4TSSA

Toxic shock syndrome toxin-1: tetragonal p4(1)2(1)2 crystal form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 42
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4tssA01
1YN4A 1LT3D 1S5FD 3BVMA 2TSSA 4RGNA 1V1PB 1TY0A 1EEFD 2IJ0A 1PZJD 3BVZA 3OWEB 1LT6D 1ET6A 1BCPC 5TSSA 1CT1D 1LTID 1I4QA 1S5ED 1PZID 2NTSA 3O13A 1I4RA 4L6TB 1QILA 1D5XC 1HTLD 1B44D 1F77A 1I4XA 1LT4D 1UNSA 2AQ2B 4RGOS 1TS3A 2AQ3B 4BWGB 2J4XA 5D3DA 1UUPA 1RCVD 1FD7D 1TS2A 2XN9C 1FGBD 1L0XB 1V1OA 4RCOA 2O2LD 1I4GA 4OHJA 4RFBA 1PRTD 1L0YB 1BCPD 1SBBB 1AN8A 2RDGA 1PZKD 1PTOB 1JCKB 3CHBD 3TSSA 1JQYD 1D6EC 2IPKD 1LLRD 4RGMA 1SE4A 5D3IB 1RD9D 3MFGA 3SEBA 5ELFA 5FK9C 3DWAA 4RGTA 3BVGA 1HXYD 1KTKA 1S5DD 1SJHD 1TS4A 1CQVA 3R8BA 1XXGA 1FNWA 1KLGD 1TS5A 4L63B 1XTCD 1LTRD 1DYQA 1ESFA 1T5XD 4TSSA 1FNVA 1PTOC 1JWMD 3BZDB 1BCPB 1JR0D 1LTTD 2WV6D 3R2TA 1YN5A 1PYWD 2ICIA 2QEJC 1CK1A 1V1PA 1JWSD 5FKAC 1BCPF 1DJRD 1EEID 1D5ZC 1LTSD 2QILA 4UDUC 4RH6A 1EU4A 4RHRA 2AQ1B 5ELCA 2SEBD 1KLUD 1MD2D 2XRQD 5I4DA 4ZYSA 3GP7A 3R2IA 1M4VA 3DWPA 1S5BD 3EFXD 3DWQA 1EFID 4K6LA 1LTAD 4C56C 1LO5D 1D5MC 1BXTA 1CHQD 1SJED 3EA6A 1YN3A 1LTBD 1TY2A 1RF2D 3W2DA 2Z8LA 1PRTF 3URYA 1GOZA 1EU3A 1JWUD 1HA5A 1S5CD 4DXFA 4Z9CB 1LT5D 1HQRD 2G9HD 1CHPD 1PTOH 3V05A 4DXGA 1AW7A 4RHSA 1SE2A 2RDHA 1ENFA 2XNAC 3KLSX 1I4HA 2NTTA 2CHBD 1PTOD 1SXTA 2R61A 1PRTC 1I4PA 3BYYB 1ET9A 1PTOF 1FNUA 1EWCA 1PRTB 1B1ZA 3MC0B 1LTGD 1G8ZD 1RDPD 4O1NA 3BYTB 5ELBA 4NZLB 5ELEA 1STEA 5ELDA 1SEBD 2XRSD 1SE3A
chains in the Genus database with same CATH superfamily
4DPGA 1A3TA 1XF5L 3ULLA 2KWCA 2L0CA 1SDFA 3AB9A 4RWSC 3EHVA 4RF1A 5E6JA 3VA5A 2EYFA 3VYSA 4IWOA 2A68C 4C3IH 5JH5C 4HKZE 4GOPA 3B2GA 1CI3M 1SMYD 2A6HC 4KY5A 4CJ0B 2IBIB 3EECA 1V8QA 2CKZB 3FP9A 1WR1A 2QEXA 4ZUIA 4LFAL 2UUCQ 1RLFA 2UWQA 3ZNHB 1GM5A 1IGCA 2J0KA 1OQRA 1K28A 1TWGB 1ZPSA 1HTLD 2DHZA 5JJLA 5M3MH 1XCQL 3RULA 2JZPA 3S14H 3PO2G 3NHHA 4GKJL 2LGYA 3HZXA 3Q8DA 1E0BA 1N61A 5JPNC 1GNUA 2G45B 3Q3MC 1E90A 2R93G 3D32A 4FXGC 1WCMB 2K28A 4HCNB 2AWNA 3I70A 4H44C 3OJ4B 4NPNA 2I5LX 4FF3A 4HR7B 4JI4L 2N9KA 2DUDA 5E6NA 4GU2A 1SE4A 3MFGA 3K57A 4CDDC 4JI0Q 1JMCA 2Y5BB 2LVQA 3V6EB 3VDYA 2L0FA 5HKHA 4MDKE 4A3FB 3KUPA 1ILPA 1EYGA 1QOGA 2ZM6Q 3QJYA 2JRHA 1FNWA 4ZHOA 3M9BA 1M90C 3RCZA 1LM8B 3ZTCA 1LTRD 2IW3A 2K25A 1T5XD 1TWCH 5C3WA 4OIJA 2WXIA 3T3OA 2KJRA 1JR0D 3AE8B 3K9OB 4OW0A 5C3EH 2PNHA 4FXDA 4DNRB 5K36H 1MJEA 4FNFA 1HTOA 2KOXA 4K8JA 2LJ5A 1EEID 1ZXHA 2QILA 2OQKA 1ML0D 2WAQB 4C3JH 1DOXA 1ZEQX 3TS2A 1SRUA 1HFGA 2LHDA 3AEEB 4MSMB 4C7YA 2ZEQA 4DV6Q 3WAMA 2QCPX 3VA7A 1SFOH 1QOAA 4P1CC 1ILQA 3EFXD 1IBKQ 1E7PB 2VQFL 4IFDG 4Y52H 4JPBW 1YVCA 4G3XB 4LUOA 4QMGA 2ES2A 2KTFA 2ZTCA 3OAWA 3FKIB 2BYTA 2KCTA 1HNXQ 5CBEE 3PO0A 3PVLA 1V6EA 3IXSA 1XEEA 3UF8A 1G2SA 1PRTF 2AKWB 1S5CD 4Z9CB 3L08A 2Q2IA 1OXUA 1UZXB 1VMCA 2K03A 2KUMA 5AJ3Q 1WVLA 3K5MA 1YJJA 2WXOA 5AZFA 3CMEA 4KHVA 1YNNC 3MEFA 2ZTDA 3EFCA 1ENFA 1X3FA 5LXIB 1HZ6A 1WD1A 2E2JB 4X3UA 1O7ZA 4XT3B 2ZJQA 3NZUA 1BUVT 3CRLC 3ZW3A 2Z4HA 3ND9A 3KYHC 5HI1A 3CIRB 1QB5D 1XQQA 2NPTA 4P72A 5C44B 4XDCA 3HKZE 3I9V1 1SROA 4II2B 3BK2A 3ML9A 1RDPD 3NQIA 2R93H 1X3EA 4IFDI 3J7AF 4DWFA 2LHEA 4H0LC 1E8ZA 2PJHA 2A69C 3T13A 4DN4M 4F8MA 1PH3A 1BNZA 4A3GH 5AUIA 3VRBB 1GJZA 1TQOA 2KCNA 4N9PA 4F87A 2E76C 5IGBA 5KIXA 1QOBA 3WA0A 4DHZB 3QIAA 2BA1A 4EVOA 4GNXB 5IYCG 3G71A 3GO5A 3QB3A 4KN7C 2KCMA 1KD1C 1KDAA 2IYDB 3A9KA 2D07B 2C9WB 2JXTA 2E2DC 1STGA 1VD2A 2ATWA 1VQOA 5K5PA 5EAYA 5M9OA 2BKRB 4MJSB 4PZ8A 1DGSA 1WJUA 4P75A 4DV2Q 4NB3A 5MPOA 4R8IA 1VQ7A 4BKTA 2OQ0A 3HP3A 1DD2A 1YMHE 2KQ7A 1AE3A 1YZ6A 1GC7A 3UGBB 3VFKA 5HFYA 3AE5B 1RODA 1SSOA 5KHQA 1YNND 4RMAA 2JA6H 3V3XA 3SU8X 1ZDXA 5FO7B 1HTQA 3EIVA 3ZYYX 2MEKA 3D31A 3LX0A 1EF5A 2PMZB 4B08A 4A20A 1Q8KA 1L0YB 1HQMC 3K0XA 2M17A 1GUNA 1NBWA 3JC66 5IGFA 3HGBA 4HSVA 1E7VA 1T0QC 4YHHQ 3NTHA 2H88B 4A6QA 3AE2B 3P63A 3PZ7A 5T1GA 1RIPA 3QWNA 2GBRA 4KKTA 2L12A 4R4CA 4A3MG 4TUUA 4M8NA 3GZNI 3QJZA 5BMGA 4KX6B 5CTRC 1M94A 1FCCC 4PG3A 1L1OA 1F2ZA 5C4XG 4A3PA 5BN5A 3NHEB 4YSZB 4IJLA 1LUZA 1TT2A 2KJ6A 4DV4L 1EY9A 2PI2A 2KX3A 3J7A5 2CFMA 2LFNA 4HJKA 3OPOA 2NCNA 4C3IB 1I50B 2IO0B 5GXGB 2EIFA 3PO3B 5JOBA 2Z9HA 4Q5VA 4MTNA 5AEKB 1B70B 5D7GA 1EIHA 5AZGA 2MGSA 3FPPA 1IBLQ 2EELA 3KF8A 1SNMA 3WCQA 1FO4A 3D4RA 2G9DA 2MJ8A 4MTKA 1KLUD 3B6YA 1KHIA 3OIQA 4IUUA 4A93G 2F0QA 2VXWA 2J52A 4FYDA 1E0ZA 1YQ4B 2V3PA 3E6ZX 1VQPA 1S5BD 4EZJA 1UWXA 2BA0A 2R2QA 3ZGZA 2KHSA 1TT5B 3C19A 3N32A 2EPBA 4LFCL 2QF7A 4KVGB 1YN3A 4GS3A 2KQ4X 4WJWA 1ICWA 2RR9A 2V9HA 2CQOA 2KZRA 1IKLA 1TKWB 2DN8A 4DR6L 1K52A 4IM3A 1U4PA 3URYA 3NELA 2EY6A 4P73A 1VZ8A 2FIDA 4LF8L 1SYDA 1J5EQ 4GDLB 1WMHB 1B9NA 3SK6A 1YITA 3IKJA 3S17H 3A74A 1K3RA 2RHSB 2C60A 3JSVA 4ALPA 3LDZE 1YJ1A 1TKGA 2AL6A 2R61A 4MGIE 3ZDTA 1ZOYB 4ARIA 4HDOA 1S72A 1WI5A 2JJQA 4BA1I 2ZVOA 4NAMA 3WALA 3TZUA 4HPPA 2AL3A 2FHTA 3HKZG 1D8LA 5ELDA 1O7LA 4FF1A 1YNJC 1QOFA 3QHTA 4G7OC 4IFDH 4P1BC 5EDSA 4DR7Q 2BS3B 5IT9c 2O6VA 3GTQH 4A3KB 2ZJDA 4WAAA 1L2NA 2A73B 1UELA 4AOFA 3CCVA 3KF8B 4K5XA 1C9FA 4GGQA 1I4QA 1PUTA 4HEDA 2K1FA 3R3MA 3X0WA 2R6GA 2UUBL 2O6VB 3I57A 2PMZE 3H0GG 1F2MA 1H9SB 3FKIH 4X3SA 1TBEA 1XT9B 1GUAB 2R7ZH 3RNAC 4B0MA 4ITKA 2XN9C 1XNRQ 4KV6A 2KWVB 2XVSA 1OTRB 2K5WA 2NB0A 1OXSC 4RFBA 2O5JC 2N4FA 3ETRA 4HXDA 3A1QB 2M0AA 4KDIC 1WE6A 1CM9A 3R93A 2ASBA 1PTOB 2QMTA 2P5ZX 2MO0A 3D4WA 1O7YA 4JPSA 4ZRJA 2GVBA 1ZE3D 3ZXRA 1JQYD 1YJWA 2BT6A 1QUQB 3AEFB 3HOYH 4KDLB 1FR3A 1H9JA 1STBA 5D3IB 3GTPH 2A19A 2JN4A 4U68A 5DNFA 4RGTA 2I1JA 3A33B 3P4QB 2DZIA 2BS2B 4MH0E 2L76A 5E6PA 2JWZA 3B9JA 5CV8A 1DOKA 2K5HA 5G3LF 4F8CB 1DOIA 4K8IA 3Q8CA 3R8BA 5M3FG 1EIFA 5EPLA 3RN5A 4BY7G 3UE1A 1R4MI 2MH7A 3U2SC 3T1YL 4JWSC 4EX5A 4W9DA 4L63B 5HGTA 3DXJC 3KYCD 4JI8L 4L5TA 3M3YH 2E2IB 3CP0A 4DV4Q 4X65L 2ZXPA 4P6VF 4YWGG 3JAME 1STNA 3LGJA 2M56B 4RCNA 4UPAA 5J22A 2L7RA 1X3GA 2WKDA 5IO9A 3S1QB 3NG0A 1D5ZC 2DLBA 1JB7A 1XD3B 5IE8A 5ELCA 2MFIA 3PV0A 5EGTA 3C3LA 3A9JA 1EY7A 4YCVA 1DONA 2N8NA 2PKOA 4CJ2C 1MIUA 3QG1A 5FO8B 5ISRA 1EWYC 2PI2E 3HOXG 2DBYA 1PH7A 5IIFA 4AS1A 3ER0A 3KW5B 1HZ9A 1UWVA 4K2KA 2A68D 3APFA 1I50H 2JSOA 3NQTA 4HIMA 2I5HA 3P75A 4DR6Q 4C56C 1BXTA 1CHQD 3EA6A 4WWPA 2RPVA 3R66C 2RQXA 2WDTB 4AIMA 4V0BA 2M00A 3AU4A 2K9XA 4YTMB 3J9CA 2K04A 3PQIA 2M0XA 1VQCA 1Q81C 4HN7A 4X64Q 3IHPC 3MTSA 1EYCA 2YTXA 4BY1B 2JYTA 1H95A 3FILA 2X38A 1STYA 1SXTA 4NXMQ 3T51B 2JWUA 2LUEA 2B8FA 2NN6I 3H94A 3TS0A 1ET9A 4IWPA 4W9JA 2QDLA 2B2UC 3I5JC 2XK5A 4KN4C 1N63A 3UQBA 2JA8G 4ILWA 2INDC 3BYTB 3U9SA 4RKBA 1WRDB 4CYEA 1V8CA 4E74A 2CS4A 3IT4B 4HVBA 4Y7NB 2VB2X 1SYEA 2NZHA 5D6JB 2LVPA 4GN4B 1PH8A 2JU6X 2KDFB 4IW0A 4ABNA 2FCSA 4HCSA 4BBSH 3DDCB 3HM3A 1AYFA 1JALA 3KUZA 1RKNA 1CT1D 3GDEA 2WAQE 2J53A 3N20C 3D4DA 1SNCA 1MSHA 1YHAA 4JBKA 2C7HA 2MWSB 3H7PB 5DPWA 2MBBB 1KABA 1GJXA 4JIOU 2B39A 4JCVE 3T1HL 4GOPB 4KSLC 1UNSA 3NBIA 3Q3OC 2FCQA 1MHWC 4LUZA 3UE0A 1HNWQ 3AXCA 3IFWB 1IZ6A 1SB3C 3DVNU 3LNNA 4MSQB 1E2VA 2F0HA 1I4GA 2HCCA 2YLMA 3JYUA 4D2KA 4B95A 4WRDA 4DBGA 4BY1H 4A3JG 3GTMH 3L7ZC 5FLXL 5CMDA 1QOHA 3S17B 5GQOA 1FIQA 1YX6B 4MIUA 2ASQA 1SN8A 1X65A 2PZTA 3VYTA 3HOZH 3BZCA 3SK4A 3B2FA 3T1YQ 3DWAA 3C0RB 3TEXA 3C46A 3D6WA 2Q8TA 2L00B 3D6CA 2L32A 1SJHD 3W5UB 3KBGA 5IWAQ 1O80A 4YIJA 1OO9B 3VR2A 3HKZB 2BB6A 4O0AA 1LTLA 1H9SA 4KKUA 1U4AA 5C3EB 5E4WC 4CDFC 3ONSA 3NVWA 1PDQA 1V49A 1SNOA 4NDXA 3DBHI 5C4JH 4N59A 5IA7A 4GXBA 1MGSA 4LF7L 3IG3A 1P9DU 2D3CA 1ONLA 5JJKA 1DJRD 2DY7A 4KGRA 1WGYA 2QIEB 4DA2A 3KJOA 3NS8A 2L9HA 3Q8FA 3CPFA 4NQLB 2XWJB 4CDCC 3MVVA 3S15H 2W3SA 2LXJA 1V86A 4N9TA 2BWES 1Z9FA 1NMFA 3HM6X 1IBXA 2K8CA 3V61A 1Q1OA 2JUOA 3DWQA 2WB1E 2E5LQ 2JQOA 1CKNB 2CU3A 1V97A 5DM73 1PV4A 3CC4A 1HH2P 1FYCA 2LMCB 4DNTB 4ZKBB 1C4CA 2UUAL 4JL9A 2OTLA 2Z8LA 1RAXA 1GUWA 2X6LA 2XSCA 2JX5A 1PH2A 2KHIA 1HNXL 2YU9H 4YT0B 1M1KC 3WWVA 3UI3A 5C0XG 2LUMA 1TR5A 2UUCL 2QGQA 4RHSA 4WH4A 4OO1H 2MNAA 3RFZB 2XNAC 1Y8OB 1VQ8A 2E2HB 2WXJA 5HURA 3VQIA 4KD3A 2J0JA 4X6AH 2R7ZG 4AYBE 1PTOF 4IOAA 3UDXA 5AZHA 4ZCKA 2KDEB 1HUNA 3SR6A 2OEDA 1WTHA 4A3DH 3VUXA 2Z1CA 2E2IH 5CV7A 1YNTE 3SFDB 1IW7D 4PV1C 3GTJB 2RBMA 3K80C 1D7QA 1WGHA 4DKAC 1BBUA 1NCVA 5C4XB 2LASA 1YN4A 4XE0A 3BVMA 3T56B 5M3MG 2KLCA 3PRPB 1OXXK 2W3RA 2O4XA 4PS8A 4CQNA 1SNQA 1UE7A 3ULJA 1VQGA 3VUWA 1P98A 1UH6A 1PZJD 1SR3A 3BVZA 4A3LG 2F4IA 3Q8AA 3PIPA 4M02A 1D1IA 2ZM6L 3TDQA 3C2PA 3PO2H 3AE4B 3DMUA 4TQ0A 4I7ZC 1TKYA 4GN1A 4IFDJ 2CQAA 3T3NA 1BMLC 1UUPA 2E75C 1ACCA 4AJWA 1E6EB 2ONQA 2A6ED 3L13A 4GLSC 3HRZC 4DDID 4N8FA 3I4MG 1L6VA 1G91A 4WJOA 2JA7B 1E7UA 3J80c 5GAGC 3OW7A 4KIKB 1HR0L 1Q86C 3B0AA 2PQEA 3J81E 4XX5A 2ICEC 5KNBA 3W1YA 1HE8A 2QHOA 1GO3E 1QVFA 2CU1A 2X8XX 4GDLA 4OWXB 1Q46A 3A1QA 4F1SA 4J6IA 1WTQA 2BOSA 1P7FA 1BBWA 1HXYD 4N58A 2Y0SE 1S5DD 2WKCA 4A3CH 2VW9A 3HOWH 1C79A 2NVTH 1PDXA 4B3TL 3OJ3A 1GUOA 2OCEA 5DM63 4IQZA 1MVKA 3SHLA 2O5IC 4K6DA 4IUQA 5IAAC 1XTCD 1DYQA 3AFQA 2K5DA 4W9IA 1Q10A 1YN5A 2KEEA 4BFRA 4FHKA 5FKAC 3DWGC 4P71A 2D3GA 4UP8A 3HOXB 1WXMA 3I8ZA 3V96A 2MBEA 3PZ8A 4QL5A 3X23A 1A8VA 1YNJD 3BWUD 4GB9A 3CPWA 4XYOA 5DPTA 4NAWA 1AEXA 2AUKA 3CU7A 4L8JA 3R2IA 1EF1A 1CMXB 1Q0WB 1T0RC 3W1SA 5C4ZA 3WOEA 2IY1B 2F0FA 4KK7A 5M5XB 1HNZQ 3DBSA 2B2WC 4KIKA 1LTAD 5EQ0A 2AEHA 1HNZL 4FADA 1N32Q 3VR5A 2ZW1A 2DJGC 4ANWA 1U5KA 4HK2A 1JWUD 1DGJA 4DR5L 2NMQA 2N55A 1WTVA 5M5YH 1TWCB 2CVRA 2C9OA 2UU9Q 5FLMH 2IDYA 2HD3A 2RPQA 3RNUA 2VUMG 4BY7B 2G9HD 3AH7A 3V60A 4A9AA 5E6OA 4DXGA 4GOPC 3AULA 1GKHA 2E3TA 3PMFA 1H8CA 2PQAB 1I4HA 3HEJA 4KJNA 3VH3B 1WGDA 3GE8C 3BYYB 1HRJA 5DLQE 2KTRA 3QCAA 1PRTB 4HSPA 1VCIA 2MQJA 4DK5A 3E0EA 3TEHB 2JT4B 2BYEA 1HUMA 1S40A 4GNXA 4DV0L 2B2UA 1TJEA 2F0LA 5I9PA 4II3B 4LF5Q 3CRKC 2IX1A 2M1MA 3MC8A 3KLRA 2K50A 3NPPA 3L17A 3N1YC 2MJ3A 1HCZA 1PLFA 1NYRA 3WAPA 1C1YB 1AWDA 4QJFA 3O65B 3PHXB 2FMCA 3H0GB 1UGJA 2F0EA 4OXPA 1V81A 2R7DA 4S0RA 3ECIA 3PUZA 3O13A 4L6TB 4IUVA 1WCMG 3P1MA 2R93B 5IOCA 1D5XC 3G4SA 1SE9A 4NNJB 2KC1A 1TS3A 4C3HH 4A3BH 1CUKA 1KFYB 3DBHB 4OVZA 3RT3B 5LMUL 5M3MB 2MLBA 3U4ZA 2CJOA 4YXDB 5D14A 2OHFA 2EYMA 1ENAA 1TYGB 1FVIA 4YTPB 1GXDC 1AN8A 1PZKD 4NXNQ 3GV3A 1QLBB 1NEKB 3HOYB 4WWMA 2WACA 3CSTA 2REXA 1F2RI 1B8AA 2KENA 4QF4A 4DF7A 2HD5B 4K3BA 4JI3L 2EYJA 4CDEC 3TEZA 2UU9L 2LSSA 2L11A 3T16A 3ZTDA 2L4NA 3R3OA 5C0XH 2CWPA 1EOTA 1F9SA 4HMIA 2BH8A 2K01A 3I55A 2FNJB 3CF6E 1SNDA 2PMVA 2MCNB 3UQAA 3ZJYC 3Q24A 5IP9G 1CKMA 1BBXC 3HOUG 1WY8A 1XXGA 2Q2HA 1E24A 1EYAA 1S3SG 2WGSA 2N9PC 3P4SB 4ZYNA 2HE7A 2KMAA 2G4DB 2EY5A 2Z0SA 3NTIA 3GTMB 2F0WA 1NI2A 1GUSA 3W3AA 4C3JG 3S2DH 2QCZA 1R9TB 1FNVA 1G51A 2BDNA 3QARA 1JQ4A 1EWIA 4YSYB 1LM0A 3PSEB 1IL8A 1DM0B 1FEHA 2Q5WD 2ICIA 2KCCA 1XMOL 4E71A 4C7ZA 2VZAA 4IM2A 2BPSA 2LRUA 4PZ6A 3MJWA 1UBIA 3HOWB 3GS2A 2D0OA 2HDMA 4J15A 3RD4A 1EY8A 4Y7NH 4M0WB 4PZ7A 1R4MB 4M00A 4LF6L 3GTOH 5CHWA 5JAVA 2K52A 1EFID 4BS9A 1MJCA 1WYGA 2ZCBA 2WXHA 1GB1A 1LO5D 3NS1A 5IY0A 4IUTA 4C3IG 4WQOB 4EQOA 1RF2D 1AZQA 4DK6C 1CKOA 5CBAE 1Z2MA 4G0NB 2Y5CA 1WYWB 3W1GA 5CV4A 4CKBA 1WOCA 3S2DB 1OQYA 2M9VA 1S3OA 2G3QB 3P7JA 4B0EA 4B6WA 2MP2B 4ID6A 2F4VQ 2JA8H 1Y56A 2L15A 1PTOD 3FHWA 4OGQC 3I91A 4GZYC 4LNFA 1GPXA 1SGHA 1QZEA 5EE0A 1LTGD 4JI3Q 4BBNC 1KDCA 3LWUA 3NVZA 4A93H 1N34Q 4K81A 2F0SA 2WXFA 4C4VA 1NVID 4XZ4A 1ZKOA 4DXAB 1E1OA 2I0QA 2FBWB 4AYBB 1MG8A 1STAA 4XQQA 1IUEA 3FAHA 5FJ8H 5LMNL 5HY6A 1VQFA 2D3AA 1BCPC 4DAVA 1JE4A 3BDLA 3TQYA 1N33L 3VUYA 4R1JA 1UF0A 4KGSA 1G291 5AFWA 4I6NB 4FBJB 1HTPA 4DK3C 2J7QB 5BN4A 2O2VB 4BVUC 3I56A 2QJLA 4A3DB 2B8GA 1F77A 4HLEA 3L10B 2BVCA 2N9XA 1VS0A 1E1TA 2LGIA 2F0NA 3S1NH 1ZUD2 2WDRB 2JXMB 4XDXA 3W5OA 4JI7Q 1PH9A 5BYQA 4LDTD 1IPGA 4B3TQ 4HEA1 5A35A 1WXAA 1VQAA 3A4SC 5JZEB 5C6AA 1WGRA 3H8HA 4MGZE 1B4OA 3BJUA 3EVQA 4S17A 4R4QA 4F88A 1JCKB 4HDQA 5M5WB 4A3CG 3QQ8B 3ZRFA 3BS1A 2FAZA 1T9HA 1XO3A 1FJGL 3NY5A 2IO2B 3A9JB 2WXGA 4GDKA 5FR3A 1KIXA 2IWHA 3RZWC 1PGBA 1JOQA 2EMSA 2JA9A 3TN2A 3UDGA 1I42A 1MI2A 1X6OA 1XMOQ 3Q2AC 4NY0A 4YWMA 1NSNS 4MGKE 5I6WA 1JE5A 1VQEA 3HK0A 3R7RA 4ZHPA 5H8YE 1BKBA 2F0DA 1HR0Q 2OTJA 2BH2A 1WX8A 4ME3A 4WJ4A 4DV2L 1OEYJ 5J17A 2L3ZA 2EYOA 3VYUA 5A2QE 1Y1WB 2IZVB 1Z5SB 4GLAC 2FMMA 3HOXH 4TMAB 1WGGA 2JA6B 1EY6A 5L83A 2WLBA 2V3NA 2E8GA 5EE9A 4PS3A 1XLOA 3G6EA 1P0RA 3AE7B 2PPHA 3HS0C 1JICA 4WWOA 4LNQA 2NVQH 2WDQB 3DHGC 1HPCA 3SVMA 4K7UA 2F3WA 3LWEA 3P20A 3IFDA 5DCNA 2G1EA 3I4NH 2M2LA 3I72A 3DVNV 1WJ4A 3M4OH 4HJ8A 3U50C 1XTDA 3Q23A 3PIOA 3K7AB 5LLIA 1KOTA 1X54A 2H4OA 1E8WA 3SFEB 2V0GA 4BY7H 4LW1A 4DR2Q 4QAYA 1CZPA 4M0WA 3NVVA 4BBSB 3KFUA 2CHWA 2FCMA 3CC2A 3HOUH 3LYYA 3L0WB 3STBC 2FCNA 3AN1A 5M3FB 4IPCA 1HQRD 2YTYA 2JEAI 1CHPD 3TP7A 1B3QA 2LEKA 3NUHB 3QR8A 2KBNA 2HQEA 5FLXc 1LYLA 4DR7L 3IAS1 4V190 3K5NA 4EUTA 3HOYG 3FDTA 3KLSX 3SDZA 3D3RA 3FC4A 4LWCA 2IY5B 1FXIA 3AE6B 3KOJA 1KC8C 4DFAA 2D5DA 5F2DA 4JYAL 4Q2JA 3J81i 3T8MA 2N1WA 5LL6S 1TVXA 1CZWA 4QCLA 1ZYRC 1J6QA 1STEA 2B2YC 2KDMA 3MC9A 3P4PB 3UIPB 2K3UA 1PYSB 5HGQA 3KYDD 2E5LL 4ICUA 4DV7L 4MNOA 1C4AA 2WB1G 1HEZE 1V1PB 1EEFD 4GDKB 3HVDA 4GSWA 1WTWA 3MZ5A 3PO2B 2MSED 3GTQB 4CKCA 1ET6A 3NVYA 1PFNA 3J80E 2D62A 1UAPA 4J3OD 4FVMA 3PUWA 4ZRZA 5IGCA 4TVAB 1RWSA 3J81j 2V4IB 1EZ6A 1KL9A 1ZYRD 1LT4D 1RRBA 1YX5B 1IGDA 1C7YA 3OIPA 2WXQA 2A74C 2EYLA 2RHQB 1N32L 5DEHA 2DY8A 4XWWA 2WU2B 1PVOA 4GLVB 3NSWA 3AYHB 1UGMA 3K5LA 1LACA 2CHZA 1KQSA 3CCMA 4JI4Q 3ERSX 1HHVA 1JMLA 1CJEA 1LFDA 2KDBA 3HOVB 1BT0A 3L3OC 3CCUA 2N49A 1P1AA 4R4TA 2UUBQ 5H1SE 1P3QU 2DNCA 2L5TA 3N30A 1C4QA 1Z7TA 2RSOA 1RD9D 3SHQA 1VQDA 4EE2A 1GD7A 3ZVVA 3S1NB 4A4IA 1IXRA 1KTKA 3S14B 1NDDA 4KGTA 1G6JA 1KDBA 1E7ZA 3F8TA 1WIAA 2KKCA 3CWIA 3QIJA 4G11A 4W9HA 2Z6KC 3GTGH 3RUZA 3MJ5A 5C1ZA 3TBIB 1EY5A 1PXUA 1J19A 2K4KA 1WJNA 2F0OA 3NBHA 4DAYA 3M63B 2YU9B 3BZDB 3W5VB 4OZCA 5BMIA 3ML8A 1A3VA 3NP8A 4PK1A 1EQVA 3ZIMA 2XWBB 1BCPF 4P7IA 5JHAA 1LTSD 4PMWA 3PO3H 2VZKB 3DCGA 2BWFA 3VXWA 2GI9A 3H6MA 2KNBA 5BN3A 2XRQD 2K5NA 4ZYSA 3GP7A 2XIWA 2LMCA 3DBLI 3DWPA 5KEEA 3GTPB 2PE6B 3HKSA 1SYGA 3PRZA 2FFKB 3PO3G 1F2RC 4CBVA 1TZOA 2W54A 2MRPA 1D5MC 1OXVA 4JC0A 1YNXA 1TY2A 4DAPA 4G7HC 2F03A 3GTGB 5EBCA 1PMRA 3NBHB 3ZJUA 4WWNA 1SIJA 2Y3AA 2BYVE 2MO1A 2LWPA 5J2RA 3AMZA 2LS01 4KKJA 4F7ZA 2YVCA 3PLUA 1IBMQ 1CSQA 3EN2A 1SE2A 4FJYA 2DNFA 3S1RB 3J7AV 1SYBA 4TQ1A 2B63H 1N34L 3CF5A 1VQMA 5M5YB 5JEAG 1HFNA 1Z6HA 2QSDA 2BDOA 2ZT9C 3KLSA 3AEAB 4DR1L 1J8CA 3UI2A 3PUXA 2F4VL 4YSXB 3E5SA 3DBRB 3PS6A 1TWHB 3MC0B 2PNRC 2LGXA 3KF6A 2IHEA 3TMPB 1X32A 5JJIA 1QCBD 1SYCA 1XPUA 1AFPA 3L4PA 2LZ6A 3TP6A 4NZLB 4OIKA 4FHJA 2L1BA 2VY3A 3TRZA 1EL0A 3OTOQ 3H15A 3AU5A 4A90A 3DQVA 1U9RA 1PFMA 3HOVH 2NN6G 2D0PA 2XK5B 4JI5L 2TSSA 4JI6Q 2VZKD 1CZGA 4URKA 1Y1VH 3OW2A 1TY0A 1F9QA 4PMCA 3VTUA 4FULA 2E2JH 1YJNA 3ZJVA 1SMXA 3DHHC 4BAXA 2K39A 3RNFC 3H1UA 1JWBD 3PUYA 3U8ZA 1FRRA 2BQQA 1E22A 1JRPA 2WP8J 2V4DA 4AYBG 4IG7B 3JSVB 3VAWA 2VL6A 4QB4A 1V1QA 2DNEA 5D2MB 4BWGB 3F2DA 4XT1B 3ICEA 2PZUA 2RDBC 2MBQA 3ERQA 1K73C 5KYIA 2ZXRA 3PIP3 3APCA 4OHJA 1TU2B 1NE3A 5E4XA 2YYZA 4ZK9B 1K8AC 1PFDA 4QGUA 4ANUA 1XNQL 3PF5A 1EY0A 4JI1Q 4XTCS 2I38A 4YWLA 1EY4A 2J0TD 1GUGA 3H09A 4ULLA 3RN2A 4CJ1B 4L5RC 3SEBA 3N9YC 5E3FA 1FXTB 2KFKB 1WX7A 2R2OA 2BKFA 2IO3B 1I3QB 2INCC 2UXDQ 3N52A 2EZVA 1JWAD 4HPMB 2E2HH 4DR4Q 5G3LD 1KH0A 3QOLA 1W6JA 2TMPA 3ZO5B 1V5TA 4DK1A 3Q14C 4DR4L 2JYEA 4K0KQ 2JY6A 3U4EG 4OONA 3FKIG 1XPOA 2NVXH 4JV5Q 1LGRA 2CCZA 2JA7H 1QNKA 1LTTD 2LKVA 4JBWA 2XTIA 4MHEA 3RMHA 4A3LH 1WR6E 4LJOB 1I7HA 3RLNA 2M19A 2QEJC 1CK1A 2SDFA 4EQPA 2NVQB 1B9RA 2CR5A 5KYLA 3GTKH 4EQNA 1X9NA 2DX5B 4K7SA 5FLXE 3K7UC 3TBLD 3RYTA 4YY3Q 2AHOB 2JRIB 2N9LA 1LQBA 1MD2D 1ZDVA 1VQ5A 3NOBA 2O6VD 2L1AA 1XLQA 2JVCA 1K0RA 1ZP0B 3VYRA 5C3EG 2Q2TA 4GN3B 4O42A 4AWJA 1FCLA 5CR3A 2H1EA 5KHOA 2AYOB 2H5XA 1JJGA 2KT7A 2WXMA 2KQ3A 3X3NA 1A15A 4DV1Q 2Q8IB 1BOSA 2RMMA 4BOSC 3S9WA 1VR9A 4A3FG 1NI3A 4L5QA 1K0SA 1PTOH 3KF6B 4N9F4 1JRUA 1AW7A 1J7BA 3U7DA 2RDHA 1ASZA 4MJSA 5CV9A 2N0SB 3VTWA 3E9SA 3ZNID 1NTGA 1GHJA 3OHXC 1BF4A 3HG9A 1EWCA 4C1NI 4PS7A 3NENA 2LXCA 3Q0AA 4ZLTF 1YIJA 1JROA 2EKIA 1EWHA 2WB1B 4GKKQ 2VH2A 1B50A 1WGKA 4ANXA 4CGYB 2PW9A 2ALYB 2AUJD 3AU7A 1LABA 2SOBA 4YCUA 1C0AA 2J7ZA 3H91A 2KX0A 4JG2A 4IUNA 4JI0L 1L1OB 1Q7YC 2SNSA 1PHJA 2MW5A 4C80A 2FE8A 3E56A 5BR8Q 2J0MA 4X64L 1QILA 5GADC 2BB5A 3BY4B 1XNQQ 4W9LA 2NZOA 3BG3A 1ASYA 2RGFA 3R7QA 3EUB2 3Q69A 2PLPA 5D3DA 3HOVG 4WAFA 1FD7D 4FXKC 4XQNA 4K14A 4GMVA 3U52E 2FJ2A 3IVFA 3PHWB 1XMQL 3AV8A 1PQSA 2B63G 4RCOA 2O2LD 1N6ZA 2KANA 3A7AB 4C2MB 2EJMA 1QZGA 2KDIA 3A5ZB 5IYBG 5G2NA 5JJZA 4AP4C 1JT8A 3KDFA 3ZQ4A 2WXRA 1JOKA 5J39A 1EQRA 3U58A 1AARA 4ME5A 4W9EA 4BY1G 3G7LA 1ZGUB 1LLRD 2KOLA 2K8BA 2KHWB 3Q3NC 1HNWL 3I4NB 2Y0SG 5ELFA 2MP1A 4I65A 1VQIA 2RSNA 2D11A 1A2UA 2EJFC 3BVGA 2F0GA 4A3MH 5CC4A 2AX5A 3K7AH 2BYFA 2FIFA 1TS4A 2E6XA 4WIPA 1CQVA 1XLNA 1ZW7A 1HZ5A 1DXMA 4A3EB 1GVPA 3PTFC 4XXEA 5CORA 4RM8A 2CKHB 1KLGD 1TS5A 2JA6G 3OYYA 1UWMA 1PH4A 2WQYB 3AEBB 4A3EH 1AE2A 4K1RB 5FR6A 4JQWC 4B9WA 2GMIC 1OEYA 2R7FA 1TIID 1U0LA 2K0PA 2DZMA 2HJ8A 3K9PB 4NKLA 1KAWA 1PYWD 3S2AA 3K8AA 1L0VB 2EE1A 2KHJA 1C78A 1WXSA 3MP9A 5BYSA 4L1BA 1KRSA 1X56A 2F3IA 1TXYA 3OSOA 3I3CA 1L5PA 3NTKA 3CD6A 4BKSD 2V3SA 3GV6A 2Q8RE 2B3GA 2A1AA 3CQZB 2NYZD 3S1MH 3ZNZB 4JK1C 1ROEA 1Y14B 4G4KA 5GMVA 4HTHA 4JOIA 5I9OA 1E2WA 3ITPA 2XEWA 4JLCA 2R92G 1TZ1A 2UU7A 4A3IG 5JVH3 1VQ6A 4C3HB 4HJ7A 1A3UA 4XQJA 4K2LA 3F2UA 4A3BB 1ISNA 2Q2UA 2CJNA 1H9MA 3HRDD 3QX1A 4F7XA 4OEMB 4M8MA 3J80L 1R9TH 1C4PA 3M4QA 1MJDA 1L0WA 4X66L 2JYOA 2HDLA 4ZRIA 5EE3A 4GOCA 4B3ML 4LF9Q 4R3DA 2GN5A 2NTTA 4LF4L 4MH8A 3SR1A 3AB5A 4BBRG 1G6PA 3PF4A 2DYBA 4HIDA 1IYFA 3VR8B 1D2BA 3FEWX 5AUKA 1GUTA 3SGIA 5ELBA 4LNNA 1XLPA 3S1MB 4XDDA 1ENCA 4WJQA 3TUOA 3DOWA 4DV5Q 4DV6L 1LT3D 1NNXA 1S5FD 4OL7A 3H0GH 3C1EA 2EQSA 5IGGA 2R3ZA 1BQQT 4QUFA 2K33A 1IBKL 4RGNA 4JI8Q 3GTJH 1CA5A 1UBQA 1WXQA 5TR5A 4B9KA 2UUAQ 2MBHA 2OEOA 5E7NA 1WF9A 1M8AA 2C5CA 1A63A 4IPDA 1AH9A 4X62L 2WIIB 1FFVA 3QOJA 4A3KG 1S5ED 5T1IA 1VQJA 4DV3L 4JI6L 3PGZA 4KV2A 4LF8Q 2MA9B 1I6VC 1RJTA 3S1QH 4DQOC 2AQ2B 4DR2L 2F0JA 1WYDA 2B2WA 1E3PA 2KAJA 1K51A 2MHJA 1L0XB 1V1OA 2GLSA 1IYVA 1JC7A 2UXCQ 1PRTD 1SIFA 3CCSA 2KYWA 2R7ZB 1SBBB 4XYCA 2RDGA 1VCBA 1Q90A 1HZBA 3BDOA 2UXCL 4B3SL 1S1QB 1IP9A 3PGEA 2RVLA 2NVYB 3MXNA 1E10A 3A56A 2QKIC 3I4OA 4P2CB 4XYQA 5KGUA 2RCFA 2VQEL 4FA6A 3WANA 4DGZA 5IWAL 4NMZA 4ZAIA 2V4LA 2IL8A 5GAHC 5LMUQ 4KKIA 3VRAB 4FLHA 2MHVA 4X62Q 2PQAA 1PA6A 4QQBX 5D94A 4GN5A 3AQQA 5IGEA 2CW0D 1W3SA 3NE5B 4DV7Q 4EZKA 2N7JA 2DAJA 1A0IA 4AJYB 1CFMA 4A3OA 4IDIA 4IPHA 4POFA 1V80A 5BO4B 4GKJQ 3DVGX 5HHDG 4CHKA 4A75A 5FLMG 1WTOA 2NVTB 2LI5A 3M4OB 1MKHA 2HT1A 3PZDA 4NP5A 1L1OC 1Q1EA 3WDNA 4A93B 2MUYA 3R2TA 3G48A 4A3JH 4PQXA 4GNXC 3WOFA 2JSVX 2PE9A 4LLGM 3N3KB 2RDFA 2A6EC 3A8KE 1JWSD 2KMMA 3X3MA 3EBEA 1OQQA 3ZNGC 2D2CC 2L55A 2LRWA 1WTRA 5EJWA 3DBLB 3MTNB 1DOYA 1NJIC 1OGWA 2OT2A 3DHIC 4OX9Q 3A4RA 1VDZA 5I4DA 4QUCA 4G57A 4NPSA 4X66Q 3V6CB 2ZPYA 1OTCA 4K5VA 2N7EA 3UDFA 4B3MQ 4HJAA 3H6NA 3JVZX 3AEDB 1A70A 1HJPA 3L16A 1TTNA 1O78A 2H89B 2AWOA 5FJ8G 1G6ZA 2WDVB 1SE8A 4DXFA 4TV3A 4O2DA 4KHPQ 1XYIA 3AECB 1LXDA 1N5XA 3PPAA 4A3MB 2KFKA 2B76B 2UXDL 1N60A 3DBRI 4JX1C 1V9PA 4CKEA 3KQ4A 1IBLL 4OZAA 3EC8A 3HHMA 4HRSA 3I73A 5GROA 1WE7A 2EYPA 5J18A 1FL0A 4BXXH 2JE6I 3K59A 5H92C 3KJPA 4MM3A 2WFWA 4O1NA 1K8OA 1J9OA 2K75A 2ZJRA 1L6UA 2B2VA 2G4SA 3K5OA 2FUG1 5KNDA 4FO2A 2RKSA 3T53B 3CSFA 3IFTA 3DPDA 4W9CA 3CCJA 1DCZA 1UE5A 4J6HA 1XCTL 2SAKA 3S2HB 3OG5A 2FXQA 3OWEB 3TREA 3EQLC 1ESRA 4I6PA 3AI5A 2J42A 3PREA 5IYCH 1Q5WB 1PZID 2NTSA 1FJGQ 2NR2A 5EE1A 2RCNA 5EBDA 3TZDA 4LFBL 1NR4A 5KRUA 2L05A 1VDVA 1ICFB 1JOOA 2AQ3B 3A0JA 1VQ4A 3SDLC 4YWKA 3VR4A 4AH6A 4JOIC 4EKUA 4JI2Q 2AMCB 2K8HA 2VUMB 5IT9L 4FF2A 2KXJA 2QA4A 3P1HA 4R4IA 5G5HA 3DWMA 3PSIA 3TP8A 2GBKA 3Q3FA 1F9RA 3I63C 4WQMA 1PH5A 2DWQA 5CV5A 3Q22A 2YTVA 2LXKA 3OTOL 2BE5C 1Y8PB 5KNCA 2ZPNA 1PGAA 3MHZA 3CCLA 3U7ZA 4KZCA 3ZRCA 2M8SA 4OWTB 2QDFA 3AEGB 2I2YA 1D6EC 1T0YA 4RGMA 3CCEA 3W1BA 4EGVA 5HG2A 1VMPA 4R4OA 1WTXA 4DUZQ 4LDTB 4ZRQA 1X3PA 2BS4B 4B3RQ 4EFOA 1YJ9A 1F2YA 4R8NA 1IBML 4PYZA 3DHQA 5C23A 3K0YA 3DM3A 2N3SA 2KVZA 3I4MH 5D65A 4HJ5A 4WJNA 2JA5H 1JWMD 1VQLA 1RFAA 2K22A 4WORA 4QIWE 1T5EA 2PO4A 4FF4A 3GTLB 2F0PA 2QW7A 4H13C 4OO1I 2N9EB 2XBBC 3BK1A 4NXNL 3IRBA 4A55A 2HHHQ 1IBXB 4UDUC 4A3KH 5FO9B 3TCAA 4FXCA 3B1LX 3NJTA 2B2TA 3GTKB 2ZTEA 4ASWC 5K36G 2WHIA 4WJPA 2R92B 1I6HB 1TWFH 1P7EA 5JVG3 2DZJA 4M01A 3MHSD 1O7IA 4C00A 1Q1BA 1TWFB 2NUCA 3RZDH 1I94L 4KHZA 4IUPA 4LNKA 4HROA 1N62A 1R4QB 3CW2C 1QVGA 2HIVA 3HOZB 3W2DA 4CHTB 1CSPA 2WINB 2EKEC 2LXAA 2JA7G 1FXAA 4FDBA 2WX1A 1Y69U 1EIGA 2JA5G 1MPEA 5JEAJ 4ZRKA 3MEHA 3V05A 2LGDA 1EZ8A 3ALBA 3GE3C 3I2ZA 2RD0A 1VQ9A 4JVZA 2NBFA 4BA2I 2W55A 4LJZC 2KACA 2CHBD 1IL2A 5EKIA 3QAQA 4L2YA 1A6XA 1KAAA 1II3A 1WSPA 2LVOA 3RUIB 4YY3L 5NUCA 5CX3A 1IYUA 4N8X1 1QZHA 1G8ZD 5LL6X 2KK8A 4H2AA 2EOTA 4DAMA 2KEDA 2ZW0A 4N6EB 1N36Q 2R92H 4OVUA 3J7YW 4UP9A 2XRSD 4AQYL 2UXBL 4DR3Q 1CKNA 2EMTA 2PZWA 2PPBC 1V9JA 2RA4A 2WXLA 4NJCA 4OZBA 3RZDB 2JXXA 4U673 3I4NG 3N1XC 3A7LA 4C1NK 2O2VA 1W2BA 3UDIA 3A54A 3IT6B 4A3IH 1X3QA 3CMMB 4LK0M 3FPUB 2E74C 3OOCA 5T8IA 5LMNQ 1W6KA 1YD8U 1TWHH 1NY4A 1E9MA 4ZUJA 5CHVC 1QQRA 2ZNVB 1Q82C 3SXHA 2YEPB 1MHHE 2NS5A 3SK8A 2NWGA 1YOVB 1J7AA 2WXPA 1Y1VG 1YHBA 2CH4W 3VR3A 4JI1L 2B63B 2KJHB 5C3XA 2RF4A 1D1KA 3KH0A 1RCVD 1T0SC 2K5PA 1K9MC 2DAFA 2JK8A 2CWAA 1J7CA 1F9PA 2DGYA 4KMUC 3HUIA 3ZJTA 2L0TA 1VJKA 1C9OA 3P2BA 1MI0A 3CMAA 2HUGA 3I4MB 2ZXOA 2Z0EB 3F1ZA 3P4RB 3Q6BA 3CHBD 2F0MA 3TSSA 5IOIA 1FMAD 1B53A 5ELOA 3Q8EA 1TWGH 4MT5A 5CGKA 2Z6BA 4WURA 4JGHB 2WX0A 4US8A 1Q3LA 1EFWA 1BO0A 3H3VH 1RYJA 4REZA 1NUCA 5COYA 3N1ZC 1FD6A 2IGHA 2VUMH 1H9KA 3PIO3 3KDFB 3KVFB 4RNAA 2PW7A 4JI2L 2KWDA 1C8CA 4LJPB 3DM1A 2K7VA 5G55A 3RNCC 3MFYA 4Q0FA 2ZCCA 3M3YB 2EXZA 1QUQA 1LV9A 2BGFA 3S15B 4KLKA 1V43A 3M85A 4HJ9A 5C5LA 2ON8A 1P8LA 1QVCA 3T1HQ 1I5FA 4RM9A 3RNEC 4X3KA 4HCPB 3ZLZA 1CQFA 5IODA 3J81c 5IYBH 4TRDA 1TWAB 3RNGC 3E9HA 4JWUC 1L2FA 2KWUB 3J81L 4W9FA 3U9OA 2RSUA 2PYKA 3KUDB 1V5OA 4PNYA 4MACA 2F0UA 2WU5B 3H7PA 5I2XA 1K50A 2BCOA 2BW2A 2DJFC 3VVWB 4LUVA 3MXGA 1SNPA 4IOIE 2M4NA 1S4ZA 4IALA 1VF5C 2NVXB 4E3CA 1GB4A 1NBFC 4A3GG 1SMYC 4RMFA 4EQ5A 4OVVA 2HTME 5IP4D 2GVAA 2F52A 3Q3JA 4DHJD 1SJED 2UYZB 1PH1A 1N5WA 4XC2A 1QWYA 3RI7C 3CC7A 4AUQC 2KN5A 1HA5A 1IW7C 3ZDMC 2JQRB 2KTRB 3RD2A 2F0TA 4W9KA 4ANVA 5A2QL 2WNMA 2ID0A 1RFKA 2N88A 2GBMA 1E8XA 4DR3L 1GG3A 2YV5A 1Y8RC 3ZKJC 1UE1A 1PRTC 3M7GA 4HIKA 4YL8A 3RZOB 3V62A 2JF5A 3NEMA 2UXBQ 1L7YA 4WFN3 2C7MB 4MELA 2KA7A 3SD5A 1N36L 1HZCA 2MX2A 3BINA 3RLFA 2QC8A 3I7FA 3FRPB 1WWTA 1SFOB 4HCEA 2WXKA 3MHBA 5I6YA 2BF8B 2BBCA 3ZXVA 3HFZB 5LHY1 4AQ7A 4FP5D 3AE1B 4ICVA 4M1UB 2QDBA 1OXTA 2F0VA 1K8GA 2X69A 3F2CA 1SSNA 4JI7L 2GB1A 2WYQA 4MM3B 2JA8B 3IBEA 3CCRA 1Y1VB 2VRRB 1J8IA 4BKSA 4I7AA 3H9DA 3NZ3A 1GAQB 2KLGA 2MQHA 2MJDA 3KWLA 2BTEA 2VQFQ 4POGA 3NUCA 5C5MA 1I4RA 1HZAA 1ZXTA 4HAEA 1F0ZA 1UD7A 3CAMA 2A5UA 1VRAB 3A55A 1I4XA 1WFYA 2D10A 2KO3A 5ELNA 2HDEA 2Z59B 4XGAB 1XPRA 4KTAA 4ZQ3A 3EJIA 1A62A 3D8GA 3L0OA 4KJOA 2LGSA 3MXNB 4A3JB 1TS2A 1G2TA 5C44G 2L52A 3W1SC 2CW0C 5L37A 1B2TA 1OFFA 2B2TC 1RTOA 3AE9B 5G5GA 1BCPD 3ULPA 1DOLA 5IP9H 1F9JA 1SF0A 3GB1A 3KLWA 4H7BA 5C3JB 1E5WA 1ZXIA 1Y1WH 2A4ZA 1WI0A 4B3SQ 2PVGC 3TIXA 1IKMA 4OO1G 1NYQA 1TKEA 5FK9C 2WWZA 2MP2A 2PIAA 3MWYW 3LJ3A 3U30A 2Z0DB 4EZLA 3TL5A 4BBRH 1U4LA 3ABVB 3KBXA 4QIWB 3E9IA 2JA5B 2D3BA 3ENEA 1Q12A 2K1BA 1UEBA 4B3RL 3A5UA 2EXDA 1E8YA 2K6QA 3HOZG 1GC6A 1F2LA 1R4NB 4US9A 3RPFC 1EO6A 3UINB 4MZ9A 2ACZB 3M3JA 3DVGY 3C8YA 4RG1A 1Y8NB 3DEOA 1ESFA 4TSSA 3GD7A 4K5WA 3TP5A 1HR0W 4C3HG 4A3BG 1BCPB 4IOCA 3I4LA 2VH1A 5AJ3L 4L5SA 5JHBA 4NAWB 2GRIA 3NWTA 3S16B 4PMBA 1F52A 3QA8A 3SK5A 1WH3A 1WCMH 4JBMA 4RKLA 4RF0A 2K6AA 4RH6A 4IN3A 4JYAQ 2IGDA 5CYUA 2K6DB 3J7ZC 3MAQA 2V1CC 3QO2A 4JBJA 4BKGA 1YI2A 1N8RC 2EYHA 1JW9D 2JEBI 3T4AC 4DDGD 1K83H 2ZNVC 3JW0X 2GA4B 2NN6H 3E3XA 1I3QH 1K83B 3S24A 3PV1A 4LFBQ 2F0IA 1BDOA 3E0JA 1E2ZA 4LNIA 4ODGA 1LTBD 1RTNA 4YHHL 4JW0A 3PCOB 1NENB 4TKNA 4YTNB 2F3VA 1CTMA 3CXCA 1QE6A 1AZPA 1KNAA 1EU3A 2K5VA 3IAYA 1EYDA 2NBVB 3DUZA 4UAIA 3PUVA 4A3EG 1EIYB 2X6GA 2OWOA 1KRHA 4S3SA 2D2QA 2WS3B 2ZVNA 3TEWA 4JV5L 2DZKA 3UIOB 5DPRA 2KJXA 3MXUA 3TEYA 3OMGA 1WX9A 4L23A 3AMUA 1TIFA 3TJPA 1NR2A 4M8AA 1I4PA 1Z47A 2VNUD 2Y0SB 1FNUA 3BIID 5IKCM 4NJ6A 3M4PA 1WMHA 4PYUA 2KVRA 3FILB 3QWZB 3ZUNA 1D3ZA 4HIOA 3AEVA 4K7WA 2OJRA 2LJIA 4DHZE 1BR9A 1YQ3B 2OF1A 1EQQA 3VR6A 4ACFA 3WAOA 2AWTA 1B9MA 1H9RA 3OWFA 3PRMB 3AFPA 1U4MA 1VZ7A 2I46A 3IL8A 4EOYA 4BBNF 4NXML 2OOBB 4DHJB 1WJ6A 3G6JB 4GKKL 4B9XA 2DYOA 1LT6D 3I90A 5TSSA 1WZ3A 1LTID 2KMCA 2BE5D 1U4RA 4IM0A 4APVA 1PGXA 1JORA 4GIVA 4BBSG 1WJJA 4NW2A 2V1YA 2C35B 1B44D 3D0FA 4KY7A 4LCDE 3HVZA 4BZAA 2WXNA 3A9KB 2J4XA 2NBWB 4MEMA 2W9NA 2HIXA 2ENBA 2IGGA 1IYJB 1IHZA 1P16A 4IURA 3DLLA 3WIMA 5C4JB 1RM6C 1WFQA 4OX9L 1FGBD 1SYFA 1C48A 5M5XH 1GHKA 2L8JA 3F2BA 1VQHA 5DPSA 2SNMA 2EY1A 4KSKC 4BOZB 3U4VA 5J1ZA 3EFUA 1YEZA 3FMCA 4IJHA 2IX0A 4R9WA 1EUJA 4RA8A 5CV6A 4X65Q 2IPKD 5E1FA 2N78A 2DENB 4RAUC 2A69D 3K81C 5IYDH 4HWIB 4IPGA 5CHFA 4FJVB 1XJVA 5M3FH 1WXVA 5JXVA 2K5QA 1DOMA 2PW5A 5EKLA 1KRTA 3GTOB 2Z4IA 2ZZPB 3PLVA 1I94Q 2HJ1A 4K3CA 4MGYE 4UP7A 1N33Q 2HCIA 3H3VI 2C5LC 2Z6KA 5BR8L 1VF7A 3TMEA 5BMHA 2DYMA 3L2PA 3T9LA 2IT1A 3ND8A 4A3FH 2I1KA 4JE3B 5DAUA 3A8IE 3DEPA 4LMQD 3V2TA 2VQEQ 1KM7A 2IO1B 5L95C 1AP0A 2IHFA 5C2TB 4X57B 4IUMB 1MFWA 5C4HA 4C2MH 3NXWA 3H3VC 2KN4A 2PEAA 1STHA 3K6OA 2I07B 1JJCB 5IGDA 2K32A 1KF6B 1EU4A 3ONAB 2AQ1B 2NVYH 4RHRA 3CCQA 1FPYA 3M62B 1I6HH 4ZDVA 1XNRL 3RZFA 5EPKA 2JP1A 1KXLA 1MG4A 2L83A 1R7SA 1K8MA 1K53A 3K58A 2INNE 3RN9C 4G50A 3VDZA 2XGTA 3A8JE 1RHPA 3MXPA 4J8QA 2KD0A 1V2YA 1K3BC 3GQBA 1DZ1A 3AM9A 1QG7A 3Q8BA 2WP9B 4NQKE 4WJ3M 1TWAH 4A3DG 3VHTC 4TKOB 3S2HH 2NZ1D 1GOZA 1EM7A 4HKQA 1WM2A 1LT5D 4DV1L 1J0GA 2NPTB 5EPJA 1PH6A 2KECA 4MN3A 4LF6Q 3NWSA 1YHQA 1F1HA 3W9CB 5IT9E 3LB8C 4LK1C 1Y1WG 3JAMi 1SLJA 2F0KA 1NMGA 4DV5L 4XWTA 1SAPA 2B29A 1FFUA 5IN7A 2ZJPA 5LMNW 3GOEA 4LF5L 1FRDA 3HIZA 2CH4A 2INPE 4X3TA 3JAML 1SEBD 2F1MA 4I6LB 1YQBA 3APDA 1TGZB 4ARCA 4YCWA 3FVQA 1XX8A 4P74A 4DAYB 1MHXA 4LF4Q 3NRZA 1N9WA 2GOWA 2PTLA 2W82A 4FJZA 2IJ0A 4LF9L 1UE6A 4DNIA 4NJ7A 4OELB 3RLOA 5M5WH 2D5GA 2N7DA 1A5RA 1B7YB 1BVSA 3S16H 1J5EL 4P16A 1X55A 4A76A 4FN2A 1YJIA 4GLXA 1QF6A 1NAPA 3PT2B 4LFCQ 1L4ZB 1R4NI 3M4YA 4K0KL 3NZSA 3H7SA 5GAEC 2IY0B 4RGOS 4HPLB 1PFBA 1VLBA 3LXFA 1QT9A 1UEAB 2NVUI 1RL2A 1VQNA 3RMKC 1X1MA 4TQUS 3AE3B 1ZKHA 4UHVA 2GBNA 3N6RA 1CA6A 2NBUA 2A5HA 3J80i 4HMJA 1QNUA 3KUCB 1FGUA 2OXPA 4CO7A 2G5DA 1MSGA 3IAM1 1YIWA 4ZOHC 1MBYA 3VH4B 1EQTA 4A8XC 3L9AX 5FOBB 3QC8B 4DV3Q 4ZRPA 1T3QA 4BBRB 4DUZL 4IZ8A 4IKGA 1I35A 1D4BA 5C44H 2A8VA 1C76A 2MPMA 3B08A 3JAMc 4USAA 2WAQG 2EJGC 1WD0A 4C3JB 1K8RB 5JEAH 5C0XI 2FUHB 2JPHA 2MBOA 3RNBC 3CQZH 4KKSA 4LFAQ 4KY6A 4A3GB 4W9GA 2CHXA 5LXHA 2KVMA 3FKYA 3HOUB 4A3IB 1PTOC 3BDCA 4DV0Q 3EGRA 2EDGA 2WV6D 2B2YA 1C77A 2B2VC 1BUIC 2GBJA 2KC2A 1KLVA 5LNK1 2I5MX 2LD9A 4JI5Q 2YEPF 4KI0A 1V1PA 2IX3A 4H02A 3RZOH 1VZ6A 2KQSA 1KNEA 3NK9A 3QK0A 3SE0A 3STBD 2PVOD 4IC7B 1Q8IA 2SEBD 4KD4A 4DK0A 1XMQQ 2JZZA 5J3BA 2B3AA 1R4PB 1WM3A 1M4VA 4LTUA 2HHHL 3OLMD 3GZNB 3M7NA 1B3AA 1PFSA 4DR1Q 2Y5PA 5IP7G 3I3TB 4PT5A 4DR5Q 1WRIA 4C4VB 5I2YA 2A6HD 4LF7Q 3L54A 2MJEA 5EKKA 2LFIA 4K6LA 1VQBA 1QKZA 2K05A 2VS1A 3BZKA 2PCFB 5IYDG 3GTLH 4BXXG 3P42A 1HA6A 2C7NB 4IWQA 1A2TA 3Q6SA 4DU9A 4LNOA 3VR9B 3HOWG 4UY8C 4DUYQ 2EVBA 3EROA 3VTVA 2JZ3B 4G7ZC 4OWWB 5C4XH 3C1FA 1PYBA 4DUYL 1T6BX 3M95A 4XIGS 1WTPA 2VB3X 1C3TA 2LY7A 1WZ0A 5C0XJ 2HTHA 3KK7A 1YBYA 4KHPL 3KWVA 1JJ2A 1KJTA 4KZ0A 3S1RH 2D9UA 3OMCA 3RR5A 1B1ZA 5JPMC 4J1MA 4HJGE 4EEWA 4LAAA 4ZKCB 4IO9A 1VQKA 1L4DB 1EOVA 1EUVB 4E6IA 4AQYQ 3MA2B 2EY2A 2KFJA 2N1VA 1JB3A 2OJWA 5BYRA 1H4RA 5ELEA 1FM0D 3CKIB 3BU2A 2HQLA 2FINB 2K14A 1QJOA 4QY7A 5IP7H 1XWEA 1SE3A
chains in the Genus database with same CATH topology
1A3TA 1XF5L 2L0CA 1SDFA 3AB9A 4RWSC 4RF1A 5E6JA 3VA5A 2EYFA 3VYSA 2A68C 4HKZE 3B2GA 1CI3M 1SMYD 2A6HC 4KY5A 4CJ0B 1V8QA 4ZUIA 1IGCA 1OQRA 1TWGB 1ZPSA 1HTLD 1XCQL 2JZPA 3NHHA 3HZXA 1E0BA 1N61A 5JPNC 4FXGC 1WCMB 2K28A 2AWNA 3I70A 4H44C 4FF3A 4HR7B 2N9KA 1SE4A 3MFGA 3K57A 4A3FB 3KUPA 1ILPA 1QOGA 3QJYA 1FNWA 4ZHOA 1LTRD 2IW3A 1T5XD 5C3WA 4OIJA 2WXIA 3T3OA 1JR0D 3AE8B 4OW0A 4FXDA 4DNRB 5K36H 4FNFA 4K8JA 1EEID 1ZXHA 2QILA 1ML0D 2WAQB 1DOXA 1ZEQX 1HFGA 2LHDA 3AEEB 4C7YA 2QCPX 3VA7A 1QOAA 1ILQA 3EFXD 1E7PB 4IFDG 4QMGA 2BYTA 3FKIB 3PO0A 5CBEE 3IXSA 1XEEA 1G2SA 1PRTF 1S5CD 4Z9CB 1OXUA 1B9RA 1VMCA 2K03A 2KUMA 1WVLA 1YJJA 3K5MA 2WXOA 1YNNC 4KHVA 1ENFA 1HZ6A 1WD1A 2E2JB 4X3UA 4XT3B 1O7ZA 1BUVT 3CRLC 2Z4HA 3ND9A 5HI1A 3CIRB 1QB5D 5C44B 4XDCA 3I9V1 3BK2A 1RDPD 3NQIA 4IFDI 3J7AF 2LHEA 4H0LC 2A69C 3T13A 4DN4M 4F8MA 1BNZA 5AUIA 3VRBB 5KIXA 1TQOA 2KCNA 4N9PA 2E76C 4F87A 5IGBA 1QOBA 1GB4A 3QIAA 2BA1A 4EVOA 3GO5A 3QB3A 4KN7C 1KDAA 2JXTA 2E2DC 1STGA 5K5PA 5M9OA 5MPOA 4R8IA 3HP3A 1DD2A 1YMHE 5HFYA 3AE5B 1RODA 1SSOA 1YNND 3V3XA 1ZDXA 5FO7B 3ZYYX 2MEKA 3D31A 3LX0A 2PMZB 4B08A 1L0YB 1HQMC 1GUNA 5IGFA 3HGBA 4HSVA 3NTHA 2H88B 3AE2B 3P63A 3PZ7A 5T1GA 3QWNA 4KKTA 2L12A 5BMGA 4KX6B 1FCCC 1F2ZA 5BN5A 4YSZB 1TT2A 1EY9A 2LFNA 3OPOA 4C3IB 1I50B 5GXGB 3PO3B 5JOBA 4Q5VA 5D7GA 1EIHA 2MGSA 3FPPA 2EELA 3KF8A 1SNMA 3WCQA 1FO4A 3D4RA 2G9DA 2MJ8A 1KLUD 3OIQA 4IUUA 2F0QA 2VXWA 2J52A 4FYDA 1E0ZA 1YQ4B 2V3PA 3E6ZX 1S5BD 1UWXA 2BA0A 3ZGZA 2KHSA 2EPBA 2QF7A 1YN3A 2KQ4X 4WJWA 1ICWA 1IKLA 1TKWB 2DN8A 1K52A 1U4PA 3URYA 2EY6A 1VZ8A 1SYDA 4GDLB 1B9NA 3SK6A 3IKJA 1TKGA 2R61A 1ZOYB 4ARIA 4BA1I 4NAMA 3TZUA 2FHTA 4FF1A 5ELDA 1O7LA 1QOFA 1YNJC 4G7OC 4IFDH 2BS3B 4A3KB 2A73B 1C9FA 4K5XA 1I4QA 1PUTA 4HEDA 2R6GA 3I57A 1F2MA 1H9SB 4X3SA 4B0MA 4ITKA 2XN9C 4KV6A 3ETRA 2XVSA 2K5WA 2NB0A 1OXSC 4RFBA 2O5JC 2M0AA 1CM9A 3R93A 2QMTA 1PTOB 3D4WA 1O7YA 4JPSA 1ZE3D 1JQYD 2BT6A 3AEFB 1FR3A 1H9JA 1STBA 5D3IB 4A6QA 4U68A 3P4QB 5DNFA 4RGTA 2BS2B 3B9JA 5CV8A 1DOKA 5G3LF 1DOIA 4K8IA 3Q8CA 3R8BA 5EPLA 2MH7A 3U2SC 4JWSC 4L63B 5HGTA 3DXJC 2E2IB 2ZXPA 4P6VF 4YWGG 3JAME 1STNA 2M56B 4RCNA 5J22A 2WKDA 3S1QB 1D5ZC 2DLBA 5ELCA 3PV0A 5EGTA 3C3LA 1EY7A 1DONA 2PKOA 4CJ2C 3QG1A 5FO8B 5ISRA 1EWYC 2DBYA 4AS1A 5IIFA 4K2KA 2A68D 2JSOA 3NQTA 3P75A 4C56C 1BXTA 1CHQD 3EA6A 2RPVA 2RQXA 4V0BA 2M00A 2K9XA 4YTMB 3J9CA 2K04A 4HN7A 3MTSA 1EYCA 4BY1B 2JYTA 3FILA 2X38A 1STYA 1SXTA 3T51B 2JWUA 2B8FA 2NN6I 3H94A 1ET9A 2B2UC 4KN4C 1N63A 4ILWA 3BYTB 3U9SA 4RKBA 1V8CA 3IT4B 4Y7NB 2VB2X 1SYEA 2JU6X 4ABNA 4HCSA 1AYFA 1JALA 1RKNA 1CT1D 2J53A 3D4DA 1SNCA 1MSHA 1KABA 1GJXA 2B39A 1UNSA 3NBIA 1SB3C 3LNNA 1E2VA 2F0HA 1I4GA 2HCCA 4D2KA 4WRDA 3L7ZC 5FLXL 5CMDA 1QOHA 3S17B 1FIQA 4MIUA 2PZTA 3VYTA 3SK4A 3B2FA 3DWAA 3TEXA 3C46A 3D6WA 2Q8TA 3D6CA 2L32A 1SJHD 3W5UB 3KBGA 1O80A 4YIJA 1OO9B 3VR2A 3HKZB 2BB6A 1H9SA 4KKUA 5C3EB 5E4WC 3NVWA 1PDQA 1SNOA 4NDXA 4N59A 1MGSA 1ONLA 1DJRD 2DY7A 4KGRA 2QIEB 4DA2A 2L9HA 3Q8FA 2XWJB 3MVVA 2W3SA 4N9TA 1IBXA 3DWQA 2CU3A 1V97A 5DM73 2LMCB 1FYCA 4DNTB 1C4CA 4ZKBB 2Z8LA 1GUWA 2X6LA 2XSCA 2JX5A 4YT0B 3UI3A 5C0XG 2LUMA 1TR5A 4RHSA 4WH4A 4OO1H 3RFZB 2XNAC 1Y8OB 2E2HB 2WXJA 5HURA 3VQIA 4KD3A 1PTOF 1HUNA 3SR6A 2OEDA 2Z1CA 1YNTE 5CV7A 3SFDB 1IW7D 4PV1C 3GTJB 2RBMA 1NCVA 5C4XB 1YN4A 4XE0A 3BVMA 3T56B 4CQNA 1OXXK 2W3RA 2O4XA 1SNQA 1PZJD 3BVZA 2F4IA 3Q8AA 1D1IA 3TDQA 3C2PA 3AE4B 3DMUA 4TQ0A 4I7ZC 1TKYA 4IFDJ 2CQAA 3T3NA 1BMLC 1UUPA 2E75C 1ACCA 1E6EB 2ONQA 2A6ED 4GLSC 3HRZC 1L6VA 1G91A 2JA7B 3OW7A 2PQEA 3J81E 2ICEC 5KNBA 1WTQA 2BOSA 1P7FA 1HXYD 4N58A 1S5DD 2WKCA 1C79A 1PDXA 1GUOA 5DM63 4IQZA 1MVKA 3SHLA 2O5IC 4K6DA 4IUQA 1XTCD 1DYQA 2K5DA 1Q10A 1YN5A 2KEEA 5FKAC 3DWGC 3HOXB 3I8ZA 3V96A 3PZ8A 1YNJD 3BWUD 4XYOA 1AEXA 2AUKA 3CU7A 4L8JA 3R2IA 3W1SA 5C4ZA 3WOEA 2F0FA 4KK7A 5M5XB 2B2WC 1LTAD 5EQ0A 3VR5A 2ZW1A 1JWUD 1DGJA 2NMQA 1WTVA 2N55A 1TWCB 2CVRA 2C9OA 2IDYA 4BY7B 2G9HD 3AH7A 4A9AA 4DXGA 2E3TA 3PMFA 1I4HA 3HEJA 4KJNA 3BYYB 1HRJA 1PRTB 4HSPA 1VCIA 1HUMA 2B2UA 1TJEA 2F0LA 5I9PA 3CRKC 2IX1A 3KLRA 3NPPA 2MJ3A 1HCZA 1PLFA 1NYRA 1AWDA 2FMCA 3H0GB 1UGJA 2F0EA 3PUZA 3O13A 4L6TB 4IUVA 3P1MA 2R93B 5IOCA 1D5XC 1TS3A 1KFYB 4OVZA 5M3MB 2CJOA 4YXDB 5D14A 2OHFA 2EYMA 1ENAA 1TYGB 4YTPB 1GXDC 1AN8A 1PZKD 3GV3A 1QLBB 1NEKB 3HOYB 4WWMA 2WACA 1F2RI 4QF4A 4DF7A 3TEZA 2EYJA 2L11A 3T16A 2L4NA 3R3OA 5C0XH 1EOTA 1F9SA 4HMIA 2K01A 1SNDA 2PMVA 3Q24A 1BBXC 1XXGA 1EYAA 3P4SB 2EY5A 3NTIA 3GTMB 2F0WA 1GUSA 3W3AA 4C3JG 1R9TB 1FNVA 2BDNA 1JQ4A 4YSYB 1IL8A 1DM0B 1FEHA 2Q5WD 2ICIA 2KCCA 4C7ZA 3HOWB 3GS2A 2HDMA 3RD4A 1EY8A 5JAVA 1EFID 4BS9A 1WYGA 2WXHA 1GB1A 1LO5D 3NS1A 4IUTA 4C3IG 4EQOA 1RF2D 1AZQA 5CBAE 2Y5CA 5CV4A 4CKBA 3S2DB 2M9VA 3P7JA 4B0EA 4ID6A 1Y56A 4OGQC 1PTOD 4GZYC 3I91A 1GPXA 5EE0A 1LTGD 1KDCA 3LWUA 3NVZA 2F0SA 2WXFA 1NVID 1ZKOA 2FBWB 4AYBB 1STAA 4XQQA 1IUEA 3FAHA 1BCPC 4DAVA 1JE4A 3BDLA 4KGSA 1G291 5AFWA 1HTPA 5BN4A 2QJLA 4A3DB 2B8GA 1F77A 2LGIA 2F0NA 1ZUD2 2WDRB 2JXMB 4XDXA 5BYQA 4HEA1 5A35A 5C6AA 3H8HA 1B4OA 3EVQA 4F88A 1JCKB 5M5WB 3BS1A 1XO3A 2WXGA 5FR3A 2IWHA 1PGBA 1JOQA 3TN2A 1MI2A 1NSNS 5I6WA 5H8YE 2F0DA 2EYOA 3VYUA 5A2QE 1Y1WB 2FMMA 4TMAB 2JA6B 1EY6A 2WLBA 2V3NA 5EE9A 1XLOA 3AE7B 3HS0C 1JICA 2WDQB 1HPCA 3SVMA 2F3WA 3LWEA 3P20A 3IFDA 2G1EA 2M2LA 3I72A 3Q23A 3K7AB 2H4OA 3SFEB 2V0GA 1CZPA 4M0WA 3NVVA 4BBSB 3LYYA 3AN1A 5M3FB 2JEAI 1HQRD 1CHPD 3TP7A 2LEKA 3NUHB 2HQEA 3IAS1 4V190 3K5NA 3FDTA 3KLSX 3SDZA 3D3RA 3FC4A 1FXIA 3AE6B 4DFAA 2D5DA 5F2DA 4Q2JA 5LL6S 1TVXA 1CZWA 4QCLA 1ZYRC 2B2YC 1STEA 2KDMA 3P4PB 2K3UA 1C4AA 1HEZE 1V1PB 1EEFD 4GDKB 3HVDA 1WTWA 3MZ5A 3PO2B 3GTQB 4CKCA 1ET6A 3NVYA 1PFNA 3J80E 2D62A 1UAPA 4J3OD 4FVMA 3PUWA 4ZRZA 5IGCA 1RWSA 2V4IB 1EZ6A 1ZYRD 1LT4D 1IGDA 3OIPA 2WXQA 2A74C 2EYLA 5DEHA 2DY8A 4XWWA 2WU2B 3NSWA 3K5LA 1LACA 1HHVA 1JMLA 1CJEA 3HOVB 3L3OC 2DNCA 2L5TA 1C4QA 1Z7TA 2RSOA 1RD9D 4EE2A 3S1NB 3S14B 1KTKA 4KGTA 1KDBA 3CWIA 3RUZA 3MJ5A 3TBIB 1EY5A 1PXUA 2F0OA 3NBHA 4DAYA 2YU9B 3BZDB 3W5VB 4OZCA 5BMIA 1A3VA 3NP8A 1EQVA 2XWBB 1BCPF 1LTSD 4PMWA 2VZKB 2GI9A 3H6MA 5BN3A 2XRQD 4ZYSA 3GP7A 2XIWA 2LMCA 3DWPA 5KEEA 3GTPB 1SYGA 2FFKB 1F2RC 4CBVA 1TZOA 2W54A 1D5MC 1OXVA 1TY2A 4DAPA 4G7HC 2F03A 3GTGB 5EBCA 1PMRA 3ZJUA 1SIJA 2Y3AA 3AMZA 2LS01 4KKJA 1SE2A 3S1RB 3J7AV 1SYBA 4TQ1A 5M5YB 1HFNA 5JEAG 1Z6HA 2QSDA 2BDOA 2ZT9C 3KLSA 3AEAB 3UI2A 3PUXA 4YSXB 3E5SA 1TWHB 3MC0B 2PNRC 1X32A 1QCBD 1SYCA 1AFPA 3L4PA 3TP6A 4NZLB 4OIKA 2L1BA 1EL0A 4A90A 1U9RA 1PFMA 2NN6G 2TSSA 2VZKD 1CZGA 1TY0A 1F9QA 4PMCA 3ZJVA 1JWBD 3PUYA 1FRRA 1JRPA 2WP8J 2V4DA 4QB4A 2DNEA 4BWGB 4XT1B 2PZUA 3ERQA 5KYIA 2ZXRA 3PIP3 4OHJA 1TU2B 5E4XA 2YYZA 4ZK9B 1PFDA 1EY0A 4XTCS 2I38A 1EY4A 2J0TD 1GUGA 3H09A 4ULLA 4CJ1B 3SEBA 3N9YC 5E3FA 1I3QB 3N52A 2EZVA 1JWAD 5G3LD 1KH0A 3QOLA 1W6JA 2TMPA 4DK1A 2JYEA 3U4EG 1QNKA 1LTTD 2LKVA 4JBWA 4MHEA 3RMHA 1I7HA 2M19A 2QEJC 1CK1A 2SDFA 4EQPA 2NVQB 5KYLA 4EQNA 5FLXE 2N9LA 1MD2D 2L1AA 1XLQA 1ZP0B 3VYRA 4O42A 1FCLA 5CR3A 2H1EA 2WXMA 2KQ3A 3X3NA 1A15A 2Q8IB 1BOSA 2RMMA 3S9WA 1VR9A 1NI3A 1PTOH 1AW7A 1J7BA 2RDHA 5CV9A 2N0SB 3E9SA 1GHJA 3OHXC 1BF4A 3HG9A 1EWCA 4C1NI 3Q0AA 4ZLTF 1JROA 2EKIA 1EWHA 2WB1B 1B50A 1WGKA 4CGYB 2PW9A 2AUJD 3AU7A 1LABA 2SOBA 2J7ZA 3H91A 4IUNA 2SNSA 4C80A 2FE8A 3E56A 1QILA 2BB5A 3BG3A 3EUB2 3Q69A 2PLPA 5D3DA 4WAFA 1FD7D 4FXKC 4XQNA 4K14A 3U52E 2FJ2A 3AV8A 4RCOA 2O2LD 3A7AB 4C2MB 2EJMA 5JJZA 3ZQ4A 2WXRA 1JOKA 5J39A 4ME5A 3G7LA 1LLRD 2KOLA 3I4NB 5ELFA 2MP1A 4I65A 2RSNA 1A2UA 2EJFC 3BVGA 2F0GA 2AX5A 5CC4A 1TS4A 2E6XA 4WIPA 1CQVA 1XLNA 1HZ5A 1DXMA 4A3EB 4XXEA 5CORA 1KLGD 1TS5A 1UWMA 3AEBB 2WQYB 4B9WA 1TIID 2K0PA 4NKLA 1PYWD 1L0VB 2EE1A 1C78A 3MP9A 5BYSA 4L1BA 1L5PA 3OSOA 3I3CA 3NTKA 3GV6A 2Q8RE 3CQZB 2NYZD 4JK1C 1ROEA 4G4KA 4HTHA 5I9OA 1E2WA 3ITPA 5JVH3 4C3HB 4A3BB 1A3UA 4XQJA 4K2LA 3F2UA 2CJNA 1H9MA 3HRDD 4F7XA 3J80L 1C4PA 2JYOA 2HDLA 5EE3A 4R3DA 2NTTA 4MH8A 3SR1A 3AB5A 3VR8B 1D2BA 3FEWX 5AUKA 1GUTA 5ELBA 1XLPA 3S1MB 4XDDA 1ENCA 3TUOA 1LT3D 1S5FD 4OL7A 3C1EA 5IGGA 2R3ZA 1BQQT 4QUFA 2K33A 4ZHPA 4RGNA 1CA5A 1WXQA 2OEOA 1M8AA 2C5CA 2WIIB 1FFVA 3QOJA 1S5ED 5T1IA 1I6VC 1RJTA 4DQOC 2AQ2B 2F0JA 2B2WA 2KAJA 1K51A 1L0XB 1V1OA 1IYVA 1JC7A 1PRTD 2R7ZB 1SBBB 2RDGA 1Q90A 3BDOA 2RVLA 2NVYB 3MXNA 1E10A 3A56A 2QKIC 4P2CB 4XYQA 5KGUA 4DGZA 4NMZA 4ZAIA 2IL8A 4KKIA 3VRAB 2MHVA 5IGEA 2CW0D 3NE5B 2N7JA 1CFMA 4IDIA 5HHDG 1WTOA 2NVTB 3M4OB 4NP5A 1Q1EA 3WDNA 4A93B 2MUYA 3R2TA 2JSVX 4PQXA 3WOFA 4LLGM 2RDFA 2A6EC 3A8KE 1JWSD 2KMMA 3X3MA 1OQQA 2D2CC 2L55A 1WTRA 5EJWA 1DOYA 2OT2A 5I4DA 1VDZA 4QUCA 4G57A 4K5VA 3AEDB 1A70A 1O78A 2H89B 2AWOA 1G6ZA 2WDVB 4DXFA 1XYIA 3AECB 1N5XA 4A3MB 1N60A 4JX1C 4CKEA 4OZAA 3KQ4A 4HRSA 3I73A 2EYPA 2JE6I 3K59A 5H92C 4O1NA 1K8OA 1L6UA 1J9OA 2B2VA 3K5OA 2FUG1 5KNDA 4FO2A 2RKSA 3T53B 3IFTA 1DCZA 4J6HA 1XCTL 2SAKA 3S2HB 3OWEB 3EQLC 1ESRA 2J42A 1PZID 2NTSA 5EE1A 5EBDA 3TZDA 1NR4A 5KRUA 1VDVA 1JOOA 2AQ3B 3VR4A 2VUMB 5IT9L 4FF2A 3P1HA 5G5HA 3DWMA 3TP8A 1F9RA 4WQMA 2DWQA 5CV5A 3Q22A 2BE5C 1Y8PB 5KNCA 1PGAA 3MHZA 3U7ZA 3AEGB 2I2YA 1D6EC 4RGMA 4EGVA 5HG2A 1VMPA 1WTXA 4ZRQA 1X3PA 2BS4B 1F2YA 4R8NA 3DHQA 3K0YA 5D65A 1JWMD 2K22A 4WORA 1T5EA 2PO4A 4FF4A 3GTLB 2F0PA 3BK1A 4H13C 4OO1I 4A55A 1IBXB 4UDUC 5FO9B 4FXCA 2B2TA 3GTKB 5K36G 2R92B 1I6HB 1P7EA 5JVG3 1Q1BA 1TWFB 2NUCA 4KHZA 4IUPA 4HROA 1N62A 1R4QB 3HOZB 3W2DA 4CHTB 2WINB 1FXAA 1Y69U 1EIGA 1MPEA 5JEAJ 3MEHA 3V05A 1EZ8A 2NBFA 4BA2I 2W55A 4LJZC 2KACA 2CHBD 4L2YA 5EKIA 1A6XA 1KAAA 1II3A 1WSPA 5NUCA 1IYUA 4H2AA 5LL6X 1G8ZD 2EOTA 2KEDA 2ZW0A 4N6EB 3J7YW 2XRSD 2PZWA 2PPBC 2RA4A 2WXLA 4NJCA 4OZBA 3RZDB 4U673 3A7LA 4C1NK 3A54A 3IT6B 4LK0M 1X3QA 3FPUB 2E74C 3OOCA 5T8IA 1W6KA 1E9MA 4ZUJA 1QQRA 2YEPB 3SXHA 1MHHE 3SK8A 2NWGA 1J7AA 2WXPA 2B63B 3VR3A 5C3XA 1D1KA 1RCVD 2K5PA 1J7CA 1F9PA 4KMUC 3ZJTA 3HUIA 1VJKA 1MI0A 2HUGA 3I4MB 2ZXOA 3P4RB 3CHBD 2F0MA 3TSSA 1FMAD 1B53A 3Q8EA 4WURA 4MT5A 5CGKA 4US8A 1Q3LA 1RYJA 1BO0A 4REZA 1NUCA 5COYA 1FD6A 2IGHA 1H9KA 3PIO3 4RNAA 2PW7A 2KWDA 1C8CA 3DM1A 2K7VA 3MFYA 4Q0FA 3M3YB 2EXZA 1LV9A 3S15B 1V43A 3M85A 2ON8A 5C5LA 4X3KA 1CQFA 5IODA 4TRDA 1TWAB 4JWUC 3J81L 3U9OA 2PYKA 4PNYA 4MACA 2F0UA 2WU5B 5I2XA 1K50A 2BCOA 2BW2A 3MXGA 1SNPA 4IOIE 1S4ZA 4IALA 1VF5C 2NVXB 1SMYC 2HTME 1SJED 1N5WA 1QWYA 1HA5A 1IW7C 2JQRB 2F0TA 5A2QL 2WNMA 2ID0A 1RFKA 2N88A 1PRTC 3M7GA 3RZOB 4WFN3 2KA7A 3RLFA 3FRPB 1WWTA 1SFOB 4HCEA 2WXKA 3MHBA 5I6YA 2BBCA 5LHY1 4AQ7A 4FP5D 3AE1B 4M1UB 2QDBA 1OXTA 2F0VA 2X69A 1SSNA 2GB1A 4MM3B 2JA8B 1Y1VB 1J8IA 3NZ3A 1GAQB 2MJDA 3KWLA 2BTEA 3NUCA 5C5MA 1I4RA 1ZXTA 4HAEA 1F0ZA 1VRAB 3A55A 1I4XA 2HDEA 4KTAA 4ZQ3A 3EJIA 3D8GA 4KJOA 4A3JB 1TS2A 1G2TA 2L52A 2CW0C 1B2TA 1OFFA 2B2TC 1RTOA 3AE9B 5G5GA 1BCPD 1DOLA 1SF0A 3GB1A 4H7BA 5C3JB 1ZXIA 2PVGC 1IKMA 4OO1G 1NYQA 1TKEA 5FK9C 2PIAA 3MWYW 1U4LA 3ABVB 3KBXA 4QIWB 2JA5B 1Q12A 2K1BA 1F2LA 4US9A 3RPFC 2ACZB 3C8YA 1Y8NB 3DEOA 1ESFA 4TSSA 3GD7A 4K5WA 3TP5A 2B76B 4C3HG 1BCPB 3I4LA 4NAWB 2GRIA 3NWTA 3S16B 4PMBA 3SK5A 4RKLA 4RF0A 2K6AA 4RH6A 4IN3A 2IGDA 5CYUA 3MAQA 3QO2A 1JW9D 2EYHA 2JEBI 3T4AC 2GA4B 2NN6H 1K83B 2F0IA 1BDOA 3E0JA 1E2ZA 1LTBD 1RTNA 4ODGA 4YTNB 1NENB 2F3VA 1CTMA 1QE6A 1AZPA 1KNAA 1EU3A 3IAYA 1EYDA 3DUZA 4UAIA 3PUVA 3TEWA 2X6GA 1KRHA 4S3SA 2WS3B 2KJXA 3MXUA 3TEYA 3OMGA 4L23A 3AMUA 1NR2A 4M8AA 1I4PA 1Z47A 2VNUD 2Y0SB 1FNUA 3BIID 3FILB 2LJIA 1BR9A 1YQ3B 2OF1A 3VR6A 1B9MA 1H9RA 3OWFA 1U4MA 1VZ7A 2I46A 3IL8A 3G6JB 4B9XA 2DYOA 1LT6D 3I90A 5TSSA 1LTID 2BE5D 1U4RA 1PGXA 1JORA 4NW2A 1B44D 4KY7A 3HVZA 2WXNA 2J4XA 2ENBA 2IGGA 1IHZA 4IURA 5C4JB 1RM6C 1GHKA 1FGBD 1SYFA 1C48A 2SNMA 2EY1A 5J1ZA 3FMCA 2IX0A 4R9WA 5CV6A 4RA8A 2IPKD 5E1FA 4RAUC 2A69D 5JXVA 2K5QA 1DOMA 2PW5A 5EKLA 3GTOB 2Z4IA 2HCIA 1VF7A 3TMEA 5BMHA 2DYMA 2IT1A 3ND8A 4JE3B 5DAUA 3A8IE 3DEPA 4LMQD 3V2TA 1AP0A 5C2TB 5C4HA 3NXWA 3H3VC 2KN4A 1STHA 3K6OA 2I07B 5IGDA 1KF6B 2K32A 1EU4A 3ONAB 2AQ1B 4RHRA 5EPKA 2JP1A 2L83A 1R7SA 1K8MA 1K53A 3K58A 2INNE 3A8JE 1RHPA 3MXPA 4J8QA 3AM9A 3GQBA 1DZ1A 1QG7A 3Q8BA 2WP9B 4TKOB 2NZ1D 1GOZA 1EM7A 4HKQA 1LT5D 5EPJA 2KECA 4MN3A 3NWSA 3W9CB 5IT9E 3LB8C 4LK1C 2F0KA 4XWTA 1SAPA 1FFUA 1FRDA 2INPE 4X3TA 3JAML 1SEBD 2F1MA 4ARCA 3FVQA 1XX8A 1MHXA 3NRZA 2PTLA 2W82A 2IJ0A 2D5GA 4P16A 1YJIA 1QF6A 1NAPA 1L4ZB 3M4YA 4RGOS 1PFBA 1VLBA 3LXFA 1QT9A 1UEAB 3AE3B 4TQUS 3N6RA 1CA6A 2A5HA 4HMJA 1QNUA 2OXPA 1MSGA 3IAM1 4ZOHC 1MBYA 1EQTA 4A8XC 3L9AX 5FOBB 4ZRPA 1T3QA 4BBRB 4IZ8A 4IKGA 1D4BA 1C76A 2MPMA 4USAA 2EJGC 1WD0A 4C3JB 5JEAH 5C0XI 4KKSA 4KY6A 4A3GB 2KVMA 3HOUB 4A3IB 1PTOC 3BDCA 3EGRA 2EDGA 2WV6D 2B2YA 1C77A 2B2VC 1BUIC 5LNK1 2YEPF 4KI0A 1V1PA 2IX3A 1VZ6A 1KNEA 3NK9A 3SE0A 2PVOD