4TSSA

Toxic shock syndrome toxin-1: tetragonal p4(1)2(1)2 crystal form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
total genus 42
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4tssA01
1BXTA 3V05A 1TY0A 1D5XC 1SE3A 1SJHD 1EFID 1GOZA 3GP7A 1PZJD 1EU4A 1S5BD 1D6EC 3BVZA 4K6LA 4RH6A 1PRTD 3SEBA 4RGMA 1PTOH 1PTOB 1BCPC 1LT5D 2XN9C 1BCPF 1TS2A 4RGNA 1JCKB 1QILA 1EEFD 1STEA 1JR0D 1D5MC 3DWAA 3EA6A 5I4DA 3OWEB 5ELEA 1CHPD 1XXGA 1PRTF 2IPKD 1PZID 1I4HA 2NTSA 1YN5A 3R2IA 1I4GA 1LTSD 4RHRA 1UNSA 1DJRD 2NTTA 1DYQA 1SBBB 1KLGD 1CK1A 1ET9A 5D3IB 5TSSA 2XNAC 1SE2A 4RHSA 1UUPA 3BYYB 5ELDA 4UDUC 1LT4D 1S5ED 3BVMA 1FNUA 1TS3A 3MC0B 1LTBD 1M4VA 1YN4A 1B1ZA 2RDHA 1RF2D 1HQRD 1T5XD 1AN8A 1F77A 1MD2D 1PRTC 3BYTB 4L63B 1KLUD 1TS5A 1S5CD 4RCOA 1HA5A 1KTKA 1PYWD 3O13A 1CQVA 2R61A 2RDGA 3BVGA 1S5DD 2AQ1B 1LTRD 1SJED 4TSSA 1PTOD 1FD7D 1V1OA 1I4PA 1L0XB 1V1PA 1PZKD 3URYA 2O2LD 2XRSD 1JWSD 1SE4A 1L0YB 1JQYD 1RDPD 4RGOS 1D5ZC 1XTCD 1TS4A 4RGTA 4Z9CB 1LLRD 4ZYSA 2G9HD 2WV6D 1PTOF 3CHBD 5D3DA 1BCPB 2QILA 2Z8LA 1SXTA 1LO5D 4O1NA 1HXYD 1JWMD 1I4XA 4RFBA 5FK9C 1TY2A 2SEBD 2TSSA 1RD9D 1LTID 4L6TB 3BZDB 5ELBA 2CHBD 2J4XA 3MFGA 1FGBD 1LT3D 4DXGA 3R8BA 2IJ0A 1BCPD 3EFXD 2AQ3B 4DXFA 4NZLB 1LTGD 3KLSX 1LTAD 1FNVA 1ENFA 1S5FD 5ELCA 1CT1D 5ELFA 1V1PB 5FKAC 1YN3A 1RCVD 3DWQA 1AW7A 1PTOC 1I4RA 1B44D 1LT6D 2AQ2B 1ESFA 3W2DA 2ICIA 1LTTD 1G8ZD 1HTLD 2XRQD 1FNWA 3TSSA 1EEID 1SEBD 1PRTB 1EWCA 4BWGB 1EU3A 3DWPA 1ET6A 3R2TA 1I4QA 4OHJA 4C56C 1CHQD 1JWUD 2QEJC
chains in the Genus database with same CATH superfamily
3PO3G 2RF4A 1SGHA 5EDSA 4ZLTF 5J1ZA 4RMAA 3FAHA 3QOLA 2FE8A 4OX9L 4K14A 5CX3A 1WM3A 3S17B 4M8NA 4ICUA 4L5SA 2KVMA 1QZHA 4I7ZC 3A8KE 3R66C 3I8ZA 5CV6A 4X65Q 4A3MB 4RM8A 4CJ1B 1D2BA 3NP8A 3T51B 2M19A 4JGHB 1CKOA 1PVOA 1SYFA 3PF5A 3VUXA 4NNJB 3K9OB 4DV1L 1F9SA 4B9WA 4ZK9B 1K8MA 1WOCA 1X9NA 3TS2A 1OEYJ 2ONQA 1AEXA 1ASYA 4C3IG 2OHFA 3Q0AA 3NOBA 1Q46A 3C46A 3W1SC 2DWQA 3H09A 4XQJA 2K28A 3HOZB 4B0EA 1QG7A 2MRPA 4EZKA 2BDNA 1ROEA 3GTJH 2N3SA 2O4XA 2LGYA 2B2WA 3K5NA 4IG7B 2R2OA 4CGYB 2ZVOA 2MPMA 3GTMH 1TKWB 2ZXOA 2CJNA 2M17A 3MHSD 3IT4B 3H3VI 2WFWA 3F2UA 5IP9H 4N59A 2JUOA 1L0WA 4X64Q 3LYYA 1ZDVA 2RDGA 4UPAA 2MNAA 4IURA 4K5WA 5F2DA 4LF8L 4C4VB 1NMFA 3WOFA 4DR4Q 3RNGC 3S1QH 2KN5A 3CXCA 4IUQA 2KCMA 2K5WA 2FUHB 3URYA 3TP7A 1JWSD 4P71A 2WP8J 3RN9C 3TCAA 4IWPA 2BWES 1S40A 1XTCD 3NZUA 1HZCA 1CA5A 2WV6D 1CSPA 1IUEA 1ZE3D 4KHZA 4DU9A 2M56B 4MEMA 2PZWA 3HKZB 3ND8A 3AU4A 4DR5L 2SNMA 3F2CA 1EIGA 3RT3B 4KGSA 1HXYD 1PYSB 4NAWA 1EQTA 2WKDA 4A3GB 3L16A 5AZHA 4QIWB 1C4AA 4DR2Q 3OAWA 1MHWC 3VUYA 4BXXG 3WANA 1YZ6A 3HOXG 3CCUA 4C1NI 1MGSA 2K6QA 3NWSA 4ZQ3A 4W9JA 4RA8A 2J42A 1I3QB 1LABA 2KLCA 2RGFA 1IP9A 4YWLA 2YEPB 3S16B 1WJNA 1BCPD 5T1GA 2BS4B 2HCCA 2LUMA 1LTGD 5M3MG 4XWWA 1YJJA 2I07B 2B63H 2K5VA 2KCTA 2XWJB 1WE6A 1WRDB 3JC66 2HDLA 1H9RA 1B44D 2F0PA 1N33Q 3S2DB 1XMQQ 4HN7A 1OQYA 3OLMD 4HMIA 1ESFA 4O0AA 1WM2A 4I6PA 4LNNA 2RCFA 5M5XB 1WZ0A 4F7ZA 3NENA 1NAPA 3VFKA 4ULLA 3OMGA 5C4XG 3PRMB 4BY1H 3Q6BA 3HHMA 3NELA 2J0TD 1ZYRD 2A19A 2QKIC 3R2TA 3PGZA 4DUYL 1EF5A 2G4SA 2N9XA 4AJWA 2N0SB 3BDOA 4QQBX 1WFQA 1TY0A 5M3FB 1UAPA 4LFAQ 4QGUA 4L5RC 3A56A 1TWFH 5JOBA 5ELOA 4S17A 4LFCL 3IHPC 1EY6A 5IGEA 2ZJPA 2I0QA 1DGJA 3NVVA 2MO0A 2K8BA 3RZFA 1LT5D 2BH8A 3KUCB 4P2CB 2KXJA 1JB7A 5JHAA 1QILA 3DWAA 1V5OA 2KDIA 4OXPA 2CU1A 1N8RC 3CCVA 1CHPD 1GHJA 3M4OB 1V9JA 1B9NA 4DR1Q 3HP3A 1CA6A 1JMLA 1UNSA 3AB5A 1HTQA 4X62L 2KTFA 3CMMB 1II3A 1TIID 4LNQA 1P1AA 3DDCB 1ML0D 2VQEL 1EWYC 1ET9A 1DXMA 1JALA 1QVGA 1UUPA 1V43A 4KY7A 2VNUD 2NN6I 2EYOA 2M0XA 1TU2B 2KCCA 2HHHQ 2F3VA 2V4DA 2RDBC 1RODA 2NBWB 2D5DA 1XTDA 3T53B 2PW9A 1P3QU 5CBEE 4Q0FA 2D11A 3ZJVA 4JG2A 2QC8A 4F8CB 3PIO3 1WSPA 2PPBC 4IALA 4GLVB 5JEAH 2KO3A 2LUEA 2DZKA 4LUOA 3EBEA 4C3HB 4K7SA 4WWNA 1SYEA 4I65A 1OXVA 3PCOB 2AWNA 1Q81C 3NWTA 3O13A 2EIFA 5CV8A 1HR0W 4YL8A 2RDFA 2N49A 1LTRD 4X3SA 4MDKE 5LNK1 1PTOD 1SMYD 3HFZB 2JWZA 3PUWA 2JXTA 2A68D 1WVLA 1U4MA 1VQKA 3MFYA 4DR3Q 4M02A 4BBRH 3GTJB 4CJ0B 3A7LA 3Q22A 5C0XH 1R7SA 2JA9A 3HVZA 3E9HA 4DR5Q 1EFWA 2A5HA 1E9MA 2D3AA 3PLVA 4WJNA 1GUOA 2LFNA 3NZSA 1LO5D 3S1MH 3GTMB 3A1QA 4A3KG 2DX5B 4JOIC 3B2FA 4RFBA 2CVRA 3VDZA 2WACA 2SNSA 3A1QB 4POFA 3G7LA 4M1UB 2C35B 2KECA 3R7RA 1Q5WB 2L55A 5C3EG 4IM2A 3V60A 2CFMA 4KDLB 4K3BA 1ZP0B 2OXPA 5FLMG 3ND9A 3K9PB 1GJXA 1SYDA 3S1QB 3KLSX 1LTAD 1TWCH 3JVZX 4XQQA 2OTJA 1EO6A 3S2HH 2JPHA 1YD8U 1TGZB 1YN3A 2V1YA 4JI4L 1HEZE 4NXNL 2KTRA 1MSHA 4ZRZA 2BE5C 2KTRB 3GTLB 1S72A 3SXHA 3X3NA 1F2LA 5FJ8H 3D6CA 1WTVA 1LTTD 4HIDA 1IBKQ 4ZUJA 3PS6A 4II3B 3MXNA 4FO2A 4LF6Q 3MC8A 3B2GA 3OJ3A 1UF0A 2VL6A 1IKLA 2VS1A 4LF9Q 4LLGM 4PYZA 4DV6L 1PH9A 3DHHC 1RTOA 4ZRKA 2QF7A 1JWUD 2QSDA 3EIVA 1WFYA 4P1BC 2N1VA 1JJCB 3T4AC 1YNXA 4DGZA 2LS01 1K52A 2UUCQ 2GBKA 3T3OA 2QIEB 2B63B 1G2TA 1PZJD 4DV4L 2BA1A 2KVRA 1PTOH 5CGKA 2CHZA 3EROA 4RNAA 1IHZA 2B2VC 1H9KA 2XWBB 3IFDA 4U68A 5IWAL 4A3JH 4X3TA 4A3BH 4AYBB 2R93B 1E8ZA 1XLQA 1VQCA 3H1UA 4XDCA 5KNCA 3F1ZA 1PH4A 5JZEB 1WTHA 4A93H 1XXGA 4FLHA 1E5WA 2L00B 1Q82C 1K8OA 3HKZE 1I94Q 2NBUA 4HSVA 2BYTA 3NEMA 4CDDC 3J81c 1RLFA 4DK3C 1WF9A 3A8JE 3G71A 1IW7D 3TQYA 2HD5B 2EYMA 3KUZA 5IN7A 1J5EQ 5HG2A 4QIWE 2XNAC 4CDCC 2I38A 3UDGA 4P7IA 3BYYB 3GO5A 3UIPB 4XT3B 1HZAA 4GKJQ 1HPCA 2LI5A 3D6WA 1HNWQ 4BY7G 1X65A 4BBSG 4GB9A 4JWSC 4CKEA 2FIDA 2KMMA 2MSED 3IG3A 2LJ5A 3GD7A 2E2HH 2LGIA 2WXLA 1OXSC 2WB1B 3Q3FA 1MG4A 2JA8H 5L37A 1UGMA 1MD2D 1HQMC 1PRTC 2B2UA 3VR4A 1VQ9A 2KBNA 3PZDA 3MC9A 3RD2A 1N32Q 1KQSA 4LWCA 1PDXA 1N36L 4JI7Q 2UU9Q 4WJWA 2VQFQ 1S5DD 2B2TC 2L0FA 3M4PA 1PLFA 1HFGA 1QKZA 5LLIA 2YU9H 4ITKA 4C1NK 1VS0A 1CUKA 4G50A 2OTLA 3MXUA 2RA4A 3NJTA 4JIOU 1UGJA 2YTVA 1LM0A 2QDBA 3DOWA 2INNE 2WYQA 4KHPL 4E6IA 3VTUA 1QF6A 3E3XA 3AXCA 1BCPB 2QILA 4JI0Q 1QE6A 1DM0B 2F0OA 1SXTA 4XDXA 3I4NH 2RPVA 1WJUA 3BWUD 3P4PB 2R7ZH 3NQTA 1QZGA 3GTQH 5FR3A 4IUVA 2D0PA 4HJ9A 3U52E 4QCLA 3OSOA 1O80A 4DUZQ 4KDIC 4HAEA 1W2BA 3TEHB 4G7HC 2UUBQ 3LB8C 4EQ5A 4B6WA 4DXAB 2EMTA 4DAPA 3GDEA 5C1ZA 2XGTA 2UU7A 2ZCBA 4IJLA 1KH0A 3VR2A 4EX5A 3BS1A 1R9TH 2EVBA 4OVZA 2QEXA 3HOYH 5E6JA 4GU2A 3IBEA 1VQEA 4BA1I 1ISNA 1VF5C 4BBRB 1PUTA 1VD2A 2Z0DB 2DYOA 1TTNA 2LVOA 2PI2A 1SSOA 3GTGH 2ZM6Q 2Q2UA 3PPAA 4C2MH 2ZZPB 1WWTA 4MH8A 2G3QB 1G6PA 4PZ6A 3PO0A 1MIUA 1L6VA 3D3RA 3CMEA 4M8MA 2RVLA 2A1AA 4DV6Q 1VRAB 1WMHA 1T0QC 4FHKA 4KIKA 3L7ZC 1YNTE 1XNQQ 3P4QB 3WAPA 3Q69A 5J17A 2KDBA 2F0LA 1K8RB 1SE3A 1WX9A 4J15A 2J53A 4IUUA 2PMZB 4X66Q 1YMHE 3N3KB 4B08A 4DR6L 3S2HB 2W54A 4XQNA 3WAMA 2KT7A 4JBKA 4C80A 2EXDA 3PV0A 1X3QA 5K5PA 1Q7YC 1EF1A 4UP8A 2QMTA 4D2KA 2JZ3B 3KUDB 3PSIA 4MTNA 4G57A 1EUVB 1PRTF 2A73B 1MVKA 1Y1WB 3SK6A 2DNFA 3N9YC 4RMFA 1FO4A 2D62A 5DPWA 1R4MI 3SDLC 1VQOA 1AE3A 3ZJTA 2EXZA 4JC0A 3A5UA 1DYQA 3KH0A 2C7MB 2EYFA 2PZUA 4M8AA 1V97A 1KRTA 4YHHL 2R2QA 1N5WA 1YOVB 2M1MA 2AUJD 1C8CA 1J9OA 3E9IA 1WR6E 3I63C 2LMCA 2Z4IA 2G1EA 3FPPA 1F52A 1NMGA 2JK8A 1Y8OB 4FXKC 1WGHA 4OO1G 2F52A 4HJAA 4CQNA 1KABA 2R6GA 3AECB 4A3BB 4HEDA 1F2YA 2RCNA 4EUTA 3D4RA 2L83A 4KJOA 1C4PA 1UELA 3I73A 4A93B 1QCBD 1C9OA 2KEDA 2XIWA 1EM7A 4DPGA 2RD0A 1CQVA 4HKZE 3BVGA 1SJED 2JX5A 1FD7D 2BW2A 3Q8FA 1X3EA 3L9AX 2JQRB 1L0YB 2N7EA 4RGOS 1LXDA 1D5ZC 1KRSA 4FJVB 3KLSA 4JPBW 4XWTA 1MI2A 3QHTA 1Q12A 1E8WA 3SK8A 4DNIA 1TKEA 4X3KA 1TWGH 5LMNL 3DWGC 4GOCA 2E2IB 2Q8TA 4XIGS 2Z8LA 1WTOA 1Y8NB 1ZUD2 2I1KA 2WXPA 4EZLA 3V96A 4J6IA 4HR7B 2JA8B 1PFBA 4F8MA 2ZJRA 3AH7A 1K3BC 3HZXA 2D2CC 4AYBE 5D7GA 1DZ1A 1QNUA 3MFGA 3N30A 2HE7A 5CV5A 1T9HA 3NTHA 2YU9B 5GAHC 2LGDA 4NZLB 1VQBA 5HURA 1KLVA 5ELCA 1EQRA 3CCLA 3VYTA 1FCCC 3VRAB 1D7QA 2E5LQ 4MM3A 1WYWB 4XE0A 3LX0A 4OIJA 5FR6A 3KLWA 1PXUA 1QJOA 2QJLA 4IQZA 1PFDA 3APDA 2JN4A 1C3TA 4KLKA 2WGSA 4GLXA 1GPXA 2JEBI 2WINB 3I4NB 2UXCQ 2BA0A 2AX5A 4OZBA 3VTWA 1HZBA 4LW1A 2R7ZB 2E6XA 2JA5B 3T3NA 3IFTA 2K39A 1QUQB 4YY3L 1DOIA 3L3OC 2MWSB 1E0ZA 1VCIA 1O7ZA 3DWPA 2Q2HA 4HJ8A 1H95A 2PVOD 4IW0A 1I4QA 1VQ5A 4K0KL 1GB1A 2KWVB 5IT9c 2IGDA 4LAAA 3JAMc 1NSNS 4TUUA 1JOKA 2XBBC 3J7ZC 1K83H 3PZ8A 4ANVA 1R9TB 1WGKA 5IOCA 4WQMA 3S17H 2IO1B 4LUVA 3HOYB 1K53A 3NVZA 2IY1B 4JWUC 3H0GH 2HD3A 2VZAA 4GN5A 4R9WA 1V8CA 1VMPA 4GKKQ 3GTGB 1TWHH 2EJFC 2OJWA 4A3MH 1NYQA 3AU7A 3PIP3 3ABVB 3JW0X 3O65B 1M1KC 3HOWG 2EQSA 2DZIA 1ILQA 4G7ZC 3L4PA 1WX7A 2RKSA 3CAMA 2Q8RE 4JYAL 2DBYA 4KKIA 3M85A 2E76C 2FBWB 1PFMA 4FYDA 3KBGA 3I70A 5BN5A 3HOVB 1HNZQ 1ZEQX 1GHKA 2JZPA 2KJ6A 4KY5A 3T1HL 4IOAA 2IWHA 1CFMA 2PQAB 3HOZH 2F0IA 3B0AA 1AARA 5CYUA 4XC2A 2DNCA 3NTKA 3CIRB 5C3XA 2ZT9C 1VR9A 5FO7B 1ZKOA 4JI2L 2A6ED 2RBMA 5EBDA 4W9KA 1TQOA 2W3SA 1TS3A 4ACFA 2BKRB 1LTBD 2BKFA 2HTHA 2OEOA 2L7RA 4HCPB 2NCNA 1SE8A 3DVGX 1F77A 2PE6B 5CV9A 2Y0SG 1B3QA 3MEFA 3WA0A 4LUZA 4EGVA 4ODGA 1YEZA 3C3LA 2IHEA 3PRPB 4XGAB 3HRZC 3GV3A 3NXWA 4A3LH 2KJHB 1VLBA 5H8YE 2M00A 2PI2E 5D65A 3I90A 1JB3A 2NZOA 3L0WB 3N1ZC 4R4QA 1I4PA 4QY7A 3MP9A 3I4OA 4LFBL 3CU7A 4DV5Q 3CRKC 1PH5A 2N1WA 4MTKA 4ZYSA 4JI8L 5HY6A 1E3PA 1MJEA 2A6HC 3MAQA 4DV0L 3LGJA 4IN3A 3GTPH 5IYCG 3W1YA 1VF7A 4IDIA 3U9OA 1G2SA 3GOEA 3HM3A 5AZGA 2HUGA 4OELB 5IODA 1YNJD 1WTXA 3DBHI 3H6NA 5D2MB 4OZCA 2EYLA 3V62A 5IYDG 1WE7A 3Q6SA 3NS8A 1RD9D 2RSOA 1WIAA 2FCMA 3AEDB 1LTID 3L0OA 1E8XA 1I3QH 2KOLA 3M3YB 1OTRB 1TT2A 2JT4B 3X3MA 1YQ3B 3ZJYC 2MBBB 3FKYA 4C3JG 1IBLQ 1P7EA 1BBUA 3ITPA 1RM6C 4YWGG 2JYOA 2KQ3A 1FNVA 3M63B 1VQ7A 4HDQA 4DV2L 1ILPA 4CO7A 2L15A 3K5OA 4YCVA 1P9DU 3T1YL 3WALA 3A9KA 3AEAB 1RCVD 3DWQA 3VR3A 1K3RA 4Q5VA 1LT6D 4B3ML 2VY3A 2KWCA 1GUAB 2IL8A 2NBFA 1EOVA 3VQIA 3FKIH 4R4TA 3E9SA 3KF6B 1FNWA 3D4WA 3TSSA 1EEID 1WZ3A 3AULA 4BKTA 1A5RA 4YY3Q 2JA7H 4IPGA 4LNIA 1SNQA 1V6EA 3AFQA 3Q3NC 4ANXA 4NXMQ 4HIOA 1Q86C 4DAYB 1XX8A 2NWGA 3BK2A 2FCSA 2FCQA 3RNAC 2QCZA 2JU6X 2WP9B 2R92B 4YCUA 1V9PA 4A3FB 3QA8A 4LK0M 3TL5A 2LSSA 1BCPC 3C2PA 3H7PA 3E0JA 1B2TA 1TVXA 3AMZA 1F0ZA 3AEFB 5DPTA 3I7FA 3RNBC 5A35A 1OTCA 1PGBA 1PQSA 2V4IB 4JV5Q 3ZRFA 3CP0A 2MQHA 2X38A 4WJOA 3M95A 4A3DB 1IPGA 4OO1I 5COYA 3DHGC 1ENAA 3UDXA 3FILA 1SNOA 1JC7A 2Z0EB 2TMPA 1SNDA 4KV6A 2BYFA 4KZ0A 1YX6B 1GUNA 1SE2A 1CKNA 5ELDA 4AH6A 1N60A 3JSVB 1XMOQ 1ZYRC 4ZAIA 1VQMA 3BVMA 4XXEA 1K83B 2I46A 1C0AA 1TJEA 1CKNB 4FA6A 4GOPA 3ZXRA 3PUYA 4C7YA 2UUAL 3H0GB 1Z47A 3GTOB 4KGRA 1XT9B 1J0GA 5C44G 4A3IB 4IFDG 1NR4A 1SYGA 1TWHB 4FNFA 3CCEA 1WJ4A 3HRDD 3BYTB 3NUHB 4C3HH 1YNND 2RSUA 3U7ZA 1EY5A 2ZPYA 4H0LC 5EPJA 2WXQA 2W82A 1HR0L 4UAIA 1ZKHA 1A3TA 4PZ7A 3QG1A 2IT1A 1F2RI 3PUXA 1NCVA 1QNKA 2UXBQ 1A15A 1MSGA 1YHAA 2A6HD 1BF4A 2VH2A 1GB4A 2WLBA 2Z6KA 4EVOA 4JPSA 4HIKA 4ZCKA 3VDYA 4DKAC 1T0YA 4NPNA 5BR8Q 1KNEA 3CPWA 2MJEA 3ZDTA 1KRHA 3ML9A 4QUCA 1I50H 2MP1A 4DBGA 4P6VF 5FOBB 2INDC 1SF0A 4UP9A 5AJ3Q 4HJGE 4AQ7A 1U4PA 1OXTA 4F87A 1EIHA 4KTAA 3DVNU 2J52A 1NBWA 1JOQA 3ETRA 5AZFA 1UZXB 4GZYC 3TJPA 5HI1A 5FK9C 1VQAA 5FO9B 3TP8A 1JORA 5IP9G 1V86A 1STHA 2MLBA 3K58A 2UXDQ 4PS3A 2ZCCA 4CDFC 3ZO5B 1BKBA 1Y1VG 2LJIA 5KHOA 1I35A 3R8BA 3CRLC 3EVQA 3BDLA 4DN4M 1KIXA 4DXFA 3ALBA 3CWIA 4MELA 5IO9A 1EWIA 4IFDJ 1K0SA 3P20A 2D07B 4NAMA 4IKGA 3NTIA 2MJ3A 4WJ4A 1EUJA 2K22A 1PTOC 1SMYC 2OQ0A 4PZ8A 5AUKA 1QB5D 2F1MA 4UP7A 3GTPB 2A68C 3GTLH 3TMEA 5EKIA 1S1QB 2CQOA 4L1BA 3BJUA 2K8HA 4W9LA 2F0VA 3ZGZA 4ME3A 2KD0A 1PH1A 2KFKA 1VQGA 2XRQD 5C4HA 3K81C 2OF1A 4XT1B 1EWCA 4BWGB 2WXKA 1EY7A 2L4NA 1OXXK 2HTME 4B9XA 4NAWB 4X57B 3SR1A 2HQEA 1MBYA 3NUCA 5BN3A 1MHXA 2Y5PA 2WXHA 4NDXA 1CMXB 2H5XA 1B8AA 2QEJC 4UHVA 5D14A 5CC4A 5JPMC 4LF5L 1QOBA 1Y56A 2W9NA 2NVUI 2B63G 2WAQG 2OEDA 3GV6A 2KVZA 1RIPA 1HHVA 4ZRPA 3NE5B 1SFOB 4OEMB 1J8CA 2I5MX 1L1OA 4EQPA 2R93H 1JROA 3W5VB 3I9V1 4AQYQ 3NS1A 3D31A 4CKCA 4RGNA 1VJKA 4PS8A 2KHWB 3AE5B 4ZRQA 3QAQA 3FKIB 5KYLA 5EE3A 2IPKD 4RCNA 3AMUA 3P2BA 1GKHA 2MBQA 4YT0B 2FJ2A 2LHDA 1N34Q 1CKMA 2LGXA 4BY1G 2JA7B 1Z5SB 3OWFA 1FFUA 4E3CA 5LMUQ 1NE3A 1PH6A 4DK0A 5GQOA 3RZDB 4PT5A 1IYJB 3W1GA 2O5JC 3PHXB 4OX9Q 3A33B 1S5ED 5EKLA 2NR2A 3AE8B 2K1BA 5GROA 4OVVA 1ICFB 1R4QB 1D1KA 3TZUA 1SLJA 1VQFA 1IBML 3W9CB 4B95A 2KDFB 3BK1A 2WB1G 2VZKB 1GUSA 3NK9A 3KBXA 2PW5A 3PTFC 4KV2A 2RR9A 1X1MA 1JOOA 3Q8CA 1SROA 2GRIA 3VVWB 5C3JB 5CV7A 4QF4A 4RCOA 3UE0A 4DV1Q 3F2DA 1J7AA 1YIWA 3PT2B 4GIVA 4A20A 1E7ZA 1E6EB 1IGCA 2NMQA 1PH7A 4CJ2C 5G5GA 2AQ1B 4CYEA 4DDGD 1V1OA 4AJYB 1OQRA 3OW2A 2CR5A 2IZVB 1P8LA 1TZ1A 3WWVA 2CKZB 4EE2A 1OEYA 5FLXc 2K75A 4JI1L 2VUMG 5EAYA 4GS3A 4EKUA 3TBLD 2JA6B 5KEEA 1IW7C 1A62A 2G9HD 3ZIMA 1VDZA 2EPBA 5KYIA 2GVBA 5G3LF 1PTOF 3PIOA 3PUZA 1TXYA 1UWMA 2F0HA 2BPSA 3G4SA 1KNAA 5M5WB 4G7OC 3RNEC 4AP4C 4ARIA 2D3CA 2SAKA 4G4KA 4AIMA 1N6ZA 1JWMD 2ES2A 2F0FA 2WXGA 3IT6B 2C7NB 5BYRA 4WIPA 4C7ZA 4H02A 1PGAA 5HHDG 2F3WA 3AE4B 4LF8Q 1BMLC 2ZEQA 4WAFA 3ZLZA 4JW0A 4X6AH 4TMAB 1R4PB 3PO3B 2D3BA 4CBVA 2PEAA 2RHQB 2MEKA 1Y8PB 2ZVNA 1JE4A 3U30A 3ZUNA 3EFUA 1KDAA 3PQIA 2V4LA 1KOTA 3RUZA 2AEHA 4BBRG 1LM8B 1K0RA 5CMDA 1UE6A 3NHEB 2MGSA 1VMCA 5C0XG 2W55A 1I50B 3VYUA 5IAAC 2BTEA 3WIMA 1Z2MA 1NR2A 1TWAB 1UWVA 4MM3B 4W9CA 3A74A 4MN3A 4LK1C 5IE8A 1MKHA 4IUNA 4R8NA 5L95C 2KX3A 2E75C 4R4CA 4IWOA 2ZNVB 2SDFA 3DM1A 3QC8B 4C3IB 4OHJA 1EY0A 2OWOA 4KKTA 1V49A 5J39A 1RHPA 5E6OA 2KMAA 5AUIA 1EL0A 4DHZB 4CHKA 3FEWX 5CR3A 1XLOA 3TDQA 1SJHD 4JI3L 4GNXC 1JMCA 1X6OA 3QB3A 2FUG1 4S3SA 2K03A 3PREA 2Q2TA 1VQJA 2YTYA 1DD2A 2BCOA 2JQOA 1QOGA 1CTMA 3TZDA 1B4OA 4QMGA 1K73C 1ZXHA 5LXHA 4HKQA 5FJ8G 4BZAA 1JR0D 2JZZA 3L54A 3U4VA 4W9FA 5NUCA 1HJPA 1Y1WH 1ZDXA 2ZPNA 1PZID 4HPLB 4BKSA 1S3SG 5LHY1 1UE7A 1EQVA 3RZOB 2I5LX 1IBXA 1PFSA 5C3EH 2KC1A 2K04A 2B29A 2KENA 3MXNB 1VDVA 4DUYQ 5C0XJ 3AEEB 5FLMH 3KDFA 4IFDI 3AM9A 3LXFA 5IP7H 2R3ZA 4LCDE 1WCMG 3T13A 2PQEA 1EOTA 3Q23A 2F0EA 1XPOA 1TKYA 2GMIC 4MGKE 3EN2A 1QVFA 4LFCQ 4ASWC 3J7A5 2MHJA 3HVDA 3MTNB 1PV4A 1IL8A 1KM7A 1QWYA 4A3JG 1WXSA 2EZVA 2MH7A 5C5LA 2R7DA 3AYHB 3J81i 4H44C 2F4VL 1PYBA 1TZOA 1K8AC 3FDTA 4J1MA 2LWPA 3F2BA 3ULPA 4IO9A 4A93G 3APCA 2XK5A 4IPDA 3VR8B 3UIOB 3JAML 1TS5A 3N1XC 4W9IA 4B3RL 3EUB2 5EE1A 2KJRA 5JVG3 3HOXB 4DWFA 4KI0A 3N32A 4X62Q 2V1CC 2DENB 2KLGA 4TSSA 3S2AA 1GC7A 5IGFA 2VQEQ 2B2YA 3AFPA 5M3MB 2LEKA 2GA4B 3APFA 1DOKA 3P7JA 2Y5CA 4HCEA 4Z9CB 3PUVA 3TMPB 4PMWA 2NVXH 3DHQA 2I5HA 2E2IH 2ATWA 3J81E 1IGDA 2PNHA 4MT5A 2IX3A 2NS5A 3RLOA 3PLUA 2DNEA 2JA8G 4V190 4A3EH 5C4XB 1FFVA 3LJ3A 3HS0C 2ID0A 2NB0A 2IY5B 2L76A 5JJIA 2J4XA 1GUWA 4NP5A 2PKOA 4OL7A 3T16A 2IJ0A 3EFXD 2A4ZA 2AQ3B 4LJOB 4S0RA 1SR3A 1LGRA 3U2SC 4MGZE 5HKHA 5IA7A 3H3VC 2J7QB 3EHVA 1NEKB 1FJGL 1GO3E 2PPHA 4QJFA 2BB6A 1VQDA 1AW7A 1M94A 3H8HA 5J2RA 2F0GA 3C1FA 1I4RA 1WI0A 2ICEC 2LKVA 3QIAA 1X32A 4NJCA 1IYVA 3X23A 1PDQA 5M5YH 2JA5H 4LDTD 3OTOL 3MZ5A 1IYUA 2CW0D 3S24A 3UI3A 3V61A 3DBLI 1OXUA 4E71A 4WFN3 1W3SA 1WGYA 2GN5A 3K7AB 2I1JA 2RHSB 2WHIA 4GDLA 2B8FA 1GOZA 1XF5L 4YTNB 3ZNID 2FXQA 1S5BD 3HEJA 3TIXA 2O6VA 4JI4Q 4NXNQ 3BIID 3KYDD 1R4MB 5IKCM 2B2WC 4A90A 4K7WA 1STEA 3MHZA 4W9GA 1AYFA 2VRRB 1VZ6A 2BH2A 1YN5A 1RFAA 2H88B 1LTSD 1FXAA 1R4NI 3ZQ4A 3CC2A 2PNRC 4LF7L 3DM3A 3HOVH 1XCTL 1ZXIA 1SBBB 2F0MA 2L12A 2OCEA 2GBJA 3NZ3A 1T5EA 1CJEA 2MCNB 4RHSA 4DV7L 1WMHB 4KIKB 3HOUG 1C1YB 1GUGA 3OHXC 1NDDA 3PSEB 1LT4D 3RLNA 3SVMA 4NB3A 2BQQA 3LDZE 3RYTA 4DV4Q 3DBSA 3ONSA 5CTRC 3MC0B 1AWDA 3V3XA 1LTLA 2X69A 1F9PA 1FVIA 5LL6S 5IWAQ 4JI6L 4R4IA 4MJSA 4NQLB 1CZWA 2J0MA 4NMZA 1QVCA 5G55A 1XJVA 2BBCA 2FCNA 2JVCA 4HTHA 1BVSA 1LUZA 4E74A 1XNRL 1PYWD 3K6OA 2DAFA 3GZNI 5C3EB 3W1SA 3A4RA 1YITA 1BO0A 1E24A 4RKBA 3H15A 1WGDA 4KN7C 1T0SC 5JVH3 3ZJUA 1TIFA 1XD3B 1RDPD 1AH9A 1G91A 2IO0B 4B3TL 1V2YA 3U58A 1K28A 2AKWB 4QL5A 4CKBA 2CU3A 2CH4A 3LWUA 4A4IA 3EFCA 1HZ6A 1B3AA 2BVCA 1A3UA 4DHZE 2LMCB 1U0LA 2VXWA 3A54A 1WXVA 2BGFA 5D3DA 2K9XA 5J3BA 2CWAA 2KAJA 3OG5A 2A6EC 4FF1A 5L83A 2C7HA 5H92C 2F0DA 3R7QA 1L4ZB 2TSSA 4EZJA 4P73A 4EQNA 1SDFA 1VQPA 5C0XI 2I2YA 2N9KA 4WWOA 2BYVE 4AOFA 4L6TB 1N36Q 2WX0A 1XEEA 3DVGY 3OW7A 3M3YH 3NRZA 3PZ7A 3TN2A 1KC8C 1PFNA 1UWXA 1SNPA 1WX8A 1WY8A 2Y5BB 3KF8A 5I2YA 2KQ4X 4IC7B 3Q8BA 1C7YA 3PGEA 2N78A 4WORA 5ELFA 3KF8B 1HNXL 3D4DA 1X3GA 3M4YA 5FKAC 3J80c 3CMAA 2FINB 2KZRA 5BMGA 2E74C 4YTMB 3AEVA 2EOTA 4FJZA 4KHPQ 3HIZA 4DR7L 1P7FA 1WR1A 2MHVA 5H1SE 2NVXB 3W5UB 2IGGA 3I4MG 3CF5A 4LNOA 5A2QL 3A9JA 3MJWA 1G8ZD 3AI5A 4ZYNA 4TKNA 2BWFA 2L1BA 2L5TA 3IAYA 2DY7A 4A3EB 2D5GA 2G4DB 5AEKB 4MHEA 2INCC 2KHSA 3NG0A 3AE7B 3OJ4B 1YNJC 3FVQA 3L2PA 3RN2A 3HUIA 4K5VA 1K9MC 2KACA 2F0SA 2KWUB 1Z7TA 1D5XC 2KCNA 1FCLA 2R92H 4A3FH 1D6EC 1YJ1A 1HFNA 4BY7B 5BO4B 4BBSB 2D10A 4WWPA 4JBMA 2KANA 2KK8A 4Y7NH 2WAQE 4B3SL 2WU5B 3EQLC 3J7YW 3CCQA 3A0JA 3CCRA 2C5LC 3I3TB 1D5MC 4MIUA 3STBC 2HDEA 1RRBA 2HDMA 2WXRA 3JAMi 4OWWB 2BYEA 2PVGC 4OW0A 2LHEA 5GMVA 3DMUA 5M5YB 5IOIA 1PMRA 5EKKA 2AWOA 2K5NA 2PYKA 4A3DH 5DPSA 3SK5A 2K1FA 4IUTA 1N62A 3SR6A 4OZAA 2YEPF 4IWQA 5I2XA 1B9RA 2EMSA 4XDDA 1UH6A 2JWUA 2QA4A 5E4WC 2D0OA 4RG1A 2ACZB 1IKMA 3VR6A 5DM63 2QCPX 3H3VH 3KWLA 3R3MA 3X0WA 4DR6Q 4ALPA 4BOSC 2GLSA 3UINB 2HIXA 3H0GG 3NPPA 2KDMA 2KKCA 4ZKCB 4US8A 1YN4A 3IKJA 3PIPA 2L52A 2PW7A 4YCWA 3GTOH 2WXIA 3B08A 4A3IH 1SIJA 4A3MG 5IT9E 3JAME 3C19A 4JI5L 1N5XA 1KJTA 1A8VA 4DV3L 1LACA 4A3CG 3QIJA 4R3DA 4KX6B 1G291 3H7SA 4J8QA 4N9F4 3V6EB 2F4IA 5HFYA 3M3JA 1JWAD 2N7JA 1V1PA 2CH4W 2H4OA 3TS0A 4YHHQ 3HOZG 2O2LD 1DONA 2MJDA 3RMHA 3DBHB 1MG8A 2AHOB 3CHBD 2V9HA 3LWEA 1WYDA 4ZUIA 1KD1C 1ZGUB 4YSZB 2V3NA 2J7ZA 3G6JB 1UE1A 3A55A 1L2FA 1TR5A 4P1CC 4ZHPA 4IUMB 4NJ7A 1ESRA 1KAAA 3CKIB 4URKA 3KQ4A 2HJ1A 4LF4L 4A3LG 1U5KA 2KJXA 5BYSA 2EJGC 1CQFA 3K57A 2INPE 1YNNC 2DN8A 4PV1C 4WQOB 2LD9A 3U4EG 2MQJA 3OIPA 3ZKJC 2BT6A 4CHTB 2WWZA 4LDTB 4ARCA 1M8AA 1ENFA 5DLQE 4RAUC 3SHLA 2JSOA 4N9PA 1FXIA 1HNXQ 1CT1D 4N9TA 2CWPA 1RYJA 3L10B 3RZWC 3QJYA 2OT2A 5IYBH 5LMNQ 3HKZG 2AQ2B 3Q8AA 4X65L 4JOIA 3PO2H 2SOBA 5I9OA 5IGBA 2JEAI 5DNFA 4X3UA 2LZ6A 1A2TA 4A3GG 3R3OA 1I7HA 4H2AA 3P42A 1FL0A 5ISRA 1GC6A 2WDVB 4WURA 3T8MA 1U4RA 3LNNA 4WJ3M 4KD3A 5MPOA 4ZOHC 3NSWA 3J81j 5JHBA 5CBAE 4DF7A 5TR5A 2NVTB 4GLAC 1SAPA 3L13A 1KAWA 4NPSA 1EFID 2B2YC 3ENEA 2KFJA 3J7AF 3I57A 4M01A 1SFOH 3BVZA 3STBD 1UD7A 5IYCH 1YJIA 2IX1A 1KL9A 4FULA 4YSXB 3VYSA 1NUCA 2MJ8A 2L05A 5C2TB 5KHQA 3A9KB 2UWQA 1ICWA 3AB9A 4GXBA 4HPMB 5I4DA 1Q90A 3L08A 3QK0A 1C4QA 2MA9B 4BOZB 2FAZA 3P4RB 2K8CA 2NN6H 2NZ1D 2JA7G 4KSKC 1F9RA 1SYCA 2B2UC 4X64L 1SE9A 2GB1A 1I4GA 4TQ1A 4YSYB 4FXDA 3NQIA 4MGIE 2NBVB 4DR4L 4C3JH 3RZDH 4K0KQ 1RTNA 1LQBA 5JXVA 2ZTCA 5C6AA 5M3FG 1STYA 1BR9A 4HIMA 4TVAB 4A3OA 4R4OA 2KA7A 3A5ZB 5BMIA 4L5QA 2KQSA 2B2VA 3KK7A 3MHBA 3BG3A 1O7YA 1VQIA 1RFKA 5K36G 2JXXA 3SGIA 3NBHA 2LY7A 1ZXTA 3E6ZX 4Y7NB 3TP5A 1KDBA 2IBIB 3H7PB 2ZTEA 3ICEA 3CCMA 1AN8A 1STAA 2B8GA 2AUKA 2K6AA 4DR2L 2RMMA 2F0JA 1OQQA 3UQBA 1H9MA 3H9DA 1ZW7A 2HIVA 4JYAQ 4FXGC 5JAVA 5JJZA 1DOXA 1NENB 2N9EB 2F0QA 1MJDA 2WQYB 3Q3OC 5EE9A 2LGSA 4C00A 3Q2AC 3T1HQ 1B53A 3EC8A 1L0XB 1DCZA 3FILB 2KEEA 3TEYA 1SE4A 2L3ZA 3Q8EA 2Z1CA 1EWHA 1EY8A 3ZTCA 5BMHA 1TS4A 4OONA 2JA6H 1Z6HA 1UBQA 4JI2Q 1N33L 1XMQL 1BOSA 1KXLA 2G5DA 5M5WH 2N7DA 2ZW1A 3TUOA 1Q8KA 1C48A 3RR5A 1E7VA 1WGGA 4GOPB 1W6KA 4HJ5A 2PJHA 4BKSD 2WU2B 3RNFC 1EY9A 4XYOA 5AFWA 1I4XA 3VUWA 4C3HG 4N8X1 5JJKA 4PNYA 2L8JA 2J0KA 2B2TA 2BS3B 1SN8A 1X54A 2Z59B 2EY5A 3H6MA 1CI3M 2V3SA 1GD7A 2Q2IA 3BZKA 2M4NA 3PO3H 4US9A 4IJHA 2KHJA 2L11A 1SRUA 4LFAL 4BBNC 3RUIB 4LFBQ 2C5CA 4QUFA 2NYZD 5HGQA 5E6PA 4JI8Q 1Q8IA 5KGUA 1MHHE 2DZMA 4HROA 3CQZH 4DNRB 4DV0Q 1AP0A 1WXAA 3TEZA 5A2QE 5C23A 5C44H 4TQUS 1YVCA 5IGGA 4HCSA 1TWAH 4IFDH 1WH3A 2EYPA 2JRIB 3WCQA 3TEWA 2RSNA 3Q8DA 3VA5A 3IFWB 1EYDA 2Z4HA 3C0RB 1VQNA 1YBYA 3J81L 3HOWB 4DR1L 1HZ5A 2GBNA 2WXOA 4BFRA 1JJGA 3DBRI 1Q1BA 4NW2A 3PV1A 5CHVC 2K6DB 3V2TA 2QHOA 1ET6A 1XWEA 4K8IA 3CCJA 3CC7A 4C3IH 2LASA 3AV8A 1CHQD 5LL6X 2A69D 1OO9B 1CSQA 3D8GA 1TYGB 3VH3B 3FMCA 2CHWA 2ON8A 2DJGC 4W9HA 2HHHL 1QT9A 4DV2Q 5T1IA 2OJRA 3T1YQ 4NKLA 4F7XA 2D2QA 2JXMB 2XN9C 4FF3A 1VZ7A 1BCPF 4B3MQ 3EA6A 2WIIB 3PO2B 2WS3B 2Y0SB 3S14B 4IUPA 4DAVA 2CHXA 4C4VA 5C5MA 4BA2I 3RZOH 1PGXA 2KFKB 1MFWA 1Y1VH 4KKUA 1XYIA 5C4JH 1L7YA 4K81A 3SHQA 2JY6A 2ZW0A 1H9JA 1KLGD 3VTVA 5D3IB 1XO3A 3AE3B 2F0TA 3IAS1 3VRBB 3H91A 4M00A 4DR3L 1VQ4A 4PYUA 4KVGB 1JQ4A 3EGRA 4N6EB 1J8IA 2R93G 4AYBG 4M0WB 4LNFA 4P16A 2R7FA 2RQXA 3M7NA 3S15B 2IGHA 4K1RB 1L1OB 1BT0A 3RMKC 3RNUA 2K5HA 4OVUA 1GXDC 4POGA 2D9UA 4KKSA 4BXXH 3AE6B 5KIXA 3NVWA 3HOXH 1AZQA 4A75A 2AL3A 4GLSC 3RFZB 1PA6A 3HGBA 2BS2B 4F1SA 1G6JA 1PHJA 4K2KA 1JJ2A 3ZYYX 3OIQA 4II2B 4C3JB 1C4CA 5M3MH 2O6VD 3U9SA 2GVAA 4BBNF 2WDTB 2N9LA 3GE8C 3MA2B 4U673 2G9DA 2NPTB 3DLLA 4P72A 2E3TA 3C1EA 5EJWA 1MJCA 4PMCA 3VHTC 4G0NB 5CHFA 1H9SA 3K59A 2UUAQ 1A2UA 1IBKL 1Q10A 4A76A 4DHJB 1D3ZA 4G3XB 3CCSA 1H9SB 4XZ4A 1TT5B 3NBIA 4LF6L 2PO4A 5C4XH 1XLNA 1TY2A 3DVNV 3CSTA 1HR0Q 4LF9L 3VYRA 1I6HH 3QCAA 1HA6A 1NVID 4BKGA 1PH3A 3TRZA 4DXGA 4YWMA 1KF6B 5DCNA 4ZHOA 2ZXPA 4K3CA 1GAQB 1LV9A 3IL8A 2UUCL 3M62B 3BZCA 4REZA 3Q3JA 3AN1A 1STGA 1UEAB 5E7NA 2WKCA 5DAUA 4K2LA 2EKIA 1FR3A 3S1RH 5GAEC 4MH0E 2NVQB 5EPLA 3QR8A 2PMVA 4TQ0A 1E0BA 5KRUA 3U50C 5JEAG 1WD1A 1S3OA 5FLXE 3D32A 1BUIC 1ZOYB 1EU3A 3K80C 3N52A 2H1EA 1I94L 1EYGA 4KK7A 1F2MA 3AEBB 3RCZA 1DOYA 4KD4A 1PH8A 1J5EL 2E8GA 3K7AH 4A3PA 2VUMH 3KWVA 2V0GA 1YX5B 3ONAB 1X56A 4GKJL 2FFKB 1CZPA 4FVMA 1IXRA 4IPCA 1YIJA 4HWIB 4DK6C 1HNWL 4GMVA 4DK1A 3DEPA 4K6LA 1ZPSA 4RGMA 4KN4C 4TRDA 1E1OA 3CQZB 4HRSA 1JT8A 2ALYB 3IXSA 1Z9FA 3E56A 5C44B 1A63A 2WXJA 1XPRA 3DEOA 3I4LA 2OOBB 2RPQA 4ZRIA 1N32L 1U9RA 1NI3A 1I4HA 1TBEA 2KNBA 4WWMA 1RKNA 2VZKD 2ZJQA 4RHRA 4JI7L 3CW2C 2UU9L 3ZXVA 2VQFL 1EZ8A 4HSPA 3J80L 4PK1A 2IY0B 5G3LD 2YVCA 2CQAA 2OQKA 1FD6A 1PH2A 4LF5Q 2CW0C 2PZTA 2YYZA 3BDCA 4APVA 5JEAJ 1C79A 5I6WA 1I6VC 1GM5A 2JF5A 2KC2A 3FHWA 3M7GA 5IGCA 3HK0A 3FP9A 4JI0L 1A6XA 2MUYA 2BOSA 4ILWA 1E90A 1I42A 4A3KH 2DHZA 3KJPA 1WI5A 2N8NA 1Y1WG 1KLUD 4WAAA 5G2NA 1IYFA 2LRUA 4DUZL 3RI7C 4RWSC 2L0TA 1D1IA 1GVPA 3MEHA 4MGYE 2UUBL 1Y1VB 4P74A 2WXNA 5C4JB 2DY8A 1IBXB 2JJQA 4K8JA 5IP7G 5D6JB 1SNMA 3UI2A 4BAXA 2K0PA 3KDFB 1JQYD 2LRWA 1D4BA 1TKGA 1XQQA 2YLMA 5T8IA 3SFDB 4GN3B 3W3AA 3NHHA 2DYBA 1IBMQ 2ZM6L 4KHVA 4BVUC 4AUQC 1U4LA 1YHBA 4A3BG 2KQ7A 1GUTA 4IM3A 2VB3X 2PLPA 2K52A 2L1AA 3IVFA 2SEBD 1AE2A 5IT9L 2Q8IB 1CZGA 3HM6X 5CHWA 1Q0WB 1STBA 2DJFC 2KHIA 2KN4A 3U8ZA 2XK5B 3L17A 1HTOA 4ABNA 2BF8B 3VH4B 1XNQL 1FGBD 1LT3D 3MXGA 1HRJA 2LXAA 2Y0SE 2UYZB 4FADA 1X3PA 1WCMH 1SIFA 2QDFA 3GQBA 2J0JA 4IOCA 4PS7A 4X66L 2ZTDA 2WAQB 1X3FA 4JI1Q 2LXCA 2NPTA 1V81A 2H89B 3CSFA 5G5HA 1A70A 4HMJA 1F2RC 1B7YB 1NJIC 1YI2A 2ZXRA 1HH2P 1B70B 3DUZA 3DBLB 4G11A 1UEBA 3UE1A 1FRRA 2REXA 3J9CA 3KYCD 3U7DA 4YXDB 1LYLA 1X55A 3QOJA 4IZ8A 4A3EG 1EZ6A 2E2JH 3AQQA 2Z0SA 4BY1B 3G48A 3SU8X 2YTXA 1I6HB 2M9VA 1BNZA 2A8VA 4HPPA 2MBOA 1FPYA 1E2ZA 3N6RA 1WYGA 4FF2A 5EQ0A 4KY6A 4B9KA 5LXIB 1VCBA 1K8GA 1VQLA 1OFFA 3AE2B 4WJQA 1TWFB 1ASZA 3AE9B 2K25A 3ZNHB 4RH6A 4BY7H 3WAOA 4BBSH 2WXFA 2JP1A 4KSLC 2Z6BA 1R4NB 4GOPC 2BB5A 2KDEB 2V3PA 3A8IE 3S1RB 3ULJA 1TS2A 2XVSA 2K4KA 5IP4D 1O78A 1JCKB 3UQAA 2F3IA 2B76B 2HCIA 3I4NG 4DA2A 1O7IA 2K01A 2WDQB 4MSQB 2R7ZG 2K50A 2JA5G 1N61A 4FF4A 4AWJA 4MNOA 5KNBA 1FEHA 3N1YC 1DOLA 5EPKA 3MWYW 3GTKH 1AFPA 4KJNA 2PIAA 2AMCB 2KMCA 1EYAA 3S1NH 2L32A 3F8TA 3TP6A 1F1HA 1RAXA 1FRDA 2KWDA 2YV5A 3WOEA 4JX1C 1DGSA 5ELNA 1K50A 3DPDA 2VUMB 3PVLA 2Z6KC 4QB4A 4JI3Q 1HUMA 2F03A 4R1JA 3HOYG 4GDLB 2AYOB 2O5IC 2NZHA 3E5SA 2HT1A 3GZNB 1B1ZA 2O6VB 4BS9A 1I5FA 3KOJA 2Y3AA 2K32A 2HJ8A 2GI9A 4L23A 4HDOA 4L63B 3QWNA 1E2WA 1M90C 1L4DB 1BDOA 3KW5B 1G51A 1NTGA 3G6EA 2R61A 2WNMA 5M9OA 1H4RA 2P5ZX 4RKLA 4I6LB 1MPEA 4OGQC 3HOVG 5JH5C 1D8LA 4GN4B 2EELA 1WJ6A 3ZTDA 1HCZA 3ZDMC 2EKEC 4DAMA 3ERQA 2F0WA 2BE5D 5IIFA 4FN2A 1NBFC 2IYDB 4HXDA 4DDID 3K8AA 2N4FA 1B9MA 2VW9A 3EJIA 2F0KA 2E5LL 4N58A 2BDOA 2WXMA 4MACA 3IAM1 3SD5A 1YQBA 1RJTA 2QDLA 1FYCA 1JW9D 1QOFA 1GJZA 1E7PB 5D94A 1F2ZA 3IRBA 3T9LA 3TEXA 2MO1A 3ML8A 2UXCL 1L6UA 2F4VQ 3S1MB 3EECA 4MJSB 2B3AA 3DXJC 3FPUB 4WRDA 4ZKBB 4A3KB 1WXMA 1JICA 1EIYB 2X8XX 3UF8A 1Q1OA 4FJYA 4XYQA 1DOMA 4B3RQ 4DK5A 2PE9A 3BU2A 4XYCA 1NY4A 3BZDB 1E7UA 5ELBA 3JYUA 2CHBD 1FM0D 2WDRB 3HG9A 3CD6A 3ZNZB 1WTQA 5I6YA 1BQQT 4OWXB 3HOUH 1J7CA 1TWCB 4CDEC 2DYMA 1S5FD 2FNJB 1T6BX 1VQHA 3QQ8B 1JRUA 5C4ZA 3M4QA 4GN1A 2JYTA 2EJMA 4GKKL 1F9QA 4NJ6A 1L1OC 4YTPB 2ICIA 4KGTA 2MX2A 5FO8B 2FMMA 4V0BA 4W9EA 2AWTA 3VR5A 4JL9A 4WJPA 4JQWC 4ZRJA 4HEA1 4A8XC 4GSWA 4RM9A 1VQ6A 3ZNGC 3J80i 4QAYA 3GE3C 2K5QA 3CPFA 4PG3A 1HNZL 4HCNB 2N88A 5DM73 1WTRA 4R8IA 3K0YA 3T56B 5BYQA 1BXTA 1WTWA 1KDCA 2NVTH 3KFUA 2XEWA 4L5TA 1E1TA 4O42A 1L2NA 1WCMB 2EYHA 1J6QA 2F0UA 3QARA 1SMXA 1XLPA 1MI0A 1EU4A 1FJGQ 1V80A 1PRTD 1RL2A 1U4AA 1PTOB 1BBXC 3N20C 4OO1H 4A3JB 5E4XA 4ANUA 4IM0A 3OWEB 1Y8RC 2W3RA 1WXQA 5GADC 2KX0A 3NVYA 4H13C 2LVQA 1Q1EA 2E2JB 2NTSA 1EQQA 3OTOQ 1B50A 3J80E 3A9JB 3V6CB 3S9WA 1DJRD 1FGUA 3I56A 3K5LA 1HE8A 3P4SB 2AL6A 5DEHA 4JLCA 5I9PA 1BBWA 1T0RC 1E2VA 4DFAA 1EYCA 4EEWA 3GS2A 1CK1A 1HTPA 4MZ9A 3E0EA 5TSSA 1V8QA 4DV5L 2DLBA 3FRPB 3MVVA 4UY8C 4HLEA 4F88A 3VR9B 4L8JA 3VA7A 1YJNA 2R92G 4A3FG 1J19A 1KHIA 3PHWB 4LNKA 1FNUA 1NNXA 2K05A 4K6DA 3RPFC 1FIQA 1M4VA 3I4MH 3K5MA 3KUPA 4AS1A 4K5XA 1JE5A 2E2HB 2RDHA 2GOWA 4ZDVA 1T5XD 2ZJDA 3BY4B 4ME5A 3B1LX 1A3VA 3KVFB 5J22A 2F0NA 3TREA 1IL2A 1HA5A 2MW5A 3DWMA 3ECIA 2IX0A 4A3DG 4FXCA 3UGBB 3W5OA 4K7UA 4LF7Q 1J7BA 1T3QA 1STNA 1W6JA 3GTKB 1Y69U 1IBLL 3S1NB 3MTSA 1UBIA 1Q3LA 2NVYH 4YIJA 4KMUC 4ICVA 5JPNC 3K0XA 4OWTB 5E3FA 3ULLA 4DV7Q 1SSNA 2CS4A 5JJLA 1KFYB 3FC4A 4XX5A 4RGTA 1C9FA 1LLRD 1O7LA 3D0FA 1QLBB 3MJ5A 2PTLA 2N55A 1WTPA 3QWZB 1SB3C 1A0IA 1UE5A 2X6LA 3KLRA 4JI6Q 3Q14C 1QUQA 4A3IG 4O1NA 5BN4A 1VZ8A 4HVBA 3GTQB 1QQRA 2KYWA 1P16A 3M9BA 5EGTA 2N9PC 2KOXA 3ZVVA 2CKHB 3DCGA 2A5UA 2B3GA 2QW7A 5EBCA 3PMFA 1XNRQ 4EQOA 2LXJA 4NXML 2ZNVC 4Q2JA 2WB1E 2FMCA 2GBRA 3ER0A 3U4ZA 2PCFB 4FBJB 1WJJA 4OIKA 3GB1A 1EY4A 2DUDA 3UDFA 3OOCA 4IPHA 4O2DA 3ERSX 2O2VA 3SFEB 2B39A 4Y52H 2C9OA 5DPRA 1YJ9A 1SYBA 2MBHA 1V1PB 2O2VB 4B3TQ 1V5TA 2EY6A 2Z9HA 2VB2X 5GXGB 3W1BA 5IGDA 2EE1A 4RF0A 1OGWA 1CM9A 1BUVT 3NY5A 3SK4A 3W2DA 2XSCA 4C2MB 1L0VB 4JV5L 3HOWH 3BINA 3QX1A 3VAWA 4DQOC 1N63A 2EYJA 1SEBD 2HQLA 4A3CH 3RNCC 3RULA 2IO2B 4FHJA 4A9AA 2DAJA 3AE1B 2DGYA 3WDNA 2PQAA 3Q24A 4ID6A 3I55A 3I5JC 4JK1C 3RLFA 4C56C 5J18A 1WRIA 3P63A 3I91A 1ACCA 2ASBA 1JRPA 3V05A 1GNUA 3KYHC 3C8YA 1G6ZA 2K7VA 1FMAD 1XMOL 3HOUB 2IHFA 4PQXA 4DHJD 4EOYA 2GBMA 3GP7A 2IDYA 4J3OD 3J7AV 5EE0A 3SEBA 3DHIC 4I6NB 4TKOB 2K5DA 2M8SA 5IYBG 4XTCS 2L0CA 2EY1A 4DR7Q 4HJ7A 1EEFD 3PO2G 1C78A 4RF1A 2LXKA 1L5PA 4LJPB 5ELEA 3S14H 2JRHA 1WD0A 3OYYA 2JE6I 2MBEA 3HKSA 1XPUA 3R2IA 5IY0A 2VH1A 1LFDA 4NY0A 1YJWA 5FLXL 2MP2A 2NTTA 2UXBL 1E8YA 2QGQA 3I72A 1AZPA 2G45B 2MP2B 2JSVX 3SE0A 3P1HA 4GNXA 4WH4A 2K5PA 4UDUC 4YWKA 3TBIB 1VQ8A 1RWSA 2LVPA 3MXPA 5BR8L 3R93A 4GNXB 2LFIA 1ONLA 2FIFA 2A69C 2K14A 3B9JA 3I3CA 5AJ3L 2KUMA 4ANWA 2XTIA 3H94A 3UDIA 5C3WA 3S15H 2PMZE 4B3SQ 1RF2D 1S4ZA 4I7AA 4J6HA 1HQRD 5GAGC 3PF4A 4A3GH 2M0AA 4KKJA 3I2ZA 3FKIG 3QJZA 4TV3A 1K51A 5E6NA 2NN6G 5E1FA 3KJOA 4USAA 1S5CD 1F9JA 2UXDL 3B6YA 5IYDH 2DZJA 1KTKA 2K33A 2K3UA 4M0WA 4W9DA 2X6GA 3AU5A 3DQVA 4A55A 4EFOA 3S16H 3VXWA 1WGRA 1PZKD 3A7AB 4JBJA 4HK2A 5CV4A 2EY2A 2XRSD 4FDBA 5KNDA 1E10A 1HUNA 2C60A 2C9WB 4P75A 1QOHA 3CC4A 4JCVE 3S2DH 4HJKA 1C77A 3KF6A 1TWGB 2IW3A 4MSMB 3RD4A 5LMNW 4H7BA 3Q3MC 2CJOA 1E22A 3I4MB 1Y14B 4FP5D 5M5XH 1H8CA 3CF6E 1XCQL 2ASQA 3NBHB 1QOAA 1JWBD 4A6QA 4JI5Q 3SDZA 4DAYA 1NYRA 4DV3Q 1GG3A 2NUCA 4GGQA 4N8FA 1YHQA 1ENCA 2WX1A 1SNCA 4LJZC 4LTUA 1NI2A 2FHTA 2ENBA 5M3FH 4KZCA 4JBWA 4GDKA 2D3GA 4B0MA 1V1QA 1P0RA 3P1MA 2NVYB 3K7UC 4GDKB 2JA6G 2EDGA 2E2DC 2M2LA 3OPOA 3QO2A 2A74C 5K36H 1C76A 3DBRB 4IOIE 4JE3B 4LMQD 3PRZA 1EIFA 4AQYL 3A4SC 2NVQH 4PMBA 2L9HA 5CORA 4NQKE 3ZRCA 3ZW3A 2IO3B 1HTLD 3M4OH 3OMCA 2JYEA 3RN5A 3AEGB 1HZ9A 1P98A 2Q5WD 1PRTB 1IZ6A 5HGTA 1N34L 4L2YA 4JVZA 2MFIA 5LMUL 1FXTB 1N9WA 3P75A 4LF4Q 1QZEA 1YQ4B 2CCZA 3JSVA 4DNTB
chains in the Genus database with same CATH topology
4ZLTF 5J1ZA 3FAHA 3QOLA 2FE8A 4K14A 3S17B 2KVMA 4I7ZC 3A8KE 3I8ZA 5CV6A 4A3MB 4CJ1B 1D2BA 3NP8A 3T51B 2M19A 1SYFA 1F9SA 4B9WA 4ZK9B 1K8MA 2ONQA 1AEXA 4C3IG 2OHFA 3Q0AA 3C46A 2DWQA 3H09A 4XQJA 2K28A 3HOZB 4B0EA 1QG7A 2BDNA 1ROEA 2O4XA 2B2WA 3K5NA 4CGYB 2MPMA 1TKWB 2ZXOA 2CJNA 3IT4B 3F2UA 4N59A 3LYYA 1ZDVA 2RDGA 4IURA 4K5WA 5F2DA 3WOFA 4IUQA 2K5WA 3URYA 3TP7A 1JWSD 2WP8J 1XTCD 1CA5A 2WV6D 1IUEA 1ZE3D 4KHZA 4DU9A 2M56B 1E10A 2PZWA 3HKZB 3ND8A 2SNMA 1EIGA 4KGSA 1HXYD 1EQTA 2WKDA 4A3GB 4QIWB 1C4AA 4C1NI 1MGSA 3NWSA 4ZQ3A 4RA8A 2J42A 1I3QB 1LABA 2YEPB 3S16B 2BS4B 1BCPD 5T1GA 4XWWA 2HCCA 2LUMA 1LTGD 1YJJA 2I07B 2XWJB 2HDLA 1H9RA 1B44D 2F0PA 3S2DB 4HN7A 4HMIA 1ESFA 5M5XB 1NAPA 4ULLA 3OMGA 2J0TD 1ZYRD 2QKIC 3R2TA 2N0SB 3BDOA 1TY0A 5M3FB 1UAPA 3A56A 5JOBA 1EY6A 5IGEA 1DGJA 3NVVA 1LT5D 4P2CB 1QILA 3DWAA 1CHPD 1GHJA 3M4OB 1B9NA 3HP3A 1CA6A 1JMLA 1UNSA 3AB5A 1II3A 1TIID 1ML0D 1EWYC 1ET9A 1DXMA 1JALA 1UUPA 1V43A 4KY7A 2VNUD 2NN6I 2EYOA 1TU2B 2KCCA 2F3VA 2V4DA 1RODA 2D5DA 3T53B 2PW9A 5CBEE 4Q0FA 3ZJVA 3PIO3 1WSPA 2PPBC 4IALA 5JEAH 4C3HB 1SYEA 4I65A 1OXVA 2AWNA 3NWTA 3O13A 5CV8A 2RDFA 1LTRD 4X3SA 5LNK1 1PTOD 1SMYD 3PUWA 2JXTA 2A68D 1WVLA 1U4MA 3MFYA 3GTJB 4CJ0B 3A7LA 3Q22A 5C0XH 1R7SA 3HVZA 1E9MA 2A5HA 1GUOA 2LFNA 1LO5D 3GTMB 3B2FA 4RFBA 2CVRA 2WACA 2SNSA 3G7LA 4M1UB 2KECA 2L55A 1ZP0B 2OXPA 3ND9A 1GJXA 1SYDA 3S1QB 3KLSX 1LTAD 4XQQA 1YN3A 1HEZE 1MSHA 4ZRZA 2BE5C 3GTLB 3SXHA 3X3NA 1F2LA 3D6CA 1WTVA 1LTTD 4ZUJA 3MXNA 4FO2A 3B2GA 1IKLA 4LLGM 1RTOA 2QF7A 1JWUD 2QSDA 3T4AC 4DGZA 2LS01 1K52A 3T3OA 2QIEB 2B63B 1G2TA 1PZJD 2BA1A 1PTOH 5CGKA 4RNAA 3EROA 1IHZA 2B2VC 1H9KA 2XWBB 3IFDA 4U68A 2R93B 1XLQA 4X3TA 4AYBB 4XDCA 5KNCA 1XXGA 1K8OA 4HSVA 2BYTA 3A8JE 1IW7D 2EYMA 5HG2A 2XNAC 2I38A 3BYYB 3GO5A 4XT3B 1HPCA 3D6WA 4JWSC 4CKEA 2KMMA 3GD7A 2LGIA 2WXLA 1OXSC 2WB1B 1MD2D 1HQMC 1PRTC 2B2UA 3VR4A 1PDXA 4WJWA 1S5DD 2B2TC 1PLFA 1HFGA 1QKZA 4ITKA 4C1NK 3MXUA 2RA4A 1UGJA 2QDBA 2INNE 4E6IA 1QF6A 1BCPB 2QILA 1QE6A 1DM0B 2F0OA 1SXTA 4XDXA 2RPVA 3BWUD 3P4PB 3NQTA 5FR3A 4IUVA 3U52E 4QCLA 3OSOA 1O80A 4HAEA 4G7HC 3LB8C 4DAPA 1KH0A 3VR2A 3BS1A 2EVBA 4OVZA 5E6JA 4BA1I 1VF5C 4BBRB 1PUTA 2DYOA 1SSOA 1WWTA 4MH8A 3PO0A 1L6VA 3D3RA 2RVLA 1VRAB 3L7ZC 1YNTE 3P4QB 3Q69A 2F0LA 1SE3A 2J53A 4IUUA 2PMZB 1YMHE 4B08A 3S2HB 2W54A 4XQNA 4C80A 1X3QA 5K5PA 3PV0A 2QMTA 4D2KA 4G57A 1PRTF 2A73B 1MVKA 1Y1WB 3SK6A 3N9YC 1FO4A 2D62A 3ZJTA 2EXZA 1DYQA 2EYFA 2PZUA 4M8AA 1V97A 1N5WA 2AUJD 1C8CA 1J9OA 2LMCA 2Z4IA 2G1EA 3FPPA 1Y8OB 4FXKC 4OO1G 4CQNA 1KABA 2R6GA 3AECB 4A3BB 4HEDA 1F2YA 3D4RA 2L83A 4KJOA 1C4PA 3I73A 4A93B 1QCBD 2XIWA 2KEDA 1EM7A 1CQVA 4HKZE 3BVGA 1SJED 2JX5A 1FD7D 2BW2A 3Q8FA 3L9AX 2JQRB 1L0YB 4RGOS 4XWTA 1D5ZC 3KLSA 1MI2A 1Q12A 3SK8A 1TKEA 4X3KA 3DWGC 2E2IB 2Q8TA 4XIGS 2Z8LA 1WTOA 1Y8NB 1ZUD2 2WXPA 3V96A 4HR7B 2JA8B 1PFBA 4F8MA 3AH7A 3HZXA 2D2CC 5D7GA 1DZ1A 1QNUA 3MFGA 5CV5A 3NTHA 2YU9B 4NZLB 5HURA 5ELCA 3VYTA 1FCCC 3VRAB 4XE0A 3LX0A 4OIJA 1PXUA 1QJOA 2QJLA 4IQZA 1PFDA 1GPXA 2JEBI 2WINB 3I4NB 2AX5A 2BA0A 4OZBA 2R7ZB 2E6XA 2JA5B 3T3NA 3IFTA 1DOIA 3L3OC 1E0ZA 1VCIA 1O7ZA 3DWPA 2PVOD 1I4QA 1GB1A 2IGDA 4LAAA 1NSNS 1JOKA 3PZ8A 1R9TB 1WGKA 5IOCA 3HOYB 1K53A 3NVZA 4JWUC 4R9WA 1V8CA 1VMPA 3GTGB 2EJFC 3ABVB 1NYQA 3AU7A 3PIP3 1ILQA 4G7ZC 3L4PA 2RKSA 2Q8RE 2DBYA 4KKIA 3M85A 2E76C 2FBWB 1PFMA 4FYDA 3KBGA 3I70A 5BN5A 3HOVB 2JZPA 1ZEQX 1GHKA 4KY5A 2IWHA 1CFMA 2F0IA 5CYUA 2DNCA 3NTKA 3CIRB 5C3XA 2ZT9C 1VR9A 5FO7B 1ZKOA 2A6ED 2RBMA 5EBDA 1TQOA 2W3SA 1TS3A 1LTBD 2OEOA 1F77A 5CV9A 4EGVA 4ODGA 3C3LA 5H8YE 3HRZC 3GV3A 3NXWA 1VLBA 2M00A 5D65A 3I90A 1JB3A 1I4PA 3MP9A 3CU7A 3CRKC 4ZYSA 2A6HC 3MAQA 4IN3A 1VF7A 4IDIA 3U9OA 1G2SA 2HUGA 5IODA 1YNJD 1WTXA 4OZCA 2EYLA 3Q6SA 1RD9D 2RSOA 3AEDB 1LTID 2KOLA 3M3YB 1TT2A 3X3MA 1YQ3B 4C3JG 1P7EA 1RM6C 4YWGG 3ITPA 2JYOA 2KQ3A 1FNVA 1ILPA 3K5OA 3AEAB 1RCVD 3DWQA 3VR3A 4Q5VA 1LT6D 2IL8A 2NBFA 3VQIA 3E9SA 1FNWA 3D4WA 3TSSA 1EEID 1SNQA 1XX8A 2NWGA 3BK2A 2JU6X 2WP9B 2R92B 4A3FB 4LK0M 1BCPC 3C2PA 3E0JA 1B2TA 1TVXA 3AMZA 1F0ZA 3AEFB 5A35A 1PGBA 2V4IB 2X38A 4A3DB 4OO1I 5COYA 3FILA 1ENAA 1SNOA 1JC7A 2TMPA 1SNDA 4KV6A 1GUNA 1SE2A 5ELDA 1N60A 1ZYRC 4ZAIA 3BVMA 4XXEA 1K83B 2I46A 1TJEA 3PUYA 4C7YA 3H0GB 1Z47A 3GTOB 4KGRA 4A3IB 4IFDG 1NR4A 1SYGA 1TWHB 4FNFA 3HRDD 3BYTB 3NUHB 1YNND 3U7ZA 1EY5A 4H0LC 5EPJA 2WXQA 2W82A 4UAIA 1A3TA 3QG1A 2IT1A 1F2RI 3PUXA 1NCVA 1QNKA 1A15A 1MSGA 1BF4A 2A6HD 1GB4A 2WLBA 4EVOA 4JPSA 1KNEA 2MJEA 1KRHA 4QUCA 2MP1A 4P6VF 5FOBB 1SF0A 4HJGE 4AQ7A 1U4PA 1OXTA 4F87A 1EIHA 4KTAA 2J52A 1JOQA 3ETRA 4GZYC 5HI1A 5FK9C 5FO9B 1JORA 3TP8A 1STHA 3K58A 2LJIA 3R8BA 3CRLC 3EVQA 3BDLA 4DN4M 3CWIA 4DXFA 4IFDJ 3P20A 4NAMA 4IKGA 3NTIA 2MJ3A 2K22A 1PTOC 1SMYC 5AUKA 1QB5D 2F1MA 3GTPB 2A68C 3TMEA 5EKIA 4L1BA 2F0VA 3ZGZA 2XRQD 5C4HA 2OF1A 4XT1B 1EWCA 4BWGB 2WXKA 1EY7A 2L4NA 1OXXK 2HTME 4B9XA 4NAWB 3SR1A 2HQEA 1MBYA 3NUCA 5BN3A 1MHXA 2Y5PA 2WXHA 4NDXA 2QEJC 5D14A 1QOBA 5JPMC 5CC4A 1Y56A 2OEDA 3GV6A 1HHVA 4ZRPA 3NE5B 1SFOB 4EQPA 1JROA 3W5VB 3I9V1 3NS1A 3D31A 4CKCA 4RGNA 1VJKA 3AE5B 4ZRQA 3FKIB 5KYLA 5EE3A 2IPKD 4RCNA 3AMUA 4YT0B 2FJ2A 2LHDA 2JA7B 3OWFA 1FFUA 4DK0A 3RZDB 4PT5A 2O5JC 1S5ED 5EKLA 3AE8B 2K1BA 1R4QB 1D1KA 3TZUA 3W9CB 3BK1A 2VZKB 1GUSA 3NK9A 3KBXA 2PW5A 1JOOA 3Q8CA 5C3JB 2GRIA 5CV7A 4QF4A 4RCOA 1J7AA 1E6EB 1IGCA 2NMQA 4CJ2C 5G5GA 2AQ1B 1V1OA 1OQRA 4EE2A 2JA6B 5KEEA 1IW7C 2G9HD 1VDZA 2EPBA 5KYIA 5G3LF 1PTOF 3PUZA 1UWMA 2F0HA 4ARIA 5M5WB 1KNAA 4G7OC 2SAKA 4G4KA 1JWMD 2F0FA 2WXGA 3IT6B 5BYRA 4WIPA 4C7ZA 1PGAA 5HHDG 2F3WA 3AE4B 1BMLC 4WAFA 4TMAB 1R4PB 3PO3B 4CBVA 2MEKA 1Y8PB 1JE4A 1KDAA 3RUZA 5CMDA 2MGSA 1VMCA 5C0XG 2W55A 1I50B 3VYUA 2BTEA 1NR2A 1TWAB 4MN3A 4LK1C 4IUNA 4R8NA 2E75C 2SDFA 3DM1A 4C3IB 4OHJA 1EY0A 4KKTA 5J39A 1RHPA 5AUIA 1EL0A 3FEWX 5CR3A 1XLOA 3TDQA 1SJHD 2FUG1 3QB3A 4S3SA 2K03A 1DD2A 2BCOA 1QOGA 1CTMA 3TZDA 1B4OA 4QMGA 1ZXHA 4HKQA 1JR0D 5NUCA 1ZDXA 1PZID 5LHY1 3RZOB 1EQVA 1IBXA 2K04A 1VDVA 5C0XJ 3AEEB 4IFDI 3AM9A 3LXFA 2R3ZA 3T13A 2PQEA 1EOTA 3Q23A 2F0EA 1TKYA 3HVDA 1IL8A 1QWYA 2EZVA 2MH7A 5C5LA 4H44C 1TZOA 3FDTA 4J1MA 3VR8B 3JAML 1TS5A 3EUB2 5EE1A 5JVG3 3HOXB 4KI0A 4TSSA 5IGFA 2B2YA 5M3MB 2LEKA 2GA4B 1DOKA 3P7JA 2Y5CA 4HCEA 4Z9CB 3PUVA 4PMWA 3DHQA 3J81E 1IGDA 4MT5A 2IX3A 2DNEA 4V190 5C4XB 1FFVA 3HS0C 2ID0A 2NB0A 2J4XA 1GUWA 4NP5A 2PKOA 4OL7A 3T16A 2IJ0A 3EFXD 2AQ3B 3U2SC 3H3VC 1NEKB 2BB6A 1AW7A 3H8HA 2F0GA 3C1FA 1I4RA 2ICEC 2LKVA 3QIAA 1X32A 4NJCA 1IYVA 1PDQA 3MZ5A 1IYUA 2CW0D 3UI3A 1OXUA 4WFN3 3K7AB 2B8FA 1GOZA 1XF5L 4YTNB 1S5BD 3HEJA 3BIID 2B2WC 4A90A 1STEA 3MHZA 1AYFA 1VZ6A 1YN5A 2H88B 1LTSD 1FXAA 3ZQ4A 2PNRC 1XCTL 1ZXIA 1SBBB 2F0MA 2L12A 3NZ3A 1T5EA 1CJEA 4RHSA 1GUGA 3OHXC 1LT4D 3SVMA 3MC0B 1AWDA 3V3XA 2X69A 1F9PA 5LL6S 1CZWA 4NMZA 2BBCA 4HTHA 1PYWD 3K6OA 5C3EB 3W1SA 1BO0A 4RKBA 4KN7C 5JVH3 3ZJUA 1RDPD 1G91A 2CU3A 4WQMA 4CKBA 3LWUA 1HZ6A 1B3AA 1A3UA 2LMCB 2VXWA 3A54A 5D3DA 2K9XA 2KAJA 2A6EC 4FF1A 5H92C 2F0DA 1L4ZB 2TSSA 4EQNA 1SDFA 5C0XI 2I2YA 2N9KA 4L6TB 3PZ7A 1XEEA 3NRZA 3OW7A 3TN2A 1PFNA 1UWXA 1SNPA 3KF8A 5I2YA 2KQ4X 3Q8BA 4WORA 5ELFA 5BMGA 3D4DA 3M4YA 5FKAC 2FINB 2E74C 4YTMB 2EOTA 3W5UB 1P7FA 2MHVA 2NVXB 2IGGA 5A2QL 1G8ZD 2D5GA 2L1BA 2L5TA 3IAYA 2DY7A 4A3EB 4MHEA 2KHSA 3AE7B 1YNJC 3FVQA 3HUIA 4K5VA 2KACA 2F0SA 1Z7TA 1D5XC 2KCNA 1FCLA 1D6EC 1HFNA 4BY7B 4BBSB 2WU5B 3EQLC 3J7YW 4MM3B 1D5MC 4MIUA 2HDEA 2HDMA 2WXRA 2PVGC 4OW0A 2LHEA 3DMUA 5M5YB 1PMRA 5EKKA 2AWOA 2PYKA 3SK5A 4IUTA 1N62A 4OZAA 2YEPF 5I2XA 1B9RA 4XDDA 2JWUA 5E4WC 2ACZB 1IKMA 3VR6A 5DM63 2QCPX 3KWLA 3NPPA 2KDMA 4ZKCB 4US8A 1YN4A 3IKJA 2L52A 2WXIA 2PW7A 1SIJA 5IT9E 3JAME 1N5XA 1LACA 4R3DA 4KX6B 1G291 4J8QA 2F4IA 5HFYA 1JWAD 2N7JA 1V1PA 2H4OA 2O2LD 1DONA 2MJDA 3RMHA 3CHBD 3LWEA 4ZUIA 4YSZB 2V3NA 2J7ZA 3G6JB 3A55A 4ZHPA 1TR5A 1ESRA 1KAAA 3CKIB 3KQ4A 2KJXA 5BYSA 2EJGC 1CQFA 3K57A 2INPE 1YNNC 2DN8A 4PV1C 3U4EG 3OIPA 2BT6A 4CHTB 4ARCA 1M8AA 1ENFA 3SHLA 4RAUC 2VZKD 2JSOA 4N9PA 1FXIA 1CT1D 4N9TA 1RYJA 3QJYA 2OT2A 2AQ2B 3Q8AA 2SOBA 5I9OA 5IGBA 2JEAI 5DNFA 4X3UA 1A2TA 3R3OA 1I7HA 4H2AA 3P42A 5ISRA 2WDVB 4WURA 1U4RA 3LNNA 4KD3A 5MPOA 4ZOHC 3NSWA 5CBAE 4DF7A 2NVTB 1SAPA 1EFID 2B2YC 3I57A 3J7AF 3BVZA 1YJIA 2IX1A 4YSXB 3VYSA 1NUCA 2MJ8A 5C2TB 1ICWA 3AB9A 5I4DA 1Q90A 1C4QA 3P4RB 2NN6H 2NZ1D 1F9RA 1SYCA 2B2UC 2GB1A 4TQ1A 4YSYB 1I4GA 4FXDA 3NQIA 1RTNA 5JXVA 5C6AA 1STYA 1BR9A 2KA7A 5BMIA 2B2VA 3KK7A 3MHBA 3BG3A 1O7YA 1RFKA 5K36G 3NBHA 2LY7A 1ZXTA 3E6ZX 4Y7NB 3TP5A 1KDBA 1AN8A 1STAA 2B8GA 2AUKA 2K6AA 2RMMA 2F0JA 1OQQA 1H9MA 4FXGC 5JAVA 5JJZA 1DOXA 1NENB 2F0QA 2WQYB 5EE9A 1B53A 1L0XB 1DCZA 3FILB 2KEEA 3TEYA 1SE4A 3Q8EA 2Z1CA 1EWHA 1EY8A 5BMHA 1TS4A 1Z6HA 1BOSA 3TUOA 2ZW1A 1C48A 1W6KA 2WU2B 1EY9A 4XYOA 5AFWA 1I4XA 4C3HG 4PNYA 2B2TA 2BS3B 2EY5A 3H6MA 1CI3M 4US9A 2L11A 2C5CA 4QUFA 2NYZD 1MHHE 1Q8IA 5KGUA 4HROA 4DNRB 1AP0A 3TEZA 5A2QE 4TQUS 5IGGA 4HCSA 4IFDH 3TEWA 2EYPA 3WCQA 2RSNA 3VA5A 1EYDA 2Z4HA 1HZ5A 3J81L 3HOWB 2WXOA 1Q1BA 4NW2A 3V2TA 1ET6A 1XWEA 4K8IA 3AV8A 1CHQD 5LL6X 2A69D 1OO9B 3D8GA 1TYGB 3FMCA 2ON8A 1QT9A 5T1IA 4NKLA 4F7XA 2JXMB 2XN9C 4FF3A 1VZ7A 1BCPF 3EA6A 2WIIB 3PO2B 2WS3B 2Y0SB 3S14B 4IUPA 4DAVA 5C5MA 4BA2I 1PGXA 4KKUA 1XYIA 2ZW0A 1H9JA 1KLGD 5D3IB 1XO3A 3AE3B 2F0TA 3IAS1 3VRBB 3H91A 1JQ4A 3EGRA 4N6EB 1J8IA 4P16A 2IGHA 2RQXA 3M7NA 3S15B 1GXDC 2D9UA 4KKSA 3AE6B 5KIXA 3NVWA 1AZQA 4GLSC 3RFZB 3HGBA 2BS2B 4K2KA 3ZYYX 3OIQA 4C3JB 1C4CA 3U9SA 2N9LA 3MA2B 4U673 2G9DA 2E3TA 3C1EA 5EJWA 4PMCA 1H9SA 3K59A 1A2UA 1Q10A 1H9SB 3NBIA 2PO4A 1XLNA 1TY2A 3VYRA 1HA6A 1NVID 4DXGA 1KF6B 4ZHOA 2ZXPA 1GAQB 1LV9A 3IL8A 4REZA 3AN1A 1STGA 1UEAB 5DAUA 2WKCA 4K2LA 2EKIA 1FR3A 2NVQB 5EPLA 2PMVA 4TQ0A 1E0BA 5KRUA 5JEAG 1WD1A 5FLXE 1BUIC 1ZOYB 1EU3A 3N52A 2H1EA 4KK7A 1F2MA 3AEBB 1DOYA 4KD4A 3KWVA 2V0GA 3ONAB 1CZPA 2FFKB 4FVMA 4DK1A 3DEPA 4K6LA 1ZPSA 4RGMA 4KN4C 4TRDA 3CQZB 4HRSA 3IXSA 3E56A 5C44B 2WXJA 3DEOA 3I4LA 1U9RA 1NI3A 1I4HA 4WWMA 1RKNA 4RHRA 1EZ8A 4HSPA 3J80L 5G3LD 2CQAA 1FD6A 2CW0C 2PZTA 2YYZA 3BDCA 5JEAJ 1C79A 5I6WA 1I6VC 3M7GA 5IGCA 1A6XA 2MUYA 2BOSA 4ILWA 1KLUD 4RWSC 1D1IA 3MEHA 1Y1VB 2WXNA 5C4JB 2DY8A 1IBXB 4K8JA 1SNMA 3UI2A 2K0PA 1JQYD 1D4BA 1TKGA 5T8IA 3SFDB 3W3AA 3NHHA 4KHVA 1U4LA 1GUTA 2VB3X 2PLPA 2L1AA 2SEBD 5IT9L 2Q8IB 1CZGA 1STBA 2KN4A 4ABNA 1FGBD 1LT3D 3MXGA 1HRJA 1X3PA 3GQBA 2WAQB 2H89B 5G5HA 1A70A 4HMJA 1F2RC 2ZXRA 3DUZA 1FRRA 3J9CA 4YXDB 4IZ8A 3QOJA 1EZ6A 4BY1B 1I6HB 2M9VA 1BNZA 1E2ZA 3N6RA 1WYGA 4FF2A 5EQ0A 4KY6A 3AE2B 1OFFA 1TWFB 3AE9B 4RH6A 2WXFA 2JP1A 2BB5A 2V3PA 3A8IE 3S1RB 1TS2A 2XVSA 1O78A 1JCKB 2B76B 2HCIA 4DA2A 2K01A 2WDQB 1N61A 4FF4A 5KNBA 1FEHA 1DOLA 5EPKA 3MWYW 1AFPA 4KJNA 2PIAA 1EYAA 2L32A 3TP6A 1FRDA 2KWDA 3WOEA 4JX1C 1K50A 2VUMB 4QB4A 1HUMA 2F03A 4GDLB 2O5IC 3E5SA 1B1ZA 4BS9A 2Y3AA 2K32A 2GI9A 4L23A 4L63B 3QWNA 1E2WA 1L4DB 1BDOA 2WNMA 2R61A 5M9OA 4RKLA 1MPEA 4OGQC 2EELA 1HCZA 3ERQA 2F0WA 2BE5D 5IIFA 1B9MA 3EJIA 2F0KA 4N58A 2BDOA 2WXMA 4MACA 3IAM1 1RJTA 1FYCA 1JW9D 1QOFA 1E7PB 1F2ZA 3TEXA 1L6UA 3S1MB 3DXJC 3FPUB 4WRDA 4ZKBB 4A3KB 1JICA 4XYQA 1DOMA 3BZDB 5ELBA 2CHBD 1FM0D 2WDRB 3HG9A 1WTQA 5I6YA 1BQQT 1J7CA 1TWCB 2DYMA 1S5FD 1T6BX 5C4ZA 2JYTA 2EJMA 1F9QA 4YTPB 2ICIA 4KGTA 5FO8B 2FMMA 4V0BA 3VR5A 4A8XC 4HEA1 3SR6A 2K5QA 2N88A 5DM73 1WTRA 4R8IA 3K0YA 3T56B 5BYQA 1BXTA 1WTWA 1KDCA 4O42A 1WCMB 2EYHA 2F0UA 1XLPA 1MI0A 1EU4A 1PRTD 1PTOB 1BBXC 4OO1H 4A3JB 5E4XA 3OWEB 2W3RA 1WXQA 3NVYA 4H13C 1Q1EA 2E2JB 2NTSA 1B50A 3J80E 3S9WA 1DJRD 3K5LA 3P4SB 5DEHA 5I9PA 1E2VA 4DFAA 1EYCA 3GS2A 1CK1A 1HTPA 5TSSA 1V8QA 2DLBA 3FRPB 3MVVA 4F88A 3VR9B 4L8JA 3VA7A 1FNUA 2K05A 4K6DA 3RPFC 1FIQA 1M4VA 3K5MA 3KUPA 4AS1A 4K5XA 2E2HB 2RDHA 1T5XD 4ME5A 1A3VA 5J22A 2F0NA 1HA5A 3DWMA 2IX0A 4FXCA 1J7BA 1T3QA 1STNA 1W6JA 3GTKB 1Y69U 3S1NB 3MTSA 1Q3LA 4YIJA 4KMUC 5JPNC 1SSNA 5E3FA 1KFYB 3FC4A 4RGTA 1C9FA 1LLRD 1O7LA 1QLBB 3MJ5A 2PTLA 2N55A 1WTPA 1SB3C 2X6LA 3KLRA 4O1NA 5BN4A 1VZ8A 3GTQB 1QQRA 5EGTA 5EBCA 3PMFA 4EQOA 4Q2JA 2FMCA 2PCFB 4OIKA 3GB1A 1EY4A 3OOCA 3SFEB 2B39A 2C9OA 1SYBA 1V1PB 2EY6A 2VB2X 5GXGB 5IGDA 4RF0A 2EE1A 1CM9A 1BUVT 3SK4A 3W2DA 2XSCA 4C2MB 1L0VB 4DQOC 1N63A 2EYJA 1SEBD 4A9AA 3AE1B 3WDNA 3Q24A 4ID6A 4JK1C 3RLFA 4C56C 1WRIA 3P63A 3I91A 1ACCA 1JRPA 3V05A 3C8YA 1G6ZA 2K7VA 1FMAD 3HOUB 4PQXA 2IDYA 3GP7A 4J3OD 5EE0A 3J7AV 3SEBA 4TKOB 2K5DA 4XTCS 2L0CA 2EY1A 1EEFD 1C78A 4RF1A 1L5PA 5ELEA 1WD0A 2JE6I 3R2IA 5FLXL 2NTTA 3I72A 1AZPA 2JSVX 3SE0A 3P1HA 4WH4A 2K5PA 4UDUC 3TBIB 1RWSA 3MXPA 3R93A 2LFIA 1ONLA 2A69C 3B9JA 3I3CA 2KUMA 3H94A 5C3WA 1RF2D 1S4ZA 4J6HA 1HQRD 2M0AA 4KKJA 1K51A 2NN6G 5E1FA 4USAA 1S5CD 2K3UA 4M0WA 1KTKA 2K33A 2X6GA