4TSCH

Structure of a lysozyme antibody complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
206
Chain Sequence
b'QVQLVESGGGLVQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGRGDSIDYWGKGTLVTVSSASTKGPSVFPLAPSSAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Structure of a lysozyme antibody complex
rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 37
structure length 206
sequence length 218
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tscH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tscH01
2IH1B 2H8PB 3CVIH 4RAUA 2A9NH 1JPSL 4PRPB 3IF1B 1DQMH 2C1PA 3IJYA 1JUFB 1CTNA 2DMCA 3VFGL 1G9MC 4LRIC 5ADPL 4P2OD 5FO7A 3V6FA 2IQ9H 5ENWA 2VUOA 3HE6A 5T1LB 4GS7C 2VXSH 2VO5A 1T4KA 5EIQA 1HXMA 1XF4B 2EDLA 4PG9A 3BI9X 3MLRH 5HHMD 1FAIL 4JFDA 5ANME 3M07A 1Q72H 2X4NB 1FIEA 2AJXL 5FECA 3GMMA 3GSXB 4GBXD 3V0VB 5JIKA 5DK2A 4ZUVA 3HE7A 2X40A 5DUBA 5BRZE 3JWDH 4EEEA 5JLZA 3O8XA 2VC2L 3SBWC 4AL8L 2UUDH 1I8MB 1ZOXA 5F93C 5DK0A 3DMMA 4I2XB 3VXNB 4QRSB 4U6YB 4O51B 4DKDC 1A9BA 1XCQB 4LCYB 2CK0H 3M1BA 3O2WH 5E9DE 1I8LA 3PDDA 2BDNH 3GZKA 1CF8L 4OD3L 3WS6A 2VLJE 1Y18A 1J10A 1YNTA 1I1CA 3KJ6L 3MYJB 4Z7WF 3VXOA 3PWPD 2P1YA 1XGPB 2X44D 4OLYL 1YYLL 2DQDL 1FZMB 1VFBB 5IFJA 2I9LB 1KIQA 5JOFA 5LCVL 3DIFB 3BQUA 1OB1B 4AH2A 3QFJB 5TE4L 4UZGA 5GSVA 3TV3L 4EUPB 1JN6B 2ZCKH 4L4VB 3U6RB 3ARZA 5KTEH 1V5JA 3T3PE 2HKFL 4MJ4A 2H2PC 2XY2A 3NH7H 4N1HB 2NY3C 3SDXB 5AAWA 3HA0A 1ZGLM 4R4ND 5LJYH 6FABH 3B9AA 2OI9B 2X89D 1CVSC 4Y5YB 5I1HH 1FO0A 3MRDB 4MJIE 3B9VA 5JNYA 2QQLL 4RNRA 2AP2A 3IJHA 4XAKE 2DD8H 5JHDA 2NCMA 3UZEA 3O3AB 5EO0A 1R24A 5CBEA 3IKKA 3X13B 4M48H 5TH2A 4XVJH 4NZTL 3RWIB 2DLFL 2CD0A 1T2XA 1OAYH 1RJZA 3G9VA 3AS2A 1VENA 4N0UB 5FM8A 3KLSA 1N0XL 3EYSL 4NHCH 4OB5H 2MMXA 3LV3B 2GHWB 3TJEH 4H5SB 2J2ZA 3PQYE 1H3WM 3VH8A 1LO4L 5GQBA 3EYFB 1KTKE 3X3GH 2NTFA 1JHLL 1RV6X 5IVXF 3FB8B 4NQCA 4GBXC 3VFOA 4KKBD 1GGBH 4I5BB 4YHNB 4L9LB 3ECBA 1TZIA 4PJ7A 4DKFH 2EH7H 1E4XL 4CRPA 2IJ0C 2FYYB 5IK3B 3VRLE 3MUZ1 3L5WB 1YY9D 3WEXA 2EDQA 1XGYL 4X6DB 3IDJA 1HH6B 4FQXB 2R1WB 4RZCB 5ID0A 3BKYL 3DTXB 4NCC2 1NEZA 3EW3B 1FDLH 3U36B 4LLMB 1UT9A 1G7PB 2ENSA 3DX8B 1FC1A 2ZZUT 5CSBA 4CJ1A 5LBSH 1RVFL 4DUVA 2EE3A 4NRXA 1F97A 1J05A 4GXVL 1KC5L 4X5WA 2GJ6B 2PW1B 5F1NB 2LAAA 1M7DA 3EHBD 2HVKB 4LLYB 3B9DA 1MCHA 3O2VL 3MLYL 3TBYB 1KIRB 2A74B 4HCRA 1IAIM 1C8PA 1ZLUK 3U9PH 5FUOL 2VZ1A 1NDGB 3G04A 4X6CE 4LU5L 4K8RD 2IWGA 1WZ1L 4JFHD 4K7PX 1JHKH 5SWSD 2C1OA 5EN2B 4IIQA 1B4JL 1FE8L 4LEXH 2VN7A 5IF0A 5HYJE 1HI6A 1T20A 3TFKD 4J8RB 4QXUH 4LLQA 3JWDC 1Z0MA 1B2WL 4RWYH 1HZHH 4XC3H 1IL1B 1LGVA 2XOTA 3LAFA 4OCYL 4WW2F 5F9OH 3P30H 2E6JA 2A9MH 4PJGE 4DK3A 4I0KA 3KDMA 4EI5A 2NY7H 1A4JA 1TJGL 4W68A 4JQVC 3VFVA 5DI8B 3CUPB 1HHIA 1S7TA 2HN7B 4OZFH 2PXYB 3CDCA 3WNPA 3NZHL 4MNGE 4CKVX 1MCWW 5I15L 1ZHBB 1ZT7A 3KYNB 5JOPE 1EO7A 1F13A 3EFFA 1IEBB 5BVPH 5T1LA 1DBKL 4KVNL 1MLBA 4ZDHB 4NN6C 4XVTH 4PJAB 5HHVH 2J4WH 2X4NA 3K2MC 5E94B 4OI9A 2BOCB 1UZ6E 2Y36H 3JTSA 1WLHA 3RKPA 1U8KA 3UBXG 3V0VA 1RFDH 3A0OA 9CGTA 3VXQB 3PIQB 1U2CA 2AV1B 2XTJD 3HI6H 1RIVH 4O4YL 5INDA 3OGOE 1JRHI 1X5ZA 1BF8A 1PEWA 3ZKND 1ND0B 5ERWB 1YY9C 1QSZA 3AS3A 4ODHL 4YR6B 4I2XA 2H1PL 3AY4C 4K7PY 1T1YA 4O51A 4LCYA 4L8SB 4UNTA 2QQKH 4WFGE 3BH9A 2EDHA 1N64L 3HNSL 4U1LA 3RVTD 1RAMA 4ZTOL 1YMHB 1MJ8H 3JUYA 4DN4H 1XCTB 3O11A 3TN0B 3VFPA 2EO9A 4LIQE 1Q9LA 3E8UH 5DMJB 4QRRD 2VXTL 1MRFL 4OCLC 1FZMA 2XWBB 3WL9B 3EHBC 3KPTA 1EXUB 2B1AL 3U1SH 5AWNH 2A6IB 4G5ZL 5EO9B 5BW7C 2OJZL 4XBPB 3BH8B 2NTSP 2BCKA 4HMEA 1JN6A 1K5NB 5EU5A 3VWJD 5EORL 5T3XL 3EYOB 4K8RC 3W2DH 5C6PB 3U2SB 1NUNB 1PG7L 1OF2B 2JTDA 1BX2A 2F54A 3MGOB 1OY3B 3WHXA 4P59L 3RJDA 3IGAA 4QCIB 3UJJL 2SEBA 4MWFB 2NXYB 3QDMA 3EO0A 4P9MH 1WZKA 2H45A 2EEBA 4IOIB 3TPUB 2BVOB 4H0GA 4Q9QL 1PBYA 5FB8A 3TT1L 2XQYK 3O3AA 3QUZD 1MRCH 2C3WA 3B4NA 2PR4H 4Y19D 3DUSA 4MGXA 5C0IA 1U9KA 3RY6A 4G8GD 4YNYB 3EO9H 4JDVA 4APQA 3GBLA 1Q1JH 4P3CL 2VWEC 4AL8H 2GKIA 2X4UB 4N68A 1OPGH 4H5SA 4P9HL 3QDJA 1CDCA 1OARH 2YZ8A 5BS0A 2VIRB 5TF1L 3ZO0A 5I73C 1IBGL 2Z9TA 3EYFA 1DTUA 5HDQH 1RUPH 3SE4A 4KY1H 4OD3H 2H32H 2F53D 4LIQH 4I5BA 4YHPB 5TQ2L 5ESVB 1EGJA 3AAZB 4UUJA 5GRVK 2XTJC 3KJ6H 3C5ZD 4J23A 1QHPA 5DT1L 4CADB 2RAMA 3VGAC 2BNQE 3H7BA 1AO7E 4NNXB 4OLYH 1F90L 1TVBB 1RUAL 1Z9SA 4JFXB 3ZKNC 3DYPA 5LKNA 3L5WA 3HTLX 1DBJH 1FYTB 2R2HB 1Q94B 2ZCLH 4X6DA 3V4VH 1PLGL 1W0WB 4FQXA 5TE4H 4Z76B 4DCQA 4RZCA 5JPMB 3RIAF 3TGXA 1YC8A 3DTXA 3TPKA 1KBGH 2DQJL 4NZDA 3DSNA 3GSOB 4H1LH 3CDGB 2CDEB 4NKDA 3RVTC 4G9FA 3VD3A 4JJ5B 3E3QE 3MBEA 1MFAH 1BQLL 2VUYA 1S7RB 4KI5F 2RBLA 2VLLA 1CIUA 3VWKC 5E2UH 2V2WB 2CKBA 5DWUH 1FORL 3TBYA 2A74A 1QEWB 1NFDF 2DM4A 2ERJC 3MLVH 3VWJC 2NX5E 3PHOB 5F6IC 3VD9A 2JIXB 2ZSWA 2AJUH 5CGMA 2O93L 1AGDB 3LSOA 2AK4B 3DGGB 4P4KA 3CX5K 1SHMA 2BSSB 3DUUB 4J8RA 1AH1A 2JJUA 1IL1A 3BKCH 1MCLA 3C8KB 3SCMB 4HS6B 4KKNA 3QUZC 5BZDA 3QXUA 1I8KB 4GAYA 4UDUA 1CK0H 1T0NB 2KBGA 4BKLB 4LLDB 4NOBA 3SDAD 3CUPA 3RX7A 4S1QL 4NO2A 1HDMB 3QG7L 1FL6A 1H8SA 4HJGB 4Y1AE 2HN7A 2PXYA 4EJ1C 5C07E 5C0CE 4M8QB 2BVUA 5I1GH 1C5CH 1C12B 5A1AA 3I02A 1OGAB 4CN1A 1RZFH 3DYMA 1XGYH 3BPOB 4DQOL 1JNJA 4U1MA 3QQNA 4KJWD 3UROR 3RGVC 2H9GA 5B3JE 2P24B 5DGQA 2NQCA 1TCMA 5C0ND 1LEGA 4FRWA 1QO3A 4F37F 35C8L 3VXQA 3PIQA 1B6UA 4M7JL 2AV1A 4LCWB 5IT2L 2R0WL 4FXGA 4MAYD 3ZDZE 3MA9L 4X4XB 2OMNA 4UT6L 5MI0C 4GXVH 1KC5H 4KKCD 2N7AA 5C92A 1PGRB 4F2MB 3LN5B 1FFOA 2XA8L 2ZJSH 2EDXA 3A6OA 2MFNA 3W9EB 2R0ZL 1T0MB 1QFWH 4JANB 3NCMA 2D3VA 1J88A 4ODUB 1RHFA 1K4CA 3K1KC 4PJFF 4D9RE 1OP5H 1YA5A 1MIEL 1BFTA 4JFEA 1DR9A 3TNNA 5KVEH 4WU5B 1HHHB 3QUKB 1CBVL 1EHAA 2DQEL 5A2LH 1XCTA 3TN0A 3CLFL 4UV7L 4CBPA 4E41E 4MHHG 1RURH 2W9DL 2UZYB 1IT9L 3HUJF 2VLKA 4S1SL 4KJYA 1A0QH 1EFXB 3MNWA 5C09A 3FRUB 3PP4L 4OCYH 1EXUA 4RBPK 1JPGA 3N06B 5EO9A 5J4MA 3VXPB 4M7KL 4XBPA 3BH8A 1S7WB 5DEGB 4Z0BL 1N2RB 1H3VA 4XPBH 1NANH 5GGQL 3JV0A 3MUY1 1OF2A 1J0YA 3OKOA 2J8UF 4B7LA 2Q6WB 4B0MM 4U0QB 2XZQH 3ILPA 4JPIA 5DD3H 3I9GL 5SX5K 2X4RA 3D3VE 1EO8L 5GRUH 3MLSH 2J6EL 1U42A 4G8IA 4UILH 4PGCA 3VFWB 3S4SB 3SDAC 1LWRA 4KKAC 1MWAA 1MUJB 4JRYB 4N9OB 4YNYA 2XQYG 5FDYA 4DEPB 3K4AA 5KSVB 5EBMA 3WFCL 4PJ5D 1A4KB 4PJ9A 4N0YH 1UACH 1NAML 2XZAH 3T0ED 1P69B 1B0RA 1NC2D 5C08B 3ARDB 1RZ8B 5F7NC 32C2B 3D85D 1QRNB 2H1PH 2HYMA 3K8LA 4G6JL 4KJWC 1AC0A 4NKIH 4F7PB 1I1FB 1FFNB 3QIUD 1GGTA 3OB0K 4K94L 5D72L 3KNBA 5C0NC 3UBXB 1J8HB 3BGMA 1N64H 3HNSH 1Q9OA 4ZTOH 2BERA 5LXGL 3C8DA 4GH7B 4MA7H 5ALBH 1WQVT 4MAYC 3IFOB 2N1KA 3OL2A 4JREB 3MRCB 3RA7H 4DK6A 4RAVB 5I8OH 4KKCC 4NNXA 5DD0H 1MRFH 1A3QA 1XH3A 4JHAL 3DXAA 4JFXA 2FJFA 1JK8A 5ESAA 3WNNA 3FOLA 1FYTA 2DQTL 1RZKL 2APXA 4QOKB 1I85A 5DDHA 3U0TA 4AT6B 1N6VA 3O4OB 5KSBA 5C0FB 5GSRB 5D7IF 4Z76A 1T7WA 3UTPE 1WAAA 5JPMA 1DFBH 1H3GA 1N4XL 5K33A 2FZ3A 3FHAA 1PG7H 1AP2B 4U1GB 5A3ID 4GRMB 2IPKB 4HX1B 2E7LC 1WICA 1KPUB 4MAUH 4JJ5A 1DLHA 2BVQB 3QXAA 1FBIH 5JXAL 5CKAA 4GQ9H 4I3SL 4ZQKB 1S7RA 5F88A 4C83A 5MHSE 4V2BA 3VI4F 3F7VB 4U49A 4HUUB 4LHUD 5IBUB 2F5BH 4PRHE 4XX1G 5T5NF 4X80L 4Q9QH 3TT1H 3VMNA 4D2NA 5JW5B 1HHGA 4R7DA 3FRPG 3I6KA 2NZIA 1ACZA 1UKTA 2A6JA 5FCUL 5ITBL 3SE9H 2X1QA 3GSRB 4EIGB 3DSFL 3QCUL 4J3TA 2VDOH 4WVRA 1CXHA 3LEVH 2BXZA 4QHUA 4BYHA 3U30B 4NSKA 2O5ZH 3P4MB 4POUB 1BM3H 5DVNA 5EUOF 3EO1B 3T4AA 3SCMA 3C09B 4HS6A 5KANG 4I48A 3UTTE 4P49A 2ZUSA 3BKMH 4W6YB 1NGYB 3V4UH 1QBLL 1OOAA 4A6YL 5AEAA 3PNWB 2X1WL 3DRTB 1HDMA 3IVKB 5ALCL 5EU6D 2GUOB 3B2VL 4YWGL 2DS4A 4Q9RL 4YBLC 3PWNB 4YE4L 2PCPB 4OLXH 3IXTA 3D6GA 3T0EC 2NZ9D 3PDOB 4UMGA 1ZTXH 5CD5D 3QUML 1NEUA 2I9TA 4NPYB 3HC0B 4N5UA 3OG4B 3FT4B 4FMFA 4P5TD 2OZ4A 4PJIA 3HFMH 2AVGA 3QIUC 4YZFE 5D1XD 5J8OA 2WP3T 2YUZA 2DQJH 3TNMB 4KUCF 4OFIA 1OD7A 1MCOH 3TWCH 4PJDB 5IR1A 4XCNB 5C6TH 3WCYA 3BO8B 1K3ZA 4K7PL 5D6DC 3OKKA 1T04A 1NCWL 1Q9WB 1V7NH 2VLRD 1I3RB 2ICWI 2ICEB 1WIUA 4F9PA 4X7SH 5J11C 1CDIA 4PYGA 4QY8B 4GG6E 1J12A 1WGOA 3MV9D 1S9WB 2R2EB 3FFDB 4WHDA 4XGZA 3QFDB 3O6KL 1WFNA 3DHMA 3V95A 3EOAB 4MB5A 2VOTA 3MGAA 4HPOL 2JK5A 4D9QD 5I0ZA 2HJFA 4WV1C 3WXVH 4EI6B 5DFWH 5A3IC 1B6DA 1S7SB 15C8L 4WU5A 4XNUL 2M2DA 4OQ1A 5JMOC 3HMXA 1F6AB 5EZIH 5A40E 2CXGA 3KYMB 1A14L 4NDMA 3BZEB 1EEZB 4F15B 2G2RA 3C60B 3PGDA 5CCKH 1RI8A 4LVNB 2ADIB 1X9QA 5GGRB 2XPGB 1AD0A 5E8OB 4HIIB 3RIAK 4LKXA 1CFSB 4RMSA 4KTDH 3CFJA 3I6LE 3HE6D 3N1MC 1JNLL 1A7PH 1YPZB 5KSAA 4S1DC 2R29L 1XF5A 3MOQA 4JFDD 1G0DA 4WJ5A 4P57B 4LGPB 3WJLA 5D71L 4IM8A 3FFCB 4HJJL 5D5MF 3HE7D 3P9LB 1RZGB 1FNGA 1FO0H 4OLZH 1MUJA 5F7FA 5CJ5A 4PLJD 1W72B 4TVPH 3TCXA 1HIMH 3O8XD 4M7JH 4GW1B 1UM4H 2H26A 3RUGA 2NY2B 2NZ9C 3DMMD 2XA8H 3ARGA 5CD5C 3DETD 5C08A 3GBML 1JGEB 1RZ8A 4PRIB 5JTWA 3KWWB 4P5TC 3MBXH 2NY0D 5D1XC 3QRGH 4A2LA 4F7PA 5GS0L 2BNRA 1ED3B 2EDKA 3MV7E 3G6JE 3UBXA 4ELMA 1J8HA 4J3SA 3WKMH 1UM6L 4LCUA 4UDTB 2UVFA 5DJZB 5C0AE 1CBVH 2DQEH 4V1DE 3VFSA 4KPHH 3WO4B 2W9DH 1BD2A 4M6OL 1R0AH 3OXRB 1IC7L 1KLFA 3HLAB 4DUWA 3BQUD 1KGCD 2VZOA 3QP3A 4AT6A 3F7QA 4LFHD 3H6JA 5GSRA 5TDOA 4Z0BH 5J0BA 1ZVSA 4P5MA 3CFCL 1RZ7L 4MDIB 4PP2B 2BY3A 3V5HB 4HT1L 4K8RL 1X7QA 1YMMB 4TTDD 3X14B 1KPUA 3VXSB 4F58L 2B2XL 2BMKB 2CUHA 1BZ9A 2YPLB 4F37K 2FR4B 3RFZC 1HINL 1YEGL 4JRXE 3HZKA 5I1EL 2V5YA 3I9GH 1XMWA 1JTPA 4WFED 5C3TA 5JHDD 4Y5XA 1EO8H 4G6AC 4HUUA 1LK3H 1YEHH 1NMCB 4X8JA 1ORQA 3JV4B 5JW5A 5J13C 3UAJD 2HRLA 3RTQB 2P5WB 4M3JA 4PLOB 3D25B 3QJHA 2E6QA 4FQIL 3AS0A 4CL7A 4FXLA 3HC4H 3T8XB 1BVLB 1BJMA 4JPKH 2JCCA 4YFEA 2OMBA 3FQXA 5H2BB 4YHIB 2DB8A 4XZUA 1T80A 4CNIB 5L2KE 3TESA 2JB6A 1FAKT 5SWZE 5IMMA 5JPNA 2I5YH 5DD1L 4AIZB 5L7XL 5TDPB 4NQCD 2XN9A 4K94H 2R0LL 3HE7C 2FJHB 3T3PF 5GGTL 3LN4A 4JFYB 2E9BA 4PTUA 3NACL 4ZSOB 4PLJC 3O8XC 2GUOA 3ZTJH 5F3BA 4FFVD 4OAWB 1KTDB 3GMOA 4JHAH 3DMMC 1YDPB 4NFCA 3BEVA 4JG0H 4XB8A 1N7ML 1JF1A 1HWGB 1KJ3L 2DQTH 1RZKH 5D9SB 2R2BB 3AU1A 3FT4A 2NY0C 4TUJA 1DSFH 1KCKA 4IS6B 4RMTA 5IM7B 1EEYA 1V3JA 4RFEB 3GSQA 3BO8A 2HWZH 3ZDXF 4ODSL 4O2EB 2HTLD 4L8DB 1U91A 1RMFL 5HPMA 2ICCA 4I3SH 4Q6IC 3W5NA 1RY7B 3ULVL 1ZVHA 1UQSB 1KULA 1KCUL 3BQUC 1V7ML 1UB5B 4WNQB 4CW1A 2Y4SA 1ZEAL 4NJ9H 5FUCC 1S9WA 3UDWA 3WXWL 5DMKA 3QFDA 4B53A 3ULUH 1K9TA 4XHJD 1A7OH 3EOAA 5DJ8B 4YEEA 3ZE2E 4FQCH 1TZHB 4TTDC 2V5MA 5DFTA 2KQMA 1YECH 2AERT 3QT2A 3HHRB 3VRLF 1G7MA 4HHAB 1LE9B 1G7LB 1ZVYA 2EDRA 5IOPB 1F6AA 3GUTB 5IMOB 4N8CL 2QJDA 5I74C 1MH5A 1R5IA 3ULSB 5E8NB 1KENH 4ACPA 3CX5J 4EI5D 1Q9KA 1BP3B 3BZEA 1EEZA 3VG0H 2VSCA 3QQ9D 2AKRB 3C60A 1ZT1A 5MEPB 3IDMB 3UAJC 4DZ8A 1DLFL 1C16A 4WTWA 2ESVD 5MENB 1KN4H 4RGND 5HVHB 1MQKH 2XPGA 4ODVL 4M9OA 3QPQD 4ZOCA 5E8OA 1UEMA 3HN3A 4WUUB 5HDBE 3QCTL 2ICWJ 4HK0B 5HYSB 3FHQA 4CVUA 4AEHH 5T1LD 4KROB 5FKPA 3VGGA 1NBZB 1NAKH 3H9SE 4PRAB 4LDEB 1YPZA 4PJXE 5EU4A 5DJ6A 2IQAA 4WEMB 2W9EL 3HNTL 3S8WA 5K9QG 1AXSB 4Z7WB 4Y16A 4X6CF 2MNUA 3DUHA 3FFCA 4XP5L 1PZUB 1BBJA 2NY4D 3P9LA 1EPFA 1MI5E 2VDRH 3OKMB 4BFIB 1K8DA 3ULUD 4PJBA 4OZHF 4FFVC 3MXVL 3HPJB 3IKCA 5CEXA 3DV6A 5KS9E 3AB0C 4OCSH 5D7JB 5TGBB 5EOQL 2CLRB 1S9XA 5JA8B 4HWZA 3Q0HA 2Q7YA 5T1KB 5BZWB 1HKFA 3SN6N 3WNOA 3TZVB 4ZPVA 1RJYA 4GRWE 2HFGH 5DEFA 4G3YH 5E00B 2JB5H 5AZEH 4OGYH 3HG1A 2P48B 2A6DB 3AUVA 5K9QI 4XT1C 1S7QB 4KV5E 3QXDA 1FJ1A 2HTLC 3HPLA 4MNHA 3UTSA 3D48R 3RPIB 3CGTA 2YPVL 3JV6A 3L7FA 4OGXL 1KELL 3HLAA 4NM4L 4IDJL 3W81A 3RY4A 1DEEB 3I50L 1DUYA 4HC1A 4OF0A 4XMKH 4ZODA 1UZ6F 1YEDA 4G8FA 4XHJC 4IIQC 2C3VB 1MCJA 2F54D 1LK2B 3L3KB 2ZUVA 2W91A 4H20L 3KJ4C 3QDMD 4P23B 3X14A 3VXSA 3DX7A 5BOZG 5I71C 2PYEE 1JHTB 5EH1A 3WDJA 1D9KA 3CSGA 2B39A 4WFFE 1FFRA 3KGRA 3FT2B 3Q1SH 4DGVH 4HGWB 1MCSA 2YUWA 4EI5C 1CI5A 4HD9A 1WBXB 3RVUD 4JM2F 3MJ9L 3D39A 3QQ9C 4OT1L 3JV4A 4FQ1H 4RGNC 1D5MB 1TQCB 5TPWL 4APQD 4KK9D 2Z8VC 1H5BA 1XGUB 4GAGL 1FLTX 3QIWA 4HS3B 2CKBH 4GO6B 4N8VB 4HWBL 4ZPTB 4AG4H 1YEIL 3QDJD 2ILLA 5HYQB 1EJOH 5FOBA 5BS0D 1KJVB 5H2BA 1HCVA 1OAKH 4XPGL 1DZBA 2AXHA 4L4TE 2OTUB 3VFNB 3QULB 4MJ5A 1U58A 1C7TA 1X5FA 1P5VA 1CFBA 1L9NA 4EOWH 2X41A 5C2BL 4N5ED 1UG9A 5GS0H 4OLUH 4UB0H 1MREH 2MJWA 1B4RA 1R5WB 2NY4C 4F8QA 3BWUC 1RJLB 1EFQA 1Z3GH 3B43A 3MUGA 3ULUC 3IDXL 4P2RB 1ZWIB 3ZYZA 4PRNA 3IDIA 4UT7L 3QHTC 3U4BH 4J2XA 1F4YL 4OAWA 3WIHA 1ODAA 4NM8L 3GK8L 1KTDA 4R0LA 1N6UA 2P47B 3U4AA 1PDKA 2D31B 5I1CL 1JZ4A 5IMLB 5C0EB 3TYFB 3P73A 3WSQL 5D9SA 3LPWA 5IGXL 5E5RB 4QTHB 4X6BB 4GAJH 2UUDK 5E6IA 5CILH 3E2HB 2X4OB 2IBZX 3S35H 3CFCH 3SDDB 1RZ7H 2FATH 4LVHB 4ZO8A 3V6ZB 4RFEA 2PTTB 5GJTL 4G9FD 5DQDL 5EZJB 3MBED 4ZTPL 2HJLB 5F96H 4F58H 1WWCA 2AI0H 3EOBA 3MRJA 4LQ1A 1JPFB 3I2CL 5KJRL 1MAML 4NUJB 5HYEA 5IMKB 5IJKA 2R39A 3C5JB 2WUCL 3HMWL 3ULVE 2QBWA 1CDHA 4PB0L 1KB5A 1R5VB 5E8DL 4DZBB 5BO1L 1KV3A 3QO1B 4OQTL 5DJYB 1UWGH 4P4KD 1I7UB 3T08A 1OGTB 2O5XL 3RZCB 1TZHA 3OGCA 3B9KA 4QGYA 2P5EE 5E24E 4GRLC 4YK4B 1H8NA 1G7LA 5C0CB 3CVHA 5IOPA 2F58H 5CSZB 1U95B 2VISA 3G5VA 4GW4B 5E8NA 3RVUC 4OLWL 1BVZA 2AKRA 4XBEH 1WFUA 3RY6C 1I75A 4XPFL 3FRPA 3K81A 4APQC 4KK9C 3R0MA 5C0GA 2YWYA 3QWOB 2EDTA 4PS4H 4WUUA 4RGOH 3T1WA 4NN7C 2FHCA 4N0RA 1Z9OA 1CD1A 2QADD 2CIIB 4TSCL 1FH5H 2V5RA 4KXZI 3L1OL 2IBZY 2LTQC 2OJEA 4X4YA 5DD6A 3SE4C 2AEPH 2B5IB 3GSVB 3OG6B 4N5EC 2CRYA 3NPZB 4HKXB 4Z7WA 1B0WA 4NWTH 4ZD3L 4EDWH 1H9VA 1U6AH 5DEZA 3RGHA 1GJIA 2XWTB 4IRSC 3MJ7B 4LPUA 3WFBL 2ICWA 4BFIA 1CE1L 1VADA 1RMFH 3CXDH 1WCBB 2FD6H 1LDPL 2NY5C 4KHTH 2R1XA 2HAZA 5TGBA 4NC0B 5E1AB 2IG2L 5IB2B 2A38A 4GKNA 3TH4T 5T1KA 3VFUA 2WLZA 3BYTA 4JDZB 3LPGA 5KBNC 1UVQB 1A1MB 4PY7B 4HKBB 3VA2C 4JFED 2XKSA 3NCYP 1ETZB 1SY6A 1OD9A 4X7TB 3MBEC 4NO0B 5DC0A 4YIQB 2IC2A 5D70H 3M8OL 1FL3A 2DIJA 4H88L 4NQSA 3WE6A 2VLKD 3RPIA 3NMEA 2WBJB 5C09D 5DHVH 3GBNL 1BQUA 4M43L 1DQQB 3B83A 4YDVB 2VH5H 5M7QA 3LMJL 4K3DH 1DEEA 5CIPH 5B3JF 2R0KH 1NL0L 1H0DA 4RDQF 4ODVH 2XZCH 5JQHC 1P4IH 4P4KC 2EDEA 5FYJL 3QCTH 5C8JA 2AXGB 3PWVB 3WHE1 1S7VA 4P23A 5I6XC 1WWWX 4JO3L 5LQBL 4F7EB 3L7EB 1JHTA 3OWEA 5IVXA 5AZ2H 1N59B 1IAIL 1PAMA 2JJSA 3GKWH 2OR7A 3HNTH 1FSKB 4HGWA 5DRZB 5ADOL 4ODXA 5DJAB 3MLUH 3P0YH 3MRKB 4PIRF 1YC7A 5DRWA 5HHOA 5DJDB 4FZ8H 5I8EB 4R26H 1D5MA 5F1OB 4QO1A 1P6FA 1A5FH 5D1QA 4PJ9D 1FZKB 3MXVH 3CU7A 4HS3A 1OAQL 1QKZH 12E8H 2BSED 2VDPH 2R69L 2QADC 4MD4A 3ZYOA 4LAQL 4F7CB 1IQWH 5L6YL 1IKFL 1X5HA 3VFNA 3V4PL 3LN9A 2ED9A 2Q87A 2WNGA 3S36X 1YEEL 1ZSDA 4JFFB 1JGUL 1R5WA 4NRZA 4HK3J 1ZWIA 2HH0L 3W39B 5TE6H 4X9IA 3DXAD 1BFOA 3MOBL 1G7HA 2YPVH 2V2XA 4HV8B 3TBTB 2P8MA 4OGXH 5CS7A 3V7MA 1KB9K 3EJJX 3HRZB 2O26U 2YRLA 4NBYB 5C0EA 4QXTB 3P77A 1OVZA 4JLRA 5K9KB 4HULB 2YD6A 4PB9H 1IGTB 4JR9L 3P9MB 3CH1B 4HIHB 5H37H 1A6AB 2C5DC 5GGVH 2PTTA 2UWEB 5DQ9B 4U6HB 4LSUH 4YXLL 4H20H 1I1AA 5EZJA 5ILTL 3RWFA 4PGJA 4WW2A 3GMPB 4XCFL 1SJEB 3VFRB 3VMOA 5EA0H 1M7IB 1F58H 4M62L 1CFVH 3LB6C 2MQ3A 3QQ3B 3WD5H 2EDNA 3MGTB 4NUJA 2Q3ZA 3MXWL 3KR3L 1JNNL 4OT1H 2DRUA 4MCZA 4M02A 2WQRA 1CGVA 4DZBA 4Z7NF 1RUKL 5J1SC 1QSVA 2DM2A 3N9GL 3QO1A 4U31A 2MSPA 3CFBA 3KPRB 5FV1L 3BIBX 1A6WL 2VDQL 3ME0A 4S1RL 2ITDB 2YXFA 3IJSB 4GG8B 3T77A 4C57C 5IHLB 4HZLB 4NP4L 4QLRA 3QDAA 3BHBA 3SCMD 2RJMA 1U95A 4GW4A 1K4DB 1B90A 4KK8D 1LP9E 3RHWF 3NFPA 3ZDYE 4R4BB 1IGIH 3TBVA 3FT3B 5I2IB 3QDGE 1EAJA 2JJWA 3HMXH 3RWCA 5T3ZE 1RHHA 4HUNB 4PJ9C 4MX7B 1AFVL 4TSAL 2K1MA 2R4SL 1TFHA 1N5YL 4JG1H 2P49B 4EQ2A 2CIIA 4LDOB 3M17B 2ZUWA 2BRRH 4KAQL 4PJFB 5I1CH 4GXUN 5HD8D 4HXAH 3WSQH 3KS0J 2MOVA 2WZPD 3EGSB 4W4OA 5MP6L 1LQSR 2D9CA 4P4RA 3G6AA 1HHJB 4KRPD 1MHEB 5HJ3B 1TZGL 2XWTA 3HUJB 5DTFB 5K9OA 3VFMA 3GSUA 1ZHKA 2DWEA 4N8PA 1CU4H 4P2QE 2YWZA 4X98B 3P4LA 5CINL 4PREB 1WCBA 5D4QA 5E8PA 2VDNH 3WIFB 3BD5A 3O9WB 5KJRH 5E1AA 5CGTA 2W38A 4FTVA 1G0XA 1I85C 2FGWL 4EN3B 4EKXA 2DJ4A 3QHFL 4GXUM 1FZOA 1JRHH 5DA0B 4JGUA 3K2UL 4W81A 3TEUA 4JDZA 3VXMA 2Z8WC 2EIZA 4OZIB 5E8DH 1QLFB 3MREB 5ICZA 1DQDL 4MQTB 4PY7A 3DURA 3VGEA 3BE1H 4H0HB 3D9AH 5I19L 3SY0A 1BOGB 1EMTH 5F9JA 3D2UB 3Q6FB 4KWUA 4L8CA 1S5HB 3H3KA 2R4RH 3GO1H 2V17L 3T3ME 2WBJA 2ZUYA 2NLJB 2OTWB 3MACL 4YHKH 3AGVA 4OLWH 4GMTH 1LEKA 5T3ZH 4LSVL 2F8OA 2XIDA 1U8HA 2KQNA 3T1FB 4GS7B 1YQVH 4D0BB 4M6MH 1NCBL 1XGTB 4Z7VE 2R8SH 4OD1H 3THML 3KXFB 4BSVA 5E95B 2VTFA 5DVOA 2DQUH 1OP3H 3S3JA 1UWEL 5FYJE 3L7EA 3LKRB 5KSAD 5HBBA 1CXLA 4BQ6A 3R8BB 5IV2B 1G9NH 3WJJC 2QSCH 1CXEA 5A43C 1NJ9A 4QHKI 1R3IH 2Y5TA 1AI1H 4KK8C 1PKQE 4FOMA 1I8IB 5FUZH 5I0DA 4U6TA 5I8EA 1YEFH 3ILQD 4PJEA 4JY6A 3WFBH 2YS4A 5D7LB 3MV8E 1FZKA 4R97C 3QXVA 4WWKD 3ARGD 4YXHH 1U93A 1PSKL 4ZUTA 4LBEA 3S88L 3PF2A 4MNQA 5DHXB 4YUEL 2WWMD 2BNRD 2EDWA 3SKNB 5ACZB 4KRPC 4PJHB 3V0WL 1A6VL 5BCAA 4OZFG 3MJ6A 3O4LE 3UTZA 1B0GA 4WHYH 1MIMH 4HJ0C 3OAYH 3EUUA 4H88H 1BD2D 3QXTA 4F9PC 1NFDA 4XNYL 1N3NB 4Z7QE 5C7XH 3O2DA 4IMKA 1F4XL 2FBJL 1KIUA 2EYRA 3KPPB 3HI5H 1AGEA 4L3EE 2LU4A 4M43H 4QRPB 2NY3B 3E6FA 2V5TA 2BNUB 4WY7H 4HCRL 4S2SA 1XF1A 2IADB 2R9HC 1KLGB 4JCLA 3P9MA 1F6FB 3GSNH 4XMPH 1A6AA 5I1IL 4U6HA 2Z91B 1NLBL 4J3OC 4KZDH 5D2NC 1FCGA 1NFIB 3F58L 4LASL 2YPKA 2J7LA 3NCEB 3OKLB 4TOYH 1M7IA 5K9JL 3T2OA 4AQ1B 1OP5K 5F7DB 2FX9L 4LEOA 3MGTA 3NZ8B 1R3LB 2AJZA 4K3HA 3D5OF 5KAQG 4P2OB 2XKNA 1F42A 1RUMH 5DMYA 5DUML 3G6JF 2VZTA 4QRQB 2UV3A 3T09A 5HHMB 4NQEE 1RZJC 1SVCP 5CD3B 4MXVE 1REIA 4KJQC 4HF5L 4J1UB 4GBXB 4Z0XB 1FVDA 3V4PH 4MD5B 2XN9D 3LD8C 3WJLC 2A6KB 1QBMH 2CR3A 2P7TB 1U41A 5I17A 4K2UL 1T6WA 3HRPA 1WV7T 5DJXA 1YEEH 4JAMA 3MLXL 3DBXB 3ILQC 1OW0A 3FO1A 1FNEA 3CFEB 1M05A 4HKZB 4WWKC 1MNUL 5D7KD 3SQOH 5J6GB 25C8H 4PJFA 3NVQA 4RIRB 5DC9B 3ROOA 5BMFL 5D2LA 1LO5B 1FGNH 3PWPB 4YHLL 3WIIH 4JR9H 5KSUA 2IPTH 4JFOB 1DBAL 1UH2A 4YXKL 3HUJA 3ULUF 2AXFB 4FQQB 4YXLH 2GYSA 4CVXB 5ILTH 4XCFH 4JO1L 1I7RB 1CQKA 4M62H 1RIHH 1IGFH 3O9WA 5IB3A 4L9DA 5DA4A 3MXWH 4O9HH 1JZ3A 2J8UA 1G9NC 1JNNH 4JM4L 1J0HA 1DN2A 1CTOA 2X42A 4C56E 3PP3H 3BESR 3N9GH 2FRGP 1OAXL 5IHUL 1U8JA 5FF6B 4URTB 4G7YH 3D2UA 3FN3A 2J3SA 1UB6A 2WIIB 4OFKA 4GKSB 1NGQL 3MRFB 1A6WH 2VDQH 2MQCA 5CJOL 2VXUL 1D5IL 2CLZB 3KLAA 3FO9B 4Y5XC 3L3OA 1UYWH 3GFUA 2YKLH 2NLJA 2Y72A 2DIBA 1X4YA 1WBZB 3MFFB 4H1LG 4LRIA 2VLME 2BVEA 3F6LA 4BZ1L 1IEHA 4WI3A 1KEMH 4ZYKB 1YN7B 4WFEE 3T1FA 3MLZL 4XBGA 1JGDB 2BVPA 3LOWA 4IRZL 5FM5M 4G42A 4OZGE 5T33L 4NN6B 1AFVH 2R23B 2W60B 4K9EL 1FG2B 1F3JA 4KI1A 3NFNA 3QEQA 5CEZL 3L5IA 5IB5A 5IW1A 1CE6A 5L2JB 3BP7B 4Y16D 4U1NB 4YDLC 1NGPL 5IBLD 1CGTA 5MP6H 3K46A 2JJTA 3SBWA 1I8IA 2RIKA 1NDMB 1FL5A 4HUXA 5EUKA 2GTZB 4ZFFB 3EZJB 1EGJL 4NQCE 4UOW1 5B21A 4I77H 4KQ3H 1FIGL 1S78C 5ICXA 5D7IA 4E9LA 3IB4A 5IFAH 3X12A 4I9WD 2L0DA 4N0FA 3P3YA 2HFEA 3SKNA 2Z92B 2H6PB 3HG1D 2CKNA 1DQDH 1XR8B 2OCFD 1MSPA 2IANA 1JV5B 5HDBF 3RHWK 4O58H 3BZFB 4GKZB 3UTSD 1Y6NR 1JZ2A 3NGBC 4JZOB 4X9HA 3LHPH 1VGKB 2X4SB 4PJXF 2V17H 4HFUL 5I76B 4NT6B 3TO2B 5SWSB 1QYGH 3UDWC 4HDIA 4NO3A 1WWAX 1UZ8A 1A21A 2BNUA 2G75A 2X70B 5A2KH 2OR8A 2VABA 5C0BA 5FGBC 5C3LD 1MFBL 4XRCA 3L3JA 3CCHA 1BVKB 3THMH 2R56L 2Z91A 3VXSD 1A1NB 4M7LH 5EUOA 1D9KD 4LMQE 3BGAA 4TN9A 5L88L 4OKVB 3FJTA 1VFAB 1NGZB 5F7DA 3GJFB 3VXRA 3D1MC 5J9PA 5HHPB 3HCVA 1R3LA 3D39D 2I27N 3O41B 4ZOBA 5HGAA 2CRIA 4UNUA 5HHXL 3E1F1 1PJ9A 3S36L 3DO3A 1MRDL 1QSEE 4HK3N 4KHXL 3GRWA 3S34H 3VXUE 3OXSB 4XAWH 4UV4H 3QIWD 3QH3A 5D6CB 1IC4H 5I73B 1FN4B 5DD5H 3DYOA 3ZSSA 5TE7L 4R96B 3GSWB 3QQ4A 3ELAT 3G5ZA 1AJ7L 4PRPE 4J1UA 2D7OA 1I3GH 5JA9A 4NNPL 4Y16C 2XTJB 5IBLC 2A6KA 4AM0A 1QFWI 4UTBH 4WIQA 3VGAB 3WUWG 5FOJA 4QHLA 5CMAA 3L3DA 2WINA 5KVGH 4LSPH 3ARFA 3RX8A 3B2UD 4FA8A 5ITFB 1FNAA 4N90E 1MFEL 1XZ0A 4OTXH 5CGYD 5J6GA 5F7YC 2FBJH 3M45A 4TULL 4RDQG 4RIRA 5CZVH 3VCLB 5F89A 5E6ID 4XNMA 4CGTA 1JL8A 5IEHB 5B38G 2DTML 4QRRB 4I2XE 2NY6C 4MJ6A 4XCEB 4OZFB 3S98A 3BKJH 3R0NA 1KPRA 1NANI 5GJSL 3FO0H 1KB9J 2ADJA 5I1IH 1RUQH 4LHUG 4CVXA 2HFFB 3F58H 4LASH 4LOUD 2ERJB 3FAXA 2QQNL 4FXKB 1I7RA 3VWJB 4JKKA 3Q2CA 2I60L 5F6IB 1TETL 1G7JB 4KJPD 4MCYA 2IPUK 3STBA 1FFPB 4XVSH 5IFHL 2UY6A 4F3FB 2BJML 1NCAH 2PETA 2YMXH 1BWWA 5DUMH 3ARBA 2VDKL 2CRZA 4M93C 3V7AE 1N8ZA 3QWQB 3QFJE 1T1ZB 1AD9A 3B9KD 5FF6A 4Z78A 3PWLB 4FQHA 3QUZB 4PRBB 3OKEB 3HNVL 1AQKL 4Y19B 3SDXE 5D5MA 2CLZA 3LIZL 1I9JH 4G8GB 2FB4L 3T2PA 2XY1A 4QHNB 4J6RH 3NCJH 4TPRL 2IFFL 1GOGA 4OZHB 5CZKA 3QJFB 1WBZA 2NNAB 3U4EB 4F57L 5JIPA 3H42H 3MLXH 1IAKA 3LQMA 2ENYA 3RJQB 1QR1B 4JFZH 1EERB 1MWAL 5DHYB 1H5BC 3S5LB 1QA9B 3BEWB 3QIWC 3S37X 1J18A 2R23A 2W60A 3DV4A 4DW2L 3RWGB 5BV7H 3RGVB 4AZ8A 1AKJA 5IUSA 4JO2L 3RBGA 2F53B 4O5LH 5J7CC 2C7UB 4N0UE 4RQQA 3BP7A 5GIRB 2FEEL 1IEAA 2IH3A 5CEZE 4WUKH 3T0DA 1ADQL 3C5ZB 3GMNA 3U7YL 4IEFB 5EIIB 3CSYA 5FO8A 3MRLB 5MI0B 1GZPA 1LE5B 2YSSB 5SX4I 5CBAB 2X7LB 2GTZA 2A83B 3LQAH 3OTTA 4G7VL 3B2UC 5ANMA 1U8PA 4R0LC 3D0VB 5DC4B 3QUYD 4YGAB 2FJGB 5CGYC 5EFIB 1U36A 1EK3A 4YGVA 5JW3L 4DVBA 3U9UB 4NWUL 2EDYA 5BRZA 4HBCL 4NN5B 2E8ZA 5E6IC 2D2OA 4N9GA 4JM4H 2X4PB 2Z92A 1N6QL 4X6DE 4LAJH 3LEXB 3LS4L 1HHKA 1JV5A 5IVZA 3RRQA 1OAXH 4OLVL 4WU7A 1QNZL 2P8LB 5FIEA 2R2CA 3DPBA 4ESKA 2PNDA 1QUNA 4LOUC 4GAFB 4U2ZA 5CHNB 2ADFL 3PWJA 5E9DA 2ZCHL 3QA3B 4G6ML 1H3PL 4E5XA 4PLNC 3CC5A 2VLJA 1TCRB 3FQTA 4KJPC 5SWSA 4ODWA 1WTLA 1A2YB 4U1JB 3RWJB 2QKIA 1MFDL 3CH8A 2I26N 3RY5A 2EECA 2GJ6E 3C6LD 4OV5B 1JVKA 3MLZH 5AD0B 5T33H 4NQDD 5IBTL 3B9KC 1BVKA 3G5YA 3KPMB 2ORBL 4GQPH 3DI3B 5EZOH 1MCDA 5JUEH 2YUVA 3GI9H 3BXNB 1K8IA 3SDAB 4P0DA 1PEZA 3MRGB 3NOIA 1C08A 4LLWB 5F7WC 5HHOD 1V3MA 3H0TB 4LVOC 3BAEL 5CJBA 3LY6A 4MJIA 5D1QD 2RCSL 1WWBX 1IM9A 4RISH 1GHFL 2LABA 1FQ9C 2UYLB 3SKJH 4LSQH 1SEQH 1FIGH 1QVOB 1DQJA 2XWJA 3GSWA 4JKLA 4ZXBA 1FZJA 1AGBA 4XB7A 4BH7B 2HT4C 3MRNB 4HWUA 1OSPL 4C58B 3RWEA 3JVGA 1JF5A 1YJDL 4Q58C 3MLTB 1LD9B 2I07B 3BPCB 5IHZB 5IB4B 1P4LB 4MAYB 2OZ4L 4R7NB 2Q8AL 1PYWB 3QUXC 2HMID 5L8LB 2OQJB 3NIGE 3K7UA 3PQYA 4G80B 4PJAE 4XXDA 1HYRC 2OS7A 3I6GA 4HEPG 4MDJB 4HWNA 1U8QB 2HVJA 2MHAA 3NTCL 4L8BA 3QUYC 4H26B 4K07A 4XNQA 2AS5M 5INCA 2ATPB 2HTKD 3BW9B 1BEYL 2UVEA 4FABL 1DANT 4CDGC 5ICYB 5L9DH 3MRRB 4BH8B 4BK5A 5IEHA 1HXYB 3PHQB 1NCDL 4OZFA 5GZND 4AIXA 1I1AD 4K3EL 5DS8A 3MLWL 5FHBH 3VWKA 1KEGH 3ZE0E 5F7EL 1INDH 4OD2B 5IESH 5T1MB 5KG9A 4MQ7A 5BV7C 4QXGH 3RL1B 2EEDA 3O45A 5JO5B 4X5XA 3NPSC 2YD2A 2J8HA 3C6LC 4OCRL 1GIGH 3ZT7A 2IPUG 1TDQA 4MD0A 1CZ8H 5EBLB 1N26A 1NMBH 1MRDH 5TDNA 4OBSA 4JQIH 5GISL 4M61B 4M9PA 1LNUA 2DBJA 4PJCB 1KCVL 3PWLA 3QUZA 4PRBA 5ID1B 3C87A 1RZJL 2X10A 3IS0X 3LQAC 4X6CA 4Y19A 1ZGLB 6CGTA 2ID5A 3DARA 4MSWA 2KPNA 1NBQA 2J8OA 2JJSC 1YY8B 5CLWA 3WLBA 4CVZB 1UCBL 4UQ2B 4W6XB 3QHZL 5H35B 2F5AH 4PJ5B 2ZSVA 4YBLB 5TQ0L 4OUOA 3QJFA 5HYJA 1T0PB 1TMCB 2Q20A 3CK0H 3RVXD 3IETA 4HIXH 2WUBL 2GK0B 3SGJA 3T0EB 2ITCB 5D1QC 1QR1A 1NC2B 2X2YA 4TUKL 1U8OA 3UPCA 4ONHB 1MEXH 1AIFB 3D85B 1X6NA 4X4ME 1T21B 4OFVA 4P2CG 4U4BA 1INQB 3QIUB 1MFEH 3CLEL 2AJVH 3RGVA 3EOTL 4LP4A 2EE2A 4RMRA 4QT5A 4OUUA 3MR9B 1OAUH 4M6NH 3FL7A 5E2VH 3UYRL 1HOCB 5A2FA 5DJCB 2UZIH 5GIRA 2RGSA 5C1MB 4QNPE 1KJ2H 1I7ZA 4MNGA 1H3UA 1VSCA 2G5BB 3WUWB 2DTMH 2HMIC 3BSZL 3H9ZA 2XG4A 1AY1L 1O7VA 1GPOH 1TJHH 3MRLA 3QNYB 2HFTA 2DQCH 2C9AA 2FL5B 3CFDB 5J11B 4M5YL 1MF2L 3RUGF 1F6LL 2ARJA 3GGWA 5DQJB 5ESQA 2DQFB 3ESUF 2I60H 3ZKMD 4FTVD 3I3DA 2HTKC 4GFTB 3FMGH 4YHMH 4WV1B 4E42B 2VDML 1MQ8A 3RU8L 3KPOA 3VXMD 5DF0A 3RX5A 2YEZB 1FYTE 1A6UL 2VDKH 1A1OA 4KGJA 3LEXA 2VXVL 1J7VR 1I1AC 4WI8A 5B3NA 3O3BB 1JYXA 2P8LA 3RVWD 1P2CA 4LHUB 3P4OB 4G8EA 1HNFA 2F74A 4FFWD 3WKNA 3HNVH 3KYKL 4JM2A 1ZLWH 1T83A 3QA3A 5JORB 1VEPA 2EKSB 2HJKA 4PBVC 5C9KA 5CUSL 2Q76B 5IQ7L 2EICA 2ATKB 4F7TA 4U1JA 1ZKAA 3RWJA 2H32A 3O0RH 4XP1L 5FO9B 3FQRB 2YD1A 3IFPB 4F57H 4AEIL 4NNYB 1ORSB 5GGUA 5EC1B 2DM7A 1GH7A 3CFIC 2WP3O 3RI5K 4R8WH 2R1YB 4JKMA 3DVGB 5FDWA 2LU3A 2XQBH 4Z18A 1A7NH 3CFKA 2VDLH 3QEHB 4DGIH 4HUWB 3SDAA 2AK4E 4XNZC 4LCIL 2JLLA 3MRGA 3ZHKA 4CMHC 5EU6B 4OV6F 1ADQH 4X7FC 5FA4B 5I75C 4H1LA 1I4FA 3EDDA 5FHAH 1XGRB 1XF3A 4NUGL 1H15B 3REWA 2AABL 1M6OA 3WS3B 2JELH 4NZUH 3C6SA 4X9FA 5GPRA 3EKCA 2M8XA 4HH9B 1K3IA 4P5TB 2VAJA 4LNVA 5IW6B 5D1XB 2MWCA 1Y0LB 4ZUUB 3T65B 2VZSA 5E99L 5I30H 4DGYH 2Z31A 4MNQD 4BH7A 3MRNA 4OCXL 4HBCH 2OP4L 3MLTA 1GGCL 3OJDA 4U1HA 2VLRB 5DMGD 1P4LA 4WDIA 1OGAE 1A3LL 1JZ6A 3GI8L 4KI5D 3LS4H 4G80A 1IGJB 4Z7VF 1QNZH 2E3VA 1AGCB 4QHMB 4FQLL 1T7YA 3MV9B 4NBXB 3FQNB 4WENB 3CIQA 5KOVC 4JO4H 3NCBB 3NCYS 3U0PB 3ZKMC 1H3PH 4FP8H 4TSBL 3BW9A 4U6VH 1T1XB 1ITCA 3KPNA 4LCWE 3DWTA 2JE8A 4D9LL 4LF3B 3MCLL 3LH2H 1Q0XL 1AO7A 2J5LC 4BH8A 4QRUB 1PX3A 4J4PD 1HXYA 1VKXB 3QDHA 1FNSL 3G6DL 1BJ1H 2GITA 1PKOA 5FKAB 3TBWA 4Q2ZA 4MA3A 4YLQT 1BFVL 5J13B 4LLAA 4RAUB 5EZLB 3F12A 1I7TA 5IQ9A 1LDSA 2WWKO 5E6ZA 3IJYB 3VG9B 3MRMA 3V6FB 4YDIL 5ENWB 3HE6B 5FYKD 1XEDA 3Q6GH 1T4KB 3BAEH 1HXMB 4JHWL 1GHFH 3BDYH 4JFDB 1C7SA 4M61A 4G9DA 1DP0A 4I3RL 2OBGA 3IU3B 4ZFOA 1IQDA 3T0BA 3STLA 2EIDA 2NX5A 5DK2B 4ZUVB 1AE6H 3HE7B 2QHRL 4N0CD 2O5YH 5DUBB 3ZMRA 2PW2B 1NGWA 4UQ2A 5JLZB 5H35A 1YJDH 3O8XB 3TJHD 3JWOC 1G6RH 2ZUQC 4MQSB 3REVA 1MHHA 5DK0B 1JGLL 1JWSA 1X5JA 2EH8H 3DMMB 3SOBL 2ITCA 5GS2D 1A9BB 2EXYD 4KMTL 2BX5A 3P11H 3D85A 3R4DA 4JJHA 3NTCH 3M1BB 1A64A 2NY0B 3DRQA 2DJUA 1INQA 3BRDA 4JRYE 1Y18B 4YX2L 1P7KA 4Z7UF 3PXJA 1NKRA 3A6CL 1AXIB 4Y1AA 3VXOB 2IMMA 1XIWA 2VZUA 5DMGC 2D7QA 3O6FA 1URLA 2Y1VA 5AYUL 5C07A 5C08E 3WFDL 2ADGB 2G5BA 5E7BA 4KXZH 3WUWA 5IFJB 5D8JL 4JB9L 4Q6IB 1QRNE 5FYLL 1KIQB 1GOFA 2W1NA 5JOFB 1IARB 3MLWH 3BQUB 1CLOH 4AH2B 5DJ0A 1BPVA 5GSVB 4E0RB 4MXVF 2C3GA 1KF9B 3TCLA 1C5DA 2CJUL 1J8HE 5DQJA 3MRPA 1BECA 7FABL 4RX4A 4WV1A 2CIKB 2F19L 5GRXG 5EWIL 1FO0B 1PQZA 4HC1L 4JKWA 5A16A 5B38A 4J4PC 3ALXA 3MRIA 5FV2A 5E2TL 4RNRB 3QG6A 4QOKE 3IJHB 5I74B 2NR6D 3D2UD 4M1GL 1X3DA 3O3BA 5JHDB 4R6UA 2B0SL 3D0LA 1IFHL 4NZRH 4LHUA 1JPTH 5EO0B 4GSDL 1R24B 3S37L 4FNLL 3EFDL 4JFPA 2Z0BA 3BUYA 5JORA 1RJZB 5T1DL 4DAGL 1I9RL 2X5PA 2DN7A 3ABZA 3UZVB 5TQ0H 2A77L 3PGFH 4NRYA 4E41A 2OXGA 3KPLA 5FO9A 1KUMA 3A6BL 3VH8B 1UXWA 3SQBA 2APBA 2DOCA 4BELD 1FPTL 2X1OA 2GJZA 4HIJA 2N4IA 3L5XL 4NQCB 2EEAA 3F7PC 3QEQD 1Q0YL 4Z77A 3VFOB 5JZ7D 4N0CC 1UENA 4LHQB 1EHLL 4RMVA 1CGSH 3UYRH 4LQFL 3V52H 1LO3L 3ECBB 1TZIB 4PJ7B 5DMIL 1NBVH 5CJQL 2BSRA 3TJHC 5LAXA 5J1AA 1I9IL 3EIFA 3SO3C 4BUHA 4OM1H 3AB0B 1OW0C 4CU7A 3IDJB 2EXYC 2DBLL 4LPYA 3HR5A 1GYAA 2V7HA 3D3VA 2ZPKL 3STZA 1GC1L 4TQEL 2A1WL 1MCIA 1NEZB 1Y0LA 4OSUL 3FQUA 2AGJH 1PFCA 2VDMH 4KZEL 1NMAL 3MRQA 4NRXB 1J05B 3OPZL 4X5WB 3W0WB 2IAND 1A6UH 1M7DB 4Z95L 2VXVH 4OZGF 3JWNC 4WFHE 3AREA 3O6LL 1J1XL 4DUXA 2BY1A 3VA6A 3RQ3A 2I24N 3VDAA 4CVWA 3G04B 1CR9H 2RR3A 3IDYC 3MV9A 4PJDE 1AC6A 1VACA 4U1IA 1WUNT 4IIQB 1X5AA 5GRVL 5IQ7H 1QPPA 3BRFA 3OAUH 2F15A 3KJ4B 4I0PD 3VD4A 4LLQB 2CH8A 4LF3A 4DFIA 5I71B 5C0BD 4AEIH 4QRUA 1UADC 4LNRA 2NR6C 2EC8A 4EI5B 4BFEA 1A4JB 4JFQA 4CMMA 4Y5VA 3IFNH 1RU9L 3VFVB 2Y07H 5F8RC 1HHIB 3ZT6A 2ESVB 4RGNB 1S7TB 5EZLA 3VXRD 1WEJH 3QNXA 1GAFL 3WUZA 1JZ8A 5F21B 1ZT7B 2XTLA 4M03A 1J1OL 3EFFB 5F71A 1S9YA 2DICA 4ZO9A 1MLBB 2AABH 1IC5L 2EE6A 3EYUH 3H9HA 4I18A 5E1HB 2WLYA 4KUZH 2EDFA 4YPJA 5MERA 4TNVF 2F8VA 4HLZH 2CMRL 2D7TL 4UQ3A 4PRHA 5DRXB 1S7UA 3IU3A 5JQ6L 3JTSB 1U8KB 4LHJB 3ZTNH 4KUCD 5JZ7C 2NY4B 2DDQL 3NA9L 2WMPA 5DYOA 1CXFA 1Y6KR 5INDB 2PW2A 3AM8A 2PF6A 3S97C 3UC0H 3UO1H 2JJTC 1GGCH 1OP3K 1YPZE 3SPVB 2ZWLT 2FWOA 3U79A 4WI2A 2D7PA 4WI7A 3GI8H 1M1SA 1IE5A 1D6VL 3Q5YA 3ARFD 5IG7A 1T1YB 4PGBA 2QSQA 3FFCE 1EJ6A 3NAAL 3UTTA 3BH9B 2FGZA 4X0KA 2OL3H 4DJMA 4TSBH 4U1LB 1ES0A 4Y2DA 2FX8H 3NIFE 3O11B 3VFPB 3SE8H 1Q9LB 4M3KB 4ONFL 1D5XA 3UX9B 2ADGA 5FK9A 4PRIE 1D5BB 1CD8A 3KPSD 1UKQA 3OR6A 4JKPH 4Q6IA 4RCAA 8CGTA 2X9WA 1E0OB 1T2QL 3OZ9H 1HSBB 1E4KA 2VITA 4LSTH 1SY6L 2VZVA 2BCKB 4E0RA 5EU5B 3PHSA 5FYLE 2OSLA 1P1ZA 1BFVH 1QLEL 2O61B 1S3KL 1BX2B 3ZE1E 2F54B 3WHXB 1EBAA 3UEZA 3EDJA 3IGAB 3NIDE 3ZHDA 1QFWM 3OAYK 2SEBB 3QDMB 4I0PC 2CIKA 3EO0B 2XNAB 3ARBD 1IZJA 5FXCH 1ZGLP 3LQZB 4NKQB 1JMZA 5D1ZA 4JHWH 4JN1H 2FLRT 4XI5D 5FB8B 3VDBA 5TFSL 1DUZA 4NC1E 4R90L 3DUSB 4D0CB 5C0IB 3ZL4H 2MKWA 1KTLB 1JE6A 1YMME 4KDTA 4JDVB 4APQB 5DR5H 3RWHA 3VXSE 2DQHH 4P46C 2YPLE 3DLQR 2GIYA 5EOCL 2YD9A 4NN7B 5H37G 2WBKA 3R06A 4MMZC 5GRJH 1CG9A 1ZV5A 3QDJB 4C59B 1JGLH 5BS0B 1BBDH 5F3HA 1TNMA 4XC1H 4MQXD 2LTQB 2DI9A 1W72H 4IHOA 3GHBL 2P5WE 1AKJD 4XPAL 1YNLH 4D0DA 4WO4A 4Z6AT 4FFYH 4KGLA 4IRSB 4UUJB 1TTFA 5EU7E 4HEME 4YJZL 5JOEA 4YHZL 4OCWL 4O02L 3L3IA 3H7BB 1BIHA 4FQJL 2VXQH 4UBDC 1S9KC 3GIVA 2DQGL 3DVIA 3RL2A 4JB9H 2ED8A 4FQ2L 4OFPA 3TC9A 3ARFC 1ZLVH 3TH2T 1JZ5A 4DCQB 5DUPH 2AJYL 3ZKXC 2ZOKA 5BOPA 3PV6B 5KVDL 5J57B 4ZSOE 3SDXF 1CL7L 3C2SA 4NKDB 4HPYH 5BRZD 4G9FB 3DX6B 3MBEB 1NUGA 4ZFGL 2FDBP 2F19H 1D3CA 3DVFA 3JUZA 1DE4B 2C3XA 3QPXL 3W0WA 3BGFC 2P43B 3Q5OA 5IW3A 2VLLB 4X9GA 2CKBB 2DQIH 4M1GH 3EJYD 3RAJH 3TIEA 1VEMA 4ODTH 2Q8BL 5E9DD 1HKLL 2ZSWB 2VLJD 4Z7OF 1I9EA 5JHLH 1A7QL 3MV7A 3G6JA 3LSOB 4XWGH 5EPMA 5T1DH 3BVNA 4P4KB 2BVTA 5C0AA 5BQ7A 2A77H 1PX4A 4IMLA 4V1DA 3WNMA 3ARBC 5I6XB 1F3DH 3A6BH 2X4TB 3RBSA 4PPTA 4XI5C 4CUCA 3D18A 2GW5A 5BZDB 3HC3H 5BJTA 4GAYB 4UDUB 5FYKU 4HUMB 3PP3K 4NO2B 3T2QA 1FL6B 2ESVA 3S9DB 1K2DB 4KVCL 4HS8L 1KCLA 2PYFB 3LS5H 3TYGL 1TLKA 3DROB 4EVNA 3OJMB 4MJID 2QADB 3GB7B 1IM9D 3I02B 4LGRB 1OQOA 4JRXA 4U1MB 2GT9B 3MODL 4MQXC 3IXAB 4X6FA 1RIUH 1R3JA 4XAKD 4M7ZC 2B4CH 2ZPKH 1CWVA 2A73B 2H9GB 5DRXA 2VL4A 5MENE 3O6MH 4ZXBD 4C4KT 2P8PA 1LEGB 4NGHH 1W0VA 1QO3B 4OSUH 4WUUE 5I1AA 3P9WB 4PUBL 3TF7C 1JJUA 3HZVA 3TT3L 1CXKA 3BDXA 4ZFZA 4FXGB 1MHPL 2EDBA 4ISVB 2DYPA 3OPZH 3QI9C 3SPVA 3PQYD 1FFOB 3PUCA 4UOW0 1ZANH 1KFAH 1A47A 5L2KA 3BFOA 1ZXQA 2C3HA 4Z7WE 3O6LH 4XPTH 5SWZA 3VGDA 1K4CB 5IIEB 1AQDA 4G6KL 2AEQH 1UA6H 5I1DA 1QSFB 3Q3GA 4ZAKA 1CLZL 4DKEL 4M4RA 2W0PA 3MNVA 4JFEB 3TNNB 1CN4A 4YC2C 1C5BH 4ERSH 2QHLA 4ONGL 1YEJL 1J5OH 2AQ2A 2R15A 2VLKB 4KJYB 1B88A 4XHQA 1D5BA 3MNWB 5C09B 3VWKD 3BP6B 3JTTA 3EJYC 4AMKL 1HSBA 1JPGB 2FECL 5L8KB 1KLUB 4RGMC 1DN0B 3U46A 4JPVL 1CDGA 4K71C 2O61A 5J3HD 1JPSH 3OKOB 1GAFH 1OT2A 5H8DA 4J3WA 1LVEA 3C08L 3VFGH 5ADPH 4KMQA 1U8LB 5LG1A 3DVNB 2NY2C 4DTGL 2XNAA 4NYLA 1MJJA 3ILPB 1RULL 4JPIB 4GRLA 4KTEL 1A3RL 1DANU 4WHYG 4XCCL 5J6HB 3LQZA 3EDFA 4C54A 2YRPA 1FAIH 2X4RB 3RP1A 2CMRH 2ZKHL 2HKHL 4G8IB 3U48A 4PGCB 2KH2B 3QWRA 2AJXH 2W07A 4D0CA 3NA4A 3QNZA 1SEBA 1MWAB 4KC3B 1KTLA 5F6HI 3NA9H 4LSRL 1I3UA 5LGKA 5EBMB 1P7QA 4PJ9B 2B20A 5HYJD 2VC2H 1B0RB 3JWOL 3DO7A 3LKSB 4KMLB 1D6VH 2FIRT 2BZDA 5F1KC 1CQYA 3ZE0F 5SV4A 2FSEA 5HHOE 5JW4M 2D7NA 3TA3D 3RGVD 3IRPX 3KNBB 4ZXBC 1P7HL 1NSNL 1CF8H 3BGMB 3FTGA 1UM5L 1Q9OB 1FNFA 4IRSA 5C86A 5CIPB 3JVGC 4HXBL 4R4FL 1EA9C 5C0RL 3T0VA 2H41A 5SWQA 2CLVA 5JOPD 5DURD 1XH3B 1YYLH 2CDGA 2DQDH 3DXAB 2FJFB 1JK8B 4PJEF 5ESAB 2YBRB 4JY4A 3H2WA 3FOLB 3H9SA 1FNLA 4PJXA 4QRTA 5LCVH 5DDHB 3U0TB 5KSBB 1ZT4A 3TV3H 3EBAA 1LO2L 4D3CL 2J88L 4U0RB 1CICA 3H9YA 5B8CA 2Q1EA 2FZ3B 3PV6A 5DLML 1QLEH 4TNVK 5T5FL 2HKFH 2BOBA 1BGXL 4P2RE 3FB6A 1L7TL 1MI5A 4HUVA 1OTUD 4M5ZL 3DX6A 3UJIL 1DLHB 3BT2L 3QXAB 3BZ4A 5IWLA 4XH2A 4TRPL 1DE4A 5KS9A 5F88B 4C83B 2I25N 2QQLH 5GHWL 4Y4KA 2DLHA 2E6PA 4R90H 4JM2D 1HHGB 3AXLB 3I6KB 4R7DB 4WFGD 2LVEA 4LARL 4NZTH 2B4CC 4X6EB 2A6JB 4DKAA 3L3HA 5J3HC 1BAFL 2DLFH 4AENA 1VFOA 2H3NA 1MCRA 4MXWL 3BIAX 1NH6A 1N0XH 3EYSH 2IGFL 4QHUB 5A2JH 4OF6A 1LO4H 2Q86B 5GXBB 4NSKB 5FYKL 2X4TA 5HYFA 4OGAD 3T4AB 4GW5A 1V3KA 4I48B 1JHLH 1A6ZA 5JDSA 2RQ8A 1DVFA 2QEJA 4XPAH 2DAVA 1J8KA 4KKAD 4D94A 1GGIL 4TNWF 1KXVC 3GDBA 3V6OE 1U8NA 1K2DA 4K7FA 4J3XA 1VPOL 4OCWH 1MVFA 2PYFA 3DOSA 4R97B 4EBQL 1E4XH 3DROA 3IXTB 3R1GL 3SGJC 2QQQA 1F5WA 2PYEA 3GB7A 5J1TC 1U3HC 1ZS8A 2I9TB 2YXMA 4FQ2H 2NW3A 1DQLL 1KNOA 5AUMA 2GT9A 3IXAA 4M1DL 4PJIB 3BKYH 1JFQL 3TA3C 2A73A 4LPVA 5IR1B 4KRPB 1CL7H 2Z31D 1F2QA 2AJ3A 4L4JA 2IAMC 3OKKB 1T04B 1HILB 1RVFH 1LILA 1EIBA 1EEQA 4RA3A 4ISVA 1BFSA 3F5WA 4C55A 2EXWD 3MROB 2CDFA 3O2VH 3MLYH 1E6OL 2HRPL 1S7XA 4XGZB 5FUOH 3RDTD 3GMQA 4LU5H 5FGCB 5IIEA 4XNXL 1CLYL 1QQDA 1QSFA 2JK5B 1WZ1H 2HJFB 4GUPB 5D2LF 3R8QA 2E27L 2B1HL 3UP1A 1B4JH 1FE8H 1OTUC 4FFZL 4H8WL 5E5MA 5GGTA 2BNQD 5D2NB 1AO7D 3VFTB 2M26A 3MZGB 1IGML 1L7IL 1B2WH 2EYTA 3BP6A 5E70A 4NDMB 3H3PL 2G2RB 3PGDB 5CP3H 2V5SA 5E2WL 4JM2C 1TJGH 1KIPA 1KLUA 1T83C 3MMEA 1DN0A 4Z8FL 1AD0B 3WDIA 4LKXB 1I1YB 5T3XE 3CFJB 3J7HA 3NZHH 4HGKC 1LO0L 5I15H 1S5IL 1U8LA 3DVNA 4Y89A 5BVJA 1G9ML 1NGXB 3OR7B 5KSAB 1DBKH 4KVNH 4ZNEE 5J6HA 2Z4QA 1XF5B 4XP9L 1JTTA 3IU4L 4OGAC 4WJ5B 4F7MA 1VGEL 3LD8B 2IEPA 1U0QA 2NX5D 4XCYB 1F45A 1FNGB 1T22A 1S9VA 4F33A 4PUBH 4YQXL 4O4YH 1GSMA 1E28A 4ETQA 1CGYA 4P5KA 2H26B 3LVEA 3RUGB 4OJFL 4WWKB 3S6CA 1HEZB 3ARGB 3BWAA 3LKSA 4ODHH 3T4YA 2M1KA 3OF6A 4JZNB 3P0GB 1BZ7A 3V0AC 1QFHA 3AROA 5EDXA 5MEOA 1XGQB 2BNRB 5J06A 5DHVA 3O3DA 1WISA 4ELMB 2Z31C 1HH9A 4Y1AD 1EZVX 4LCUB 1XIWD 4YBHA 5I9QC 5CIPA 3TO4A 4NKOB 4M00A 4WCYL 1YEJH 3PABA 3VFSB 3BYYA 3O6FD 5C07D 1X44A 1KT2A 4HBQA 2VXTH 1BD2B 3V9FA 2WQ8A 1OCWL 2EXWC 3GEWB 2YBRA 2B1AH 4G5ZH 2P45B 2OJZH 5TDOB 3RDTC 1J0IA 4GMSL 4JFFE 1ZVSB 4JPVH 5EORH 5F6HJ 5T3XH 4P5MB 1A7RL 5SX4H 4KI5E 2V2TB 1FP5A 1CDBA 4RX4D 2W9LA 1KCSL 1X7QB 2WAHA 1RQ5A 3C08H 3MO1A 1S8DB 4PV9A 2E7CA 4P59H 3UJJH 1BZ9B 4Y4HA 3HZKB 4F9LA 1JCKA 5TF0A 5HI4D 4Y5XB 3LEYL 1P84K 4X8JB 3S96A 5E0QA 1ORQB 5DJ2B 1X4XA 2N56A 3AXLA 4HGMA 2F9BT 2UWEE 4LLVA 4D9RD 4X6EA 4EXKA 1OAZL 3L3GA 3QJHB 2DMBA 4WHCA 5I1LA 3E3QC 4W4NA 5DVKA 4P3CH 4E41D 2JCCB 1G1CA 3FQXB 1T3FA 1XT5A 4P9HH 4B7IA 1ZAGA 4XZUB 2EDOA 1D6EA 2Q86A 2JB6B 4S1DD 1MCEA 5TF1H 5IMMB 3KLHD 1WFTA 3GRWL 3WJJA 5JPNB 3T2NL 1IBGH 1F4AA 1EZVY 4UIKL 2XN9B 4L1HA 2Z93A 4YDLB 4OIIL 3P0VL 1NSNH 3LN4B 4PTUB 5HGDA 5TQ2H 2APVA 4IOFD 4NJAL 3KPRE 3DNKA 5F3BB 3VDCA 4L5FL 4ZS7L 5DT1H 3GMOB 3GSNB 1BZQK 1F90H 1RUAH 4R2GD 1YNKL 3BEVB 3MPCA 4HAGA 1WBYB 1JF1B 5HDLA 1CT8B 3AU1B 3D3VD 1PLGH 4LMQI 5LVEA 4TUJB 2NYYD 3LKPA 2QV2A 4PJ8A 4KRNA 1EEYB 1TPXC 1NQBA 3GSQB 3B3IA 4YFDB 4UINL 1XIWC 5F7LB 2ZG2A 2ZUXA 1J1PL 1U91B 4YK4C 3O6FC 1HILA 1BQLH 5HPMB 4WI4A 4PJFE 3CVIL 3WO3B 4I4WB 4OIAA 3MROA 4WTZG 3ARED 1DQML 4CW1B 2GSGB 3SJVB 5FCSH 3IDNA 1FORH 2D4DA 1F4WL 2IQ9L 2GFBA 3LZFL 3HAEH 5DMKB 1UGNA 3CSPA 2VXSL 3HUJE 4OF3A 3MLRL 3PL6A 1BAFH 5FA3A 4GUPA 1BMGA 4WHTA 1Q72L 5DZOA 4JPWL 1G7MB 3FCTA 5D2NA 3EAKA 3VFTA 4LKCA 5HI4C 1MH5B 3JWDL 1R5IB 3SKMA 1RZIA 4B5EA 4Z5RB 4G6AD 1Q9KB 4S10A 4OZIE 3QIBD 1ZT1B 3UTPD 4DZ8B 1C16B 4ETYA 2BY0A 4S1QH 3QG7H 4YDJA 3V7AG 2HG5A 1I1YA 2E7MA 1MPAL 2CK0L 3ROLA 4FG6D 3O2WL 2GCYA 5FKPB 5EB9A 4ZUSA 3BRGC 2YD5A 1NGXA 3OR7A 4YAQB 1KG0B 5EU4B 3VRIA 5DJ6B 1A6TA 2IQAB 5MHSD 4DQOH 3KLHC 3L95A 2Q3AA 4Z7UB 3CJJA 4PRHD 4Y16B 3TBSA 1Z2KA 4QF1A 4PJDF 2XXCB 4LCCC 1AXTL 1BBJB 4XCYA 4TUOB 4IOFC 3KXFE 35C8H 1K8DB 4PJBB 2VL5B 3OKYA 1JWMB 4G6FD 2ZCKL 5IT2H 2R0WH 5DRNB 1UXSA 3IKCB 5CEXB 3DV6B 3MA9H 5KTEL 4UT6H 2RFXA 2YZ1A 4R2GC 4WWKA 1S9XB 1HEZA 4HWZB 3NH7L 5CEYA 2Q7YB 5HY9A 2CGRL 4JQXA 4ZPVB 2R0ZH 1RJYB 4JZNA 5DEFB 2GTWA 2HRPH 2NYYC 3UTTD 5I1HL 2V6HA 1XGQA 3MUHL 2V9RA 4XTRD 1CLYH 1BOYA 3HG1B 4ZUWB 1L6XA 4Y2DD 1IAOA 2NY6B 5D7LE 5JXEC 2E27H 1MIEH 2B1HH 2DD8L 3QDGA 3QXDB 1FJ1B 3HPLB 4FFZH 4MNHB 4NKOA 4H8WH 2MCPL 3UTSB 5AG8A 3CLFH 4TNWK 4UV7H 1PG7X 4M48L 4XVJL 1XR9B 1G1YA 3JV6B 3L7FB 1IT9H 5F8QC 3ZLQC 4S1SH 3BZDA 3AREC 3PP4H 4P9HC 3ARQA 3H3PH 4POZD 4OB5L 4NHCL 1DUYB 4M7KH 4PJHE 1YEDB 4G8FB 5FM5O 1IM3A 5GGQH 1NBYA 5I8KL 5C70A 2V2TA 4RMWA 2GQHA 3BMVA 4M93B 3U83A 4OCNC 4D8PB 43CAA 4HFWA 1S8DA 3DX7B 4HAFA 1D9KB 2NXZD 1G9MH 4TVPD 1GGBL 3K8KA 5D1ZD 4QRPE 3B9EA 5IKCA 1JTOA 1T2JA 3D39B 2J6EH 3MTRA 4JY5L 4Y5VC 4O2FA 3QIBC 4Y7MA 5DJ2A 3V5KB 4J3VA 4WGWB 2BRQA 1T6VN 4X5LA 5C0DA 4U7KA 3WFCH 1H5BB 1SVZA 5E8EA 8FABA 3QIWB 4FG6C 1NAMH 5FOBB 1FDLL 4I18C 4MJ5B 1U58B 3SDCA 2FCBA 4G6JH 1U2HA 5IROC 4ZO7A 4WO4D 5D72H 2Y7QA 2G60L 1VB9A 1G6VK 5HHME 4PRDA 3MUGB 3AM8C 3RIFF 5LXGH 4HKJA 4M8VA 4PRNB 3NIDF 3IDIB 4Z7VA 1MOEA 1JIBA 3U9PL 1O0VA 3I6LD 1I3VA 2PO6A 2YD8A 1SYSB 4R0LB 3GSNA 2YD3A 2DL2A 5E7FA 1WBYA 5DXWA 4LEXL 3P73B 1CT8A 1D7FA 2Q7NA 3ZT5A 5E6IB 5HHNA 1N4XH 2PUQT 4XTRC 1OTTD 1A7RH 4EZMA 4RWYL 3WLWD 1HZHL 4XC3L 4UU9A 4Y2DC 1KCSH 3BPLC 5F9OL 3P30L 4NQTA 2A9ML 4OBRA 2NY7L 3MV8A 4MZ2A 1ZA6B 2D0HA 3W0WD 3EOBB 3MRJB 3TVMA 3EJZD 5JXAH 2OK0L 4I4WA 2BXYA 2WW8A 4X7EC 1E4KC 5C9JB 3MYZA 3PWPE 4OI8A 2GSGA 3LEYH 3SJVA 4POZC 4X80H 2V7NA 5D96C 1KB5B 4JN2A 5BVPL 3K1DA 4BFBD 1IZKA 3KG5A 5DZNA 3MV7D 3H7LA 3RNKA 1MCPL 4XVTL 5FCUH 5ITBH 1OAZH 3O4LA 2J4WL 5HPOA 5FGBA 5C0AD 4JE4B 3DSFH 3OGCB 3B9KB 3QCUH 5C6WH 4V1DD 3FQWA 2NXZC 3CVHB 1RFDL 5D1ZC 1QG3A 3HI6L 2VISB 1RIVL 3G5VB 5GRYA 4Q97A 4JCMA 4Z5RA 4L3EA 1WZLA 3QO0A 1KTRL 3N1QC 2KKQA 4BSWB 1QBLH 4KDTC 4A6YH 4LVOB 1EAPA 5C0GB 3E6HA 1RJCA 5ALCH 5ABDE 1U8MB 3B2VH 4YWGH 4Q9RH 2QQKL 4YE4H 1CD1B 4XPHL 4JRXD 2BK8A 1PZ5B 1YNKH 5IB1A 4YAQA 4UIMB 1KG0A 2OJEB 3QUMH 4X4YB 5DD6B 4KRLB 2FH8A 4Z7UA 1WSST 3E8UL 5F72S 1OHQA 4JEGB 4QYOA 4RWHA 3OB8A 1DL7L 4WO4C 3C2AL 3QUXB 2CPCA 4TUOA 3FONA 2ICWB 5AWNL 4K7PH 2NW2A 3KHQA 2VL5A 5KAQF 1IGYA 1JWMA 1J1PH 1NCWH 2BSTA 1VADB 4NQEA 2VE6A 2DYPD 5DRNA 1IRAY 3OBAA 2R1XB 3MNZB 3P40A 3QUYB 3W2DL 2WV3A 5L2KD 1FGVL 1CDUA 4GKNB 3GNML 5J12C 1EX0A 3VFUB 5SWZD 4UT9L 4PJGF 1CYGA 1F4WH 2VQ1A 3LZFH 4P9ML 1JBJA 3O6KH 2EC9T 4ZAKD 5DSCA 1OTTC 3WLWC 5B4MC 4ZUWA 4HPOH 2GJJA 3ES6A 15C8H 1BQSA 4XNUH 1MRCL 4JPWH 1AGFB 2BVYA 1FL3B 1JNHA 2PR4L 4NQSB 3WE6B 5F7HA 3F65A 3EJZC 1XR9A 1E27B 4JHZA 3B6SA 3EO9L 3LKNA 1A14H 1Q1JL 5BV7B 1NUDA 4IRJD 1OPGL 3NPSB 1Z5LB 1H0DB 1UJ3A 1OARL 3C6LB 5CP7A 5E56A 2L7UA 4K94C 5HDQL 2GAZA 1MPAH 1RUPL 4NQDB 4D8PA 1A02N 5C8JB 1S7VB 4PGDA 2FEEI 4KY1L 1LEIA 5IVXB 4GRLD 1JNLH 4PR5A 4LIQL 4JFHE 3WN5A 4AEFA 5SWSE 2QSTA 2R29H 3P4NB 4ODXB 4ELKB 1QFOA 3QWRD 2XRAL 5DRWB 5D71H 5HHOB 1RZKC 3FN9A 1AXTH 4HJJH 3V5KA 2W59A 1DBJL 5MEQB 1UCTA 2DKUA 4C56A 2ZCLL 2Y25A 1P7QD 5D1QB 3V4VL 3L6FA 3GJEB 1KPVB 1ZHLA 4L3AA 1KBGL 4MD4B 4PG2C 4GRWH 4U3HA 5I1JL 3GBMH 1FVCA 2CGRH 1YN6B 5H94A 1MFAL 3EDEA 4FHBD 2VWEE 4GLRH 4MMXC 1ZSDB 3BPNC 1K85A 4NRZB 2WSKA 4UOJA 4IRSD 5E2UL 1HN1A 5DWUL 1UM6H 1GZQB 4OZGA 2MCPH 3MLVL 1BFOB 1G7HB 1SYSA 2V2XB 2AJUL 3LKOA 3H9SD 4LRNL 4M6OH 2P8MB 1IC7H 2G9HA 1KYOK 2XTJE 4P2OC 4Y8DC 3P77B 3G08B 3ZDXE 4JLRB 3X11A 1CICD 4PGEA 4U3CA 4ZAKC 3CNKA 3CPLA 5I8KH 4NBZB 3BKCL 3WFEL 1TVHA 1MI5D 3MRHA 4BQCA 4HT1H 4K8RH 1I1AB 3RWFB 4WW2B 2GY7B 1QTYT 2B2XH 1ZA6A 2A0LD 1CK0L 1HINH 1YEGH 2GSIA 1QOKA 5I1EH 4RFOL 2VR4A 4Y4KD 1MY7A 5C9JA 4NOFA 4JY5H 4IRJC 4YO0A 4RFNC 3V8OA 4QRRE 4MCZB 5J56B 5I1GL 3RKDD 1C5CL 1RZFL 4UNVA 4HQQL 5GS0D 4P3DA 4FQIH 2DMKA 1P84J 3CFBB 3GJFH 3GMLA 2YR3A 3L9RA 3IYLW 4NC2B 3T77B 5HTSA 3BHBB 4XNZB 2DWDA 3FB7A 4CMHB 1HWHB 5DD1H 5L7XH 2VQTA 3MZTA 1DVFD 3NFPB 2R0LH 4ZFOL 5I75B 3TBVB 2ZJSL 4OZ4A 2G60H 5GGTH 4BSWA 1A7BA 3RWCB 3NACH 1RHHB 1SBSL 1A6PA 1QFWL 3PV7A 2JJVA 5ETUA 1U8MA 1SJHA 3QRFM 4Y19E 2PYED 3FOMA 4WFFD 3EDKA 2DI7A 1JYVA 3BN3B 4G8GE 1PZ5A 5KVEL 4UIMA 1N7MH 1KJ3H 4R4NC 4J12A 4OZHE 1ZA3A 2IALA 1PG7W 4BQBA 5GGSA 1RURL 4L29A 5TJWK 4P4RB 3G6AB 5EBWB 5KN5A 1A0QL 3QUXA 5K9OB 3LRGA 1C1EL 1R3KA 3VFMB 3GSUB 1ZHKB 4PTTA 1QSEA 3VXUA 2K7QA 2DWEB 2LFGA 4ODSH 1FVEA 3HI1A 1MHCA 3KPQA 4PD4J 3VRJA 3O3UN 4XPBL 3S4SG 4WW1A 5E8PB 3MNZA 3QUYA 2F53E 3VW3L 2IH1A 2H8PA 3ULVH 2OK0H 4FTVB 4L4TD 4PRPA 3IF1A 1KCUH 1PY4A 1V7MH 1JUFA 1FZOB 3VGBA 1ZEAH 1CICC 5B8CC 3VXMB 1EBPA 4RA0C 2EIZB 3WXWH 1RSFA 5ICZB 1QSFD 2XZQL 5DD3L 3DURB 3RPKA 1XF4A 2J5LB 1MCPH 2GY5A 3SY0B 5GRUL 3MLSL 5F9JB 1ZLVK 2VMFA 4L8CB 2L4OA 2A0LC 4UILL 1AGFA 5IWLC 3RIFK 5HGBB 1SMOA 4KKBC 3GSXA 4GKOA 3LB6D 1E27A 4Y4KC 4N8CH 4WTZA 3SEPA 3MCG1 4N0YL 3UPRB 4FQPA 2Z8SA 1LEKB 1UACL 2P46B 2XZAL 1I8MA 3RKDC 1U8HB 1DLFH 1Z5LA 3C6LA 4U7MA 3HS0B 1EH9A 3W82A 5GS0C 3CMGA 3VXNA 4QRSA 1KJ2B 4U6YA 4NKIL 1XCQA 4BSVB 4NQDA 5CJXA 1D5ZB 1P9MA 1EEUA 3ZDZF 4XPHH 4BSJA 5ACLA 3PDGA 1NJ9B 5IP4A 3P4NA 3MYJA 2W9EH 4MA7L 4FZEL 5ALBL 3UBXI 2Y5TB 3ULVD 1XGPA 3RA7L 1DVFC 4ELKA 5I8OL 5DD0L 2XZZA 1DL7H 2ZUQB 1NCTA 4XP5H 1VFBA 3C2AH 2I9LA 5MEQA 4PJEB 4JY6B 2P44B 3F7RA 5IBUG 3DIFA 1OB1A 1O5DT 3QFJA 5F9WC 4EUPA 3GJEA 1DFBL 1KPVA 2P5ED 2VN4A 4L4VA 3U6RA 3IFLL 3CDFA 3S3PA 4JGJA 1GCFA 5EOQH 1Y6MR 5ISZB 1FGVH 1U93B 3OF6D 4ZUTB 3GNMH 4LBEB 4RRPG 3SDXA 4UT9H 4MNQB 4MAUL 3AMLA 1YN6A 3TFKC 2CRMA 1J87A 4BM7A 1FBIL 3DECA 4Y5YA 3MRDA 4GQ9L 3SHSA 3UTZB 1B0GB 3TO4D 2F5BL 3VD5A 1GZQA 3S35X 5GS1C 3X13A 1NFDB 4ONOA 4X8XA 2ZNWA 1IKNC 2E9JA 3RWIA 3SE9L 4HLZG 2EYRB 1KJMB 1AGEB 1KELH 4NM4H 3E6FB 4IDJH 5HDOA 4N0UA 3G08A 3SGDH 3I50H 2VDOL 4S2SB 3LEVL 3LV3A 5IVNA 5E08L 2O5ZL 4DWHA 1DQTA 3G5XB 1BM3L 3QBTB 4MVBD 3GMRB 4MA1C 3FB8A 4Y4HD 2YPKB 3BKML 3V4UL 4I0CC 5BXFB 2YA1A 4YHNA 4L9LA 4LEOB 2AJZB 2Y6SD 3MJ9H 2XRAH 2FYYA 4OLXL 5IK3A 4U1KB 2XKNB 3C9NB 1ZTXL 5E6YA 1WITA 1L0YA 1FHGA 5TPWH 4LL9A 1HH6A 3HFML 2R1WA 1U3YA 4GAGH 4HWBH 1YEIH 3TWCL 1MCOL 5C6TL 3U36A 5I1JH 4XPGH 4LLMA 1VCAA 3SKUD 1BJ1J 3TM6A 1FVDB 1G7PA 3DX8A 1V7NL 3ULVC 5C2BH 2OYPA 2E9WA 5I17B 5DJXB 2GJ6A 2PW1A 4JAMB 5F1NA 4U1SB 2D03L 4X7SL 3SO3B 4LLYA 2HVKA 1B3JA 1KIRA 3FO1B 3IDXH 4PJCE 1FNEB 2XV6B 1M05B 3LKQB 4RMUA 5B22A 4UT7H 4LDLB 1NDGA 1F4YH 1Q38A 4NM8H 3GK8H 3MA7B 4PV8B 2N7BA 4LRNH 4K23L 3WXVL 5EN2A 3ROOB 5D2LB 2DLTA 4PJ5E 5IGXH 1MY5A 4PJ8D 5KSUB 5EZIL 3T0EE 3BD3A 3X17A 2UWEF 1CIDA 2X4QB 5EBWA 1IJ9A 3WFEH 1PD6A 3TO4C 5GJTH 5DQDH 4BA8A 4ZTPH 4HJ0D 5CCKL 4DVRL 5KOMC 3IDYB 5DI8A