J9CT 2X1WL 3C8KA 3SJVB 3DI3B 4APQC 3JWNC 4EI5B 1OF2B 5CZXC 1L7TH 2BNRA 4Z5RA 3V4VH 3HI6L 4X8JA 3SE4C 3MRJA 1G9NC 1K8DB 1A7PL 4YFLF 5BS0E 2VXQL 2DJ4A 4JG1L 1P69B 5D2NC 1CFVH 1U8IA 5IESH 4LIQL 3TO4A 3BZDA 2V7HB 3LMJL 5BXFA 1ZA6B 3F12A 4LP5A 2O5XL 4L4JA 1N0XH 2ICWB 1G7JB 2DJUA 3C08L 1QSFE 3WFEL 2CKNA 2DQUH 5EFIB 5T5NF 2UVEA 3MNWB 1RURL 2A0LC 3JVGA 2E5EA 2X7LA 3BRDA 1T66D 2DBJA 1T0MA 4TOYL 1HXYA 3TYFB 2IFFL 4KKCC 5CJBA 1DLHA 3LRSB 3CK0L 3KYNB 5EBLB 2OP4L 4GMSH 3TV3L 4WFGD 1DTUA 2XWJA 1NH6A 1TJHL 1Q9WB 4IRJA 1CLOL 4FFWD 2HG5B 1CGSL 3ES6A 1QLRB 2NY3D 3RWJA 1AHWA 2VXSL 1NCDH 4JQXA 5K9JH 5IKCA 1X4YA 3FO0L 2FIKB 2J8UA 4YO0B 4U1SA 5IW6A 2DQJL 3DSNA 4RFNC 4XPHL 5GIRA 4NQED 5IB2B 2VAAB 4HFUH 2W59A 4WRLA 3QNZA 3KWWA 5LBSH 3C5ZB 1R3HB 3O0RH 4F58H 4ODXA 2I07A 5DVNA 3QPQC 1YUHA 3MNVB 1EA9C 5DD1H 3VXMD 1TQCB 3GMLA 1MCPH 2IEPA 3HI5H 5DC0A 1MF2L 2ILLA 3H7LA 1A6UL 1QPPA 4ACPA 4F37K 3HE7B 4JM2A 3QXUA 5D7LD 2A6JB 5CMAB 5LGHH 4M6MH 3PHOA 2X4SA 1SVCP 2VOTA 2IMNA 3L5HA 2PCPA 3I9GL 1EVTC 1KIQB 1GGYA 1SBSH 2VQUA 1D9KC 1WCQA 3DGGB 3DO3A 3CSYA 4LVHC 2WSKA 5GGTA 5J1AA 5F9DC 4QRQB 1CGTA 2Q20A 2DQIL 2YA2A 1X5ZA 5D5MB 3G5YA 3PL6B 4XB8A 4NQXB 4PJBA 4TPRL 3F58H 2NCMA 1OGAA 4NNPH 2JJWA 4JGUA 5FXCH 3BKJL 2ZJSH 1FYTA 5F8QC 1A6VH 1SEBB 1T1XB 1JGEA 3CJJA 5IW3A 4JREC 5IVNA 1MHEA 1TZGH 5FGBA 1RZ8B 5EC2A 1I1AB 1U8KB 1FZOB 1SJHA 3DARA 4OQTL 4YBQD 2FX9H 3BZ4B 3UROR 5J1TC 3OAUL 4QTIH 4TUOA 2FHFA 1JHTA 4PGDA 4KUZL 1CE1H 1UM4H 1MFAH 5I1HL 1LD9A 3ME0A 5FOJA 1MCWW 2VLKD 1IE5A 5BW7C 4N0UE 4MWFB 2IGFH 5I17B 3RUGF 12E8H 3VGEA 5C6WH 5C0BD 4LAQH 5F9WB 3ZHLA 2ZZUT 4EI5C 3S4SB 1PG7W 4F7PA 1YMHB 4NZRL 4KKBD 5FM5M 2BHUA 4D94A 2RCSL 5I74B 1WBZA 2BNRB 3U83A 4Z5RB 1JF1A 4X8JB 4WO4D 3HZVA 4GLRH 1CBVH 3MO1A 5E1AA 2EDFA 3PWPD 5KW9L 2BJML 2W9DH 3RGHA 5CIPH 1H3UA 1U8IB 3TO4B 4A2MA 1M1SA 5KAQF 2R0KL 5BXFB 3KYMA 1AP2A 3F12B 2VABA 1Q0YL 5HYJA 4JKPH 3UJIL 4KXZI 4HPYL 2X7LB 3V6OE 1JL8A 3O2DL 3ABZA 3DVFA 1HXYB 1T2JA 1DLHB 1MCCA 3JSSA 3KLSA 1OCWH 3TZVD 2P49B 2FNBA 2BX5A 1T89C 3J7HA 4Y1AE 1GYAA 5EOCJ 4EUPG 1OAKH 2DI9A 3SDCA 3RVUC 4U6HA 1CICD 2XWJB 4PLJD 5A16A 4GUPA 4KPHL 4XVTL 5JZ7C 3RJQB 4IRJB 4NZJA 1T5WA 5LXGL 3VXPA 4H88L 3ES6B 5IK3A 3RWJB 4UDTA 1AHWB 3FOMA 1R5IA 4XWGL 3OXRA 5IKCB 1ZA3A 4PP2A 4OSUH 4NC0B 2J8UB 4RFEB 2C1PA 3OGOE 2X4RA 4QRRE 5IW6B 1IM3A 5GIRB 4UB0H 5MENE 4OCWL 3C5ZC 4K7PY 2DM3A 3KWWB 4DZBA 2ATKA 3GI9L 1B4JH 2VDQL 4V2BA 1TQCC 4ODBD 4ODXB 2I07B 4NJ9L 1NL0H 1YUHB 5C07E 4K7PX 3HE7C 1MAKA 3GMLB 4MAYD 3CC5A 4V1DA 4QHNA 4JM2B 1KCUL 3RI5F 3PHOB 2X4SB 3N50A 2PCPB 2YHGA 1KBGL 5GGSY 2C4FU 1OAUH 5J1AB 1CCZA 2XRAL 3PL6C 2NY6B 1MJJA 1EBAA 1LO5A 4QXUH 4ZO7A 4D9LL 1QZ1A 2ZUSA 1UM5H 3G5YB 5IBUB 4PJBB 4YHOL 5IHZA 1OGAB 1OAQH 1PGRB 3ZL4L 1FYTB 5F6HI 1I3RA 2H41A 1I1AC 3FT4A 4LVNB 1JGEB 4EOWH 1P4IL 4KRMB 4YHLH 3IDYB 1J8HD 1MHEB 3UCRA 3MRDA 5BV7L 1FFNA 2EYSA 4U3XA 1MIMH 1OSZB 1EO8H 5GSRA 3V0AC 2ZSVA 4X83A 4L3ED 2OSLA 5FAAA 2YZ1A 1AKJD 4PRID 5L2KE 4S1RL 1TCMA 4TUOB 3RVWC 3JUYA 1NCBL 1JHTB 1F13A 4PGDB 5DJCA 4ZFZA 1LD9B 3U36A 1J18A 3ARBA 1TETL 1JGVH 1YA5A 2YXMA 2DLTA 1JRHL 1YYMH 5F9WC 4LSQL 2YPVH 2FR4A 4X8XA 1YN6A 5C6TH 1L0XA 1P1ZA 5E08H 5BV7B 1WWWX 5HHVH 1L9MA 4F7PB 5I74C 1UKTA 2XNAA 2Y07H 5EB9A 4ZFFB 1WBZB 2K3TA 5E4IA 2E9JA 3HZVB 2O5YL 4W4OA 3QR2A 4YHMH 3MO1B 2VLJD 5E1AB 3TO4C 4PJDE 3DMMD 5ISZE 2H45A 3T08A 3WNLA 1UG9A 3KYMB 4YZFF 1AP2B 5C0EA 1M71A 4H1LG 3MZTA 1NEZB 3ETBF 2VABB 3H9YA 3V52L 5GS2H 5HYJB 4WI8A 4DWHA 1RHFA 1ODAA 2E7CA 3JVGC 4TSBL 1EJOH 4M7KH 3R06A 1EEYA 1CDYA 1LGVA 3QHZL 5DK3A 4Y8DC 4P5TA 4N8VA 5IF0B 2X42A 3LZFH 4MS8D 4XPAH 4CU6A 4PJGE 3ZKSD 2MSPA 3T2NL 5HD8C 4IRJC 3SDCB 3OMZA 3ZLQC 4U1KA 4KMTL 5A16B 1AHWC 1ZOXA 4JQXC 1GPOL 1BFVL 3U2SA 3WHXA 1T5WB 2WIIA 3VXPB 4UDTB 3QUZA 9CGTA 3FOMB 5F8RC 1R5IB 4X5LA 3OXRB 1ZA3B 4PP2B 1YY8A 4JO4H 2C1PB 4R26L 5DHYA 2X4RB 1IM3B 2PUQT 2Q8BH 2X5PA 4JKMA 2R2BA 2ADJA 4M43H 2ATKB 3D0LA 4AYFA 1EZVX 1ED3A 4AEIH 3GRWH 3I6LE 2XIDA 4YXKL 2FX7H 4UAOB 3GK8L 5M95B 4JM2C 4DGYH 1XCTA 4KVCH 3CC5B 4V1DB 4QHNB 4K2UH 3UAJD 5LCVH 1T1WA 3BDBA 1UWXK 4CU7A 3TFKC 3P11L 1IAOA 3UYOD 2AK4A 3MQIA 2JIXD 2NY6C 4ALAL 1YEFL 2DBLH 1YC8A 1J0YA 1O5DT 5I1KH 1MJJB 1LO5B 5HTSA 2B1AH 1EJ6A 5L7XH 4EIZC 4XH2A 5IHZB 4H0IA 1S9WA 4OCMC 5D96B 4LCWE 3WN5A 1OHQA 1GIGL 1K6QH 2EH7L 3IDYC 3IJYA 4LVEA 2FATL 3PWNA 1I3RB 5FGBC 3TBWA 5F7UA 6FABL 2XKNA 4MZ3A 5JOPD 3MRDB 4FQIL 1MFCL 3GSOA 1OQOA 4JJHA 1FFNB 2EYSB 4J23A 4AENA 2ZSVB 2HFGL 2JB5H 5LQBH 3C8DA 3NCJL 5HGBA 2GYSA 4LNVA 2OSLB 1B2WH 1U3ZA 5E2WH 2PYED 4FMFA 2V2TA 2FEEI 5DJCB 4O00A 3GM0A 4ZFZB 1T04A 3HRZA 3EFDL 3OZ9L 4HF5H 3U36B 3O81A 3ARBB 3GO1H 2NY5C 4MJIA 4DKEL 5CKAA 1BEYL 1N3NA 5BV7C 4OZIB 2FR4B 2XTJB 3DROA 5CEXB 1YN6B 3MLWL 4L4TD 1P1ZB 5DD0L 3DLQR 1NMAH 2X9XA 1G0YR 5DHXB 1MCKA 4LSTL 2XNAB 3ARFA 4BQ9A 4ZO6A 2BXZA 4WNQA 3ET9F 3DRTA 2AJ3A 5E9DE 5ANME 4ZS7H 3S7GA 4NOBA 3NTCL 4MD0A 4YAQB 3A67L 1MRFH 5B39A 4QHUA 5F72S 5I9QB 1DL7L 4RMQA 1BIHA 1YYLL 1EGJA 4QHMA 5C0EB 1M71B 4R96A 3RX8A 1DBMH 2AEPH 4MA1B 1HZHH 3WHE0 3PXHA 3TBSA 1QHPA 5A1AA 1F4XH 4U6VL 3HUJF 2HN7B 3R06B 3K2UH 5SWZE 2EH8H 4M7LH 4MNQB 1QBMH 3GBMH 3MSPA 4OF8A 4P5TB 4N8VB 1F5WA 2F5BL 1RFDL 1OP5K 5JQHC 1F8TL 3SDCC 2B4CL 5KVGL 5JMOC 2IAMA 3QQ9C 1ROWA 4RX4D 1AC0A 3N85H 4TVPD 3FQWA 1UH3A 3KPNA 4U1KB 3DUSA 4PV9A 1WITA 2DQDH 4DKDC 2IBBA 2BHZA 3HC4H 1I3UA 4LKXA 3WHXB 2Q87A 3U2SB 2PO6D 3VGHA 4HLZH 4X4MA 3KNBA 3QUZB 4JPWH 5J9PB 1YY8B 2P5WA 1MFEH 4YXLH 3RWCA 1JNLH 5FKAA 4Q9RL 3M8OH 1SY6A 3TPKA 5DHYB 3ROLA 4UV7H 1XGPA 3OAZK 4JRYB 5DGQA 1KCRL 2R2BB 2ADJB 4H8WC 5E8DH 2LE9A 3LKPA 4UAOC 3NCEB 4WFHE 3S36L 3IYLW 3D0LB 2Q76A 4K7PH 1ED3B 1NBVL 5IM7A 4XCNA 4HFWB 5D2LE 2CSPA 4R9HA 4EDWL 3VRLF 4ZS6D 4FABH 1XCTB 5JO5A 4JHAL 5TF1L 2CXGA 2DTSA 1EERB 1ITCA 3K8LA 1FGNL 1T1WB 5C0RH 1MFNA 1YNKH 3D85A 3L5XL 4DW2H 1IAOB 2EDHA 2RIKA 4YLQT 3ARVA 4XNQA 1I1RA 2D31A 2AK4B 2IG2L 3TA3D 2BVYA 1MHPH 2ZOKA 1HN1A 1WFUA 2Y36L 2KQNA 2VDKL 3IRPX 5D96C 4XH2B 4G6FD 1CD1A 1PLGH 1RJYB 1S9WB 5CINH 3SDDA 1ADQA 2Z8WC 2AQ1A 5IW1A 5CJ8A 3IJYB 3PWNB 1YPZF 4GXUM 3TBWB 4PJ9D 5T1MA 4H5SA 4XX1E 2XKNB 3T0DA 5DWUH 4XP9L 2PF6A 5C70A 3GSOB 5J11B 2DM4A 2XTLA 4AENB 2NTSP 2XPGA 3KJ6L 2FECI 5HGBB 2EC9U 3VGDA 2GJ6E 1NFKA 1YQVL 3ARBC 2V2TB 1F4YH 5ADPL 2X09A 1OSPL 4PLKC 2QQLH 1T04B 3HRZB 3UTTA 5JXAH 3QWOA 1BAFL 4XP6H 2XTJC 4MJIB 4V2CB 5GS0C 1N3NB 1KB5A 3ZTNL 4XCCL 3DROB 3GJEB 1KOAA 1FZJA 1EUTA 3PF2A 1Q1JH 4XHJD 1GGUA 3ARFB 3BKYH 4D2NA 4RMVA 4WNQB 5DUML 4W4OC 5DMKA 1IMHC 3DRTB 2AJ3B 2ZP0T 1MCQA 3Q5OA 4XP1H 5BS0A 5I9QC 5I1EH 2CRIA 4MD0B 4ZOEA 1UVQA 4Z0BL 2Y5EA 4WFED 4Z7OE 4QHUB 4QXWA 4MA1C 4QHMB 4M1CD 3RAJH 1YECH 2YA0A 3EHBC 1QSFA 4JFHE 4PP1C 3TBSB 2OCFD 1BQUA 4OF0A 1FGVL 1P4LA 4P5TC 3PWLA 3BGMA 1JHLH 4I77H 5DMGC 4J3OC 1YEHH 3GMOA 5JHLL 4KQ3H 1BOGA 3B9VA 1KTDA 3JUZA 4Z7WA 4YDJA 2IAMB 2ICEB 1C5DA 5CZKA 1N5AA 2ZUVA 4PGZA 5C0JA 3KPNB 3DUSB 4PV9B 4UIKH 4Z9KB 5JHDB 1TLKA 3QUZC 4LKXB 2HMID 4X5XA 5C86A 3KNBB 5EORH 5CZVH 4UT7L 1ZHKA 3O8XA 5TE7H 2P5WB 3RWCB 1JMZA 2AXHA 3PHQA 4PG2A 5FKAB 4MDJA 2B4CC 3RTQD 3S5LA 3ROLB 2B0SL 2OS7A 4GS7B 2Z91B 1XGPB 1NDGA 1UH2A 4G9DA 4HK3N 3MOAH 3KLAB 2AJVH 4JFDE 3KYOA 2EE2A 3LKPB 3RA7H 2FEDC 2Q76B 5IM7B 3PNWA 4XCNB 3A6BH 2NTFA 5C7XH 5JO5B 4Y5XA 1IAIH 1J5OH 3U0WL 4MLSA 4Z7UF 1W0VA 4ZD3H 1ZANL 4TQEH 3D85B 5DJ0B 3K7UA 5DS8A 1RMFL 3HKFA 3VFPA 4XNQB 4ZPTA 2D31B 4M7JH 4KK5C 2ZOKB 5CGYD 1GH7A 3SEPA 1CIUA 1N64H 1Q9LA 4ORZC 1NMBL 3WN5C 4NKDA 4WTWA 3SDDB 2ESVE 4KC3B 4NN7B 5IW1B 2AW2A 5J11C 4MGXA 1YEGH 5T1MB 2EEDA 5TH2A 5EOCH 5HI4C 5EU5A 5F7FA 3SE8L 3SGKA 2XPGB 4JGJA 5D7KE 3WE6B 3ZE2E 1AQDA 2E6JA 1C12A 1WAAF 2X9WA 3OBAA 2H1PL 5C0IA 4HCRL 4R0LA 3RVXD 5HGAA 2D03H 1BZ7A 2R15A 1U36A 5SX4I 4P46D 4L8SA 3UTTB 1IEBA 2D7QA 3QWOB 5GRWA 5HXMA 4N0UA 2AGJL 1P9MA 3CMGA 2W0FA 3VXUE 5E95B 3EAKA 1KNOA 4NCC2 3F7YA 4JPIA 4KJPC 4LSPL 1KB5B 1KG0A 5I1IL 4M9PA 1AFVL 2Y06H 3EOYG 3ARFC 4UTAL 3SKUD 1FZJB 2EKJA 1LE9A 3TH2T 5D7LA 5DEZA 4U1JA 4JO3L 2R29L 3G04A 1ZE3C 5DMKB 4TTGA 1MQKL 2DQGH 4HKXB 4L9LA 5BS0B 4P5KA 3RL1A 2B5IB 2WWMD 4PFEA 3VWKA 3WEXA 1MNUL 3RZCD 2GAZA 2NR6D 5L88H 2IMMA 3AS3A 5L9DH 1NUGA 1QSFB 2GJZB 1TFHA 3KLDA 3PWJA 3U79A 2I5YH 3TYGH 4U0RB 1P4LB 3D48R 3V6OA 3PWLB 4OLXL 4KHXH 4Q0XL 2KQMA 3BD5A 5EU7E 2APXA 3GMOB 4C4KO 1EO5A 4ONFL 4DKFH 1RZGA 4Y19D 1BOGB 2YPKA 1TZHB 2IAMC 1KTDB 5D6DA 4Z7WB 4Y1AA 4YDJB 5D1XD 4O4YH 1DUYA 1DANT 1YY9C 5EPMA 1C5DB 3X3GL 3ESVF 1N5AB 1UACL 1ZT1A 4OM0H 3DX9A 5C0JB 4RDQG 2EDLA 2V17L 4NOFA 4YHKL 1Q8MA 2E9WA 4X5XB 1IC4L 5GGUB 4KK9D 4X4XB 4YR6B 5AAMA 5DT1L 1ZHKB 3O8XB 3PHQB 4GS7C 4MDJB 4QRRA 1N6QL 3S5LB 1H9VA 5MENA 4KKLC 3MOBH 4P4KB 4E0RA 1NDGB 5HDLA 1CG9A 4G9DB 3KYOB 2VH5H 1C5BH 3UTOA 3I02A 3TC9A 3PWUA 5C07A 4N0FA 2A9ML 2NTFB 4TRPL 1I8MA 1EFXA 1NCAH 4Y5XB 5JNYA 1JNHA 4BFGA 2XACC 1TMCB 1W0VB 4N8CH 4N9GA 2JCCB 3E6FB 1XIWA 15C8H 5DS8B 1WQVT 3VFPB 3MA9L 3P9LA 4U1NA 4P9HH 4KI1A 4RGNE 4M61B 3UYRL 4G7VL 2PXYD 5IQ7L 1Q9LB 2VDPL 3QRFM 3O2VL 3SDDC 3WXVH 4NN7C 4OT1H 4RAVA 1V7ML 1E4XH 3BKCH 5JPMA 3P40A 1B0GA 4GJTB 1U8HB 2ZOLA 1LO0H 2XQYG 3B9DA 2DI7A 2NY3B 32C2A 3V4PL 1PZUB 5TH2B 3BJ91 2C5DC 5EU5B 3FT2A 3LQAC 4NZTH 4OJFH 1KC5L 4Y2DA 5L2KA 1AQDB 1C12B 4B41A 3IAQA 4GG6F 1CXFA 5EZOH 3S97C 1GAFH 1UWGH 5C0IB 3ZZ1A 2CDGA 4R0LB 4IHOA 5HGAB 1BZ7B 1LK2A 4X9FA 4L8SB 3QUKA 1IEBB 2HT2C 2VDRH 3K8MA 4N0UB 1JPGA 2W0FB 2NY0B 3DSFH 1KNOB 4JPIB 1E4WL 4L1HA 1KG0B 5L6YH 5HI3C 3VXMB 1URLA 1D5IH 4UNTA 4K07A 1LE9B 4RAUA 4R97B 2VIRB 5D7LB 4U2ZA 4E41D 4U1JB 3G04B 4DQOL 1MRDH 4AJ0A 4JDVA 1LE5A 2Q6WA 3GMNA 1PFCA 3T65A 4L9LB 4PJDA 1FJ1A 3RL1B 4D3CH 3NCBB 1FVCA 2GW5A 5ISZA 4KQ4L 3BIAX 4FQPA 3WEXB 2XFXA 4XXDA 1A3QA 4LQFL 1SM3H 2GAZB 3L5JA 5DVOA 3VGAB 4JZOA 1ZVSA 3DETD 4U0RC 1U8QA 3PWJB 3DVIA 1JPTL 4XHQA 1JZ6A 3FO2A 2P1YA 4R8WL 2ZSWA 4OGXL 1RZGB 2WLZA 3OX8A 4NO3A 2YPKB 2OJZH 1QFWH 4PJGA 1T7WA 4UDUA 4JRXE 3NACH 4Y1AB 5I18H 4EZMA 1DUYB 2VDNL 5EPMB 1O0VA 2BVQA 2ZWLT 1ZT1B 2R23A 3DX9B 3G08A 5I1DA 1WZLA 2W07A 4OCSH 3PV6B 3O8XC 3T0BA 4PG2C 1QUNA 3UBXA 2XY2A 1YEJL 4Z7QF 4P4KC 4QRRB 3MLXH 3UPAA 5MENB 3QDGD 2CKBA 4NFDA 1AO7D 2AK1L 1X4ZA 1CG9B 3RY5A 3PP3K 1RIVH 4OLWL 4G9FE 2AQ3A 5TQ0H 4GKZA 4YFEA 3I02B 4ONOA 2Q8AL 4XGZA 3PWUB 4Y5XC 5C07B 3PHSA 3UP1A 3CSPA 3IAPA 4N0FB 1I8MB 1EFXB 5JNYB 4PJ5E 3ULUD 4FZ8L 1JNHB 3TCXA 2AXGB 4N9GB 2F74A 4GO6B 3OAYH 3IVKA 4OZGE 1K4CA 3P9LB 4U1NB 5AAWA 5E7BA 3CMOL 3P73A 3PABA 1D6EB 4WIQA 3ZMRA 5FO8A 3LB6D 2PTTA 3VA6A 1FFRA 1H5BA 1QP1A 1F3RB 2BK8A 4RAVB 4LCWA 4PJCF 1G6RH 3E3QE 4U7MA 3ARDD 5JPMB 4FFWC 2ED8A 5K93A 1J1XL 1B0GB 1HE7A 4XMPL 4IM8A 2JJSA 1U3HA 2ZOLB 2H26B 5D72H 3SGKC 5E6ID 3QYCA 1EHXA 3PV7A 1AGBA 5TDNA 3CX5K 2JJTA 3FT2B 1HH9A 1NC4D 4Y2DB 5IIEA 5L2KB 5C2UB 2OBGA 4R0LC 4MJ6A 1N6VA 4L8SC 5AD0B 5E0QA 3P0VH 2CDGB 3VFVA 4CMHB 1P9MC 4IHOB 2GSGA 1LK2B 2NY0C 4OBSA 3QUKB 5I2IA 4PJDF 2Y6SC 1JPGB 3O6KH 1I7TA 4GQ9H 4NM8H 3NA9L 4WI3A 2OI9B 2VZOA 3UTSE 3EYQC 4R97C 4XPGL 1MREH 4CVXB 2A74A 3WD5L 4RAUB 1A47A 4OIIH 2CK0H 1AR2A 5E9DA 4HUUB 4L9LC 5ANMA 1UKQA 1NUNB 2VJXA 2Z4QA 3GMNB 4JDVB 3ZE1E 1LE5B 3T65B 4M6OL 3HPJA 3VWKC 3C6LD 1FJ1B 1J0JA 3MLUL 1FVCB 3O11B 4KGLA 5ISZB 1BQHA 1B4RA 4PJGF 5AZEL 3IB4A 1SYVA 3VGAC 2XFXB 4XXDB 2CIIA 4O2CA 5T3XH 5D7JD 1CL7I 4JZOB 2QSVA 1ZVSB 2AJSL 3V6OC 2CRYA 1U8QB 4P3CH 3QIUD 5SWZA 1WWCA 1CI5A 3UZEA 4OKVA 2R1WA 4ZO8A 1MPAH 2ZSWB 1B6UA 2X44D 1A0QH 2ICWI 5D6DC 4JGMA 1NFDE 5E94A 2IALA 3EIFA 3OX8B 4NO3B 4B50A 3ISWA 5DXWA 3FN0L 1T7ZA 4HS8L 5ILTL 4UDUB 3BRFA 3LPGA 5JA8B 1AC6A 1GCFA 2IC2A 5T1KA 4WWKA 2BVQB 5ADOL 1VFUA 4YFLI 5DFWH 2R23B 3G08B 1MFDH 4LCIH 4OFYD 1L7IL 5GJSH 4ODWA 5I1DB 4ZXBA 2HLFC 4GT7A 4PLOB 4F8TA 4ZFGL 1LK3H 4U7SA 2UZIH 1M05A 5F93C 3UBXB 1RU9L 3B9KA 4XPFH 5FA4A 3QEQE 4X80L 2NW2A 3E2HB 2CKBB 4DVBA 4BK4A 2C7UA 5E2VL 3JZ7A 3CLEH 4JN2A 1MI5D 2ID5A 4KTEH 4RAHA 4GKZB 4P99A 4OD1L 2CR3A 4P59H 5D2LA 2D0HA 3O2WH 4XGZB 3K8KA 1MHCA 4HT1H 3QXWA 3P77B 4Y4FA 2YD8A 3O6MH 2FBJL 1OAYL 4KZEH 2AJYH 3FQUA 1S5IH 3M07A 1XIWC 1MCDA 3CUPB 2IPUG 1RUPL 3FRUA 5IMOA 1P53A 2F74B 1MAMH 3D9AL 5EO9A 3IVKB 4P2RD 1K4CB 3CGTA 1XGYH 3BP6A 4TSAL 3B5HA 3MRCA 1FH5L 3DYOA 3P73B 3PABB 1FIGL 3BHBA 5EIIA 5FO8B 2PTTB 1K3ZA 2IPTL 4JAMA 4WENB 1RIHH 4LOUD 1KSRA 5LGJA 4LCWB 3ROOA 2FLBT 4BELD 1BLNA 1DBKL 2ZKHH 3WUWG 4JFOA 3ULVH 2RFXA 3LEXA 1FNSH 4GRWE 1U3HB 5C9JA 2XZQH 1OARH 2ZCHL 4Y2DC 1DUZA 1AGBB 1J1OH 1VGKA 3W5NA 3CFKA 1HH9B 1BVZA 2GJ6A 4XCFL 5T1DL 5IIEB 3KPMA 4CMHC 2B8OT 1F90L 1HQRA 2A1WH 5C0CD 4MJ6B 3E6HA 3VFVB 3TNMA 2GSGB 2VDLL 4NKIL 3QQNA 2OI9C 5I2IB 1P4BL 3G6AA 4R4FL 1I7TB 4HIIA 4MNGE 5DC4B 4LLUB 3CVHA 7FABH 1OW0A 3HFML 3PDOA 4NZDA 3OHXA 1UC6A 1FG9C 3QRGH 5B4MD 4K3EL 1ZTXH 5E9DB 5ANMB 4Z7NF 5C09D 5I0ZA 2Z4QB 3HPJB 5DD5H 5A2JH 3MGAA 1I7UA 3NZ8A 4O5LH 5T1LA 1SYVB 2CIIB 4O2CB 3MGTA 1I8IA 1BQLL 1QKZL 1IM9D 5SWZB 4X9BA 5A2LH 1NBYA 3B83A 2YK1L 1QFUL 3VD3A 3EDFA 5JDSA 4LCUA 4PJHB 3OPZH 5E94B 4JZNA 3IKKA 4F7TA 1MWAH 2XN9D 3AB0B 4PR5A 1A7PH 3CXDL 5K9OA 5T1KB 4O2FA 4Y2OA 4WWKB 3AAZA 4JG1H 3TBYA 3AS0A 3LMJH 4ODWB 4ZXBB 1IGYA 4YPGA 5CJ5A 3ALWA 5I15L 3QH3A 4LHJB 3WFEH 1CDHA 1M05B 3KLHD 1DEDA 3JWOC 1RURH 3E2HC 3B9KB 4JPVL 1V3LA 5FA4B 3T4YA 3MX0A 4G7YL 1KEMH 2NW2B 4TOYH 2IFFH 3NGBC 4NYLA 1KJ2L 4DVBB 2VKXA 4LKCA 4JFDA 3UO1L 4MVBD 4S11A 2C7UB 4W68A 5KTEL 3CK0H 4DKAA 3K4AA 2R2HB 2OP4H 5GJTH 3KHOA 3O45B 4KK6D 4LSSL 5D2LB 2X70A 1TJHH 1DN2A 1MHCB 4CBPA 4Y4FB 1QFPA 4QNPF 3E1F1 1CLOH 3WNOA 1OL0A 3FQUB 4PJFE 2VXSH 2BERA 5E2UL 3BKML 5FKPA 4TVPL 1VACA 2AJZA 2VLLB 2E7LA 3FO0H 3FRUB 2VRAA 5IMOB 4F15B 2DQJH 4GBXA 1EHNA 2CO7B 4KK8C 3EYVA 5EO9B 3NFNA 3BP6B 1H5BC 3MRCB 3BHBB 1R24A 1MIEH 3JV6B 5EIIB 4JAMB 3V79C 4MDIB 4BFEA 1ORSA 2CR6A 2X41A 5LGJB 1MJ8L 2ESVA 2Z31A 1GC1L 5F7MC 1MF2H 2E3VA 3ROOB 3C5SA 1A6UH 1BLNB 2JJSC 3OXSA 1U3HC 4JFOB 2RFXB 3LEXB 5DQJB 4RWYL 5E99L 2A73A 2GCYA 2QADD 3CVHL 2JJTC 3VRIA 5IB1A 1DUZB 3R4DA 3I9GH 3B2VL 1VGKB 3N1QC 1A8JH 3CFKB 5D8JL 4KTDL 5IFHL 1UA6L 2J4WL 3KPMB 1HQRB 5EH1A 3E6HB 4AL8L 2FLRT 2DQIH 3LAFA 4POZC 5AG9A 2G75A 2R2CA 3TNMB 4TPRH 3VXUA 1F6LL 3ZKMC 4S0SD 3G6AB 1L6XA 3S88L 2O26U 3D39D 5FDWA 4HIIB 2JTDA 3CVHB 4WHYH 3PDOB 4HAFA 5A43C 5BRZD 1FDLL 2HH0L 4OQTH 4MD5A 1HHHA 3GHEL 3OHXB 4FG6D 1VEMA 4FFZL 1JBJA 1N5YL 1A4JA 3OAUH 4JFFE 1S8DA 2AXFA 5ECJE 2E7MA 4BFBD 1GZQA 4KUZH 3TH4T 4WHCA 5I1HH 3OKMA 5DEGA 4G6KL 1I7UB 1RPQA 3HNVL 1P7QA 1RJCA 5T1LB 2MHAA 1QSEE 3MGTB 1BQSA 4EN3A 1I8IB 5D9SA 3GB7A 3WSQL 1IC5L 4NN5B 4M1GH 3H3PL 2FX8L 5J0BA 4NZRH 1NBYB 1QOKA 2R9HD 1J05A 2RCSH 5JDSB 4LCUB 3QDAA 4M3KB 1ZGLP 3AB0C 2JE8A 1H0DA 3D2UD 4F7TB 4I0KA 4UILL 4WWKC 3P30L 2EKSA 2BJMH 4O2FB 1OD7A 1CXIA 4ZXBC 3AAZB 1LILA 4NSKA 3TBYB 2R0KH 2YPLE 4WTZG 1IGYB 4YPGB 4KZDL 3CNKA 4XAKE 3AS1A 2Y72A 1NCCL 1ZVYA 2WWKT 3UJIH 1NGPL 1CGXA 2APVA 4JHWL 3QH3B 2P5ED 3B9KC 4CNIA 5M94B 3OF6D 1FBIL 4N5UA 2HTLC 4X4YA 3DUUA 1QYGH 4XP4L 3PQYE 3T4YB 4WDIA 3PJSA 3O2DH 4LHUG 1RZJC 1YEDA 1NCTA 3QDMD 1FPTL 4HS3A 4NYLB 5IVXE 4JFDB 1GSMA 1I9IL 4J6RH 5T33L 1ZK9A 4Y4FC 2F8OA 3ZSSA 2Y5TA 1RIUH 2X70B 1DLFL 3NFSL 5SWQA 3VXQA 2B1HL 2XQBL 1NGXA 1BX2A 2WM0A 5F7LB 3TN0A 4H88H 1U2HA 4XWGH 2R4SH 4F15C 3RDTD 1VACB 2AJZB 2D7PA 4RGMB 4OUUA 3HMWL 4PRHD 1JF5A 4GBXB 2NYYD 2GHWB 5C0NC 1FZMA 3EYVB 3HG1E 4OCWH 1NGZA 3NFNB 3WNPA 1T83A 4ENED 3HNTH 1ZEAH 4C83B 1A3RL 3VD9A 2OJEA 3GI9H 1R24B 2VDQH 3QI9D 4WW2F 1LP9E 4Y19A 5DJZA 4NJ9H 1Q72L 1ORSB 3S36X 4DVRH 1V7NL 3C2AL 4LNRA 1T4KA 2ESVB 2Z31B 3LQZB 2NX5D 3C5SB 5IEKA 3NIDF 4GFTB 3X3FL 3OXSB 2Y4SA 4K7FA 1KCUH 4BSWA 2R0ZL 2F53E 2A73B 2GCYB 3VRIB 4LFHG 5IB1B 2OL3A 3BE1L 1KBGH 2D2OA 4HIEA 1NAMA 1CLYL 4QLRA 1OQXA 3RKDC 3W9EA 1JI2A 4FZEL 5I8EA 2XRAH 4I3GA 3F7RA 5JDJA 4D9LH 3GEWB 1U8OA 3GNML 3IFOA 2F54E 4KJYA 1G0XA 3VXUB 1OW0C 3ZL4H 1ZVHA 1S7RA 3IDIA 2XQYK 2DIJA 1LDPH 3I6KA 1B0WA 4HX1A 5BV7H 2AKRA 1JMXA 4MD5B 1PEZA 1HHHB 1KJVA 2R56L 1A4JB 3GBNH 4YBHA 1RZKL 1S8DB 2LAAA 3CCHA 2AXFB 4J4PD 1NCBH 1GZQB 4WUKL 3OKMB 1IC1A 5DEGB 4Y4KA 3Q3GA 1P7QB 1TETH 4F37F 4TNWK 2MHAB 1FE8L 1JRHH 3DIFA 4NN5C 1FYHB 5KVMC 1F11A 4APQD 1YJDC 4LSQH 4EN3B 5D9SB 3GB7B 3S4SG 5CZXD 4MA3A 1J8KA 5HYEA 4D9RD 4NNXA 4QGYA 5KVEL 1GOFA 1BMGA 3O6LL 1H0DB 1KIRA 4JRXA 2O5YH 2PR4H 1N7ML 4HEME 4Y5VA 2EKSB 1JTOA 4JPKL 4U1MA 4NSKB 4HUXA 4QY8A 1KELL 2A0LD 2PETA 3V52H 3MZGB 3GMRA 4G43A 2BY0A 1PAMA 2BVEA 4CNIB 3NZHL 4OGAC 4TSBH 1YDPB 3DUUB 4XCEA 3QHZH 1WJ3A 4WDIB 1J88A 5KOVC 3PJSB 5CLTA 3T0XA 3U9PH 1YEDB 1RHHA 3RJDA 4ONGH 5KAQG 3BN9C 2BXYA 4G9FA 4N90D 3I85A 3IGAA 4P2OA 3T2NH 4HWUA 2YD9A 2Y5TB 1QRNE 4HJGB 5SWQB 3F6IA 3VXQB 1GPOH 1BFVH 3QJHA 1RUKH 1NGXB 1BX2B 4PJ5A 3LPWA 1JGUL 4Q6IA 4RGMC 2E7LC 3MRMA 3DV4A 1X5GA 3DYMA 3QUMA 4GBXC 1X7QA 4N9OB 1RSFA 3TNNB 3RPIA 4PLNC 4OUUB 4R26H 3MFFA 5CILL 1WISA 4OQ1A 4RGNB 5DURB 1FZMB 2DRUA 4WW1A 1GL4B 1NGZB 1BECA 1NLBL 2IFGA 1T2QH 1OLLA 5FYKD 5C0FA 2OJEB 2G60H 3MV8E 4Y19B 5C0AE 2Z31C 5JW5B 1UCBL 3GK8H 4LNRB 4O02L 1T4KB 2VZ3A 5DQ9A 5IEKB 3CU1A 3K74B 3S37X 3EW3B 4K7FB 1D9KD 4BSWB 1SMOA 3H9ZA 2UWEE 1KULA 3WO4C 2GQHA 3MRLA 3P11H 2OL3B 5ESAA 4F3FA 4HLJA 4HIEB 1NAMB 1IGFH 2E9BA 2J5LB 4ALAH 3G6DH 2D0FA 1Z0NA 3W9EB 1PD6A 5I8EB 4X6FA 5IBUG 1CDGA 1U8OB 3IFOB 1CXKA 3HPLB 1A7QL 3QA3A 5T3ZD 1U2CA 1OP3K 1S7RB 1GIGH 5DMJB 2EH7H 3UTSA 2FATH 2EDDA 5JR1H 1XCQA 6FABH 1KENL 1A7OH 4XP5L 3I6KB 4FQIH 1MFCH 3OKNB 4HX1B 2AKRB 2N56A 1KJVB 2WQ8A 3HMXA 3T0WA 2A6DA 2HFGH 3NCJH 1XF3A 4NJAL 4XBEL 2R0WL 1KGCE 3V5KA 1HCFX 1QACA 3R0MA 3HR6A 1NC2A 3GI8L 3EFDH 3OZ9H 4UOW0 3Q3GB 4Y4KB 2DD8L 3SJVD 4EI5D 4EN3C 1JZ5A 3CSGA 1EEZA 4RMTA 4DKEH 3DIFB 1BEYH 5CD3A 4XC3L 1F11B 4NP4L 1U8NA 4LPUA 2W1NA 4KDWA 4X6DF 4MA3B 3DVGA 3MLWH 3PXJA 2Q3ZA 4NNXB 5DD0H 5EU7C 3B8YA 1U3YA 4G80A 2MKLC 5DJ2A 1Z3GL 4LSTH 2BVUA 3EO9L 4PB9L 1NFDA 4L8CA 3P9WB 3FB8A 3R8BB 1KIRB 4JRXB 5F44A 3DOSA 4Y5VB 2ENYA 3D87B 4LSUL 3NTCH 3MJ9L 4OF5A 3A67H 3BD3A 1DL7H 1S9YA 4LPWA 4U1MB 2AEQL 1YYLH 2HJKA 3O3BA 4S1SL 4ZDHB 4HUXB 4QY8B 3GJFK 4NFCA 3AM8C 3GMRB 4ZAKA 1W0YT 4G43B 4LHUD 4U6VH 3QEQA 4XCEB 3QUML 4QHLA 2VB5A 1BWWA 1M7XA 4YUEL 3RVUD 1RHHB 1FLTX 2F5BH 1RFDH 1O7SA 4JLRA 4M6NL 1F8TH 5JZ7D 4XNZB 5KVGH 4OV6F 4G9FB 2I25N 4OZGF 1S7XA 4P2OB 3IGAB 2CLVA 1LO3H 5H37G 2XI9A 4KKNA 3TN0C 4L29A 3BT2H 3QJHB 2G2RA 5K33A 4PJ5B 1ZLVH 1IJ9A 4UV4L 2D4DA 4XWOC 4Q6IB 1U6AL 3MRMB 1A6ZA 3C5ZD 3DV4B 3QUMB 1S7SA 2G9HA 1I85A 1X7QB 4Q9RH 4FQLH 1VFBA 4RGNC 3MFFB 5MHSE 1T83C 1CS6A 1U42A 4ZUVA 3TCLA 2VSCA 4WW1B 4ETYA 3WKNA 1KCRH 3HE7D 4TVSa 3MNZA 1R3JA 2DKSA 5F3HA 1FC2D 3S36H 5C0FB 3BEWA 1NFIA 5M7QA 2GSIA 1X5JA 1NBVH 1U8JA 4JHBA 4UQ2A 1QHOA 4XMLL 1HINL 4R3SA 4MJ2A 4FN0A 4X6EA 5DQ9B 4HZLA 4MA8H 4LFHD 4P23A 1NAKL 4JHAH 1LVEA 5TF1H 4ODSL 3FJTA 2DI8A 3GSNA 3RIFF 1FGNH 3ARPA 4O2EA 3U4BL 5CAYB 3L5XH 3MRLB 3PL6D 2J5LC 3ARSA 2H32A 3SKMA 5ESAB 4F3FB 3ULUL 3T3PE 5FUZL 1YZZA 2CGRL 3OR7B 2O93L 4HWBA 3HZKA 2VXUH 3MXWL 4LSVH 5CUSH 4G8IB 2Y36H 4X6FB 5FYLD 3MLVL 1EHLL 1I1AD 3WDIA 2HWZL 3TWCL 4X7DC 4L5FL 4PY8I 2X89D 3QA3B 2DIAA 4MNGA 4D0BA 1IT9L 4JFZL 2K9UA 3UTSB 4JQIH 1CIDA 1IC7L 4MAUL 2DN7A 3IETA 3T3MF 1U9KA 1XCQB 4OAWA 4PTTB 4XP9H 3RVWD 3EJYC 1OLZA 4YDKL 2BMKA 2A6DB 4WVRA 1XMWA 1Q0XL 4JFPA 4Y4KC 3OG6B 5CHNA 1F6FB 5ADPH 1OSPH 3MJ7A 1NC2B 2DF3A 1U91A 3CVIL 4YGVA 4Y5YA 1EEZB 1A22B 2BNRD 2BHYA 3HB3C 5CD3B 5HYIA 4LVOB 1BM3L 1AQKL 4XCCH 3DVGB 4RSVA 2FWOA 3LS5L 4G80B 5D6CA 5DJ2B 4ESKA 1RK1A 1BFTA 2AERT 4OD3H 2P46B 4JCMA 1OT1A 3G5ZA 3TO4D 1NFDB 4L8CB 1IKFL 1CF8L 4NKQB 4CADA 2YSSA 4Y5VC 5B3JF 5CGMA 4RBPH 2XV6B 1T7YA 3CDFA 5IFJB 4J3SA 3TLRA 4X7TA 4U6YA 1KLUB 4Z0BH 2KZWA 2AEWA 3BZFA 1B3JA 1S9YB 3OB8A 3F5WA 4GSDL 2HJKB 4HHAA 3O3BB 1XAUA 4FFYH 4M4RA 3LPFA 4ZAKB 3GGWA 2YXFA 3Q6FB 3KG5A 3SGDH 3HAEH 1NMCB 5D7SH 1J1PL 1FGVH 1QBLL 3FKUS 2A9NL 3NABH 5E1HB 3QEQB 4HIXH 3QHTC 4N8VG 1I9JH 2RBLA 1KEGL 3EOAA 4HBQA 4QHLB 5EUOB 3FB7A 5HD8D 4IRJD 4XNZC 3MRPB 1PJ9A 2WUCL 4P2OC 4S1DC 4JLRB 4FP8L 5DQDH 5FYJD 1S7XB 1CDCA 4GAGL 2CLVB 3D18A 3RQ3A 3INUH 4Q6IC 2AS5M 3HA0A 4L29B 4OZFH 4OCRH 3DYPA 3C6LB 3C09B 2G2RB 4PJFA 5KZCB 4QEGA 3B5GA 4UT7H 4P48A 1A6ZB 4WEMB 3CFBA 2G9HB 5F1SA 4GXVL 5JMRA 1VFBB 3GSNL 4H25B 4Q97A 3QEGL 3PDGA 4ZUVB 2BRQA 3TCLB 1AXIB 3VXRE 1DANU 4JM2D 3RUGE 1R3JB 4LU5L 3BVNA 5KOMC 3MLYL 1OB1A 5DSCA 2DS4A 4HWBL 3KGRA 3BEWB 2NPLX 3E3QC 2GSIB 4UQ2B 1U8JB 5KSVB 1NCUA 4R3SB 3S37H 4M6AA 4X6EB 3WLWC 4HZLB 4P23B 2MKWA 3U0WH 5AYQA 5HVWA 3GSNB 2NY6D 3BOVA 4GRWB 3GSUA 5L2JA 4O2EB 1FO0L 4DN4L 5C08E 1ES0A 1H8NA 2LQRA 1RMFH 1F4AA 3SDXF 2H32B 3SKMB 5I1CL 1OGAD 3V6ZB 3CDCA 1QVOA 4I2XE 1FYTD 4BA8A 4MCYA 4OFDA 1WFNA 3IFLL 3WNMA 3JTSA 1CDUA 1NMBH 1A6TA 1UXWB 3SE3C 1KJMB 4J3WA 2BSSA 2P4AB 4GKOA 2ADIA 1MI5B 3V6FA 4MNGB 4D0BB 5GPRA 1L9NA 4HMEA 3IETB 2FD6L 4OAWB 1WT5A 3DRQB 4C57C 2R2EA 4JFFA 2P42B 1FV1A 2BMKB 4HK3J 3T0AA 3CZJA 4JO1L 4MNHA 2HVKB 2NZ9D 3ZTJG 2ZUYA 4JFPB 2KBGA 5CHNB 4HCRH 3MJ7B 1QTYT 4HK0A 4PJAF 4LVOC 4LLMA 1U91B 1QSEA 3VG0L 2AGJH 4YGVB 3STBA 4Y5YB 5MP6L 4LASL 1AY1L 3BISA 3QB7C 5BZWA 2ARWA 4LSPH 1MCOL 2P8MA 1HEZA 4O9HH 5I1IH 2Z8RA 1AFVH 1R5WA 3WBDA 4UTAH 2FWOB 3EBAA 3DURA 3MROA 4H0HB 5D6CB 3VFGL 2IANE 1RK1B 5DJ6A 1UWEL 1BGXL 3G5ZB 4JO3H 1NGQH 2R29H 4K8RC 4CADB 2YSSB 5HYJD 5DUBB 5J57B 1FC1A 4X7TB 4U6YB 2X4NA 4RWHA 4C55A 5C6PB 3BZFB 2VTFA 3IU4H 5LVEA 5EA0L 1MNUH 3F5WB 1E28A 5C0CB 2YPLA 4ZAKC 4HHAB 2C26A 1P5UA 1NMCC 2LVCA 2R0LL 4I9WD 1CFQA 3GGWB 4PJIF 4JN1L 4X7SL 5CSGA 5FGCE 3SDCD 3PQYA 5F3BA 2W0LA 4Q0XH 3QQ9D 3IXAB 3EOAB 3QFJE 4DGIL 3D69A 3FB7B 3ELAT 4ONFH 5IBTH 3UTPE 4WY7L 4NQUA 4KFZC 5JLZA 3V7AG 2C1OA 3X3GH 3RY6A 1UACH 3W81A 3C09C 5C09B 3D18B 2V17H 43C9A 3EO1A 1HK6A 3U7AA 4RFOL 4PJFB 3GJFA 5CEZD 3BXNA 1I85C 2XZZA 1I3GL 4Q9QL 2RGSA 5DMIL 3CFBB 5CJQL 1C08B 1N6QH 3BRGC 3H0TA 2OZ4L 4QRPE 3HG1A 5BJTA 5CS7A 4GKNA 3B2UC 1D5BA 3HLAA 4V1DD 5I1JL 1BIIA 3BVNB 1M7DA 4BM7A 1LP9A 1OB1B 5DSCB 5FFLA 2A6IA 4JANA 4B53A 4P23C 2XXMB 2A9MH 4TRPH 3T1WA 4QKXB 1FNAA 5F89A 4OM1L 2YMXL 1C7TA 5GISL 3BZEA 2VLRE 2F53A 4L4VE 3GSUB 5L2JB 5GQBA 3IKCA 2VXTL 1ES0B 4IMKA 5B3NA 3T04D 3MBXL 4UBDC 3MA9H 1QVOB 4YZFE 3MRBA 4MCYB 5IV2A 2VN7A 5E8OA 4G7VH 3K1KC 4B7IA 3HHRB 1FSKB 3EJZC 5EBWA 2VDPH 3QCTH 3O2VH 1EBPA 2F54A 3D25A 4JY4A 2QSTA 5KVFL 1V7MH 3I3BA 2BSSB 35C8L 3V6FB 2ADIB 2X1QA 5CFHA 2NXYB 1G7PA 4NT6B 2FB4L 3BWUC 1JYNA 3OL2A 2W9EL 4G5ZH 1WBXA 1AH1A 2J7LA 5JW4R 2CMRL 3NOIA 3AGVA 5KJRL 3V4PH 3ARBD 4ERSH 4WUUE 4FQJL 4PLKD 1NGYA 2R2EB 2VZVA 4JFFB 1FV1B 4ZSOE 3DX7A 2XTJD 4MNHB 3KPSE 5H35B 1R3LA 1RUQL 3VWJD 1SHMA 5GS0D 3KPLA 3NVQA 4Y5YC 2BP3A 4HK0B 5DYOA 1QSEB 1A02N 2KUTA 5BZWB 4LEXL 1WSST 1G7HA 1Z9OA 3QT2A 2P8MB 2OK0L 1HEZB 2ZPKL 4ZNCD 1R5WB 3DURB 2P8LA 5DJ6B 4KI5E 4DQOH 4LSRL 5IEHB 4KROB 5IVXF 1MQ8A 1T2XA 1CR9L 3MRRA 3EHBD 2X4NB 3CFEA 5C71A 4PP1D 1BD2E 3U7YL 5HHOE 1E28B 4J1UA 2YPLB 4P5TD 2OTUA 2X4QA 1GGIL 5DMGD 3LS4L 3NBNA 1CFQB 2GTWA 5E00A 1RJLA 4ODVL 1DFBL 3T0EE 4RQQA 1T7XA 2BSTA 3PQYB 5F3BB 1OM3L 3VFOA 4R8WH 4M5ZL 4OGXH 1UJ3A 4FTVE 3UBXI 1PY4A 3QUZD 2K1MA 2DTML 4IRZL 4CL7A 5JXEA 5JLZB 1A14H 1XEDA 1ZV5A 1I4FA 1DBJL 2VDNH 3S96A 2C1OB 4HUMB 3IFNH 3P9MA 1QRNA 3L3KB 3CX5J 43C9B 1LP9F 3EO1B 3L3OA 1K2DA 4NNYA 3TO2A 3GJFB 2ERJB 3BXNB 4ORGB 4UOW1 5IQ9A 4M93C 3VXSE 1LWRA 4WCYL 3JV0A 5I8KL 4D0DB 3S5LG 1QPXA 2I9TA 1YEJH 1CLZL 3O3EA 3RWIA 3H0TB 3JWDL 3HG1B 5BJTB 4GKNB 1X5XA 3HLAB 1BIIB 2EDJA 4OLWH 3OAZH 3MV8A 1LP9B 2YKLL 5C0AA 3RBGA 1YC7A 2YA1A 4JANB 4FOMA 2Q8AH 3SGEH 5DLML 3RZWA 1I3VA 4NBYB 2NY4B 5F89B 2AK4D 4FZ8H 1NCWL 4MQ7A 3BZEB 1BVKA 3V5HA 2F53B 2UWEA 1I9EA 4KK5D 5J4MA 1RAMA 3IKCB 2OXGA 5CP3H 5CGTA 2P5EB 5GZOC 2OX5A 1FSKC 3LIZH 2LU7A 4DZ8A 3MRBB 3CMOH 5CKGA 4I3RL 5IV2B 5E8OB 3LEYH 5EBWB 1HHIA 2CDFA 5I1LA 1R6VA 5DRZA 4I0PA 1P5VA 2F54B 3V4VL 3D25B 4JY4B 4U1HA 3HUJE 2NXYC 1FP5A 4YXHL 1KYOK 5H94A 1X6NA 2WZPD 3AREA 1I1FB 4KMQA 1G7PB 5HI4D 3L9RA 1J1XH 1WT5C 2BRRL 1GOGA 1MEXL 4XMPH 5IESL 1V8HA 3ARXA 1WBXB 3Q6GL 1N0XL 1NGYB 4XAWL 4MJID 3RDTB 3L6FA 1WEJL 1MUJA 4W70A 1QO3A 4HJ0C 3DX7B 1R3LB 3W9DA 4KJPD 4Z0XA 1LO4L 3SE9L 4PGBA 3RI5K 2Y25A 3KPLB 4AEHL 4Y88A 2R69H 3L95A 2HAZA 3ARFD 5DYOB 1CZ8H 2EDTA 3MTRA 5CIPA 4D9QD 1G7HB 4MB4A 2C3GA 2FJGA 1NANH 4O58H 4XPGH 3FOLA 2JELL 4OCYH 5JUEH 2P8LB 1KCLA 3QG6A 4KROC 2Q7YA 3O3AA 3STLA 3VRLE 4ETQA 1JV5B 4OGYL 4M6OH 4ZUUB 3VW3L 3MRRB 1QBAA 3DPBA 2PNDA 5AZEH 3CFEB 1KXTB 4OLUL 5HHPA 4HGMA 4J1UB 2P8PA 3WMSA 5B21A 3VGBA 2OTUB 2X4QB 5ERWA 3C9NA 2AJSH 2GTWB 3O0RL 2NXZB 4UINH 5E00B 1RJLB 4AEFA 2DWDB 2IAMD 3RVTC 4RQQB 2BSTB 1MCPL 3HI5L 3VFOB 1YY9D 4G6ML 1UJ3B 3FN0H 5ILTH 1SQ2N 3RY6C 2ZCKL 4K9EH 1Z2KA 1G9NL 1YPZE 2P5WD 1I4FB 3S96B 1KN2L 4P2YA 3IAGC 4G8GE 5ADOH 1SBSL 1QRNB 2DYPA 2ERJC 2XA8H 5HYQA 4K23H 1L7IH 3L3OB 1K2DB 1F97A 3TO2B 8FABA 4CRPA 4S0TD 3IU3A 4KKLD 4FQCL 3ARUA 4ZFGH 5IQ9B 1ZT7A 2GFBA 3CDGA 3TP4A 2QJDA 5MEOA 1RU9H 3HC3L 3S35L 2I9TB 3RU8L 3O3EB 1S3KL 3RWIB 3QNYA 1A6WL 2UWEF 4D0CA 5D1QA 1C7SA 1JYWA 1JNNH 2GI7A 1OTTC 4QRTA 1TZGL 4NUJA 3MV8B 5C0AB 1WFOA 5A3IC 4OD1H 3D85D 2NY4C 2V2XA 3BAEH 1EK3A 5F6HJ 5JIPA 2FBJH 3MACL 1XGQA 1CD8A 1ACYH 3H2WA 4MQ7B 1BVKB 2K7PA 5EZLA 4LAJH 3V5HB 3U30B 2UWEB 3IF1A 5FUCE 4IMKC 1RUPH 5A2FA 1YNLL 1YQ2A 3D9AH 4LAQL 1JF6A 5IP4A 1WZ1H 4DZ8B 1HWGB 1FH5H 2OMNA 2QEJA 1FIGH 1HHIB 1UKSA 2CDFB 1P6FA 2IPTH 3BO8A 3V95A 5DRZB 5I1LB 4I0PB 3I2CL 4U1HB 5F7DB 1J86A 4PJXE 4XPBL 5E5UB 5H94B 3AREB 3MV9E 3IDGA 1DBKH 3WIIL 3L9RB 5FYKL 2W9DL 4LGRB 1A7NL 3W2DL 4HH9A 5ITFA 3HR5A 4OV5A 5HVGB 3UTTD 3GIVA 4NQCE 1PX4A 4MA7L 3K1DA 2XZAH 3M1BA 2CPCA 3L6FB 5T1DH 4WHDA 2HT2D 2ZUQB 1VA9A 1QO3B 5ETUA 2X40A 3W9DB 2WAHA 4Z0XB 4PGBB 2EXYC 1NQBA 5HI3D 2OTWA 2LVEA 1LEGA 2VDLH 5I66A 1P4BH 4R4FH 1OCWL 2Z93A 3QWRA 5SX5K 4PS4H 2FJGB 3HFMH 5BS0D 1A1OA 3RWEA 4OIBA 3I3DA 2C4XA 3WFBH 3FOLB 2P44B 3VXNA 2D7MA 3QXAA 3QG6B 3UXFA 4IJ3C 1D9KB 1F3JA 2Q7YB 3O3AB 3STLB 1FG2A 2X4TA 4LVHB 4OSUL 4ETQB 2FHCA 4IS6A 1QSFD 2CUMA 2QL1A 4UB0L 4Z7UE 5ICXA 4JO2L 3ZT5A 4X6CF 3GSWB 5HHPB 2P8PB 2X4OA 2NXZC 3CU7A 5ERWB 3P0YH 4M00A 3U48A 3H7BA 3VGGA 3C9NB 2BSRA 1BQLH 5IMKA 1QKZH 5JORA 2EDNA 1B9ZA 3O6FA 2BY2A 4PRBA 2YK1H 1QFUH 2FYYA 1J0KA 3RVVC 1UJ3C 1PG7L 3KR3L 2VSDA 7CGTA 1CU4L 5JXEC 1JPFA 1H8OA 5I1GL 1CL7L 5FO9A 3WIHL 3EYFB 2EECA 4KWUA 3O8XD 3CXDH 2ATPA 1XGTA 3L3HA 5HYQB 4LBEA 4JR9H 3GRWA 4FS0A 3OTTA 1X9QA 8FABB 2FGZA 3IU3B 3UBXG 5KS9B 1MJUL 3OKDA 1ZT7B 1WAAE 4HDIB 3TJHC 3CDGB 4P49A 5I76A 5MEOB 2YZ8A 4MHHI 4JPVH 5BCAA 1AGFA 1U95A 3MV7E 3QNYB 4G7YH 4D0CB 5D1QB 3FRPA 2HRPL 3VXRA 1KJ2H 3RUGA 3UO1H 4QRTB 1CXEA 3LKRA 3T3PF 4NUJB 5KTEH 1MIML 3KXFE 4LSSH 4EUPH 5F7WC 2V2XB 4DN3L 4Y4HA 1B6DA 4JY5H 3U30C 5E2UH 5IGXL 5BQ7A 3V0WH 5EIQA 4TVPH 2XKUA 5EZLB 1RZ7L 3IF1B 5AYUL 4BH8A 5IBLC 5C08A 4PPTA 1PQZA 4LHUB 3GMMA 4I2XA 5C6TL 2ICES 4HC1L 5ALCL 3N1PC 1JFQH 4I0PC 3NIFF 2J2ZA 1C8PA 3MYJA 3U4EA 3BO8B 2R39A 2Y07L 2NY1B 3AREC 3RKPA 4PRNA 3OB0H 1MJ8H 5DJDA 1W8OA 1GC1H 4CDGC 25C8H 3LRGA 2GK2A 1HHKA 4QHKI 4HH9B 5E99H 1NBZA 1XZ0A 3HR5B 3B5TA 3QO0A 4OV5B 4S1QL 4J8RA 4P4RA 2ZUQC 3GIVB 5E5RB 3FFDA 2IH3A 5GGRY 2NY0D 5IFHH 4R90L 1UA6H 2YWYA 2J4WH 2VLME 4M7KL 5ETUB 2Y6SD 5ICZA 4JFXA 3TBTA 4XI5C 1JWMA 5HBBA 4HXBH 1T03L 2V6HA 2OTWB 3EYQD 3FONA 1LEGB 5I66B 4KY1L 1IAMA 5DHVH 5KSBF 3S88H 2WV3A 4JHZA 2Z93B 1TZIA 2D7TL 5FYLL 4YEEA 5FUOL 4HGKC 5T3XE 1A1OB 3RWEB 1FDLH 5IT2L 2HH0H 2IANA 1SEQL 3VXNB 3GHEH 3QXAB 2F19H 3VWKD 2XZCL 1D5MA 3MXVH 4YK4B 5MEPA 1F3JB 1N5YH 1FG2B 2X4TB 5DR5L 3MRHB 4HWNA 4IS6B 1Z5LA 1BQHG 3P4MA 5D1ZA 5F9JA 2HFEA 1PEWA 4NKMA 3NPZB 4G6KH 1FFOB 4KAQL 3HNVH 1W72H 5ICXB 3QIWA 3AROA 2YR3A 1VSCA 2A77L 2X4OB 3IDXL 2DWEA 4R7DA 3WSQH 1IC5H 1TIUA 2IADA 1TNMA 2BSRB 4Y1AD 4AEIL 2D4FA 3H3PH 2FX8H 5HHXL 1W8NA 5JORB 3O6FB 5CJOH 3QFJA 4PRBB 2FYYB 4KVCL 5GRUH 1JPFB 5LCVL 1RUML 1IZKA 4UILH 1XF4A 2HLFD 3P30H 2ATPB 2XG5A 2YUZA 3F7VA 5FCSH 4QRRD 1XGTB 3L3HB 2D7NA 4KV5E 4LBEB 3C5JA 5MEND 4HJJL 4KZDH 2F8VA 5DJAA 5HPMA 1NCCH 4H1LH 1NGPH 3C8KB 4JHWH 1KFAL 2B1AL 3OKDB 5L7XL 4GG6E 1FBIH 3FFCE 5I76B 4U1GB 2AEIT 4KVNL 5D1QC 3WXWH 4QRPA 4XP4H 5C07D 1AGFB 1U95B 3MRJB 1EUUA 3QULA 1FPTH 3VXRB 4WI4A 1EFXD 3BD4A 3IRZA 3ZYJA 3RUGB 4ZOCA 1I9IH 3A6CL 1N6UA 3LKRB 3LSOA 5T33H 1IEHA 1JE6A 1OTSC 1ZWIA 3BDYL 1I8KA 4Z8FL 2VO5A 3PP3H 1XIWD 3QNXA 3NFSH 3TGXA 2B1HH 3HE6A 2XQBH 2FRGP 1B2WL 5J12B 4M7LT 5GGSA 4Y4HB 2VLRA 5FYJL 3F62A 4L4VA 2AQ2A 5BQ7B 3U0TA 3GO1L 1IGTA 1T0MB 3QUXA 4BH8B 5C08B 3HMWH 4Q9BA 3ULVE 3GMMB 3FT3A 5C8JA 4I2XB 3U9UA 1NMAL 1GGBL 1C5CH 2NY1C 4HIHA 3MYJB 3U4EB 4BZ1L 4JZJA 5FV2A 3C2AH 4PRNB 4X5WA 1Z0MA 5DJDB 4WFFE 4Y2DD 4ZS7L 5L2KD 4XX1G 3DXAE 1JPST 2H8PA 5DA4A 5MERA 1HHKB 4U1SB 4NO0A 4ZMAT 5IROA 1NBZB 1XZ0B 2Q3AA 3QO0B 4RMUA 1KCVL 4WUUA 4J8RB 4P4RB 3QNZB 3ZDYF 1A9BA 4GW4A 1G84A 2WQRA 3BE1H 4HAGA 1HZHL 3FFDB 4ZSOA 2IH3B 2E6QA 3KPSA 1CLYH 3PDDA 5GGTL 5ICZB 1JGLL 4JFXB 4M7LL 3TBTB 1JWMB 2XXCB 4IOFC 3UPRA 3KHQA 3SCMD 4Z7QE 3FONB 3ESUF 4N5EC 4G8FA 1EIBA 1TZIB 2YEZA 1HSAA 3TIEA 1VPOL 4ZUWA 4YK4C 5ISZD 2IANB 1RJZA 3CSYB 1D5MB 2R56H 5MEPB 1AXTH 4FRWA 1RZKH 5GHWH 5CJXA 4CDHA 1Z5LB 4QXTA 1MCSA 4G3YL 3P4MB 5D1ZB 5F9JB 1RY7B 2HFEB 5ESVA 3BJLA 3DV6A 3NN8A 4NKMB 1BD2A 1JPSL 5F96H 5HHOA 1INQA 3S34H 3QIWB 2YOCA 5CBAA 3MLTA 2NY5L 4NUGL 2DWEB 5E8DL 5EC2B 4R7DB 1SJHB 4IMLA 4K7PL 2IADB 3O6FC 4NO2A 4EXPX 5C9KA 4BJLA 3T0EA 4HPOH 3FQNA 4OCNC 5FGCB 1MCFA 1U58A 5IFAL 5KVEH 3HZMA 5HHME 2L4OA 5F7HA 4M02A 2APFA 3QFJB 2XICA 2VISA 4OCLC 4XRCA 4Y16A 2YD4A 3O6LH 4YHNA 4FTVA 5FOBA 1X5YA 1G9EA 4PJCE 4RCAA 5C0RL 1YNKL 1AE6L 1XF4B 1B0RA 4WEUD 4DW2L 1T5XA 5HHQA 3LKQA 3F7VB 4HWZA 5FK9A 2GY7B 3VWJA 2D0GA 3C5JB 3LOWA 3U82B 3L3GA 5HPMB 1BF2A 3VXSA 4U1GC 4HIJA 1XR8A 3NZHH 3GBLA 4RISH 3ZKNC 1PLGL 2YN5A 3I6LD 1CD0A 1JF1B 1LDSA 3T1FA 4QRPB 1QA9A 3GMQA 4NWTL 5AWNH 4YEFA 1GJIA 3QULB 5I8OL 5DUPH 5DWUL 5BZDA 1CQYA 4BSJA 3LSOB 5GRVK 4KXZH 1ZWIB 4M1DL 5J12C 4MHHG 4Y4HC 3QNXB 4HBCL 3NIGF 3O4OB 2DQHL 3HE6B 2VZ1A 5GGSB 5HI5C 1JGUH 1E0OB 2VLRB 4KK8D 1XGUA 4L4VB 3IS1X 1IQDA 4UMGA 3U0TB 4DFHA 1IGTB 3QUXB 4XP6L 4EIGB 4AY0A 5CEZL 3FT3B 1LO2L 4LCWD 4ZQKA 1H3PH 5C8JB 3U9UB 4AK1A 1UQSA 4U6HB 4NQDE 4GUPB 5EZIL 1ETZA 4H8WL 4HIHB 4P2QE 2WBJA 1U3HD 5IK3B 4HV8A 3HUJA 3QUYA 3Q5TA 4AQOA 4JZJB 1AD0A 4X5WB 2B2XH 4O02H 2C9AA 5MERB 2H8PB 3WNKA 1FLRL 3DX6A 4ZNEE 1EZVY 4NO0B 3RP1A 3D3VE 2XA3A 3LN4A 3BFOA 4WUUB 1IFHH 2Q7NA 1A9BB 4GW4B 2VWEE 3BQUA 4POZD 4DZBB 4ZSOB 1MCJA 4RDQF 3KPSB 1GXEA 4UT6L 4KI5F 3ZKMD 1JYXA 3ORJA 4I77L 3V5DA 1X5FA 3UPRB 1PZ5A 1A7QH 5E9DD 3N1MC 4OZHF 4G8FB 2VQ1A 2ICCA 2YEZB 5FIEA 1HSAB 4JFEE 1NLDL 3TIEB 1V05A 2VITA 4NDMA 5AUMA 1RJZB 3BSZH 2CLRA 3KPRE 3VFMA 5EORL 3VI4F 2O61A 5ABDE 3OG4B 5B38A 5D1ZC 4NJAH 4XBEH 2R0WH 5TE7L 3MBEA 1MRCH 1N8ZA 4QXTB 2EEAA 3THMH 3QIWC 5ESVB 5C2BH 3DV6B 3NN8B 3O9WA 5SWZD 1BD2B 2VL5A 5HHOB 2HKHL 4KDVA 1INQB 3FT4B 1T80A 4XC3H 5CBAB 3MLTB 4NP4H 4EDXA 5GS0L 4IMLB 4JM4H 4NO2B 3T0EB 4HG4K 5GSRB 3FQNB 1S7VA 5T1KD 3L3JA 1U58B 4ELMF 3HZMB 1Z3GH 4WWKD 5C7XL 2VISB 3EO9H 1J5OL 4PB9H 4MQSB 4JVUA 4Y16B 4ZXBD 3C6SA 4YHNB 4FTVB 5FOBB 1T22A 4G42A 4ZD3L 3SKJL 1YPZA 4P9ML 1B0RB 5HHQB 1T5XB 4G8GA 4CVWA 2NZ9C 3LKQB 3MJ9H 3OKLA 4OTXH 3B9KD 1BOYA 4HWZB 2AEQH 5FK9B 4MXQC 4S1SH 3VWJB 2HTLD 3L3GB 1N64L 3VXSB 3WDHA 2H2SC 2O5ZL 4HIJB 1XR8B 4QO1A 4WFHD 1QSVA 3OGCA 3U0PA 3T1FB 2VERN 1QA9B 3GMQB 2UUDK 4Y4FD 4YUEH 3SKNA 3QQ3A 5INCA 5TE4L 4M6NH 5BZDB 1A6AA 1A7BA 3O4OC 3HE6C 3P3YA 3AS2A 2VC2L 2X1PA 3VFNA 3RL2A 4UV4H 1OWRM 3QUXC 1EEYB 5C0ND 1U6AH 4Z7NE 4N8PA 2HJLA 1IQDB 2ED9A 4OLVL 5DD3H 1GRWA 2NNAA 1GZPA 1F00I 4CMMA 1UYWL 4ZQKB 4YX2L 2Y06L 1CE6A 2A2QT 3GIZL 2HKFL 1ETZB 4JZJC 4OB5L 1Q38A 2UVFA 2WBJB 2WIIB 3HUJB 3QUYB 1AD0B 4PJXA 4XMLH 1HINH 1DQLH 5C0DA 3MV9A 3IDJA 4LL9A 2GJ6D 1NAKH 3P4OA 5IROC 4ODSH 1YEIL 3DX6B 3U4BH 2BNQE 4CUCA 1WV7T 3LN4B 3RKDD 5F9OL 4NQCA 4BKLA 5L88L 1S7QA 2XT1B 3BQUB 2PYFA 3MUGA 2NMSA 3C60A 5HHNA 4BQ6A 3ULUH 2CGRH 4WU5A 5GRJH 5FO7A 4L8DA 3TYGL 1UEMA 3MXWH 1FRGH 4OLYH 2BVOA 1FAIL 5E7FA 1RD6A 1EHLH 5FHBH 1TNNA 1SMAA 4LPYA 4HXAH 4XVJL 4DKFL 1DE4A 3TWCH 1PZ5B 1CFSA 3NH7L 4L5FH 3QPXL 5FB8A 1UJTA 1INEL 4O4YL 1IT9H 4JFZH 3SQOL 2VQ1B 3TVMA 5BVJA 1IC7H 4KI5C 1D6VL 2VITB 4NDMB 1V3MA 5T1LD 3ZE0E 4YDKH 5CJXC 3VFMB 2O61B 5B38B 1DQML 1QEWA 1Q0XH 2W65A 3QJFA 1CTOA 4JFHD 4QNPE 3MBEB 1N8ZB 3X14A 2ZCLH 4BFIA 1TCRA 4YDIL 1FL5A 4Z7UA 3O9WB 4XBGA 3WN5B 3MOBL 2VZUA 2VL5B 3W39A 3CVIH 5K9QI 3MCLL 3T0EC 1BM3H 4EDXB 1AQKH 1DEEA 1C5BL 3FTGA 3EYSL 5E6ZA 1A1MA 1S7VB 3LS5H 2MJWA 4Y16C 5DJXA 4YWGH 1BP3B 1G7QA 3LV3A 4NRYA 4I48A 3ZYIA 5HDBE 1IKFH 1CF8H 3C6SB 2DJSA 4BH7A 1T22B 2YD3A 4G42B 4N8CL 2ORBL 4QGTA 1YPZB 4K55A 4G8GB 1GGTA 3VWJC 3GHBL 3W5MA 2BY3A 3OKLB 2J88L 8CGTA 1EGJL 4OGAD 5D7IE 4GSDH 4MXVE 4OFPA 4P9HL 5KG9A 1S9KC 1UB6A 4JFDD 1WAAA 2EDBA 1IBGL 1XF1A 3B9AA 4YGAB 1S9XA 1J1PH 2E9IA 1H15A 2A9NH 3WS6A 3BN9D 5E24E 3MV7A 3OGCB 3U0PB 4K3GA 4CAGA 1KEGH 1BZ9A 3BKCL 4JKKA 4UOJA 3SKNB 3QQ3B 1HOCA 3VMOA 4MXWH 2WUCH 5INCB 1F4HA 5B39B 2IQ9L 2VUOA 1LO0L 2EEBA 4FP8H 3EYUH 3KXFA 1A6AB 5EOQH 2EICA 4GAGH 2DQTL 4R96B 3WFZA 4NZTL 5KANI 4GBXD 4PIRF 4XT1C 1BBDL 3VFNB 3RL2B 2AI0L 5A40E 1E6JL 1GAFL 1UWGL 4PJXF 1QQDA 1LEKA 1G6RA 2HJLB 1SY6L 4GXUN 5DZNA 5IMLA 4GXVH 2NNAB 5HDQH 2I24N 5F6IC 4C58B 4CMMB 3QEGH 2ESVD 2Z31D 4OLZL 3FQWB 4ZUSA 1CE6B 2WBJC 4LU5H 3QUYC 5MEQA 1CTNA 4PGEA 1P2CA 4M48L 4YHIA 4FQXA 2V5MA 2YS4A 3CAFA 3BYYA 1WTGT 1L0QA 5D7KD 5CLWA 5C0DB 3IDJB 3QCUH 1KIPA 3LEVL 3P4OB 3PGDA 2V5RA 5JIHA 4AMKH 1UZ6F 3QDJE 4ZYKA 4M3JA 3BQUC 1FO0H 2E7HA 3GSVA 1D5XA 4NQCB 4BKLB 1S7QB 3BPNC 4OZIE 3VXUD 2PYFB 3MUGB 5I1CH 1JUFA 3C60B 3VA2C 3FL7A 2P47B 4WU5B 5FO7B 4L8DB 3JBG7 5TFSH 3WL9A 1DQQA 2L7UA 3P4NA 2BVOB 5D70H 3IFLH 5EO1A 3UJJL 3QIBA 3K46A 1TTFA 3O4LE 5SWSE 1DE4B 1ADQL 5GGVY 4LARH 1GHFL 5E8NA 1CFSB 3BESR 2I27N 5I18L 5FB8B 4JRWA 1A3LL 2X1OA 5BVJB 3RIAF 3VD7A 1BJMA 1AR1C 2FD6H 2VDMH 5I71B 1KCSL 2KZ1B 2HTKC 1BREA 2ICWJ 3QHFL 4PJ8A 2MTPA 1P7QD 3L1OL 1J0IA 1HYSC 3MBEC 5EN2A 1GGCL 1A4KA 4HZAA 4PBWD 4EN3D 3LQAL 4JDTL 1QEWB 4JO1H 2W65B 3QJFB 3EO0A 3O9WC 1CD1B 4TTDC 4WI5A 1DBAH 2DL2A 4BFIB 1TCRB 4MNQE 1FL5B 4Z7UB 4M5YL 4XBGB 5K59F 1K85A 4ZG1A 1FNLA 3W39B 2YD2A 4U0QB 5MP6H 4LASH 1CGVA 1KB5L 4H5SB 5FM4A 1YMME 1DEEB 3FTGB 1H3XA 1A1MB 4LMQE 5JW4M 4Y89A 2AJXL 3VFGH 5DJXB 2UZXB 1B88A 1G7QB 3LV3B 1UWEH 1BGXH 1MY7A 4I48B 4NRYB 4DAGL 5J13B 5BO1L 2FJHA 2FCBA 5DO2C 3NIDE 1KN4L 5HGHA 1MLBA 3UTQA 2DMBA 3FQRA 5J89A 4HD9A 5EA0H 4JRYE 4KGJA 5FM5O 3I50H 5KG9B 3LKSA 1UB6B 3WCYA 4IDJL 4JKWA 2NY2B 3V0VA 5IVZA 4GG6A 3FFCA 2VR9A 2EZ0C 4JN1H 1S9XB 4X7SH 1UXSA 2R1XA 1H15B 3MR9A 3MV7B 3VH8A 4DGIH 1BZ9B 1JHKL 4WY7H 4TN9A 1HOCB 3TN0D 1UVQB 1VGEL 4P9HC 3BP4A 4QWWC 1EVUA 1RV6X 2E6PA 3HCVA 4RRPA 4XWOD 3KXFB 1FHGA 5IB4A 4IIQA 5GRVL 5KVDL 1HWHB 2YBRA 3MLZL 1REIA 4RGND 4RFOH 5DURD 5FUCC 3BGMB 1I3GH 5F1NA 5IMMA 1QQDB 4Q9QH 1LEKB 1G6RB 5FGSA 5DMIH 5CJQH 5IMLB 3RGVA 2Z8SA 2OZ4H 3S35X 4FQHA 1WFTA 4XXCA 1EAPA 4ZUSB 1MREL 4LPVA 5MEQB 2W91A 4PGEB 1MCRA 4YHIB 2LU3A 4FQXB 3KPOA 3EOBA 4GRLA 3WFHA 2CD0A 3D6GA 3DXAA 4QT5A 3MOQA 2X4PA 5GISH 1RVFH 3G9VA 3N9GH 4ZYKB 4U1IA 3I6GA 3QG7H 3C60C 3GSVB 4E42A 1D5XB 3MBXH 4JDZA 3SBWA 3MJGX 1JUFB 4ZODA 4GMTH 5E5MA 4KRPB 3WL9B 2EIZA 3PNWB 3P4NB 3WKMH 2OM5A 3DX8A 3G6JE 3QIBB 3UX9B 3EGSA 2BFVL 1Z6JT 2X1XR 1Y6NR 5E8NB 4TNVF 35C8H 4K94L 1NEUA 3EJYD 1L0YA 4F7MA 4QOKE 5I71C 2FB4H 4OI7A 5TJWK 2VZSA 1A1NA 1MFDL 4ZPTB 2CMRH 4Y4KD 5KJRH 3OKEA 4FQJH 3UJTL 1JCKA 2AP2A 3QQ4A 4FNLL 4WTZA 1A4KB 3RX7A 2UZIL 5EFIA 3TPUA 3H9SE 3EO0B 3HB3D 4NKDB 5DRXA 4GRMA 1VESA 2J8HA 2DQCH 1MWAA 1CFTA 4Q58C 3P0GB 4LEXH 4KV5F 1CGYA 5IB5A 4JRXD 2OK0H 4KTEL 2B20A 5E8PA 1F2QA 4P59L 3ZHDA 2ZPKH 4X0KA 4A6YH 4BZYA 1OY3B 1EV2E 5EU3A 5FHAL 5JHDE 5J13C 5SX4H 5LAXA 2MPAL 5K9QG 1S5IL 4PBVC 4PJCA 4C56E 1HQ4A 2FJHB 4NFBA 1RQ5A 2XY1A 4HSQA 5EWIL 4KJQC 4PGJA 1CR9H 5HGHB 1MLBB 3UTQB 3B3IA 4NQVA 2N1KA 1MAML 3F7YB 3T0VA 5KSUA 1WIOA 2NY2C 4L8BA 1XGYL 3QSKB 1GGIH 3LKSB 2EC8A 3LS4H 3WS6C 2V2WA 5EU6E 3SCMA 3V0VB 5IVZB 1RIHL 2NQCA 4G9FD 4GG6B 1DFBH 1UXSB 2R1XB 4P2OD 1VENA 4S1DD 3MR9B 1OM3H 4M5ZH 1KYOJ 2ZKHL 2GUOA 4P5KB 3W0WE 4PJ5D 1AI1L 2A6JA 1KPVA 3ULVF 4KMLB 4OZ4A 2FZ3A 3VWKB