4TSSA

Toxic shock syndrome toxin-1: tetragonal p4(1)2(1)2 crystal form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
total genus 42
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4tssA01
1TY0A 2O2LD 1LTAD 2G9HD 1LT6D 1V1PA 1LT5D 1JWSD 1TS4A 1LTBD 1JCKB 1PZJD 1M4VA 1PTOF 4K6LA 1PTOH 1SJHD 2XN9C 1JQYD 1RDPD 2AQ1B 1LLRD 2AQ2B 4UDUC 1S5BD 1JWUD 1UUPA 3BVZA 4RGTA 1G8ZD 1SEBD 2Z8LA 1FNUA 1KLUD 3CHBD 1I4RA 2SEBD 1MD2D 1D5ZC 4RGOS 1LTGD 1BXTA 1T5XD 5D3IB 3MFGA 2R61A 3TSSA 1S5CD 4RH6A 1PTOD 4RHSA 1DJRD 1PTOB 1YN5A 2QILA 1HTLD 1F77A 1AW7A 4RHRA 1EWCA 1TS2A 4C56C 1BCPD 4Z9CB 1UNSA 1BCPB 4TSSA 1DYQA 1HQRD 1SE3A 1EEID 2NTTA 3O13A 1STEA 1I4XA 1YN3A 1L0YB 1V1PB 1RCVD 2CHBD 1I4QA 1BCPF 2XNAC 4RGNA 4L6TB 3EA6A 1I4PA 2RDGA 3MC0B 1ET9A 4O1NA 5D3DA 1TY2A 2TSSA 3DWPA 1SXTA 1TS3A 4DXGA 1I4GA 1S5FD 5I4DA 1RD9D 1JWMD 3DWAA 1S5DD 1AN8A 1LTTD 3OWEB 4L63B 2J4XA 3V05A 4ZYSA 1D5XC 1LTID 1L0XB 1XXGA 3BVGA 4OHJA 1JR0D 1PYWD 3DWQA 1PRTD 1D6EC 1QILA 1PRTB 4RCOA 5ELDA 1EU3A 3GP7A 5FKAC 1CHQD 1XTCD 1S5ED 3R2TA 4RGMA 4RFBA 1PRTF 3R8BA 1LO5D 1EU4A 1FGBD 1LT3D 1PTOC 4BWGB 1B1ZA 2IPKD 4DXFA 1ET6A 1HXYD 1TS5A 1YN4A 5FK9C 3KLSX 1LTRD 1FNVA 3R2IA 5ELEA 1KTKA 2RDHA 2NTSA 2XRQD 1ESFA 1LTSD 4NZLB 1B44D 1HA5A 2XRSD 1SE4A 5ELCA 1KLGD 1SJED 3EFXD 1EEFD 1I4HA 3BYYB 5ELFA 1GOZA 3BYTB 1SBBB 1CQVA 2QEJC 2WV6D 3BVMA 1PZKD 1V1OA 3SEBA 1SE2A 5TSSA 1CK1A 1CHPD 3W2DA 2ICIA 3URYA 1PRTC 1CT1D 2AQ3B 5ELBA 1ENFA 1PZID 2IJ0A 1BCPC 1RF2D 1D5MC 1FD7D 1FNWA 1LT4D 1EFID 3BZDB
chains in the Genus database with same CATH superfamily
2OTJA 3VHTC 2O2LD 2MBOA 4I6LB 3U50C 1EF5A 2KLCA 2JYTA 2A6EC 4JLCA 3SGIA 3AEDB 3P1MA 3IFTA 3WAPA 1VS0A 3CCQA 2LHEA 1JCKB 4K6DA 2FFKB 2Y0SG 4DGZA 4IFDG 2MBBB 2F0HA 1F2ZA 4K2KA 1AZQA 4B9KA 4JW0A 4OVVA 3TUOA 4ASWC 1K52A 5C4HA 2GI9A 3T4AC 1VQIA 2RSNA 3APCA 3ZLZA 1XX8A 3PZ8A 4KSLC 4J8QA 2BS4B 1IBKQ 2V9HA 4JI4L 2NVTH 4HXDA 1DOXA 2HJ1A 4JI2Q 3SFEB 4BBRH 3LGJA 2F0QA 2HQLA 2GBNA 2I5MX 3H8HA 3G71A 1TVXA 2A6HC 2ZNVB 2FIFA 3HRDD 2K9XA 3SHQA 3A7LA 2DHZA 4ID6A 2WKCA 1D3ZA 4FXDA 2K3UA 3CF6E 1SSOA 3EBEA 4EX5A 3Q6SA 3MXUA 2IY0B 3AH7A 2EKEC 1R4MI 4LF7Q 1FJGQ 2NTTA 3M95A 2QIEB 2K14A 4DAYA 1C8CA 3NE5B 3TMPB 3RYTA 4RG1A 3Q8EA 1ET9A 2N88A 3UE0A 5IY0A 1R4QB 5A2QE 1L0WA 4HR7B 2NCNA 2HIVA 3H3VI 2NBVB 4BKGA 2WAQB 3U58A 4YSYB 1TIID 1Q1EA 2FCMA 1IYJB 3A9JB 4DK1A 1WGDA 3QG1A 3NG0A 2ZXRA 1HEZE 2WX1A 3V05A 4GB9A 3MEHA 4FXKC 1KRSA 3NSWA 3LX0A 1PRTD 2XSCA 1PRTB 3MXNA 3HKZG 4JK1C 5FKAC 3NZSA 1A5RA 2ZM6Q 4PMCA 1WE7A 1GC6A 3A55A 4ZQ3A 1AWDA 3AU5A 5GQOA 2RDBC 5DPTA 1I50H 2V4IB 3OWFA 2EYLA 2VNUD 2YEPF 4KY5A 2LVOA 2JYEA 3U52E 2B2TC 1YMHE 3A33B 3M63B 3N1ZC 3U7ZA 4TQ0A 4FJZA 4ICVA 1BQQT 3ZGZA 5I9OA 1HUMA 5HHDG 4X65L 2KJ6A 1P8LA 2NZ1D 1YNJD 1P3QU 1S3SG 1WJNA 4DV5L 5FLMH 4XYQA 1D7QA 5IT9c 5IN7A 1PH6A 2BA1A 4H02A 4JGHB 2DZKA 2A69C 2F4IA 3R7RA 1TWCB 4JI8Q 4C7ZA 1B44D 2KN5A 2LZ6A 1XLOA 2N7DA 5EDSA 4IUTA 2R7FA 2M0AA 1ZYRC 1CTMA 2L1BA 2LXJA 1Q5WB 1QCBD 3DVGX 4JBMA 3ZXRA 1L6VA 4URKA 1R4MB 3DBSA 1CUKA 1WFYA 4X66L 1WYWB 2B2VA 4AUQC 3EN2A 3T56B 1V1OA 4DV0L 1TKWB 1IW7D 3N32A 2FUHB 1I3QH 2E2HH 4B08A 4C4VB 2CH4A 2IO2B 5CMDA 1X56A 2ICIA 3PIOA 3KUZA 1O7LA 2VQFL 2G45B 4QY7A 4DNIA 5FLXL 1KXLA 1WWTA 3FMCA 3ULPA 3EC8A 1YJWA 3SR1A 3CKIB 3GS2A 2LFIA 2WHIA 5HI1A 2AMCB 2EXDA 1T0RC 1OEYA 5J2RA 3HOWB 5DM73 4KDLB 3FAHA 5AUKA 3I3CA 3PHWB 2MHJA 1BOSA 1VQAA 2JXMB 3DWMA 3E0EA 4MJSA 1X55A 3CQZB 3I56A 2WP8J 3D32A 3AMZA 4K81A 1G2TA 4QGUA 4R3DA 3RMHA 2EXZA 3KK7A 2KDBA 4DPGA 1V9PA 4QUFA 3A9KB 3CD6A 1S4ZA 1X3QA 4BS9A 1IL2A 3NXWA 1TR5A 4W9KA 3SK6A 3NQIA 5JHBA 4JC0A 1SAPA 4FLHA 3RULA 2RSOA 2BW2A 3Q0AA 3S2DB 4J6IA 2IW3A 3LWUA 4ZLTF 1XMOL 4BFRA 2NN6H 1RKNA 3A4SC 2UXBL 1WXQA 4OONA 3IBEA 2KA7A 5I2YA 2UXDL 4ZYNA 3UI3A 4X62Q 3ZW3A 2J7ZA 2BKFA 2HD3A 3Q22A 2KBNA 3O65B 4KDIC 4A4IA 3OHXC 2J0JA 3ML8A 2F0MA 1DYQA 4Q5VA 1QT9A 1Y1VG 4KD3A 4M8AA 5LL6S 4B0EA 1JW9D 2KLGA 2EY5A 3UF8A 5BMIA 2MPMA 3J81c 2B2WC 3J81j 4K14A 1YJNA 2MNAA 1V5TA 4HCPB 1WTQA 2LUEA 2WKDA 3JC66 5EKIA 3OTOL 4DR3Q 5KHOA 3UDXA 2F0FA 3OWEB 2KCNA 2EQSA 1HR0W 4K0KQ 2MBEA 4IOIE 3UDGA 3QA8A 4G57A 2C9OA 2XWBB 5LXHA 3NHHA 1N32Q 3IAYA 1MGSA 2J0KA 3B08A 4IJLA 4A93H 1YJ9A 2MJEA 2VUMB 1BMLC 2Z59B 4M01A 5IP7H 3SR6A 1YNND 5D94A 5J3BA 1OQQA 2LGIA 1JE4A 1WYDA 5C0XJ 3Q3JA 5TR5A 1GUSA 5C6AA 2D3BA 2DYBA 1CKOA 4XT1B 1WRDB 3S1NB 1ZKOA 1HFNA 3DUZA 3NJTA 3KOJA 1OO9B 4YCWA 5M3MB 4LF8L 2K8HA 4DV7Q 5IE8A 1WGKA 3I4MB 2NWGA 1EQRA 2EYHA 3UE1A 1KAAA 4X3SA 1N5WA 2UU7A 5EGTA 5IT9E 1IBMQ 4NZLB 3JSVB 2G4SA 3MVVA 3QOLA 2LUMA 5C44H 3PGEA 3ALBA 4JV5Q 4MGKE 4XDDA 4C00A 1XQQA 1HNWQ 4KV2A 1B3AA 4W9IA 1SSNA 1ZW7A 1TWCH 2C7MB 1FXIA 1PZKD 3A8IE 4EQPA 4Q2JA 4C1NI 1SFOB 5FLXc 2Q8RE 2JA7B 1KC8C 1JC7A 3NBHB 4C3JB 2D2QA 3PRMB 2MO1A 3I90A 2B3AA 1EZ8A 3W1YA 5GAGC 3CXCA 2GB1A 2FAZA 4ICUA 3PO3B 4HIKA 3AM9A 1V1QA 4C3HH 1JJGA 4C7YA 2Z0DB 3KJOA 4V190 3VUYA 2KMCA 2K33A 3CIRB 1JQ4A 3S2HH 2LMCB 4NP5A 1Z2MA 4L2YA 3U2SC 3P75A 3H3VH 1L6UA 4LF9Q 4KX6B 2LXKA 4KZCA 2ZTCA 1DOIA 3FKIH 5JXVA 3PSIA 1JORA 3K9OB 1HTQA 1M4VA 3L10B 2D62A 2KYWA 1WGHA 1UAPA 3J7AF 1PYBA 3RUIB 5E1FA 3T16A 3M4QA 1QNKA 2F4VL 3SE0A 2DJFC 1B8AA 1LLRD 2L9HA 3RLOA 3T53B 4DV1Q 2L12A 2DYMA 1SR3A 4XTCS 4EZKA 3L9AX 4WAAA 1BDOA 3RT3B 2JA6H 3KDFB 5CR3A 5IGBA 3Q8FA 5AUIA 5EAYA 2Z8LA 3U4VA 4GZYC 5JPMC 1WGYA 1LYLA 1UD7A 4LF4L 1E2ZA 3D4RA 3AV8A 1QE6A 3PUZA 2A5UA 1OXUA 2HHHQ 4IWQA 1A62A 2IO3B 4RH6A 2C9WB 2JWUA 3AMUA 3TJPA 1HTLD 1WCMH 5HKHA 4PZ6A 2R6GA 1EWCA 3E3XA 4BY7H 1VQKA 4MHEA 4US8A 1FR3A 1YNJC 2OQ0A 4GNXB 3M4YA 3PQIA 1XJVA 1GUNA 4OIKA 4A55A 5IYDG 1V1PB 3GQBA 2PNRC 4BBSH 2CHBD 1C4PA 1E8YA 1GJZA 2K6QA 1H9MA 3AB9A 4QMGA 4GDLA 4IW0A 2RDGA 1P1AA 3NRZA 5D3DA 4X64L 4PNYA 3BY4B 3J81E 1MJCA 1R7SA 1IZ6A 4L8JA 4BXXG 5C4XB 2CQOA 1RD9D 1P7EA 2WXOA 2D5GA 3S15B 2Y5CA 5G2NA 3S1MB 3HHMA 2Z4IA 1IW7C 2BH2A 5JJIA 3LDZE 2F0VA 4PS7A 2MBQA 1PH4A 1R9TH 4OHJA 1UE7A 1Q0WB 2B2VC 4OX9L 1SIJA 3OMCA 3DEPA 1J7CA 1EU3A 5KGUA 2KMAA 3H3VC 3GTMB 4XXEA 5EE0A 4DBGA 2RA4A 3CMEA 4GOPB 5CV5A 4S0RA 1DM0B 4HIMA 4A3BB 3N20C 4WAFA 1K50A 3ZJYC 1NYRA 1TGZB 3T3OA 1VZ7A 4C1NK 3FDTA 1HXYD 1YN4A 3PGZA 1F9JA 2H5XA 2J0MA 2I1KA 2HD5B 3RN2A 5E6OA 3KWLA 2Q8TA 3A1QA 2D10A 4KSKC 3R3MA 1NI3A 1YIWA 4DU9A 1G51A 5LL6X 1K8RB 2ACZB 1BO0A 2FMMA 2PQAB 5L37A 1KQSA 2AYOB 4FN2A 1QG7A 1SE4A 2V3NA 1P0RA 4DKAC 4EZJA 3T3NA 2K8BA 3BYYB 1LXDA 5ELFA 1GOZA 4JYAQ 4NB3A 2YYZA 1FXTB 5D6JB 3PF4A 2B2YA 2F03A 1GXDC 1CK1A 1HR0Q 5DPWA 3GV3A 2F0GA 2WB1B 3HOUG 1HQMC 3NK9A 2FUG1 2HE7A 3MEFA 1RAXA 2R7DA 5BR8Q 4Y7NB 3Q24A 4DV4L 2JUOA 1OQRA 2BT6A 1CSPA 1RIPA 1EFID 1WR6E 2ES2A 5CV6A 4POFA 3ICEA 2FINB 2MHVA 5IODA 5G55A 1U0LA 4TQUS 1SE9A 4IM0A 4NXML 2WINB 2AHOB 2Q2HA 5EKLA 1EWIA 2HUGA 3TDQA 4II2B 4MN3A 4HROA 1PTOF 1E1OA 2PI2E 4FVMA 2Y0SE 4X6AH 1ZXHA 3H7PB 4LWCA 1Y1WH 1IYVA 1JQYD 2JEBI 3AFPA 2CW0D 3K5OA 4DK0A 1SMYD 4N9PA 1J19A 1J5EQ 4ANWA 3ULJA 1EY8A 5DM63 4GGQA 4W9HA 3K8AA 2AUKA 3KF8B 4KY6A 3J9CA 3L54A 2KNBA 5C3EG 1GB4A 5E3FA 1SYGA 3N9YC 1E10A 5EKKA 1YNNC 1BXTA 2E2JH 3CW2C 5KYLA 2NBFA 1EZ6A 2Y5BB 1SN8A 1F9RA 3MXPA 4MTKA 5IYBH 4NXNQ 2A8VA 3JYUA 4K7WA 2K5QA 2KFKB 5CHVC 3TEZA 1CSQA 1HHVA 3I4OA 1WZ3A 4JBWA 2MWSB 4TMAB 5JOBA 1VQ7A 5JEAH 4LNFA 4RA8A 2X8XX 1VQNA 2A4ZA 5M5YB 2X6LA 2NVXH 1I4QA 4DNTB 4TQ1A 1A3VA 4XYCA 2N9LA 4YTPB 3F2DA 3C8YA 3MC9A 5HFYA 3LNNA 1XTDA 1V8CA 3EGRA 4KKJA 1RHPA 2I1JA 1WI0A 4K3CA 5EBDA 3RZDH 3PLVA 1S5FD 4BBNF 2B2UA 4A3MG 3HOVH 4ZK9B 3A5ZB 3LJ3A 1NMGA 4H44C 3GOEA 4GKJQ 3H9DA 4XZ4A 1H9SA 2BGFA 5FR6A 2CFMA 3BVGA 3Q8DA 4AYBB 1YQBA 2BDNA 1RODA 4FF4A 1PYWD 4OWTB 3S15H 2D3CA 4KK7A 1QILA 4OXPA 1FRDA 1Z7TA 4QCLA 2EOTA 5I6WA 3HKZE 4NKLA 1UWMA 1UH6A 2KTRA 1S5ED 2WDRB 3K5NA 2Z0SA 3MTSA 2KD0A 5AZGA 4DR1L 1HNZL 3D6CA 3CSFA 3TP6A 2WXKA 2KMMA 3WCQA 4YT0B 4IQZA 1WRIA 2JX5A 2XBBC 1G6PA 4HK2A 1H9KA 5C3JB 3PTFC 3UGBB 1XD3B 2BYTA 5EPKA 3TQYA 4F8MA 5JPNC 5A2QL 2K8CA 4OO1G 4A3FG 4EOYA 4C2MH 3TP5A 1EO6A 4N9F4 1E2WA 5C0XG 5ELCA 1X54A 2JP1A 4UP7A 3L17A 3ONSA 2G1EA 1UWVA 3UQAA 3ZDTA 3BYTB 2B63H 1VZ6A 1TWGB 2LHDA 4LNNA 2FE8A 1TT2A 2VS1A 1FPYA 4DR5L 4OW0A 2N7JA 5TSSA 4WJWA 1JRUA 3SK5A 1I6VC 4FDBA 4JBKA 5CC4A 4RM9A 3FPUB 2BBCA 2GA4B 4ZRJA 1CT1D 2O2VA 2OCEA 2I5LX 5JZEB 2YU9H 3I63C 1FNWA 3D4WA 3ZJUA 1H4RA 2M9VA 4IFDI 1BUVT 3FILA 3ZJVA 2PVOD 2WNMA 1WJ4A 1SNPA 3A8JE 4F7XA 2WU2B 4NJ6A 4BY1B 4MH8A 4KMUC 3SK4A 1VF5C 1GJXA 5H92C 3AE5B 3ZIMA 4FF2A 2N9XA 4A3KB 2EY6A 1C4CA 1WM2A 2N8NA 2XGTA 1Y8NB 2MQJA 2IGHA 2NR2A 4LF5L 2MA9B 2UUBQ 5JJKA 2K1BA 4LNKA 2KHSA 3J7A5 2WDTB 1JJ2A 3R66C 3T51B 4A3CG 3VRBB 2AQ1B 2KECA 5H1SE 1HZ5A 4DK3C 3AE7B 3CPFA 3F2BA 2I38A 1SLJA 1UUPA 5ISRA 1T9HA 4KHVA 1I42A 3HOXH 5JH5C 3CCRA 1SNOA 4ALPA 3C2PA 5IGEA 2R92B 3RN9C 3R7QA 1N36L 3MFGA 2ZJDA 5AJ3L 3T1HL 3VA7A 1R4PB 4JPBW 4ZKCB 2E5LQ 1OQYA 3M3JA 2NPTA 4NQLB 4C56C 1FXAA 4KIKA 2C60A 3CMMB 3PMFA 3MHZA 3U9SA 1EEID 3T1YL 2QA4A 5M5XH 1XNQL 4ZUIA 2NVTB 1KRTA 4A3EG 4HTHA 1P9DU 1RWSA 1LUZA 1NNXA 4R8IA 4BBRB 1XLPA 2PI2A 4CDFC 5C5LA 1A15A 4GLAC 5LLIA 4W9DA 3MAQA 1Q81C 1ZYRD 3NEMA 5IGGA 3CCUA 1K8GA 2MBHA 4LFAQ 1EY7A 1F9PA 2MRPA 3APFA 3IHPC 3K7AH 4N8FA 1LTTD 1N5XA 2Q2UA 4YHHL 1UE5A 2KANA 2WWZA 2WYQA 4JE3B 2CCZA 4G11A 2KUMA 3ABVB 1D5XC 2NVUI 1CKMA 2KDIA 2WAQE 4JI6L 2B2YC 1HNXL 1QOAA 1CHQD 5EPJA 3UDIA 4GDKA 3NVVA 1F0ZA 1ACCA 3A7AB 4K5WA 2JA8G 2PW5A 3K80C 1I35A 2IPKD 1C9FA 3RN5A 2RF4A 1S40A 1QLBB 4LDTD 1TWFH 4LDTB 2DGYA 2YTXA 1GVPA 4A3LH 1JOQA 3PIP3 1VQ4A 1VQCA 2CW0C 3QWNA 1I94L 1SMYC 1EIYB 2K39A 1XCTL 2HTME 2M19A 4HCNB 4JI5L 1I50B 2BQQA 4PG3A 1A2TA 1TZOA 1PFBA 1YEZA 4K2LA 4RKLA 1NR2A 1FCCC 1UE6A 2DY7A 3G6EA 1WXAA 1L7YA 2OHFA 3ZXVA 1GKHA 3MZ5A 2B29A 5HURA 4B3ML 5FO8B 1DZ1A 2KKCA 2CWPA 3AI5A 4AWJA 2G9DA 3IFWB 1ENAA 1XO3A 3IG3A 2UUAQ 4DR6Q 2C7NB 4KN7C 1A3UA 4ZKBB 1IGCA 2RMMA 5KNDA 5DAUA 1PZID 2O6VA 4B3SL 2NN6I 3D3RA 1WD0A 1VQJA 5L95C 4LFBL 1STAA 5FO7B 1FVIA 3A0JA 2PJHA 3RNCC 2LXAA 5G3LF 3QO2A 5C4JH 4A3GG 4QIWB 2O6VD 1MHHE 3RD2A 4EVOA 5M3FG 3I91A 2ZW1A 3NVWA 1WOCA 2RQXA 1VQOA 2R7ZG 3VQIA 4W9EA 2EYPA 1LTBD 1TWAH 1U5KA 3PUYA 4LJPB 1I3QB 5IT9L 2EVBA 2E2HB 1N60A 3VUXA 4A3OA 3IFDA 2C7HA 3KYCD 4LNIA 1OTCA 4F8CB 4I6PA 4NAMA 2B2UC 1WMHB 3ZNHB 4WWOA 3NENA 5BN5A 2X6GA 2A73B 4FO2A 5A35A 1PH5A 2ASQA 1HZ6A 2MP2A 2ZEQA 2PEAA 2VZKD 4HJ8A 1AEXA 5LMUQ 2VZKB 3BZCA 1MFWA 4A3DG 1X6OA 3Q3MC 3MWYW 4RMAA 4TVAB 3P4RB 5COYA 3NTHA 1HTOA 4X65Q 2JA5G 5EE3A 4UHVA 1SRUA 1DJRD 1PFDA 4E3CA 2JRIB 3L13A 5IWAQ 2R92H 2KO3A 4GKKQ 3QX1A 4Z9CB 3Q3OC 1YX6B 3P63A 1E8ZA 2O5JC 1VQMA 2BTEA 4ME3A 4DA2A 5DEHA 1MG4A 1JE5A 2MH7A 3WA0A 1HH2P 3C3LA 1Q86C 1FCLA 2BS3B 2YVCA 1EIFA 2PW7A 2OJRA 2UU9L 1SIFA 4LMQD 4USAA 1TS3A 3AEVA 1ZEQX 4DXGA 1A6XA 2AEHA 1YBYA 4A3JG 1QZGA 2EZVA 2MW5A 3EROA 2B76B 3I3TB 2KK8A 4LJZC 3TEHB 4BKSA 1E0BA 3RZWC 2VQFQ 1P7FA 3HEJA 1WTWA 1AE2A 3E0JA 1L1OA 3CCSA 4IFDH 3HGBA 3AEEB 3AU4A 4JIOU 5HGQA 4KVGB 3W1SA 2PYKA 1CA6A 1K83H 1IUEA 4ZOHC 3VR2A 1D1IA 3M3YH 5GAEC 2HT1A 4XYOA 1PH7A 1DD2A 2IT1A 2H88B 1CQFA 1QWYA 2ONQA 4PYZA 3UIOB 4R4IA 4TV3A 1GUOA 4JWUC 1VDZA 1VQ6A 4B6WA 5CV9A 4CJ1B 2D3AA 2K5NA 1JICA 5ELEA 3EFUA 4I65A 3EQLC 3PLUA 4DXAB 3CSTA 1XLQA 3J81L 1CMXB 4DHZB 3E6ZX 4K7UA 4A93B 4LNQA 2AL3A 2JF5A 2QDFA 1QUQB 2VRRB 3E56A 3TIXA 5GADC 2JJQA 2E75C 3SEBA 4YWMA 2R93G 1WTPA 5JJLA 3MXNB 3N52A 3BIID 1L4ZB 1H9RA 2DZJA 4FYDA 1C78A 5KNCA 3LXFA 4IUNA 4OIJA 4HSPA 4BA1I 1UBQA 5C44B 4DR2L 2N0SB 3ZRCA 4NQKE 3EJIA 1NAPA 3WAOA 1BBXC 3TBIB 2CR5A 3I4NG 2KCMA 2EELA 3NP8A 2L0TA 3HOZB 2FCQA 1E7ZA 5DPRA 4IM2A 3J81i 1TTNA 1XYIA 2CH4W 5D7GA 4DR4Q 3RNAC 3SVMA 2XN9C 4XQQA 4DUZL 4DR7L 2IO0B 2Z6KA 1SROA 2QEXA 4HEA1 4J15A 3IT6B 4C3HB 5IYCG 4IOCA 2PQEA 4HMIA 1O7IA 3DHIC 4J1MA 2OT2A 1OTRB 3W5UB 3SU8X 3S2HB 3CRKC 1QOBA 4XGAB 1KJTA 3NHEB 5FOBB 3EIVA 2X38A 1KH0A 3DBHI 2Q2TA 2F0WA 1RLFA 3AE9B 3AECB 5JHAA 1A8VA 3FKIB 3G48A 4RF1A 2IO1B 4REZA 3GE3C 1TKGA 3A4RA 4PMWA 4B0MA 3WOEA 3VTVA 1YN5A 3KYHC 2LEKA 3TBLD 3NQTA 2LI5A 4LCDE 3M4PA 1IBKL 2BPSA 5HG2A 1LV9A 5M9OA 2BYEA 2A5HA 1O7ZA 4P6VF 5J39A 1RJTA 2D5DA 3TS0A 4JI2L 4EKUA 1I4XA 1VQFA 2YTVA 5JVH3 1G91A 4KGTA 4AQYL 3JVZX 1BCPF 2QHOA 1WTHA 5LNK1 3EA6A 2JA6B 1IBXA 1JT8A 2QC8A 3NVYA 4IPGA 4M0WB 5IGDA 4BVUC 4MJSB 2AKWB 4R4TA 2LSSA 4AQ7A 3GTKB 3RNFC 3U9OA 1JWMD 3H0GB 5JEAJ 4HVBA 2JXXA 4LF7L 2EJGC 3PUVA 1IBLQ 1WCMB 2F52A 2FJ2A 2YV5A 4BY7B 3PRZA 4DDID 1L2NA 3VR5A 1UF0A 1NDDA 4S17A 1WFQA 1BBUA 3W5OA 2CU1A 1EUJA 3NBIA 4XIGS 4K8JA 1WM3A 1X65A 3MHSD 4MZ9A 3SHLA 4BBSB 2YEPB 3PVLA 4OZCA 4OVUA 4JG2A 4B3TQ 4JI7L 1B2TA 4EGVA 4ODGA 1Q1OA 1WX9A 1PYSB 2WXJA 1XLNA 1RTOA 5JJZA 4A3IB 3RCZA 4RF0A 2BE5D 4GN1A 2Z6BA 5CV7A 1MBYA 4B3RQ 2KC2A 4JWSC 3PIPA 5KYIA 4A90A 2L3ZA 3DBHB 1BNZA 1IGDA 2E2IH 4N59A 1R9TB 3KUPA 5KHQA 1UELA 2EYMA 1VRAB 2UWQA 3G7LA 4JBJA 4IKGA 4IG7B 2NZHA 1Q1BA 1LGRA 4US9A 3MHBA 2LGDA 3APDA 3MA2B 2C5LC 1U4MA 2WAQG 3S14H 2ZT9C 3HG9A 4IWPA 1Y1VH 1QOGA 2PVGC 2WXFA 4MM3B 3BK1A 1B7YB 1HFGA 4ZDVA 2RR9A 3I2ZA 2C35B 4I7AA 3DWGC 1ZPSA 4DV3L 1A0IA 2XK5A 2L8JA 3F2UA 1KD1C 4W9JA 4JPSA 1EY0A 3KWVA 1OFFA 1FFVA 2DNEA 3FKYA 2KEDA 5BO4B 4P1BC 2AWOA 4JI3Q 1PH2A 4WQOB 3AXCA 4X64Q 2MUYA 2WB1E 3TMEA 3A5UA 3GTPB 4P2CB 4WJOA 1HJPA 5C2TB 3TEYA 3DVGY 2QSDA 1PGBA 3MXGA 1SNQA 1WJUA 1DOYA 2AX5A 4YSXB 2LVQA 3VYUA 1YITA 1WTRA 3PZDA 3S16B 2KWCA 3OJ4B 4WRDA 4IC7B 3HOZH 4JOIA 4DV6Q 2KVZA 4P71A 2JEAI 2N78A 1II3A 3E9IA 3I72A 1F2YA 2GLSA 4C3IB 2JZZA 2VQEL 1FNUA 2A1AA 2LD9A 1EY9A 1L1OC 3W1SC 2K6AA 2JZPA 5HY6A 2ZPNA 3WAMA 2D0PA 3PS6A 4WQMA 3AEAB 2EYOA 2QILA 1KDBA 1F77A 4ZAIA 4XQJA 1Y1WB 3BDOA 1SNDA 1UNSA 5CV4A 1WY8A 4MELA 2RPQA 2RCNA 4TSSA 4KHPQ 2VZAA 3CCVA 1UGMA 3P4PB 3RZFA 3HOWG 5E4WC 2K25A 1RCVD 3HOYB 3ZO5B 3G6JB 4FBJB 1JB3A 1FL0A 4LK1C 1SYCA 3AEBB 1XNRL 3SXHA 4EQ5A 2KHIA 1CJEA 1EFWA 2E2JB 5I4DA 1E7UA 4F88A 5M5WH 4ZHPA 1WIAA 3K5LA 2VY3A 1KRHA 4WORA 5EQ0A 4HPPA 2N4FA 3J7ZC 3CP0A 2WACA 4LTUA 4FNFA 4WIPA 1VQ5A 3ML9A 2K50A 3GTKH 1O78A 1LTID 4DV4Q 3H0GH 4YY3L 2HJ8A 1YQ3B 3L0WB 4WURA 1ML0D 4BZAA 2NVXB 2LVPA 3QIAA 1TKEA 4BY7G 2IDYA 3ONAB 3U8ZA 4W9GA 3VR9B 2VW9A 4NAWA 4MGZE 1SGHA 2QMTA 3KDFA 3HFZB 4GS3A 4TUUA 2I0QA 3H7SA 4NXMQ 4U673 4AYBE 4DR3L 3RZDB 4F7ZA 3R3OA 2D9UA 3HOVB 2L0FA 4K0KL 2ZW0A 3BDCA 3V6CB 1TS5A 4XT3B 1J8IA 2L55A 2XVSA 3F2CA 2VH2A 3AE1B 4P73A 3AYHB 2EJFC 4A3IH 4A76A 4GDLB 1AFPA 1QZEA 5KIXA 4A3PA 4GNXA 3SDLC 1ESFA 1U4LA 2ZCCA 1A2UA 4AIMA 1GUGA 2VXWA 2RCFA 2XRSD 2R2QA 2MLBA 3Q69A 2JU6X 4UAIA 4HDQA 4P74A 2Z6KC 5IYDH 4PS8A 1TZ1A 1V49A 2LJIA 1F9SA 4DV7L 2ON8A 4L5RC 3Q3FA 2EIFA 3ER0A 4ZCKA 4B9WA 3Q23A 1IBML 2M56B 2F0IA 4BXXH 4NW2A 2PPHA 2VUMG 1ENFA 4LFCQ 2ZVOA 2IX3A 1EL0A 4JV5L 3W1GA 1LT4D 4AOFA 4C2MB 4IUPA 4OGQC 5K36G 3MJ5A 2NMQA 3VUWA 2AUJD 4LW1A 5GMVA 3TL5A 3GDEA 4GOPA 3NVZA 2B63B 4XC2A 3WWVA 1DGSA 2MCNB 3KLWA 3KLSA 1C7YA 5M3MG 3CPWA 1VZ8A 2WX0A 2WXRA 3VRAB 3A1QB 3I4MG 3OIPA 1JWBD 1PH1A 3GTPH 1LQBA 1DCZA 2JRHA 2L52A 2M2LA 1CZWA 2O4XA 3QC8B 1GG3A 4YSZB 2ZTDA 1A63A 1SYFA 3QK0A 2REXA 1KIXA 2YU9B 5BMHA 3RMKC 3V96A 1ZDXA 3HVZA 5C5MA 4ITKA 1KF6B 4L23A 3S16H 4DUYL 1HUNA 2M0XA 4LF9L 2PQAA 1BR9A 1S1QB 1X3FA 4P75A 1YD8U 2CS4A 2L7RA 1D4BA 3L0OA 2ZTEA 4DR1Q 1HNZQ 2JA7G 1IPGA 4DAPA 3DHGC 4C3JG 4DV2Q 1MD2D 5CGKA 3L08A 2VB3X 1EY6A 2N9PC 2PE6B 4LF6Q 3ZNGC 4KI0A 3HRZC 1VDVA 4YXDB 4C3IH 1PGXA 3MC8A 4ANXA 2BE5C 3PO3G 1WYGA 2AWNA 1AW7A 5CYUA 2CJNA 3I5JC 4MGIE 1Y69U 4A8XC 4UY8C 5L83A 2JWZA 4GN3B 3B0AA 3CAMA 1YN3A 1VQ9A 1NI2A 3F8TA 5CBEE 3HOUH 1NMFA 3DEOA 1KNEA 4RGNA 1EWHA 5IIFA 3HOXB 1WX7A 1H8CA 2KJXA 1ICWA 1JB7A 4QQBX 3HOYH 1X9NA 3U4EG 1C79A 1EWYC 1OGWA 4F1SA 4HLEA 3RNBC 1EIGA 3TZDA 4WH4A 4DHJD 1HRJA 1S5DD 3JW0X 4DHJB 2CKZB 1GUTA 2J4XA 1WZ0A 1LM8B 4ZYSA 3VTUA 2F0OA 3OOCA 5M5XB 3J80c 1B53A 4K5XA 2JZ3B 2F1MA 4DK5A 3H94A 2V4LA 3H6MA 2Z4HA 1YI2A 1U9RA 1QVFA 3RD4A 4LUVA 4XX5A 2ALYB 2IWHA 4R4CA 5AZFA 3MJWA 4GSWA 4HMJA 4DWFA 1LT3D 5LMNL 2K75A 4NDXA 3EHVA 3D4DA 4IFDJ 3K7AB 4ME5A 1QVCA 3KLSX 1Z6HA 1W6KA 1C4AA 4LNOA 1F2LA 1KTKA 3AE4B 4YCVA 2K22A 3WANA 4EE2A 2UUCQ 4NJCA 1LTSD 3KVFB 3KF6A 4LJOB 2L0CA 2K5WA 4MEMA 3STBD 4K5VA 3NUCA 5C4XG 4KJNA 4NPSA 4LAAA 1I4HA 4JOIC 3S2AA 4FP5D 4GN5A 3ZRFA 2BWFA 2UXCQ 3BU2A 5AJ3Q 3DBLI 1QOHA 2F0EA 4RMFA 1XMQL 1Z47A 4DK6C 1SE2A 2EDGA 3WIMA 5CV8A 3PO2B 2IHFA 5FJ8H 5IGCA 3K9PB 3VH3B 4R4QA 1TWFB 4KKIA 4A3MH 1LM0A 3I4LA 5ELBA 1P16A 2E2DC 2IJ0A 4JI1Q 1D5MC 2Q8IB 3V61A 1VQGA 4GMVA 2EKIA 4BA2I 4A3BG 3LB8C 1VQ8A 2N49A 4JYAL 4XWTA 5C4ZA 3DM3A 4EFOA 4M1UB 1LT6D 1EOTA 1KNAA 4KGRA 3CRLC 2MFIA 2K32A 1TS4A 3GD7A 5K5PA 3PV1A 4D2KA 4L5QA 2LASA 2D2CC 4GLVB 3BINA 3V60A 4QIWE 2LY7A 5BR8L 1V80A 2SNSA 2OJWA 3L4PA 2RVLA 2F3IA 3A54A 3NTIA 1PMRA 4AH6A 5I9PA 4HRSA 3GTGH 4ABNA 5EE1A 1J0GA 4UDUC 5C4JB 1R4NI 2PMVA 1SEBD 4DNRB 2GBKA 5ELNA 2E6XA 1CM9A 1Y8OB 2IBIB 2DY8A 3AN1A 1IYFA 1C76A 3X23A 1I4RA 1STHA 4OO1H 4A3FH 4G7OC 1D5ZC 3QOJA 1B70B 2WB1G 3DXJC 1TWAB 2LGSA 4XDCA 4IZ8A 2V1YA 3N1XC 1J5EL 3P1HA 2Z1CA 4YTMB 1TS2A 1VQDA 1IKLA 1LFDA 5GXGB 4O2DA 1J7BA 1AE3A 1WF9A 3V62A 4BOSC 3DBLB 3L2PA 5T1GA 1IKMA 4TRDA 3P20A 2RDFA 3RLFA 2PKOA 5CX3A 3OMGA 1MVKA 1EIHA 1Q10A 2DLBA 4G4KA 1K3BC 4KLKA 2I07B 2J42A 3NZUA 4G50A 1SXTA 5E6PA 4F87A 2KCCA 1V6EA 4B3MQ 4HIDA 2K5DA 4DN4M 2F3WA 2F0NA 2F0DA 1I7HA 3GTQH 4L63B 3SK8A 1VD2A 2MQHA 3U4ZA 4JL9A 1RL2A 1TT5B 1GAQB 5J22A 2ZZPB 4NY0A 1CKNA 4IOAA 4CJ0B 3J80E 4Q0FA 2KTFA 3ETRA 2GVAA 3PREA 1N6ZA 2BVCA 3CF5A 5AZHA 4CO7A 1CZGA 3R8BA 2RSUA 2NPTB 3RPFC 2EY2A 1EU4A 3GTLH 4GKJL 2FNJB 5CHWA 2ZPYA 4KIKB 4BWGB 4AS1A 3M7GA 2NVQH 2DNFA 4HJGE 3PIO3 2B2TA 3V2TA 1R4NB 4MSQB 4QF4A 1C1YB 3NTKA 3VXWA 3ZQ4A 1DOKA 2RDHA 2Y0SB 1N33Q 2WXMA 2XRQD 2QF7A 1V43A 1YHAA 1HE8A 1UZXB 1K83B 4CKEA 1YJJA 2BKRB 2M8SA 3M3YB 3HS0C 4CKBA 5DNFA 4JI0Q 3NY5A 2KENA 1KLGD 1SJED 3EFXD 4DF7A 1X1MA 1I6HH 1L4DB 4ZRZA 4A3EH 4IPHA 1T5EA 1V5OA 1J6QA 2WV6D 2B8GA 1QNUA 1JWAD 4DHZE 2YLMA 3VYTA 4AYBG 4FA6A 2WXLA 1Y14B 3GTJH 4ZUJA 3BZKA 2WFWA 1KHIA 2LJ5A 3IXSA 2KVRA 3AE3B 3TZUA 2M4NA 4GDKB 3NELA 5EPLA 4R9WA 3PO2H 1NENB 4RM8A 4GXBA 4L5SA 2B8FA 2LXCA 3AULA 2UYZB 4ZRIA 4FULA 1Q7YC 1LTAD 2CJOA 4JI4Q 2G9HD 4M02A 2KC1A 3NUHB 4PT5A 1X32A 4CDEC 1X3EA 5BMGA 1B3QA 2QGQA 3H91A 4IN3A 3T8MA 1MJDA 1PTOH 3BDLA 2L5TA 1SJHD 4E6IA 2PLPA 3DMUA 1SYDA 1WXMA 2Q5WD 4A20A 4OVZA 3L7ZC 3D8GA 1STNA 3VR4A 1PUTA 2E74C 1SYEA 3A8KE 4HAEA 1WGRA 1JWUD 1STGA 2N3SA 1QQRA 3K0YA 1XEEA 1ZP0B 1G8ZD 3PZ7A 5IP9G 3QIJA 3HKZB 2EMTA 3IL8A 3DHHC 4KN4C 2UUBL 1XCQL 1PQSA 2KVMA 3NS8A 3PHXB 4APVA 3Q8AA 3OW7A 2H89B 2O6VB 3I7FA 4MTNA 4GLXA 1NUCA 4LK0M 1NTGA 5EE9A 1IL8A 3TS2A 3Q14C 3NWSA 2RHSB 4V0BA 3AE8B 3ZNID 1YHBA 2NZOA 2JN4A 4IUQA 4S3SA 1FMAD 5IP4D 2K52A 2VL6A 2K0PA 2KAJA 4FHJA 4BKTA 4PYUA 4BY1G 4HKQA 2XNAC 4P16A 3AFQA 2KJRA 4E74A 4A3KG 1GB1A 3STBC 4IPCA 1UE1A 5T1IA 3DBRI 3KYDD 5IKCM 2E5LL 3AB5A 1PA6A 3S9WA 4A3GH 4IWOA 5FO9B 2IY5B 2RD0A 1N8RC 3FC4A 3S1RB 2NUCA 1N34L 3NOBA 2R7ZH 1DGJA 4FF1A 1E24A 2MP2B 2E8GA 2HDLA 2GBJA 3RFZB 3RNGC 5CTRC 1OEYJ 2CQAA 4HEDA 4DV5Q 2RBMA 1XF5L 2OOBB 2R92G 3CCMA 1E22A 1Q12A 2X69A 2JQRB 1WTVA 2J0TD 4LFAL 2V3SA 1PLFA 4M8MA 3VH4B 1PRTF 1ILQA 2AWTA 1LO5D 4YL8A 2E3TA 4KKSA 3W5VB 1PTOC 1T0SC 2QCZA 3SFDB 1NCVA 3Q3NC 1DXMA 5FK9C 4EUTA 4RWSC 3KBXA 1M94A 2OF1A 4X66Q 1DONA 2WXGA 3BJUA 4A9AA 4DV0Q 1ESRA 2PPBC 1PV4A 3QR8A 2EPBA 3BG3A 2GRIA 5J1ZA 2JA5H 2R2OA 2WP9B 3BK2A 4BBRG 3N3KB 2PMZB 5J18A 3GV6A 5FR3A 3KBGA 1TWHH 1YJIA 1F52A 3DQVA 1G6JA 1K8OA 4ARCA 4OWWB 1VJKA 2PZTA 4KY7A 3W9CB 4BKSD 4PS3A 4IURA 1WX8A 2K5PA 1ZE3D 3BVMA 3PV0A 3VR8B 3GTOB 4HDOA 4JQWC 4MGYE 1I5FA 3M4OB 4CYEA 1L1OB 3K57A 3SD5A 4X57B 1NSNS 1CZPA 1CHPD 3HUIA 2E2IB 3PUWA 1K0RA 4A3JH 4WJPA 1Z9FA 1QF6A 5G3LD 3DBRB 3ZTDA 3VDYA 3OSOA 1MI2A 4M8NA 4AQYQ 4DAYB 4KV6A 3EECA 3W1BA 4DAVA 2FIDA 3AEGB 1SF0A 2PTLA 1F2RI 3S14B 4MT5A 2DUDA 4M00A 5J17A 1Y1VB 1QKZA 4BBNC 2CVRA 3JAMc 4FF3A 1ZXTA 2Y5PA 1ZXIA 2UUAL 4DR6L 5G5HA 3OAWA 1ICFB 1F1HA 3P4SB 1B9RA 3NZ3A 2W54A 3QJZA 1F9QA 1YIJA 1PH9A 1XMOQ 2INCC 2L05A 1FFUA 4W9FA 3J7YW 2UXBQ 2L1AA 1KDAA 2UXDQ 3H6NA 1HZBA 2KWVB 1YZ6A 3A9JA 2EYFA 4X3UA 2NVYH 4JI7Q 5IGFA 1YJ1A 3K58A 1ASZA 4MIUA 5MPOA 1QUQA 2MX2A 1L5PA 2BH8A 1GD7A 1V86A 4DQOC 2KXJA 1J8CA 4RGOS 4ULLA 4NPNA 2N55A 1T5XD 2FMCA 4H0LC 5FLMG 1GM5A 3TCAA 1M90C 2I46A 2SDFA 4PK1A 2JK8A 4G7ZC 2N9EB 4RHRA 2D3GA 1JMLA 4PQXA 2HTHA 1SB3C 2MEKA 3OTOQ 3RR5A 1BT0A 2JA9A 2LFNA 2R93H 3PT2B 1SE3A 2B3GA 5LMUL 1UEBA 4N9TA 3TN2A 1YX5B 3X0WA 2ICEC 3KQ4A 5C23A 2IX0A 3VR3A 1MI0A 1E8WA 4MDKE 3QAQA 1LACA 1C4QA 2K01A 2KQ3A 4ZHOA 4R8NA 1A3TA 1QJOA 5IWAL 2KOLA 4DV3Q 4GKKL 3I4NH 4EQOA 1MG8A 3VVWB 5IO9A 1PFNA 4HJKA 2GVBA 1XXGA 1WD1A 3CC4A 3S17H 4O0AA 3S1RH 1D6EC 4LF8Q 4RCOA 2CKHB 4C4VA 3ZJTA 1PVOA 2FCSA 2INDC 1X3GA 4HKZE 4WJQA 2CWAA 5D65A 3HP3A 4KJOA 4RFBA 1TU2B 5IYCH 4CHTB 3M62B 5DCNA 4IUUA 4O42A 3VYSA 1K8AC 3U7DA 1FYCA 4P72A 5M5WB 2A19A 1NVID 1T0QC 2BA0A 3P7JA 5EJWA 3CC7A 1AARA 3PO0A 3RZOH 4HCEA 1GO3E 1GNUA 2L15A 3Q2AC 4JX1C 1VMCA 3HM3A 1IBXB 3KJPA 3EUB2 3OIQA 3H1UA 1FJGL 3ZYYX 5KEEA 1IYUA 1GHJA 1HA5A 4OELB 2GMIC 3TREA 2NN6G 2VQEQ 2DENB 4M0WA 3AE2B 4CBVA 1EEFD 3A9KA 3UQBA 3ZNZB 2K5HA 4AJYB 2H4OA 2W9NA 3H09A 4R4OA 5LMNW 1AYFA 2K03A 2GBMA 1ZDVA 1TYGB 3MP9A 1NE3A 1K53A 2I2YA 3KH0A 1FRRA 1JOKA 2KX0A 3IAS1 3VA5A 3GTOH 1HCZA 2JSOA 3M4OH 5NUCA 5H8YE 1OXXK 1RF2D 2IGDA 1EQQA 1KAWA 2F4VQ 5D2MB 2ZM6L 5CORA 4ANUA 1MSGA 1XNRQ 1VQEA 1V9JA 2G4DB 2K7VA 4LUOA 2WXHA 4WFN3 5GROA 4YIJA 1Q82C 3K81C 1EYAA 1JWSD 3JAME 2F0KA 2ASBA 2BB6A 2DZMA 2KJHB 3C19A 2F0UA 2ID0A 4LF4Q 1U4RA 2NBUA 2KHJA 2DBYA 2K04A 2PZUA 4IO9A 4A93G 4UPAA 4PV1C 1ILPA 4YY3Q 5IP7G 3OJ3A 2DAFA 2LGYA 1O7YA 1OXSC 2XTIA 2SNMA 4PMBA 4XE0A 3OYYA 3NS1A 4JI8L 4A75A 2ZJQA 2KDMA 3WOFA 3X3NA 4EQNA 3X3MA 2ATWA 3AEFB 2Y3AA 3B2GA 1KLUD 3M85A 2XK5B 4MM3A 2PW9A 2DWQA 3IVFA 2SEBD 1PDQA 1WI5A 4LLGM 2HQEA 3CCEA 1MSHA 4DR4L 1WE6A 4DFAA 2MO0A 4YWLA 2BYVE 3T13A 3GB1A 4RHSA 3P2BA 4QAYA 4G3XB 3MFYA 2Q2IA 2CU3A 1BCPD 1BCPB 5C44G 1MKHA 4HPMB 3DOWA 4GLSC 2CHXA 1YNXA 3KLRA 4OX9Q 3V6EB 2XWJB 3HOZG 2NBWB 3N30A 2TMPA 1BBWA 1WTXA 1TY2A 1S3OA 3JSVA 3UINB 3V3XA 1EYCA 3AQQA 2EE1A 4C3HG 1N9WA 3K6OA 3DPDA 1PXUA 5LXIB 2PCFB 4QB4A 4X3TA 3NBHA 4H2AA 1XPUA 2H1EA 3HOUB 3G4SA 3GP7A 2FBWB 4DAMA 1N62A 1DOMA 4GIVA 5E6NA 3FKIG 4HCSA 1J7AA 1XPRA 2ZNVC 4QJFA 4RGMA 4ZRPA 3EVQA 4HN7A 3MTNB 2V3PA 2VH1A 4HPLB 4HWIB 1IP9A 4LUZA 1KOTA 1C77A 1IBLL 3I8ZA 1MJEA 3VDZA 1TXYA 1B1ZA 2LMCA 1ET6A 2NYZD 4B95A 5BN4A 1LTRD 4MNOA 3H15A 2WU5B 4X62L 1T0YA 4ARIA 1JRPA 1K28A 4G7HC 4XQNA 1Q8KA 2L4NA 1RFAA 4B3TL 2JA6G 1U4PA 1FO4A 1STBA 3E5SA 4L1BA 2RGFA 4DUYQ 4EZLA 1PFSA 3QQ8B 1YVCA 4H7BA 1UWXA 3Q8CA 4CDCC 3C46A 2RKSA 1VQLA 3H0GG 2I5HA 4FXGC 3HOWH 2WIIB 1WCMG 4B3RL 3ZKJC 5D14A 1SYBA 5C3EB 3B6YA 4B9XA 2MJ3A 1K8MA 1D2BA 1PDXA 1GC7A 4G0NB 2O5IC 3CQZH 3E9HA 4BBSG 3J80L 5CBAE 1L0VB 1PRTC 4OO1I 2AQ3B 4NAWB 2D0OA 4BAXA 1WJ6A 5C0XI 2L76A 1O80A 4FADA 1SMXA 1W3SA 2K5VA 1WJJA 1N32L 3HKSA 1NBFC 2OQKA 4A3IG 1XPOA 4MSMB 3QB3A 1SNCA 2JYOA 2MSED 2KDFB 1V1PA 3IKJA 3S2DH 1C9OA 1K0SA 3BWUD 1EOVA 4UP9A 1GUWA 2EJMA 4K6LA 1AP0A 1ROEA 2L11A 4A3MB 1F2RC 4JI3L 1QB5D 1RDPD 5HGTA 3AE6B 4ZRQA 2WS3B 2QW7A 2A74C 2ZJPA 1VCBA 2R3ZA 1WTOA 3BVZA 4RGTA 1A70A 2L00B 4P7IA 4WWPA 2RPVA 1XWEA 2JVCA 1HA6A 1B9NA 1ZGUB 5LMNQ 1HNWL 3J80i 1T6BX 5D3IB 5KRUA 1D8LA 5GAHC 4H13C 2AL6A 1S5CD 1YOVB 1KFYB 3DVNV 3D0FA 3HZXA 4DV6L 1AH9A 4OEMB 3FPPA 3LWEA 2K1FA 2KZRA 1EM7A 3UIPB 1RYJA 1KLVA 1IXRA 1VR9A 4KGSA 2XEWA 1QVGA 2IGGA 4GOCA 3CCLA 1STEA 3GTGB 1WSPA 4J6HA 4HJAA 2LWPA 1EUVB 3GO5A 3I73A 3MC0B 1I4PA 3ERSX 4HIOA 2VUMH 4O1NA 3QARA 4K7SA 4NMZA 2TSSA 3A74A 4A3FB 2PNHA 5K36H 1XMQQ 2OXPA 4UP8A 1B50A 1DOLA 3DWAA 2L83A 1ZOYB 4AJWA 1VQHA 1E7VA 3S1NH 4KHPL 1W2BA 1QZHA 2K05A 1B4OA 3KFUA 4HSVA 1C0AA 5M3MH 4CJ2C 2BF8B 4X3KA 3I4MH 2HCIA 4CDDC 4C3IG 3DWQA 2KQ7A 2LS01 2OEDA 2F0SA 4DV1L 1XTCD 3TP7A 1V81A 2WGSA 2WLBA 4Y52H 3PSEB 1JMCA 5F2DA 5DPSA 1Q46A 3DHQA 2K6DB 2FXQA 1FGBD 4RCNA 5FLXE 1VQPA 4N8X1 5IOCA 1Y1WG 4WJ3M 1E6EB 3K59A 5T8IA 4FJVB 2P5ZX 4IPDA 4CGYB 5I2XA 1SFOH 2HHHL 2JA7H 3L3OC 4C3JH 3GTQB 3R2IA 2CHWA 1BF4A 2E76C 4DR5Q 4I7ZC 3HOYG 2IZVB 3L16A 4QUCA 4RNAA 4TKOB 2VB2X 1T3QA 1STYA 2M17A 1Y8RC 2EY1A 3PO3H 4OZAA 4HJ9A 3H7PA 3J7AV 4P1CC 1H9JA 2XIWA 5C1ZA 3TEXA 2B39A 2EMSA 2HDMA 5IYBG 1NYQA 2G3QB 1WH3A 3B2FA 3PRPB 1K9MC 2LKVA 1KABA 1CQVA 1G2SA 3GTLB 2N7EA 5CHFA 1E9MA 3KF8A 4QL5A 2NVQB 5AFWA 5JEAG 2QDBA 3OPOA 1EY4A 3IAM1 2HIXA 2KT7A 2K28A 3URYA 3QJYA 5C3EH 4LF5Q 4KTAA 1ZKHA 3ITPA 1SE8A 1BCPC 3VTWA 1FD7D 4NNJB 3B9JA 2KFKA 1QOFA 1W6JA 3BZDB 1E5WA 2F0TA 2ZXOA 4CKCA 3UI2A 3HOVG 3QHTA 1NR4A 1ISNA 1I6HB 2INNE 4FJYA 3OW2A 4A3EB 1CFMA 1LT5D 4XWWA 1LTLA 2ENBA 4YCUA 3TRZA 2YTYA 2LRWA 1PZJD 1BVSA 3FVQA 3K7UC 5ELOA 1FEHA 4C80A 3KF6B 4R1JA 4LFCL 3GTJB 1N36Q 2KWUB 1H9SB 2N9KA 3T1HQ 4II3B 1HPCA 2OTLA 2OWOA 2JXTA 2A68D 1NJIC 3CMAA 2GOWA 2K4KA 5FJ8G 4PZ7A 2AQ2B 2KTRB 1Y56A 1FGUA 1GHKA 3ZTCA 3VAWA 3WALA 3T1YQ 3PF5A 2J53A 5E6JA 3CHBD 1XNQQ 3ND8A 3ZVVA 3KW5B 2HCCA 1EF1A 1YQ4B 1LTGD 2R61A 3TSSA 5C4XH 3I70A 1N61A 2HDEA 3ZDMC 3QWZB 2JE6I 1PTOD 5AEKB 2IY1B 2JA8B 1PTOB 3S1MH 1H95A 2LRUA 1HR0L 3NWTA 3RLNA 1D1KA 3S24A 1HQRD 3O13A 2W55A 2WXPA 2EYJA 4YHHQ 3N1YC 2KDEB 2QDLA 1L0YB 1RFKA 2B63G 4IUMB 4N6EB 3RNEC 1KL9A 4DV2L 5BYRA 2A6ED 3GTMH 2RHQB 2D11A 4HJ5A 3DCGA 1V97A 4LF6L 3ERQA 1S72A 4JI6Q 1HNXQ 1TQOA 2Z9HA 4AP4C 2BCOA 2F0LA 1VCIA 1CA5A 4A3BH 2KX3A 2GBRA 1ASYA 2PE9A 2IX1A 4PZ8A 2JY6A 1UEAB 5G5GA 2BYFA 3I57A 2V1CC 3T9LA 1Y8PB 5JAVA 2BWES 5C0XH 3DM1A 1PHJA 2O2VB 3P4QB 3RI7C 1J9OA 2J52A 4XDXA 2L32A 4N58A 4YWKA 1BUIC 1VQBA 2DX5B 1WXVA 3E9SA 2SAKA 3M7NA 4WJ4A 3GZNI 4IJHA 3FILB 3CU7A 3C1FA 1MHWC 4GU2A 2QCPX 3R2TA 1NEKB 2LGXA 2A6HD 1I94Q 1F2MA 1Q90A 2JT4B 1EYDA 3CC2A 1VF7A 4ZRKA 4JCVE 4JI5Q 4OL7A 3N6RA 4A3GB 3DVNU 2G5DA 5I6YA 3CCJA 4WWMA 2MGSA 5M3FB 2ZVNA 1M8AA 2QKIC 1N63A 4NXNL 4GNXC 1EQVA 1FNVA 2NB0A 4RAUC 1G291 1L2FA 3S1QB 1HZAA 2R7ZB 2KACA 3ULLA 2KOXA 1YHQA 1MIUA 2NTSA 1RRBA 1FIQA 2KHWB 3HOXG 2ZJRA 2WDQB 3D31A 3C0RB 4Y7NH 2KEEA 5LHY1 1JROA 2F3VA 2MP1A 3HIZA 1KDCA 4B3SQ 1IHZA 4ILWA 3OG5A 2F0PA 5EBCA 1E90A 3OLMD 2JQOA 4LFBQ 3P42A 3KUCB 2PMZE 4RKBA 1OXVA 2QEJC 3I9V1 4E71A 1FD6A 1HTPA 1K51A 2ZCBA 2FCNA 4A3CH 5BYSA 3WDNA 1M1KC 4ANVA 4A3DB 1AZPA 4J3OD 1CKNB 2UUCL 4U68A 3HM6X 3W2DA 3QCAA 1EY5A 2KCTA 2WXNA 3D6WA 4A6QA 2JA5B 1TIFA 3R93A 4KHZA 2CHZA 3FP9A 2KWDA 1TWHB 2KQSA 3NPPA 4GOPC 4KZ0A 4KD4A 3GE8C 2M1MA 2UXCL 1TY0A 2D07B 2JSVX 1NY4A 1OXTA 3TP8A 1CI3M 3K5MA 4EEWA 5KNBA 3PPAA 1G6ZA 2MJDA 5C3WA 3A56A 1PH3A 2Z0EB 1HZ9A 5BN3A 2BDOA 5E4XA 1N34Q 1MHXA 3GZNB 4I6NB 4HJ7A 1WR1A 1UBIA 4JI1L 4TKNA 3F1ZA 1BKBA 2N1WA 3TEWA 4A3JB 1B9MA 2A69D 1FM0D 3ECIA 1SNMA 2DAJA 2QJLA 1XT9B 2W3SA 3IT4B 3CWIA 4K1RB 5JVG3 1ONLA 1TJEA 5IA7A 5M5YH 1S5BD 1PFMA 3FRPB 1C48A 2IL8A 3IRBA 4FXCA 1E3PA 3BS1A 4POGA 2C5CA 3PO2G 4IM3A 4FHKA 1E1TA 2IYDB 3B1LX 3PCOB 1EYGA 1JJCB 1RM6C 4IDIA 4WJNA 4WWNA 4A3LG 5IAAC 2UU9Q 5IOIA 4K8IA 1E2VA 2BOSA 2WXIA 4KKTA 4MACA 1SDFA 1RTNA 2FHTA 3C1EA 4NJ7A 4IALA 3Q6BA 1WGGA 2NS5A 2DNCA 3RNUA 2JA8H 2NVYB 1X3PA 2PIAA 4L5TA 3JAML 1ZUD2 4MH0E 2PZWA 4L6TB 4CQNA 1MPEA 3AU7A 3Q8BA 2GN5A 3HVDA 4GN4B 1JALA 3DWPA 2OEOA 1I4GA 3I55A 1K3RA 1Q3LA 4YTNB 2M00A 3VFKA 1AN8A 2KN4A 1YNTE 3W3AA 2KQ4X 2V4DA 1PGAA 4OZBA 1VLBA 2R93B 1L0XB 4CHKA 1NBWA 2SOBA 1JR0D 1GUAB 2BS2B 4BOZB 5ELDA 2DYOA 5E7NA 3DDCB 2MJ8A 1UGJA 3KUDB 2F0JA 1LABA 1ENCA 2PO4A 2ZXPA 3VR6A 1HZCA 2IHEA 4W9LA 1TWGH 5DLQE 1GPXA 2J7QB 1WXSA 4DXFA 3ZUNA 3PUXA 2KFJA 5IP9H 1Z5SB 3U30A 3FHWA 3ND9A 3I4NB 3DLLA 2BB5A 2W3RA 5BYQA 3JAMi 4JVZA 4YWGG 2B2WA 1EQTA 5M3FH 3M9BA 3S17B 2DJGC 3UDFA 2WXQA 1E7PB 3S1QH 2A68C 1KM7A 3LYYA 1V8QA 1TKYA 1P98A 2W82A 1WVLA 4KKUA 2V0GA 2WDVB 1WMHA 1E0ZA 3RUZA 4DR2Q 1SBBB 4BY1H 2DZIA 2JPHA 3EFCA 3HK0A 4K3BA 4IUVA 1VMPA 4A3KH 4DDGD 3K0XA 2DN8A 1N33L 3ENEA 1PH8A 3RZOB 2WQYB 4ACFA 1C3TA 1K73C 4OWXB 1U4AA 4W9CA 3VYRA 2INPE 2N1VA 5C3XA 1E8XA 3FEWX 4JI0L 3SDZA 4A3DH 1V2YA 4DUZQ 4DR7Q 1JOOA 1TBEA 1Q8IA
chains in the Genus database with same CATH topology
2O2LD 2JYTA 2A6EC 3AEDB 3P1MA 3IFTA 2LHEA 1JCKB 4K6DA 2FFKB 4DGZA 4IFDG 2F0HA 1F2ZA 4K2KA 1AZQA 3TUOA 1K52A 5C4HA 2GI9A 3T4AC 2RSNA 1XX8A 3PZ8A 4J8QA 2BS4B 1DOXA 3SFEB 2F0QA 3H8HA 1TVXA 2A6HC 3HRDD 2K9XA 3A7LA 4ID6A 2WKCA 4FXDA 2K3UA 1SSOA 3Q6SA 3MXUA 3AH7A 2NTTA 2QIEB 4DAYA 1C8CA 3NE5B 3Q8EA 1ET9A 2N88A 1R4QB 5A2QE 4HR7B 2WAQB 4YSYB 1TIID 1Q1EA 4DK1A 3QG1A 2ZXRA 1HEZE 3V05A 3MEHA 4FXKC 3NSWA 3LX0A 1PRTD 2XSCA 1PRTB 3MXNA 4JK1C 5FKAC 4PMCA 3A55A 4ZQ3A 1AWDA 2V4IB 3OWFA 2EYLA 2VNUD 2YEPF 4KY5A 2JYEA 3U52E 2B2TC 1YMHE 3U7ZA 4TQ0A 1BQQT 3ZGZA 5I9OA 1HUMA 5HHDG 2NZ1D 1YNJD 4XYQA 2BA1A 2A69C 2F4IA 1TWCB 4C7ZA 1B44D 1XLOA 4IUTA 2M0AA 1ZYRC 1CTMA 2L1BA 1QCBD 1L6VA 2B2VA 3T56B 1V1OA 1TKWB 1IW7D 4B08A 5CMDA 2ICIA 1O7LA 5FLXL 1WWTA 3FMCA 3SR1A 3CKIB 3GS2A 2LFIA 5HI1A 3HOWB 5DM73 3FAHA 5AUKA 3I3CA 1BOSA 2JXMB 3DWMA 3CQZB 3AMZA 2WP8J 1G2TA 4R3DA 3RMHA 2EXZA 3KK7A 4QUFA 1S4ZA 1X3QA 4BS9A 3NXWA 1TR5A 3SK6A 3NQIA 1SAPA 2RSOA 2BW2A 3Q0AA 3S2DB 2IW3A 3LWUA 4ZLTF 2NN6H 1RKNA 1WXQA 2KA7A 5I2YA 3UI3A 2J7ZA 3Q22A 3OHXC 2F0MA 1DYQA 4Q5VA 1QT9A 4KD3A 4M8AA 5LL6S 4B0EA 1JW9D 2EY5A 5BMIA 2MPMA 2B2WC 4K14A 1WTQA 2WKDA 5EKIA 2F0FA 3OWEB 2KCNA 4IOIE 4G57A 2C9OA 2XWBB 3NHHA 3IAYA 1MGSA 2MJEA 2VUMB 1BMLC 3SR6A 1YNND 1OQQA 2LGIA 1JE4A 5C0XJ 1GUSA 5C6AA 4XT1B 3S1NB 1ZKOA 1HFNA 3DUZA 1OO9B 5M3MB 1WGKA 3I4MB 2NWGA 2EYHA 1KAAA 4X3SA 1N5WA 5EGTA 5IT9E 4NZLB 3MVVA 3QOLA 2LUMA 4XDDA 1B3AA 1SSNA 1FXIA 1PZKD 3A8IE 4EQPA 4Q2JA 4C1NI 1SFOB 2Q8RE 2JA7B 1JC7A 4C3JB 3I90A 1EZ8A 2GB1A 3PO3B 3AM9A 4C7YA 4V190 3CIRB 2K33A 1JQ4A 2LMCB 4NP5A 4L2YA 3U2SC 3P75A 1L6UA 4KX6B 1DOIA 5JXVA 1JORA 1M4VA 2D62A 1UAPA 3J7AF 5E1FA 3T16A 1QNKA 3SE0A 1LLRD 2L9HA 3T53B 2DYMA 2L12A 4XTCS 3L9AX 1BDOA 5CR3A 5IGBA 3Q8FA 5AUIA 2Z8LA 4GZYC 5JPMC 1E2ZA 3D4RA 3AV8A 1QE6A 3PUZA 1OXUA 4RH6A 2JWUA 3AMUA 1HTLD 2R6GA 1EWCA 4MHEA 4US8A 1FR3A 1YNJC 3M4YA 1GUNA 4OIKA 4A55A 1V1PB 3GQBA 2PNRC 1C4PA 2CHBD 1H9MA 3AB9A 4QMGA 2RDGA 3NRZA 5D3DA 4PNYA 3J81E 1R7SA 4L8JA 5C4XB 1RD9D 1P7EA 2WXOA 2D5GA 3S15B 2Y5CA 3S1MB 2Z4IA 1IW7C 2F0VA 4OHJA 2B2VC 1SIJA 3OMCA 3DEPA 1J7CA 1EU3A 5KGUA 3H3VC 3GTMB 4XXEA 5EE0A 2RA4A 5CV5A 1DM0B 4WAFA 4A3BB 1K50A 1NYRA 3T3OA 1VZ7A 4C1NK 3FDTA 1HXYD 1YN4A 3KWLA 2Q8TA 1NI3A 4DU9A 5LL6X 2ACZB 1BO0A 2FMMA 1QG7A 1SE4A 2V3NA 3T3NA 3BYYB 5ELFA 1GOZA 2YYZA 2B2YA 2F03A 1GXDC 1CK1A 3GV3A 2F0GA 2WB1B 2FUG1 1HQMC 3NK9A 4Y7NB 3Q24A 1OQRA 2BT6A 1EFID 5CV6A 2FINB 2MHVA 5IODA 4TQUS 2WINB 5EKLA 2HUGA 3TDQA 4MN3A 4HROA 1PTOF 4FVMA 1ZXHA 1IYVA 1JQYD 2JEBI 3K5OA 2CW0D 4DK0A 1SMYD 4N9PA 1EY8A 5DM63 2AUKA 4KY6A 3J9CA 1GB4A 5E3FA 1SYGA 3N9YC 1E10A 5EKKA 1YNNC 1BXTA 5KYLA 2NBFA 1EZ6A 3MXPA 1F9RA 3TEZA 2K5QA 1HHVA 4JBWA 4TMAB 5JOBA 5JEAH 4RA8A 5M5YB 2X6LA 1I4QA 4DNTB 4TQ1A 1A3VA 2N9LA 4YTPB 3C8YA 5HFYA 3LNNA 1V8CA 3EGRA 4KKJA 1RHPA 5EBDA 1S5FD 2B2UA 4ZK9B 4H44C 1H9SA 3BVGA 4AYBB 2BDNA 1RODA 4FF4A 1PYWD 4KK7A 1QILA 1FRDA 1Z7TA 4QCLA 2EOTA 5I6WA 1UWMA 4NKLA 1S5ED 2WDRB 3K5NA 3MTSA 3D6CA 3TP6A 2WXKA 2KMMA 3WCQA 4YT0B 4IQZA 1WRIA 2JX5A 1H9KA 5C3JB 2BYTA 5EPKA 4F8MA 5JPNC 5A2QL 4OO1G 3TP5A 1E2WA 5C0XG 5ELCA 2JP1A 2G1EA 3BYTB 1VZ6A 1TWGB 2LHDA 2FE8A 1TT2A 4OW0A 2N7JA 5TSSA 4WJWA 3SK5A 1I6VC 5CC4A 3FPUB 2BBCA 2GA4B 1CT1D 1FNWA 3D4WA 3ZJUA 2M9VA 4IFDI 1BUVT 3FILA 3ZJVA 2PVOD 2WNMA 1SNPA 3A8JE 4F7XA 2WU2B 4BY1B 4MH8A 4KMUC 3SK4A 1VF5C 1GJXA 5H92C 3AE5B 4FF2A 4A3KB 2EY6A 1C4CA 1Y8NB 2IGHA 2K1BA 2KHSA 3T51B 3VRBB 2AQ1B 2KECA 1HZ5A 3AE7B 2I38A 1UUPA 5ISRA 4KHVA 1SNOA 3C2PA 5IGEA 2R92B 3MFGA 3VA7A 1R4PB 4ZKCB 4C56C 1FXAA 3PMFA 3MHZA 3U9SA 1EEID 2NVTB 4ZUIA 4HTHA 1RWSA 4R8IA 1XLPA 4BBRB 5C5LA 1A15A 3MAQA 1ZYRD 5IGGA 1EY7A 1F9PA 1LTTD 1N5XA 4JE3B 2KUMA 3ABVB 1D5XC 2B2YC 1QOAA 1CHQD 5EPJA 1F0ZA 3NVVA 1ACCA 3A7AB 4K5WA 2PW5A 2IPKD 1C9FA 1QLBB 1JOQA 3PIP3 2CW0C 3QWNA 1SMYC 1XCTL 2HTME 2M19A 1I50B 1A2TA 1TZOA 1PFBA 4K2LA 4RKLA 1FCCC 1NR2A 2OHFA 2DY7A 3MZ5A 5HURA 1DZ1A 5FO8B 2G9DA 1ENAA 1XO3A 4KN7C 1A3UA 4ZKBB 1IGCA 2RMMA 5KNDA 5DAUA 1PZID 2NN6I 3D3RA 1WD0A 1STAA 5FO7B 5G3LF 3QO2A 4QIWB 1MHHE 4EVOA 3I91A 2ZW1A 3NVWA 2RQXA 3VQIA 2EYPA 1LTBD 3PUYA 1I3QB 5IT9L 2EVBA 2E2HB 1N60A 3IFDA 4NAMA 2B2UC 5BN5A 2X6GA 2A73B 4FO2A 5A35A 1HZ6A 2VZKD 1AEXA 2VZKB 3MWYW 3P4RB 5COYA 3NTHA 5EE3A 1PFDA 1DJRD 4Z9CB 3P63A 2O5JC 2BTEA 4DA2A 5DEHA 2MH7A 1FCLA 3C3LA 2BS3B 2PW7A 4LMQD 4USAA 1TS3A 1ZEQX 4DXGA 1A6XA 2EZVA 3EROA 2B76B 4LJZC 1E0BA 1P7FA 3HEJA 1WTWA 3E0JA 3AEEB 4IFDH 3HGBA 3W1SA 2PYKA 1CA6A 1IUEA 4ZOHC 3VR2A 1D1IA 4XYOA 1DD2A 2IT1A 2H88B 1CQFA 1QWYA 2ONQA 1GUOA 4JWUC 1VDZA 5CV9A 4CJ1B 1JICA 5ELEA 4I65A 3EQLC 1XLQA 3J81L 3E6ZX 4A93B 3E56A 2E75C 3SEBA 1WTPA 3N52A 3BIID 1L4ZB 1H9RA 4FYDA 1C78A 5KNCA 3LXFA 4IUNA 4OIJA 4HSPA 4BA1I 5C44B 2N0SB 3EJIA 1NAPA 1BBXC 3TBIB 2EELA 3NP8A 3HOZB 1XYIA 5D7GA 3SVMA 2XN9C 4XQQA 4HEA1 3IT6B 4C3HB 4HMIA 2PQEA 4J1MA 2OT2A 3W5UB 3S2HB 3CRKC 1QOBA 5FOBB 2X38A 1KH0A 2F0WA 3AE9B 3AECB 3FKIB 4RF1A 4REZA 1TKGA 4B0MA 4PMWA 3WOEA 1YN5A 2LEKA 3NQTA 5HG2A 1LV9A 5M9OA 2A5HA 1O7ZA 4P6VF 5J39A 1RJTA 2D5DA 1I4XA 5JVH3 1G91A 4KGTA 1BCPF 5LNK1 3EA6A 2JA6B 1IBXA 3NVYA 5IGDA 4AQ7A 3GTKB 3U9OA 1JWMD 3H0GB 5JEAJ 2EJGC 3PUVA 1WCMB 2FJ2A 4BY7B 3VR5A 3NBIA 4XIGS 4K8JA 4OZCA 4BBSB 3SHLA 2YEPB 1B2TA 4EGVA 4ODGA 2WXJA 1XLNA 1RTOA 5JJZA 4A3IB 4RF0A 2BE5D 5CV7A 1MBYA 4JWSC 5KYIA 4A90A 1BNZA 1IGDA 4N59A 1R9TB 3KUPA 2EYMA 1VRAB 4IKGA 3G7LA 1Q1BA 4US9A 3MHBA 3MA2B 1U4MA 2ZT9C 3HG9A 4MM3B 1QOGA 2PVGC 2WXFA 3BK1A 1HFGA 3DWGC 1ZPSA 3F2UA 4JPSA 1EY0A 3KWVA 1OFFA 1FFVA 2DNEA 2KEDA 2AWOA 2MUYA 3TMEA 3GTPB 5C2TB 4P2CB 3TEYA 2QSDA 1PGBA 3MXGA 1SNQA 1DOYA 2AX5A 4YSXB 3VYUA 1WTRA 3S16B 4WRDA 2JEAI 1II3A 3I72A 1F2YA 4C3IB 1FNUA 1EY9A 2K6AA 2JZPA 4WQMA 3AEAB 2EYOA 2QILA 1KDBA 1F77A 4ZAIA 4XQJA 1Y1WB 3BDOA 1SNDA 1UNSA 5CV4A 4TSSA 3P4PB 5E4WC 1RCVD 3HOYB 3G6JB 1JB3A 4LK1C 3AEBB 1SYCA 3SXHA 1CJEA 2E2JB 5I4DA 4F88A 4ZHPA 3K5LA 1KRHA 4WORA 5EQ0A 4LTUA 4WIPA 2WACA 4FNFA 1O78A 1LTID 1YQ3B 4WURA 1ML0D 2NVXB 3QIAA 1TKEA 2IDYA 3ONAB 3VR9B 2QMTA 4U673 3RZDB 3R3OA 2D9UA 3HOVB 2ZW0A 3BDCA 1TS5A 4XT3B 1J8IA 2L55A 2XVSA 3AE1B 2EJFC 4GDLB 1AFPA 5KIXA 1ESFA 1U4LA 1A2UA 1GUGA 2VXWA 2XRSD 3Q69A 2JU6X 4UAIA 2LJIA 1F9SA 2ON8A 4B9WA 3Q23A 2M56B 2F0IA 4NW2A 1ENFA 2IX3A 1EL0A 1LT4D 4C2MB 4IUPA 4OGQC 5K36G 3MJ5A 2NMQA 2AUJD 3NVZA 2B63B 3KLSA 1VZ8A 2WXRA 3VRAB 3OIPA 1JWBD 4YSZB 1DCZA 2L52A 2M2LA 1CZWA 2O4XA 1SYFA 2YU9B 5BMHA 3V96A 1ZDXA 3HVZA 5C5MA 4ITKA 1KF6B 4L23A 1HUNA 1BR9A 1D4BA 4DAPA 4C3JG 1MD2D 5CGKA 2VB3X 1EY6A 4KI0A 3HRZC 1VDVA 4YXDB 1PGXA 2BE5C 1WYGA 2AWNA 1AW7A 5CYUA 2CJNA 1Y69U 4A8XC 1YN3A 5CBEE 3DEOA 1KNEA 4RGNA 1EWHA 5IIFA 3HOXB 2KJXA 1ICWA 3U4EG 1C79A 1EWYC 1EIGA 3TZDA 4WH4A 1HRJA 1S5DD 1GUTA 2J4XA 4ZYSA 2F0OA 3OOCA 5M5XB 1B53A 4K5XA 2F1MA 3H94A 3H6MA 2Z4HA 1U9RA 3RD4A 2IWHA 4HMJA 1LT3D 4NDXA 3D4DA 4IFDJ 3K7AB 4ME5A 3KLSX 1Z6HA 1W6KA 1C4AA 1F2LA 1KTKA 3AE4B 2K22A 4EE2A 4NJCA 1LTSD 2L0CA 2K5WA 4K5VA 3NUCA 4KJNA 4LAAA 1I4HA 4FP5D 1QOHA 2F0EA 1Z47A 1SE2A 2EDGA 5CV8A 3PO2B 5IGCA 1TWFB 4KKIA 3I4LA 5ELBA 2E2DC 2IJ0A 1D5MC 2Q8IB 2EKIA 4BA2I 4XWTA 5C4ZA 4M1UB 1LT6D 1EOTA 1KNAA 4KGRA 3CRLC 2K32A 1TS4A 3GD7A 5K5PA 4D2KA 2D2CC 2LY7A 2SNSA 3L4PA 2RVLA 3A54A 3NTIA 1PMRA 5I9PA 4HRSA 4ABNA 5EE1A 4UDUC 5C4JB 2PMVA 1SEBD 4DNRB 2E6XA 1CM9A 1Y8OB 2DY8A 3AN1A 1C76A 1I4RA 1STHA 4OO1H 4G7OC 1D5ZC 3QOJA 4XDCA 3DXJC 1TWAB 4IZ8A 3P1HA 2Z1CA 4YTMB 1TS2A 5GXGB 1IKLA 1J7BA 5T1GA 1IKMA 4TRDA 3P20A 2RDFA 3RLFA 2PKOA 3OMGA 1MVKA 1EIHA 1Q10A 2DLBA 4G4KA 2J42A 2I07B 1SXTA 4F87A 2KCCA 2K5DA 4DN4M 2F3WA 2F0NA 2F0DA 1I7HA 4L63B 3SK8A 1GAQB 5J22A 4CJ0B 3J80E 4Q0FA 3ETRA 1CZGA 3R8BA 3RPFC 2EY2A 1EU4A 4AS1A 4BWGB 3M7GA 4HJGE 3PIO3 2B2TA 3V2TA 4QF4A 3NTKA 3ZQ4A 1DOKA 2RDHA 2Y0SB 2WXMA 2XRQD 2QF7A 1V43A 1K83B 4CKEA 1YJJA 3M3YB 3HS0C 4CKBA 5DNFA 1KLGD 1SJED 3EFXD 4DF7A 1L4DB 4ZRZA 1T5EA 2WV6D 1JWAD 2B8GA 1QNUA 3VYTA 2WXLA 4ZUJA 3IXSA 3AE3B 3TZUA 4GDKB 5EPLA 4R9WA 1NENB 2B8FA 1LTAD 2CJOA 2G9HD 3NUHB 4PT5A 1X32A 5BMGA 3H91A 4IN3A 1PTOH 3BDLA 2L5TA 1SJHD 4E6IA 2PLPA 3DMUA 1SYDA 2Q5WD 4OVZA 3L7ZC 3D8GA 1STNA 3VR4A 1PUTA 2E74C 1SYEA 3A8KE 4HAEA 1JWUD 1STGA 1XEEA 1QQRA 3K0YA 1ZP0B 1G8ZD 3PZ7A 3HKZB 3IL8A 4KN4C 1XCQL 2KVMA 3Q8AA 3OW7A 2H89B 4LK0M 1NUCA 5EE9A 1IL8A 3NWSA 4V0BA 3AE8B 4IUQA 4S3SA 1FMAD 2K0PA 2KAJA 4HKQA 2XNAC 4P16A 1GB1A 5T1IA 3AB5A 3S9WA 5FO9B 3FC4A 3S1RB 2NUCA 1DGJA 4FF1A 2HDLA 3RFZB 2CQAA 4HEDA 2RBMA 1XF5L 2JQRB 1Q12A 2X69A 1WTVA 2J0TD 1PLFA 1PRTF 1ILQA 1LO5D 2E3TA 4KKSA 3W5VB 1PTOC 3SFDB 1NCVA 1DXMA 5FK9C 4RWSC 3KBXA 2OF1A 1DONA 2WXGA 4A9AA 2PPBC 1ESRA 2EPBA 3BG3A 2GRIA 5J1ZA 2WP9B 3BK2A 2PMZB 3GV6A 5FR3A 3KBGA 1YJIA 1K8OA 4ARCA 1VJKA 2PZTA 4KY7A 3W9CB 4IURA 2K5PA 1ZE3D 3BVMA 3PV0A 3VR8B 3GTOB 3M4OB 3K57A 1NSNS 1CZPA 1CHPD 3HUIA 2E2IB 3PUWA 1QF6A 5G3LD 3OSOA 1MI2A 4KV6A 4DAVA 3AEGB 1SF0A 2PTLA 1F2RI 3S14B 4MT5A 1Y1VB 1QKZA 2CVRA 4FF3A 1ZXTA 2Y5PA 1ZXIA 5G5HA 1B9RA 3P4SB 3NZ3A 2W54A 1F9QA 1FFUA 3J7YW 2L1AA 1KDAA 2EYFA 4X3UA 5IGFA 3K58A 4MIUA 5MPOA 4DQOC 1L5PA 4RGOS 4ULLA 2N55A 1T5XD 2FMCA 4H0LC 2I46A 2SDFA 4G7ZC 4RHRA 1JMLA 4PQXA 1SB3C 2MEKA 2LFNA 1SE3A 4N9TA 3TN2A 2ICEC 3KQ4A 2IX0A 3VR3A 1MI0A 1LACA 1C4QA 2K01A 2KQ3A 4ZHOA 4R8NA 1A3TA 1QJOA 2KOLA 4EQOA 1PFNA 1XXGA 1WD1A 1D6EC 4RCOA 3ZJTA 4HKZE 5D65A 3HP3A 4KJOA 4RFBA 1TU2B 4CHTB 4IUUA 4O42A 3VYSA 1FYCA 5M5WB 1NVID 2BA0A 3P7JA 5EJWA 3PO0A 4HCEA 4JX1C 1VMCA 1IBXB 3EUB2 3OIQA 3ZYYX 5KEEA 1IYUA 1GHJA 1HA5A 2NN6G 4M0WA 3AE2B 4CBVA 1EEFD 2H4OA 3H09A 1AYFA 2K03A 1ZDVA 1TYGB 3MP9A 1K53A 2I2YA 1FRRA 1JOKA 3IAS1 3VA5A 1HCZA 2JSOA 5NUCA 5H8YE 1OXXK 1RF2D 2IGDA 5CORA 1MSGA 2K7VA 2WXHA 4WFN3 4YIJA 1EYAA 1JWSD 3JAME 2F0KA 2BB6A 2F0UA 2ID0A 1U4RA 2DBYA 2K04A 2PZUA 4PV1C 1ILPA 1O7YA 1OXSC 2SNMA 4PMBA 4XE0A 3NS1A 2KDMA 3WOFA 3X3NA 4EQNA 3X3MA 3AEFB 2Y3AA 3B2GA 1KLUD 3M85A 2PW9A 2DWQA 2SEBD 1PDQA 4LLGM 2HQEA 1MSHA 4DFAA 3GB1A 3T13A 4RHSA 3MFYA 2CU3A 1BCPD 1BCPB 4GLSC 3KLRA 2XWJB 2TMPA 1WTXA 1TY2A 3V3XA 1EYCA 2EE1A 4C3HG 3K6OA 1PXUA 2PCFB 4QB4A 4X3TA 3NBHA 4H2AA 2H1EA 3HOUB 3GP7A 2FBWB 1N62A 1DOMA 4HCSA 1J7AA 4ZRPA 4RGMA 3EVQA 4HN7A 2V3PA 1C77A 3I8ZA 1B1ZA 2LMCA 1ET6A 2NYZD 5BN4A 1LTRD 2WU5B 4ARIA 1JRPA 4G7HC 4XQNA 2L4NA 1U4PA 1FO4A 1STBA 3E5SA 4L1BA 4H7BA 1UWXA 3Q8CA 3C46A 2RKSA 4FXGC 2WIIB 5D14A 1SYBA 5C3EB 2MJ3A 4B9XA 1K8MA 1D2BA 1PDXA 2O5IC 3J80L 5CBAE 1L0VB 1PRTC 4OO1I 2AQ3B 4NAWB 5C0XI 1O80A 3QB3A 1SNCA 2JYOA 3BWUD 1V1PA 3IKJA 1GUWA 2EJMA 4K6LA 1AP0A 1ROEA 2L11A 4A3MB 1F2RC 1QB5D 1RDPD 5HGTA 3AE6B 4ZRQA 2WS3B 2A74C 2R3ZA 1WTOA 3BVZA 4RGTA 1A70A 2RPVA 1XWEA 1HA6A 1B9NA 1T6BX 5D3IB 5KRUA 4H13C 1S5CD 1KFYB 3HZXA 3FPPA 3LWEA 1EM7A 1RYJA 1VR9A 4KGSA 2IGGA 3GTGB 1STEA 1WSPA 4J6HA 3GO5A 3I73A 3MC0B 1I4PA 4O1NA 4NMZA 2TSSA 4A3FB 5K36H 2OXPA 1B50A 1DOLA 3DWAA 2L83A 1ZOYB 2K05A 1B4OA 4HSVA 4CJ2C 4X3KA 2HCIA 4C3IG 3DWQA 2LS01 2OEDA 2F0SA 1XTCD 3TP7A 2WLBA 5F2DA 3DHQA 5FLXE 1FGBD 4RCNA 1E6EB 5IOCA 5T8IA 3K59A 5I2XA 4CGYB 3L3OC 3GTQB 3R2IA 1BF4A 2E76C 4I7ZC 4QUCA 4RNAA 4TKOB 2VB2X 1T3QA 1STYA 2EY1A 4OZAA 3J7AV 1H9JA 2XIWA 3TEXA 2B39A 3B2FA 2HDMA 1NYQA 2LKVA 1KABA 1CQVA 1G2SA 3GTLB 1E9MA 3KF8A 2NVQB 5AFWA 5JEAG 2QDBA 3OPOA 1EY4A 3IAM1 2K28A 3URYA 3QJYA 4KTAA 3ITPA 1BCPC 1FD7D 3B9JA 1QOFA 1W6JA 3BZDB 2F0TA 2ZXOA 4CKCA 3UI2A 1NR4A 1I6HB 2INNE 4A3EB 1CFMA 1LT5D 4XWWA 2ENBA 1PZJD 1FEHA 3FVQA 4C80A 3GTJB 1H9SB 2N9KA 1HPCA 2JXTA 2A68D 2AQ2B 1Y56A 1GHKA 2J53A 5E6JA 3CHBD 3ND8A 2HCCA 1YQ4B 1LTGD 2R61A 3TSSA 1N61A 3I70A 2HDEA 2JE6I 1PTOD 2JA8B 1PTOB 3NWTA 1D1KA 2W55A 1HQRD 3O13A 2WXPA 2EYJA 4N6EB 1L0YB 1RFKA 5BYRA 2A6ED 1V97A 3ERQA 1TQOA 2BCOA 2F0LA 1VCIA 1CA5A 2IX1A 1UEAB 5G5GA 3I57A 1Y8PB 5JAVA 5C0XH 3DM1A 3P4QB 1J9OA 2J52A 4XDXA 2L32A 4N58A 1BUIC 3E9SA 2SAKA 3M7NA 3FILB 3CU7A 3C1FA 2QCPX 3R2TA 1NEKB 2A6HD 1F2MA 1Q90A 1EYDA 1VF7A 4OL7A 3N6RA 4A3GB 5I6YA 4WWMA 2MGSA 5M3FB 1M8AA 2QKIC 1N63A 3S1QB 1EQVA 1FNVA 2NB0A 4RAUC 1G291 2R7ZB 2KACA 3LB8C 2NTSA 1FIQA 2WDQB 3D31A 2KEEA 5LHY1 1JROA 2F3VA 2MP1A 1KDCA 1IHZA 4ILWA 2F0PA 5EBCA 3P42A 1FD6A 4RKBA 1OXVA 2QEJC 3I9V1 1HTPA 1K51A 5BYSA 3WDNA 4A3DB 1AZPA 4J3OD 4U68A 3W2DA 1EY5A 2WXNA 3D6WA 4A6QA 2JA5B 3R93A 4KHZA 2KWDA 1TWHB 3NPPA 4KD4A 1TY0A 2JSVX 1OXTA 3TP8A 1CI3M 3K5MA 5KNBA 1G6ZA 2MJDA 5C3WA 3A56A 5BN3A 2BDOA 5E4XA 1MHXA 3TEWA 4A3JB 1B9MA 2A69D 1FM0D 1SNMA 3IT4B 2QJLA 2W3SA 3CWIA 5JVG3 1ONLA 1TJEA 1S5BD 1PFMA 3FRPB 1C48A 2IL8A 4FXCA 3BS1A 2C5CA 4IDIA 1RM6C 4K8IA 1E2VA 2BOSA 2WXIA 4KKTA 4MACA 1SDFA 1RTNA 2FHTA 3C1EA 4IALA 2DNCA 2NVYB 1X3PA 2PIAA 3JAML 1ZUD2 2PZWA 4L6TB 4CQNA 1MPEA 3AU7A 3Q8BA 3HVDA 1JALA 3DWPA 2OEOA 1I4GA 1Q3LA 4YTNB 2M00A 1AN8A