4TSSA

Toxic shock syndrome toxin-1: tetragonal p4(1)2(1)2 crystal form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 42
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4tssA01
3R8BA 1PRTF 4Z9CB 1LT5D 1CT1D 1JWMD 1AN8A 1SXTA 4RGMA 2AQ2B 1JR0D 2QILA 4K6LA 1RF2D 1SE2A 2R61A 1EFID 1EU3A 3BVGA 1CHPD 3BYTB 3R2IA 1BXTA 1PRTD 2AQ3B 5FK9C 1TS3A 1LTAD 5ELCA 1KTKA 1I4PA 1MD2D 1LTID 1V1PA 1XTCD 3CHBD 3R2TA 1I4XA 3GP7A 1PTOB 1TY2A 3BVMA 4UDUC 5D3IB 1FNVA 1PZID 2TSSA 2IJ0A 5ELEA 2IPKD 5ELDA 2XRQD 1YN3A 3EFXD 1LTRD 1SJHD 1B1ZA 5I4DA 1S5FD 1D5XC 2CHBD 1ENFA 1TS4A 3TSSA 1STEA 1HXYD 1D6EC 1UUPA 1AW7A 1QILA 2XNAC 1HA5A 2QEJC 1FGBD 2XRSD 1LTTD 3DWQA 1HTLD 1CHQD 1SBBB 1LT6D 1LTGD 3MC0B 4RHRA 1YN4A 3DWPA 1S5BD 1TS5A 3MFGA 1D5ZC 1JWSD 1PZKD 1SEBD 2NTTA 1LTSD 1EU4A 1DYQA 1JQYD 1LT4D 1BCPB 1I4GA 1EWCA 5D3DA 2G9HD 1EEFD 1I4RA 1GOZA 5FKAC 1TS2A 3SEBA 2WV6D 1V1OA 1PTOF 2AQ1B 3EA6A 1L0YB 1FD7D 3O13A 3BZDB 5TSSA 1I4HA 1EEID 1LLRD 3DWAA 4RGOS 3V05A 1ET6A 1LO5D 1CK1A 1F77A 1PTOD 1KLGD 2ICIA 3BVZA 4NZLB 1V1PB 4BWGB 4C56C 5ELBA 4O1NA 5ELFA 1S5CD 4ZYSA 1HQRD 4DXFA 1M4VA 1S5DD 4L63B 1BCPC 1UNSA 1TY0A 2O2LD 4RGNA 1G8ZD 1B44D 4RFBA 1FNUA 1I4QA 3W2DA 3OWEB 2SEBD 2RDGA 1XXGA 1RDPD 2Z8LA 1PRTB 1FNWA 1S5ED 3KLSX 4RH6A 1BCPD 1LT3D 1T5XD 4RGTA 1KLUD 1LTBD 4TSSA 2NTSA 4RHSA 1D5MC 2J4XA 1PRTC 1RCVD 1JWUD 1L0XB 1SE3A 1ESFA 2XN9C 4L6TB 1PZJD 3BYYB 1SJED 4DXGA 3URYA 1PYWD 1SE4A 1JCKB 2RDHA 1YN5A 1BCPF 1ET9A 1DJRD 1CQVA 4OHJA 4RCOA 1PTOC 1PTOH 1RD9D
chains in the Genus database with same CATH superfamily
5IYBG 1VRAB 4RM8A 5KNDA 1E7VA 1HNXL 4CHKA 4XQQA 3U9OA 3W5VB 4KMUC 1XQQA 4QUFA 5M5YH 4IOAA 1HQMC 4S3SA 1IBKQ 1GUWA 2FE8A 2E76C 1U4PA 5T1IA 2MBQA 2PJHA 1GO3E 3GS2A 3Q69A 1V5OA 4IG7B 4HSPA 3PREA 2YYZA 2RDBC 4URKA 2MO0A 3J81i 5FLXc 2DZJA 1TS3A 1JRPA 1GXDC 3S1RH 2KENA 1J8IA 1T0RC 5BO4B 5IT9E 2JYEA 2B29A 4BS9A 4ZHPA 4LUZA 2LGXA 2F1MA 2WX1A 3J7AV 1O7IA 5M3MH 1TWHH 3DBLB 4N9F4 3WAMA 3MHZA 3S1MH 3A7AB 5LMUL 2WGSA 3T53B 2JEAI 4NP5A 3QWNA 3NHHA 2IZVB 3HKZG 3B0AA 1L4DB 1STNA 1YJ1A 4MGKE 2G45B 2MWSB 1DXMA 1D6EC 3PPAA 3A8JE 2OWOA 4HJKA 3S2AA 4IPCA 3CCMA 4A3PA 4ZCKA 3GTJB 5DNFA 2DZMA 2RSNA 4US9A 3G71A 1RAXA 2MBOA 5C4XB 2WLBA 4RHRA 3GB1A 2BYTA 4JI4Q 1N36Q 1EOVA 5I6WA 3JAMc 2L83A 1M90C 3NUHB 4FXKC 4E74A 1VQAA 1XCQL 3DHHC 2L12A 4K0KL 2MJDA 4M02A 3AB5A 4L1BA 1TWFH 1V6EA 3U7ZA 4MTKA 1XWEA 3HEJA 4DR2L 4C1NI 1SNPA 1UE1A 2KD0A 2M0XA 2A69C 3ZJYC 3OW2A 1FIQA 3K6OA 1I50B 1X65A 3I8ZA 4REZA 3ZUNA 2C5LC 4IM3A 3VTWA 2MHVA 1I4HA 2G1EA 1WGRA 4POGA 4IKGA 1MHWC 2ENBA 4BBRB 2XWJB 4IURA 5FLMG 3Q8DA 4C4VB 2Z6BA 2EY6A 1K73C 3P1MA 3QR8A 5T8IA 2L55A 4DR3Q 2FAZA 3MXNB 4ZUJA 1A63A 3IVFA 1G291 1N6ZA 2E2HH 4X66L 1YD8U 1HNZL 3V62A 3K7UC 3CF5A 4DDGD 1GD7A 2M4NA 4ZRIA 3DXJC 1YHQA 3NJTA 5I6YA 4XTCS 5IIFA 3UDGA 4JI1Q 1JALA 2Q8RE 3PUWA 1SFOH 3TS0A 1VQ5A 2UUBQ 1WGGA 3BK1A 1PH1A 2VW9A 3J7ZC 4GKJL 1Y8NB 2YTVA 4GN4B 3PIPA 1XLOA 2KFKA 4C1NK 1I42A 3K0XA 1P9DU 1KIXA 5IYBH 2WXJA 4KJNA 1J9OA 2KACA 4AYBE 1L0XB 4WWMA 1CA5A 3QIAA 2GMIC 3TEXA 3I4LA 2D0OA 1R4NI 3I70A 3URYA 3S1MB 4AS1A 3A1QA 1TWHB 1TWAH 3Q6SA 1WTXA 1AE3A 1D1IA 1PTOC 1HNWL 4G7OC 3MWYW 4YL8A 1M8AA 2I5LX 4DR1L 3UQAA 5KGUA 5K5PA 4JI2Q 2PMZE 3D6WA 4A3JB 1VQKA 3HOZB 2MX2A 1QOHA 3G6JB 2IO0B 4A93H 3GZNB 4WWPA 4JI6L 5ELOA 1PV4A 1DGSA 1I6VC 1W3SA 1WD0A 2J7QB 3PO3B 2N9LA 3OG5A 3KH0A 2RPQA 1BF4A 3GTOB 1WVLA 1QQRA 3SE0A 3ULPA 3KUDB 4PYZA 4C3IB 3PUXA 1JJGA 5G3LF 1DD2A 4WWNA 1K9MC 3QX1A 2B2YC 2FIDA 2JA8G 1Y1VH 1ZDVA 4MJSA 2PPBC 1PTOB 1V80A 3K5MA 1Y8RC 2KWDA 3QQ8B 4UDUC 3CCLA 3G48A 2B8GA 2YTYA 3GZNI 4W9JA 1H4RA 3DCGA 2BWES 2XVSA 2I1KA 3NY5A 1KRTA 4ICUA 4HTHA 3U52E 1LTRD 2FCSA 2J0JA 2JA6G 3K9PB 4DXAB 4R1JA 2AUJD 4WORA 5IE8A 5H1SE 4G50A 4B3MQ 2G4DB 4H0LC 4Q0FA 4CKEA 3T56B 1VF5C 1RTNA 1EY8A 4KKJA 5CV8A 3TP5A 3NVWA 1SYCA 2ZEQA 1HH2P 2IX0A 3OJ3A 2B76B 4B3SQ 1XNRL 2Z6KA 4ABNA 3F8TA 2LHDA 1NNXA 1Y1WB 2O5IC 4KVGB 2TMPA 1FMAD 2W54A 4K81A 3NELA 1EQRA 4QGUA 1O7ZA 1X3EA 2LS01 2MJ8A 3P63A 3ZNZB 3EGRA 5FKAC 4B9XA 2A19A 2WV6D 1GJXA 2FUG1 1UGMA 4DV6Q 1YJNA 5TR5A 2QF7A 2ASBA 2Q2IA 4DV6L 1WJJA 2QCZA 4KHZA 1YJWA 3U4ZA 3NVYA 2L3ZA 3Q3OC 2B63G 2A68D 1AP0A 2I5MX 4YCWA 4FBJB 2IGGA 2BS4B 4ANVA 3CRKC 3R3MA 2EYJA 4YTPB 1KH0A 1UNSA 3RFZB 4ZYNA 3CRLC 1GNUA 1B53A 1G8ZD 2KQ4X 1OXUA 4GNXB 1B44D 4JBWA 4A3MG 1V1QA 2WWZA 2NVTB 4CO7A 3DHQA 1VF7A 3OMCA 3DWGC 1VQEA 1LGRA 1CUKA 3M4QA 2AWNA 1PRTB 2LASA 3SVMA 1E8XA 2DYMA 4M8AA 4JI4L 3I3CA 3M4OH 3ICEA 1FGUA 4NXML 4FF4A 1JMLA 2Y5PA 1UWVA 2JVCA 3HOUH 3TL5A 5IT9L 4BA2I 1RCVD 3NRZA 3DBRB 3RPFC 4ZRZA 4MNOA 1YNXA 3T1YL 3VVWB 2KDBA 4E71A 4LUVA 5JEAJ 1PGXA 2F0PA 3V60A 5IP7G 1ZUD2 1YHAA 3Q8EA 2NPTB 4B95A 2KCCA 4A3FH 1Q86C 4GSWA 2Z59B 4HEA1 2AX5A 3MTNB 1WI0A 2WU5B 1OXXK 3HFZB 3H7PB 4KIKA 1LT5D 4K6DA 4X66Q 3VR5A 4CJ0B 4DV0L 2JA7G 4ILWA 3TIXA 4WJNA 2B63B 3I4NB 2W3RA 2AQ2B 2D62A 3TMEA 5IYCH 1RRBA 2MO1A 2QILA 3DUZA 4K6LA 2PQAA 4BY1H 1ICFB 1VQBA 2B63H 3KW5B 3PRZA 2K5WA 4MEMA 1AARA 3KYDD 3KF8B 1BXTA 4Y7NB 3JYUA 3P4RB 4OXPA 4RF0A 4V190 4K0KQ 4KY5A 3CU7A 1I3QH 3W5OA 3VFKA 3V2TA 4A3FB 1C76A 1F2LA 4NDXA 3BVMA 3DEOA 4K8JA 4G7ZC 3DQVA 1H9KA 2K6DB 1I6HH 4BKSA 2R93G 2BQQA 1WGKA 4HJ7A 4F7XA 2LUEA 1ZW7A 3STBC 3NTIA 1S40A 2L11A 3IFDA 4IQZA 1XLPA 4AYBG 3J80L 2O6VA 3UF8A 4O42A 4LJOB 3ZGZA 2EJFC 4QY7A 1S3OA 2K3UA 1HA5A 3MC9A 1DOYA 4ZQ3A 3TMPB 4DK5A 2F0HA 1LT6D 1RKNA 2HDMA 3LWEA 2RSUA 3VH3B 2E2JH 5C5MA 1EUJA 1II3A 1WTWA 4TUUA 1XTDA 3RN2A 2N7DA 2C9OA 1OEYA 4IALA 4CJ1B 4K14A 4A3KG 3HUIA 5MPOA 3MHBA 2GRIA 2KXJA 4MHEA 3FHWA 4EQ5A 4KDLB 1YNTE 3JVZX 5C23A 3H7PA 2XGTA 4JI7Q 1VQDA 1QVGA 3TJPA 3OTOQ 1EY4A 1E5WA 4DHZB 1V1OA 3P75A 1WE6A 2LFIA 3AXCA 4ZUIA 4TKNA 3P42A 2IWHA 4II2B 1XT9B 3X3NA 2BKRB 5BN4A 2JK8A 4MGYE 1SF0A 4IWQA 3T16A 4K2KA 2DYBA 2CW0D 3ZYYX 4J6HA 4BWGB 2QDFA 4C56C 3BJUA 4XZ4A 3HP3A 2KX0A 2RF4A 1V8QA 2ZVNA 4A3OA 1IL8A 5IO9A 2UUCQ 2W55A 2D3AA 2GVBA 2J0TD 3J80E 1P98A 4BKTA 2R93H 1Y1WH 2LXJA 2YV5A 2HTME 3P20A 4NMZA 1OXVA 4UP9A 3M63B 5HGTA 1F0ZA 2Q2TA 1GG3A 3RR5A 4HWIB 2A6EC 2D3CA 1XNQQ 4CDDC 4W9GA 1EYAA 1I94Q 1MVKA 2K0PA 2EYFA 3B08A 4LF5L 1SLJA 4EQNA 4ARIA 2F0OA 2WQYB 4ZRQA 2GN5A 2EE1A 2J4XA 5GAEC 2IGHA 2K5PA 2ZPNA 5LNK1 2EY5A 3Q0AA 2F3VA 5BYSA 2K50A 4GDKB 3K5OA 4L8JA 2N1WA 1PYWD 1MHXA 2RCNA 4K7UA 1B9NA 5LL6S 3N1YC 4DN4M 1E1TA 3S16B 2MP1A 4OHJA 3RD2A 4HLEA 3I72A 3AE7B 3D3RA 2VQFL 3AYHB 2F0SA 1ESRA 1BNZA 2BGFA 1WYGA 5JJIA 2JWUA 4DV4Q 3LJ3A 3GTQH 5JVG3 4BBNC 2K05A 1XMOQ 3RLOA 4AQYQ 1CFMA 1AN8A 5EBCA 4OZAA 3WA0A 4EZLA 1CSPA 2KBNA 1A3UA 3PUVA 2R61A 3PO2B 2HQEA 4X65Q 4A93B 4JBMA 2K32A 4HIDA 1E6EB 1PFDA 1K83B 4A3JH 1J5EL 3HOZH 1H95A 1F2RI 5ELNA 1YOVB 2G5DA 2UXCQ 3P4PB 1LTID 4L2YA 3OLMD 1FRRA 2WB1B 3L2PA 1FVIA 4BBSG 3Q3MC 2VZKB 1TWAB 1GHJA 1ILPA 2HDEA 4I6PA 2JXXA 4WIPA 3AFQA 3PIO3 1GJZA 3LYYA 5C0XI 5G3LD 3IAYA 3I63C 2HQLA 1X54A 3M3YB 1SJHD 1QOAA 1TZ1A 4IUPA 3ZKJC 5KRUA 1D3ZA 5LMNW 5LXIB 1EWHA 4HPPA 2NN6H 3DM1A 1STEA 2DY7A 4WJ4A 5CR3A 1Y8OB 5IY0A 3J81E 2ZJPA 1UUPA 2LD9A 3M62B 5A2QL 3VR3A 1SMXA 3HOYG 1EM7A 3E9SA 1IBML 1N8RC 3UDIA 1K0SA 3KK7A 4G57A 1DOLA 2RHQB 1MG8A 2WIIB 1SYBA 3QCAA 3FKIH 4PZ8A 4LF4Q 1FD6A 1UELA 5IGDA 1EZ6A 5IGFA 2O5JC 2PTLA 3M3JA 4NPSA 5CX3A 4AUQC 5DPTA 1YZ6A 5FO7B 5CV6A 1KM7A 3K59A 3C46A 2B2TC 1EQQA 3AEAB 3T8MA 4LNQA 1EF1A 2UUCL 4FHJA 1QG7A 2DUDA 4C4VA 4BBRH 4RMFA 1L1OB 3HOXH 5TSSA 2KDMA 1HZCA 2ZJQA 3BK2A 4DV4L 1CK1A 5EDSA 3GD7A 2MW5A 1Q0WB 4AQ7A 3SU8X 4KD3A 1E1OA 5JOBA 4MGIE 3ZRFA 4EZKA 1F52A 4C80A 1OO9B 5AZHA 2L52A 3ECIA 3IFTA 4A20A 4GLAC 4QL5A 2E5LL 2J7ZA 1BR9A 1KJTA 3HKZB 2O2VA 3GO5A 5C3XA 2KTFA 2YU9B 2LVQA 3JAMi 2SEBD 1PDQA 1RDPD 4A3CG 1IKMA 4YXDB 5M9OA 2F0WA 4DV5Q 3T3OA 3GTJH 4J8QA 2KMCA 4OONA 5L37A 5LHY1 1IBLL 2I07B 2N4FA 5JH5C 3A9KA 3HG9A 1XCTL 4KJOA 1L1OC 5CTRC 3ZO5B 4W9IA 2X8XX 2R7ZH 1HTOA 2XN9C 1C9FA 4BY7B 1E2ZA 1HNZQ 1GKHA 2DN8A 1IZ6A 4I7AA 2WKCA 2PCFB 3ALBA 4M0WA 1YQBA 3BDOA 3FAHA 3Q8BA 4DPGA 5HURA 4DA2A 1A2UA 1VCBA 4BKGA 1WH3A 3AFPA 3MXPA 4AH6A 3S1RB 4GN1A 2PKOA 2BBCA 1L1OA 1UZXB 1ZYRC 1CT1D 4JI6Q 2V9HA 3K80C 3H9DA 3H3VC 1DOIA 4N9PA 1VQIA 2PIAA 2JT4B 3CC7A 3S1QH 3DBHB 2KWVB 4USAA 1SE2A 4L5TA 3RT3B 1BMLC 1EFID 2DLBA 1UEBA 1YEZA 5M5YB 3BZKA 4XWTA 1CHPD 3GTQB 3EROA 1L6UA 2OEOA 1B9RA 1KQSA 5FK9C 3HK0A 1LTAD 3ZXVA 4F7ZA 1VQHA 4CGYB 4K7SA 3HIZA 3F2BA 5AUIA 5DEHA 3V6EB 2R92B 3A8KE 1EIFA 2PW7A 5M5XH 3E56A 4MDKE 5KNBA 1C9OA 4DK3C 1A2TA 1PYSB 4MELA 1KLVA 1SSOA 2M19A 4JV5Q 4ICVA 4XDDA 5J2RA 2XRQD 1ASYA 3PTFC 4PK1A 1F9SA 2N1VA 1HJPA 1VQNA 5I4DA 2IW3A 4JL9A 2QCPX 3NP8A 2CHBD 3RN5A 4GKJQ 2IHFA 2WAQE 4LUOA 1QVFA 4RAUC 1XD3B 3A9KB 1IBXB 1W2BA 2BCOA 2PI2A 3CAMA 2UUBL 2PZTA 4IFDJ 3X0WA 4IUQA 4FO2A 1PH7A 4LFBQ 3AE6B 1LTTD 3NE5B 4ZK9B 3TRZA 4LFBL 3TP6A 4W9DA 5AUKA 2ZW1A 3RNBC 2E3TA 2V1CC 3HM3A 2C35B 1G6ZA 2LXKA 2N9XA 3L3OC 4XWWA 4P73A 3IT6B 4LF8Q 2FNJB 3OWFA 3H1UA 4DR5Q 2H4OA 4U68A 2BS3B 1EEFD 1I4RA 2WYQA 2G9DA 1X6OA 2JA5H 2BE5C 3PF5A 3KYCD 5M3FB 3A9JB 1ENCA 4YWLA 3E9HA 1P7EA 3BZDB 1A3TA 1LLRD 3WALA 1SYGA 4KHVA 4NY0A 4QMGA 4CYEA 2ZM6Q 2BYVE 5I9PA 3APDA 2B2YA 5CHFA 1X9NA 1F77A 1UE6A 2XTIA 3RZOB 4P7IA 4JI0Q 3AE9B 1OQRA 2JRHA 3EUB2 4LNNA 4DHJD 2F0TA 2HHHL 1RHPA 2KMAA 4E3CA 3CC2A 2CJNA 2V4DA 5IODA 3WAOA 1EF5A 1PGBA 1GPXA 3TZDA 2MJEA 3HVZA 3M85A 4PS3A 1HFGA 4MM3B 1YNJC 3U2SC 1D7QA 3L4PA 2PW9A 2NUCA 4B9KA 2KVMA 4PZ6A 2E2JB 3GE8C 2LVOA 3NZUA 2Z8LA 4HIOA 3DEPA 4P16A 1D4BA 5IWAL 1JJ2A 1VQ4A 4JI8L 2Q2HA 4YSYB 3ERSX 4X3UA 4LF4L 5EJWA 2ZCCA 1LTBD 2XWBB 5M3FG 4CJ2C 2MHJA 3I73A 3CMMB 1O7LA 1CSQA 2I5HA 4A3FG 2LJIA 3QA8A 2BWFA 2K39A 1VQ9A 3BU2A 3ND9A 2K1BA 1Y14B 4JYAL 3HVDA 3ZNHB 2BW2A 2KECA 1V8CA 5EKIA 1U4RA 5A2QE 4BA1I 1L4ZB 2WX0A 4MACA 1KDCA 4EE2A 3NSWA 1U5KA 2K5HA 3K57A 2JA8B 3TS2A 3SGIA 2ON8A 5C2TB 3W1SC 1I3QB 1VQGA 1UWMA 2SNSA 1OXSC 2JZPA 2KN5A 3GOEA 1X3GA 2BA0A 2NN6G 4Y7NH 4JI3Q 3AN1A 1JOOA 1T6BX 2RHSB 4HMJA 5IT9c 3KDFA 4DUZL 2AL3A 2KYWA 5BN5A 1K3BC 3CCSA 1MG4A 1MHHE 2B2UC 1XJVA 3Q8FA 3I4NH 3U7DA 4EVOA 4UAIA 4YTMB 3BVGA 2CW0C 4RA8A 4GMVA 5E4WC 1YIJA 2N78A 3ULJA 1FFVA 5IGBA 3VR2A 3PO0A 1GUNA 4NAWA 1F2MA 2A68C 4A3BG 2MBBB 2ZT9C 1I4PA 1XTCD 1ZE3D 4LF7Q 4LDTB 4HJ5A 1GUAB 1I4XA 1C7YA 4NJCA 3J7A5 2R3ZA 3C2PA 1QVCA 2UXBL 3T1YQ 4P75A 3UINB 4L5SA 1E7PB 3TP7A 1VQ6A 1C0AA 3LDZE 3NBIA 5ELDA 4PG3A 3PO3G 4XE0A 1STAA 4RNAA 3A74A 1CTMA 2DZKA 2VH1A 3HOXG 4XC2A 2BS2B 2NN6I 4YY3Q 4C00A 4X64Q 5ISRA 4FJYA 3P1HA 3HOUB 2FCMA 3K7AH 1RJTA 2B3AA 1N60A 5C44G 3DVGY 4IPGA 2KC2A 4DWFA 5C3EH 3H09A 2EIFA 3EVQA 3HRDD 2KFJA 4KGTA 2NZOA 1FRDA 3MC0B 2FMCA 2EYLA 3JSVB 1IXRA 4IWOA 1OGWA 4CKBA 4OX9L 5I2XA 2VUMH 2WKDA 1T0QC 3IT4B 3NG0A 1SEBD 2KMMA 1TWCH 2M56B 4KV2A 3IRBA 2NCNA 3N32A 4KX6B 1KNAA 3Q3JA 4XT3B 1WRIA 4N58A 1SNOA 5HY6A 2A73B 1WXMA 2O4XA 3C1EA 1GC6A 4JLCA 2RPVA 2K5DA 2P5ZX 5JZEB 4MN3A 4X62Q 2D5DA 2BB5A 2EYMA 3T9LA 3EECA 1X1MA 1SSNA 4BBRG 4KGSA 4PS8A 4EOYA 1L0WA 1JWAD 1R4MB 4DR6Q 2JA7H 2MUYA 3KF6B 2L9HA 2E2IB 1QZEA 4HCEA 4PV1C 4NAMA 4H02A 2M17A 3KUCB 3DLLA 2VQFQ 1Y1WG 4LNIA 1J0GA 1A70A 1V1PB 3R93A 2CFMA 4HSVA 2MFIA 5FR6A 2WS3B 3S2DH 1RL2A 3OAWA 3SDLC 2IHEA 3LWUA 2KO3A 4WQMA 4AOFA 5IP4D 4AQYL 1M4VA 2H5XA 5G5GA 1Q46A 5KEEA 3HS0C 5J1ZA 1PYBA 2JJQA 2V3SA 2GLSA 4ZRKA 4DBGA 1HUNA 4RFBA 3HOUG 1PGAA 1BBWA 4K3BA 4C3JB 1I4QA 1Z47A 4DR5L 4JBJA 4L5RC 1FXTB 3T3NA 2EELA 2BTEA 3L17A 3BDLA 4LF8L 4F87A 1I94L 3EHVA 3KUZA 3R66C 2KDIA 1QOBA 4RH6A 2KLGA 4H7BA 1LT3D 3PZ8A 1YIWA 4F8CB 2A4ZA 1JT8A 2GBKA 2KLCA 1SYEA 1KAAA 1D5MC 3UIPB 4TQ1A 4GGQA 2R7FA 2JZ3B 1QWYA 2M9VA 1VS0A 1P3QU 2K6AA 2K8BA 2PMVA 3N9YC 1YNND 2R6GA 3RULA 4L6TB 3W1GA 4BBSH 3BYYB 1RYJA 3RZWC 1TIID 4MTNA 3J80i 4A55A 1VR9A 3M4YA 1WZ0A 5IOCA 2KAJA 3NWTA 2BT6A 3TBIB 1C4AA 3MA2B 3T51B 2MH7A 1KDAA 2MCNB 2QMTA 2AHOB 1YMHE 2WXGA 2BH8A 2IY1B 2KWUB 1WCMB 1PQSA 2UXDL 3SR1A 1Y56A 4R9WA 4RGMA 3VYUA 1STGA 1SNMA 4QJFA 1MBYA 4C3JG 4B3TL 3GTOH 2LZ6A 4GN3B 4M01A 1Z7TA 3VQIA 1GHKA 4WRDA 4GOPB 2KC1A 1FCCC 1WR1A 2LRWA 1Z9FA 5KHOA 2MEKA 2AQ3B 2WDRB 4DV1Q 2WP8J 5EBDA 2DNFA 2IDYA 3AE4B 3W5UB 3SFDB 4HKZE 4FYDA 3S15B 1K8GA 5C3JB 3L9AX 5CBEE 1MGSA 3RNAC 4JIOU 4XGAB 4GKKQ 1Q7YC 3M95A 1JC7A 3H3VI 4KI0A 1V81A 1B1ZA 3NHEB 4A9AA 3RZDH 1HPCA 1D5XC 1PH5A 2EVBA 1XNQL 3TSSA 4HJ8A 2OOBB 3DBRI 2Z1CA 2IYDB 4AJWA 2ASQA 2E75C 1NBWA 3DVNU 1JQ4A 3ONAB 3ZTCA 2XEWA 1HTLD 5FJ8H 1LTGD 3MP9A 5C44H 1YJ9A 1HZ6A 3Q8AA 1SFOB 2C9WB 2PPHA 1TQOA 2V1YA 4MGZE 1PZKD 2VRRB 1WOCA 3E5SA 4DR3L 1WE7A 5IKCM 1VQJA 4JI5Q 4HCNB 1EU4A 2R7ZG 4KKTA 2GBNA 5J18A 4QQBX 2E2HB 3VR6A 1QNUA 1VQ8A 3P7JA 4JGHB 5D3DA 2CCZA 5E7NA 4K7WA 3SEBA 4QB4A 1L5PA 2Y5CA 5DAUA 3G6EA 5IYDG 3I55A 1BBUA 4CKCA 1NVID 1PXUA 4W9EA 3HOVB 1W6JA 2OQ0A 5FO8B 3HRZC 4A3BH 4MSQB 3I4MH 5LMNQ 4OIKA 4MT5A 3MJWA 4A3IG 2ZZPB 2LMCA 4DAVA 2HT1A 4ZKCB 1WRDB 2B2WC 1QZHA 2WB1E 2Y0SE 4FLHA 2I1JA 1IPGA 2UUAQ 2H88B 3N30A 4KSKC 1BUIC 3PCOB 4RGNA 5E1FA 2PI2E 2EYHA 3LGJA 2H1EA 3S14H 1IYVA 2KVZA 3RCZA 1RWSA 4N8FA 2YEPB 2ZPYA 3KVFB 4HK2A 4DNIA 2LY7A 3NBHB 3ZNID 3W2DA 3EIVA 2RDGA 1CZPA 2WU2B 1XXGA 3OHXC 4DAYA 4GNXA 2O6VD 1RM6C 5C4JH 2IY5B 3SK8A 4N8X1 5GQOA 2B2UA 1CQFA 1XMQL 1NYRA 3I9V1 4IZ8A 4JV5L 3HHMA 1PRTC 1KXLA 4TMAB 1EYGA 1TT2A 3RNCC 2WAQG 2JYTA 4BFRA 4WFN3 5J22A 4R4OA 3RUZA 1HUMA 4YSZB 5G2NA 4FF2A 5AFWA 2DJGC 2KQ3A 1SE4A 1C4CA 4ARCA 1NCVA 3GTMB 4WJOA 2OXPA 1BCPF 1JICA 3HKSA 1S72A 3RNFC 3VAWA 5HGQA 4TKOB 2GBJA 4XIGS 2A5HA 5E6PA 5IGEA 2L0TA 1RD9D 3D4WA 3HOYH 2YVCA 3FILA 2INNE 1UGJA 1YHBA 2F3WA 3PHXB 2ZXRA 5GXGB 2KEEA 2JXTA 3I57A 2OTLA 1JWMD 1J7CA 1SYFA 1OTRB 3IL8A 2MJ3A 4UY8C 2J42A 1UE7A 1NY4A 3CXCA 1H9JA 5COYA 4KIKB 3R7QA 2BPSA 4FJVB 2FINB 2NBFA 1UF0A 4ZRPA 1NMGA 1WXVA 1XPUA 1A5RA 4A3LG 4PZ7A 4OZCA 3SFEB 3HOYB 1SNDA 1O78A 5HI1A 4R4CA 1SE9A 4OO1G 4WAFA 1E0ZA 1F2RC 2WAQB 1FNVA 4M8NA 1E22A 3PF4A 2IJ0A 1E7UA 1IBMQ 2IO2B 3I3TB 3LX0A 4KY7A 1YN3A 1TXYA 3NTKA 4CDFC 2N55A 3AE5B 5AJ3L 1S5FD 2KCNA 3CCVA 4DV5L 2WXFA 2AMCB 2PEAA 4GZYC 1ILQA 4GLSC 2KOXA 4A3MH 1KD1C 1K8RB 2INPE 3T13A 3AQQA 3FC4A 1B4OA 1WXAA 3CQZH 2ZTEA 3DWPA 2EQSA 4HDOA 4WURA 4JI8Q 3VUYA 4DUYL 2NTTA 2FCNA 5HG2A 5DM73 2X69A 3UE0A 3S14B 1RIPA 3A9JA 1J5EQ 1TIFA 1WTRA 1HR0W 4BAXA 1JB7A 2OJRA 3Q8CA 5BMHA 3VRBB 2I0QA 2F4VL 1TGZB 3W1SA 4DU9A 4WQOB 1DCZA 4JK1C 2UUAL 1L7YA 3PUZA 3IFWB 4ANWA 2RCFA 3K58A 1RFKA 3MEHA 1L2FA 5J3BA 1WM3A 3VR9B 2ZCBA 1T9HA 4Y52H 1FFUA 3HOVH 4HEDA 1LQBA 5IP9G 1FO4A 3RD4A 3FDTA 3NUCA 1AZQA 4MM3A 2BDNA 1E0BA 5LMNL 4C2MB 4W9KA 4YWGG 1AZPA 2KT7A 1ZXHA 5ELFA 1K8MA 2NR2A 3MXGA 3ETRA 5C1ZA 1V86A 4GIVA 1ZDXA 1X3PA 1Q8KA 1JW9D 3CWIA 3EFCA 1A8VA 1SROA 5EKKA 1N33L 2C7HA 2N9KA 4HDQA 5E6OA 4B0EA 3L13A 1STBA 2VZKD 2IY0B 2Y5BB 1UWXA 4N9TA 3ERQA 4JI5L 4A3KH 3VDZA 4QIWB 2X6GA 4B3ML 3GTLB 3NZ3A 1DOXA 4C7ZA 2CJOA 4IM0A 4C3HG 3TEWA 2DYOA 3A8IE 4HCPB 2G4SA 1IYFA 3PGZA 3K5LA 4DFAA 2XBBC 2NVYB 3GE3C 2K25A 1EYCA 1R7SA 3ZJTA 1SJED 2RKSA 4G0NB 2GBRA 2A6HC 2VZAA 3CKIB 2J53A 3H0GB 5IYDH 1U4LA 2E8GA 1CQVA 1KABA 1JB3A 2K8HA 2Z0EB 1N62A 4FJZA 2F0IA 5M5WB 1LXDA 3KLWA 4GDKA 2UU9L 3NVVA 3MXUA 4GU2A 3QIJA 1PRTF 3L0OA 1C48A 1T3QA 4UHVA 3N6RA 1BO0A 2PZUA 5EPJA 2GOWA 3SXHA 3ZIMA 3O65B 3I56A 3HOWG 4JI2L 2VB3X 4N59A 2KANA 2OTJA 1LV9A 4IUVA 3RMHA 5D94A 1WCMH 4ZHOA 4DR2Q 1G2TA 3BG3A 3ER0A 5KYIA 3J81j 2VB2X 1I7HA 1K50A 5GAHC 1WJ6A 2WXNA 2UU7A 3ZDTA 3S1NB 3CHBD 4NQKE 4TQ0A 3OSOA 5G5HA 1I35A 2Q2UA 4G7HC 3G7LA 3RNEC 3SDZA 3MXNA 1HNXQ 3E3XA 4JYAQ 2EKEC 2EYOA 2K01A 5FR3A 5LL6X 2XSCA 4K2LA 4EZJA 3L0WB 2VXWA 4IFDI 1ZKHA 2MGSA 2WXLA 1NSNS 4IUTA 4YCVA 4CDCC 2LVPA 4IOIE 1B70B 4CBVA 4OIJA 1XF5L 1N9WA 3DDCB 3FKYA 2R2QA 2RDFA 4QIWE 3VR4A 3FEWX 3EJIA 2KJ6A 1QILA 2V3NA 3HZXA 1FGBD 4RWSC 1Q81C 1QE6A 2FUHB 2RGFA 2JX5A 5BYRA 1VQ7A 4XQNA 2WXIA 1TS5A 4C3JH 3A0JA 1D5ZC 4LNOA 1Y1VG 1IKLA 2JSOA 4B08A 5CV5A 1MKHA 2PLPA 3KWLA 3J7AF 3K9OB 4DK6C 3A1QB 4OVUA 5HKHA 2BA1A 1HCZA 1JRUA 2WP9B 4ITKA 4UP8A 4US8A 1QT9A 2QSDA 1GUOA 1TT5B 2INCC 4IUNA 3EA6A 5JJKA 3KWVA 3M9BA 1MJEA 2FIFA 4NXNL 2M8SA 3CD6A 2X38A 4RGOS 4HKQA 3K0YA 2E2IH 1IYJB 2E6XA 5EGTA 4KY6A 3ULLA 4A3DB 1B9MA 5EE0A 1SNCA 3J7YW 1SNQA 2EY2A 4KTAA 1X3FA 1S5CD 2A6HD 4JC0A 2KUMA 2ATWA 2BYFA 1BCPC 2PW5A 4GS3A 4MJSB 3AULA 3VYRA 2Z4HA 4QF4A 1KOTA 3A33B 3B9JA 5EKLA 1B3QA 1IYUA 1T0SC 3APCA 3NK9A 2K1FA 3H6NA 5DCNA 2O2VB 5C3EB 2WDVB 4PMBA 2PE9A 4AIMA 4BY7G 2RQXA 1P0RA 3PRPB 4FULA 4RHSA 4YTNB 3CPWA 2V4IB 4NW2A 4A3GH 2MRPA 1W6KA 3AEFB 2LSSA 4NXMQ 1CJEA 1ESFA 4O2DA 2ZNVC 2AUKA 2WDQB 2DNCA 3I4OA 2NBVB 1TKGA 2UYZB 1WGDA 4A4IA 3UI3A 2ONQA 3EBEA 2GA4B 3R8BA 2BYEA 1N34Q 3EFUA 1VQOA 2QC8A 3U9SA 3ML8A 3S1NH 2CH4W 2HIXA 5FLXE 3T1HL 4YHHQ 3ZQ4A 4GOPA 3DMUA 2UXDQ 4PQXA 1SGHA 4DR6L 1WX7A 2LGDA 4DV3L 4CDEC 2SNMA 2AEHA 3L08A 1OQYA 3AU4A 5C0XJ 1XLNA 1TWGH 1NMFA 1YBYA 4IO9A 4Q2JA 2LWPA 3AMUA 2ACZB 2BOSA 3PMFA 2W82A 2PQEA 1RODA 1CKOA 5KNCA 2LHEA 1XLQA 5D3IB 3ONSA 4P6VF 4DHJB 2F4VQ 2EYPA 2Z4IA 5JEAH 3ZNGC 2PNRC 2ICEC 1M94A 5D2MB 3M4PA 4XYOA 2B39A 2SOBA 1IBLQ 2NVXH 4PNYA 3HM6X 5BN3A 3GDEA 2NVYH 3U4EG 1H9RA 3JAME 1HRJA 3CCJA 5CV7A 1SYDA 4ZKBB 4WJPA 4A3GG 1QCBD 3GTLH 1GM5A 1N33Q 4DR7L 1QJOA 3H91A 2QGQA 1SIJA 2FCQA 1S5BD 4GB9A 2JPHA 2E5LQ 2SDFA 4XYQA 1Q3LA 2L4NA 2RD0A 2KHIA 4C3IG 5EQ0A 5JHBA 1LTSD 4BKSD 1PLFA 2Y0SB 2RMMA 2JQOA 1JQYD 2RR9A 1WYDA 1BCPB 3ZTDA 1I4GA 2Z9HA 3JAML 2NPTA 4IC7B 5DPWA 2LGSA 4RKBA 3V61A 4KKSA 5K36G 3GTKB 4DV3Q 1PTOF 3WAPA 1JE5A 4KKIA 2CVRA 2NWGA 1FPYA 1XMOL 1VZ8A 2KZRA 1T5EA 1L0YB 1ZYRD 2QA4A 2MLBA 2KN4A 2SAKA 4M8MA 4YT0B 1O80A 2K04A 2JUOA 3T1HQ 2KHSA 1TVXA 5A35A 1F9RA 1UE5A 4RG1A 4X65L 4G4KA 1K8AC 4DV7Q 1C8CA 2N9EB 2PQAB 3PIP3 1Q1EA 4NZLB 5FOBB 5M3FH 2WXHA 5KHQA 2A69D 3A54A 4DUZQ 4FP5D 4A3IB 2EZVA 3W3AA 1KF6B 3BINA 4HMIA 1PH4A 3L16A 4IM2A 2ZTCA 1NI2A 1MI2A 2KJHB 4LDTD 5KIXA 2D11A 3K81C 4P1BC 1CKNB 3VA7A 3NQIA 1XMQQ 1G6PA 2IL8A 4S17A 2K4KA 1CZGA 2LKVA 4DK0A 4J6IA 2VQEQ 1FNWA 2MBEA 1TBEA 5E6NA 1TKYA 3AEBB 1KLUD 2IBIB 1M1KC 3J80c 1JMCA 3TUOA 2HUGA 2QIEB 3H3VH 4LF5Q 2Y3AA 2CKZB 3BWUD 2LXCA 1NTGA 1GUGA 3ZLZA 4DXGA 3OIQA 1UEAB 1JORA 1EYDA 3EN2A 2VH2A 2R2OA 1YN5A 2OT2A 1GB4A 2UXCL 1ET9A 2GB1A 2XK5A 4EEWA 2B2VA 1HZ5A 5CHVC 2R92H 5JPNC 3NENA 2N49A 4IJHA 1QOGA 1V49A 1WJUA 2BB6A 1TU2B 2BE5D 3AU5A 1LABA 4WH4A 3OOCA 1ML0D 4DAPA 4LJZC 1EUVB 1IW7C 2CHZA 4KLKA 2JZZA 3BS1A 4XDXA 2OHFA 3DBHI 1RF2D 4FHKA 3IG3A 4M1UB 4JI0L 1EY7A 1ONLA 4UPAA 1MJDA 1F2YA 3A55A 4NJ7A 3UI2A 2RBMA 5M3MG 1KTKA 4NJ6A 1YNNC 4NXNQ 4DR4L 1A62A 3E6ZX 3R2TA 2VUMG 4FN2A 4PS7A 2WFWA 1EY6A 2WINB 3RUIB 1IGCA 4ME5A 2GI9A 1PA6A 3DBLI 4NAWB 3JW0X 1BKBA 3AEVA 2REXA 2ZW0A 4GDLA 2HD5B 1CM9A 2LI5A 3UDFA 1U4MA 4BY7H 5J39A 4PMWA 5JVH3 2R7ZB 1RLFA 1VD2A 2AYOB 1E8ZA 2WXMA 4EFOA 1K51A 3D4RA 2NVQB 2D3GA 2ZJDA 2JU6X 3CIRB 1HXYD 3GTPH 3QK0A 2CQAA 3D31A 1HZBA 3TREA 3C0RB 4LLGM 4B0MA 5C4JB 1C3TA 1E2WA 1RTOA 2QEJC 4GLXA 1FXAA 4YWKA 4TRDA 4YCUA 1V2YA 1PMRA 1SBBB 1GAQB 2F0QA 2HIVA 2K33A 4ULLA 4C3HH 1WTPA 4DKAC 4B3RQ 2M2LA 1JWSD 4II3B 2C7NB 1WGHA 3C1FA 3AI5A 3SK6A 4DR4Q 1EY5A 4ACFA 1H9SA 1DYQA 1QUQA 2KHWB 4J15A 2N88A 5LMUQ 3VYSA 1F2ZA 4A3IH 4OWWB 4EX5A 1EOTA 4XXEA 3AEDB 1KC8C 1I5FA 3NXWA 2KEDA 4JWUC 2I38A 2N8NA 2J0MA 3FP9A 2LFNA 3O13A 3K8AA 5I9OA 3I4MB 4LK0M 4GN5A 5CV9A 3V05A 1WXQA 1ET6A 1LO5D 4ODGA 4LF6L 3HOXB 1VZ7A 1TTNA 2CHXA 4JI7L 3QAQA 2UU9Q 3SD5A 4K8IA 5C4HA 1KLGD 4KD4A 1B50A 3CC4A 1PFMA 1JE4A 3KF6A 4DF7A 1FJGQ 3GTKH 2D2QA 4BBNF 4NNJB 1MSHA 4R4IA 2F0GA 4YSXB 2NZHA 1N36L 2O2LD 4DV0Q 5BR8Q 4B3RL 2JF5A 2GBMA 3CCEA 3CSFA 4GDLB 3VTVA 1XPRA 2L76A 2EKIA 1OQQA 1BT0A 2MA9B 1FL0A 2CQOA 3PV0A 5JJZA 3LXFA 3FKIB 4LF9Q 5IN7A 2BDOA 3OIPA 3M7GA 2KHJA 4QCLA 1BOSA 3PQIA 1PH8A 1T5XD 4OWXB 2AKWB 3DOWA 4HXDA 2FFKB 4TSSA 1FYCA 4YIJA 3H94A 2R7DA 4ZLTF 3U58A 4HRSA 1J7BA 4JW0A 3GTGH 4DAMA 1A15A 1JWUD 5D7GA 3RZDB 4BY1G 3HGBA 3QB3A 1HHVA 3EQLC 5JJLA 1QOFA 1MFWA 2CWPA 1LACA 1WF9A 2CKHB 1WSPA 1SR3A 1WTQA 1DOKA 2KQ7A 3P4SB 1V97A 2EXZA 3OJ4B 3S15H 3LB8C 4LTUA 1LTLA 1TJEA 2R92G 5G55A 3W9CB 1B3AA 4F8MA 1TWGB 1K83H 1YI2A 3UGBB 1V9JA 2MSED 4FF3A 1SXTA 2JP1A 1PH2A 5C4XG 3DHIC 2EY1A 2JN4A 4OL7A 2D10A 3VTUA 5EPLA 2EDGA 3BDCA 3U4VA 3KJOA 4A3EB 1ZXTA 4LNKA 3CMAA 2N0SB 1MSGA 3I7FA 2CU1A 3RYTA 2DY8A 2DZIA 4OEMB 1KRHA 3AECB 1D1KA 3TQYA 3TEHB 4IOCA 1TY2A 3VYTA 4OX9Q 3S17H 4DGZA 1E7ZA 2OJWA 3S16H 1WI5A 4YHHL 4A76A 1Y69U 2JA6H 2K6QA 2V0GA 1ICWA 3T4AC 1PHJA 4HROA 1KNEA 2EXDA 3SHLA 1WMHA 4IPDA 2BVCA 5GADC 2KCMA 1HNWQ 1VMPA 3EFXD 1P16A 5AEKB 2F0DA 1V5TA 1Q90A 1K8OA 2NZ1D 4X3SA 2NBWB 1ENFA 4XT1B 4YY3L 2JYOA 3ENEA 1E9MA 4ALPA 4BZAA 4IDIA 1R9TB 1AW7A 3DHGC 3UIOB 5L83A 2NB0A 4JG2A 4JBKA 4OELB 4W9CA 4JQWC 2CU3A 4TV3A 3AM9A 2DAFA 3PZ7A 1CKMA 2K9XA 2JEBI 4XDCA 2HCIA 2E74C 2R93B 2DWQA 4DHZE 3VXWA 3Q2AC 1YX6B 4M0WB 5CBAE 1Z2MA 2Z0DB 1WD1A 1HTQA 2WACA 3TCAA 3Q23A 1P8LA 2WB1G 1WGYA 3QOJA 1GOZA 3KUPA 1SDFA 1B8AA 4LK1C 2YLMA 3ND8A 3CCRA 2UXBQ 2Q5WD 4F1SA 1HEZE 1MPEA 4A3DH 2AQ1B 1XO3A 1ZXIA 5BMIA 3OYYA 3AB9A 1PH3A 3KOJA 3G4SA 1DONA 4HVBA 2K52A 2F03A 3V96A 2MQJA 3WOFA 5D6JB 5FLMH 5E3FA 2LXAA 4EGVA 2VS1A 1JWBD 5HFYA 2ZM6L 3M7NA 3ZW3A 1BVSA 1HQRD 5GAGC 1SIFA 4EUTA 3TBLD 4L63B 1PVOA 3W1YA 4FADA 1QF6A 1IGDA 2W3SA 1SRUA 2LMCB 4DK1A 1U4AA 1J7AA 3IBEA 1E3PA 3OTOL 1KL9A 4ID6A 1WFYA 2KFKB 1F9JA 5NUCA 3I4MG 3NQTA 2PVOD 4ZRJA 1EL0A 2IT1A 5CORA 2K5QA 4HPMB 4H13C 1Q82C 2XIWA 3KQ4A 4X64L 4LFCQ 3I2ZA 3KLSX 3CMEA 3IXSA 1R9TH 1N5XA 3P2BA 3K7AB 1C79A 4NPNA 2L5TA 3MTSA 1C78A 3PV1A 1N63A 1YQ3B 3PS6A 1C4PA 1NDDA 4MH8A 3PHWB 3D6CA 1SE3A 4GNXC 3E0EA 4N6EB 2M00A 1ROEA 1I6HB 1NYQA 3DVNV 2UWQA 1OEYJ 3VH4B 1P7FA 3Q14C 4LW1A 3FVQA 5EE9A 3WOEA 1LYLA 1TR5A 4DNTB 2JA6B 1WWTA 1LUZA 1CI3M 3D0FA 3B1LX 3QHTA 3U8ZA 3S17B 4GKKL 3IAM1 1BBXC 5IA7A 4LF6Q 2LGIA 3BZCA 2CHWA 5BR8L 4KGRA 3Q24A 3QJZA 1V9PA 4RKLA 3S9WA 3MAQA 3WWVA 4A3EH 3Q3NC 3R3OA 1X55A 2ES2A 2FMMA 4C7YA 4OVVA 1E8YA 1A3VA 2PE6B 1WR6E 3VR8B 1H9MA 4FVMA 3Q22A 2WDTB 4JPBW 2W9NA 2F0MA 4P72A 5ELCA 3RMKC 4WJWA 1PFBA 3NOBA 3MHSD 3GP7A 4HIKA 2OEDA 3FMCA 2K28A 1FM0D 1D2BA 4RF1A 5HHDG 1FCLA 3J81c 4L23A 5K36H 1F9PA 3AU7A 1L2NA 5C3EG 3RLNA 1KDBA 4A6QA 1ENAA 2NBUA 3CF6E 1YJJA 5EAYA 4JOIA 3ABVB 3GTGB 1YJIA 2A6ED 3PLVA 4AJYB 1Q12A 3WANA 3BY4B 4LF9L 2MBHA 1FXIA 2XNAC 2XRSD 2NYZD 1LM8B 3APFA 3IHPC 4A8XC 3VUXA 5DLQE 2EJMA 1AYFA 1HZ9A 1X3QA 2F0LA 2KDEB 1EIYB 1YN4A 3NS8A 4KDIC 3V6CB 5LLIA 2JE6I 1KHIA 4X3TA 2NVTH 3SHQA 1STYA 3MFYA 4JVZA 1WM2A 2N7JA 1K53A 3MZ5A 4DV2L 4DV1L 2HHHQ 3WDNA 1LT4D 1EQTA 5C0XH 3P4QB 1Z6HA 2I2YA 3UQBA 4L5QA 1EWCA 4BXXH 1EIHA 4MSMB 5JEAG 1EWIA 2WXQA 1EWYC 4OO1H 2D9UA 3EC8A 2F52A 5IP7H 5DPRA 2ALYB 3ITPA 1FD7D 1A6XA 2QDBA 1PH9A 3KDFB 2IO1B 4K5XA 2KQSA 3BVZA 1G51A 2MPMA 1UAPA 3HOVG 2AWOA 2D2CC 3CCUA 2C60A 4JX1C 1G2SA 1EIGA 2JA5B 3FPPA 1VCIA 4WWOA 1KAWA 2Z6KC 2MNAA 1XYIA 3QO2A 2K14A 2EMSA 2F0UA 1IHZA 4KKUA 3ML9A 5T1GA 4J3OD 4B9WA 2J52A 5IAAC 1IW7D 1K3RA 4XYCA 5FJ8G 3TEYA 3F2CA 2CR5A 5IOIA 2LGYA 1GC7A 4BVUC 2NVUI 4C3HB 3CQZB 4H44C 3NVZA 2IX1A 3DVGX 3QG1A 2KVRA 3SR6A 1IBXA 1NR4A 4DUYQ 3STBD 2NS5A 3OW7A 3A4RA 1BCPD 1NUCA 4B3SL 1XNRQ 1YQ4B 3VUWA 4BOZB 1SB3C 2NTSA 3GTPB 1WY8A 4GXBA 2NVQH 4WJ3M 1FEHA 2AWTA 4DR7Q 2EPBA 4W9HA 1WCMG 4S0RA 2XK5B 1UBIA 1HTPA 5AZFA 3DBSA 4ANUA 1VQFA 3NEMA 3JSVA 2PMZB 2IX3A 1PH6A 1JCKB 1NEKB 3SK5A 5AJ3Q 2PZWA 2N7EA 3AE2B 1PUTA 2KJRA 3J81L 2A8VA 1EZ8A 1C77A 4IUUA 2KKCA 2KTRB 5M5XB 1N32L 3WCQA 1PTOH 4RGTA 4AWJA 1AE2A 4HN7A 3AE3B 4R8IA 1N61A 4X3KA 3B6YA 4DDID 4GOCA 3Q3FA 1AEXA 2K5VA 3PO2G 3KF8A 2VY3A 1VJKA 4C3IH 1GVPA 4IW0A 1JR0D 3F2UA 3S1QB 4A3LH 2WXPA 3PO3H 3PGEA 2EJGC 2K7VA 2RVLA 3AH7A 2DGYA 3SK4A 1VQLA 2Z0SA 4Q5VA 2G3QB 3CP0A 2WHIA 3BYTB 1PRTD 1YITA 1PFNA 1MD2D 4K1RB 1V1PA 1WTHA 3ZJVA 1NR2A 4RCNA 2DX5B 4ANXA 2K75A 1K52A 3N1XC 1ZOYB 4JWSC 4DR1Q 3GTMH 1SN8A 5ELEA 3C3LA 2RSOA 1VDVA 2O6VB 1FR3A 2MQHA 3H0GG 3I5JC 2B2VC 2K5NA 3BIID 3IAS1 1ZKOA 3PZDA 2Q8IB 1ACCA 5H92C 1AWDA 2BKFA 1U9RA 3OMGA 1TS4A 5EE1A 4F88A 4WAAA 1F9QA 1DZ1A 1YX5B 5JHAA 1WYWB 4EQOA 1ASZA 1B2TA 1NENB 4PMCA 2KA7A 4J1MA 3VDYA 1CHQD 1R4MI 1H9SB 1QUQB 3I91A 2QEXA 3E9IA 4XX5A 4KK7A 1PFSA 5IGCA 1EFWA 4UP7A 1JROA 3MFGA 2YU9H 5JPMC 1EO6A 1UD7A 2CS4A 3QJYA 4U673 2LEKA 4KN7C 2A1AA 3CW2C 2KTRA 1MIUA 1WJNA 3MEFA 2KX3A 4FNFA 2EMTA 1K0RA 1X32A 4JI1L 3KYHC 4DV7L 3RNUA 3X23A 5L95C 2G9HD 4HPLB 4K5VA 5FLXL 3H15A 3PSIA 5AZGA 1G6JA 2CH4A 4LNFA 4O0AA 3PVLA 2ZXPA 5CV4A 3NS1A 1YNJD 4A3BB 2JSVX 4X62L 4FXCA 4OW0A 1N34L 2AL6A 1K28A 2KWCA 1I50H 1GUSA 2MP2B 5IGGA 1UBQA 5ELBA 4O1NA 5KYLA 1OXTA 4R3DA 4ZYSA 2HDLA 1BQQT 1Q8IA 2F0NA 4P1CC 1TWFB 5JAVA 4FXGC 4G11A 3PUYA 3RI7C 2PVGC 4NKLA 4KHPQ 2DJFC 4KV6A 1U0LA 3PRMB 1WIAA 5C0XG 2FHTA 1OFFA 1QKZA 5C44B 5JXVA 3NWSA 1C4QA 2L1AA 5C4XH 2L15A 3A56A 4P2CB 5CC4A 3MC8A 3KLSA 1CZWA 2CWAA 3GV6A 2JXMB 3N52A 3LNNA 1YVCA 3A5UA 4OVZA 1ZPSA 1Y8PB 3V3XA 3L54A 1WTOA 3M3YH 2NVXB 5EE3A 2DAJA 2KCTA 4QAYA 4LF7L 5FO9B 1V43A 3RLFA 3D4DA 1DJRD 2VL6A 5M3MB 4HJGE 4A90A 4EQPA 4A3JG 3HOZG 5BMGA 1JOQA 1DGJA 1DM0B 5EPKA 2PO4A 2V4LA 3CCQA 1JJCB 4RM9A 4IN3A 5CYUA 3AEGB 2A5UA 2PYKA 3PO2H 2IO3B 2IGDA 1IUEA 1FJGL 3C19A 2MP2A 3U30A 1EU3A 4PT5A 1SAPA 1N32Q 4NB3A 1NE3A 4POFA 1E90A 3AEEB 4KN4C 5GMVA 2C7MB 4DQOC 4DV2Q 4FDBA 1WMHB 1IBKL 4OZBA 2WXOA 2GVAA 2JA9A 4OO1I 5C5LA 2LUMA 2DNEA 4MH0E 4V0BA 2IPKD 2QW7A 3DM3A 4HJ9A 2WXRA 4IFDH 1HFNA 4BBSB 1J6QA 4ME3A 3TP8A 1NJIC 1R4NB 4A3GB 4GOPC 3B2GA 4HR7B 4E6IA 3N3KB 2WNMA 1CMXB 3H7SA 4DAYB 1WX9A 2ID0A 3KFUA 2LJ5A 5CGKA 3DWQA 4B6WA 2F3IA 5J17A 4TVAB 1S1QB 2JWZA 2YTXA 1EQVA 4R8NA 4LJPB 4HIMA 2A74C 1VQMA 2ZTDA 3TEZA 3HOWH 2VQEL 1BUVT 2QHOA 3L10B 2INDC 3QOLA 4HCSA 4A3CH 3FRPB 4BOSC 1ZGUB 1TYGB 4DNRB 1C1YB 1B7YB 2J0KA 4BXXG 2ZJRA 1L0VB 2FXQA 1VQCA 1E10A 3S2DB 5DM63 5DPSA 1HZAA 1SMYC 2HCCA 4KSLC 1E24A 2EOTA 4I65A 2OF1A 3RNGC 1EEID 3DWAA 2JA5G 3L7ZC 3WIMA 2F0VA 2JA7B 3NTHA 3A4SC 2KK8A 2ICIA 1VMCA 2F0KA 1EY9A 1VLBA 1QNKA 3KLRA 3PLUA 2I46A 4DXFA 1VDZA 3QC8B 5H8YE 1TY0A 4A3DG 1EY0A 3PIOA 3N20C 2KOLA 4IFDG 1TWCB 5CHWA 3X3MA 3AE8B 2VUMB 2NMQA 1FNUA 2FJ2A 4KZCA 3JC66 5D65A 5IYCG 4NQLB 2F0JA 3FPUB 2L0FA 3PSEB 3S24A 2D0PA 3GQBA 1S5ED 2Q8TA 2QKIC 1S4ZA 2PNHA 4YWMA 1KFYB 2ZNVB 2K8CA 3D8GA 2K22A 4I7ZC 1CKNA 4OGQC 3NPPA 4ZAIA 1MJCA 3HKZE 5C6AA 4IPHA 1L6VA 3ZDMC 2HJ1A 2HJ8A 1J8CA 4CHTB 2K03A 4LAAA 3QARA 3F1ZA 2QDLA 4X57B 2B8FA 2X6LA 2LRUA 1NI3A 1Q10A 3MJ5A 4P71A 1G91A 3FKIG 2RDHA 3A5ZB 4G3XB 2N3SA 3Q6BA 3VA5A 4APVA 1VZ6A 1HE8A 2D3BA 2RA4A 3S2HH 3TN2A 4LCDE 2D07B 2WXKA 1WXSA 1XEEA 2L0CA 3KBGA 4B3TQ 2FBWB 4LWCA 4Z9CB 1AFPA 4IWPA 1CA6A 1SMYD 5D14A 2HD3A 1UH6A 1LM0A 2JRIB 2L8JA 4D2KA 2OQKA 3K5NA 4BY1B 2DBYA 4W9FA 3TDQA 2YEPF 1SE8A 2B2WA 4JE3B 1QZGA 4OWTB 4QUCA 2BH2A 3R2IA 3OPOA 2B2TA 3TZUA 1WJ4A 2KDFB 3ZJUA 1F1HA 2V3PA 1HR0Q 1ISNA 3GV3A 2JA8H 3S2HB 5M5WH 3MVVA 4PYUA 3CSTA 4AP4C 3AE1B 1D8LA 1PZID 4X6AH 2JQRB 2M1MA 2TSSA 3NBHA 3J9CA 4R4QA 3H0GH 5IP9H 1RFAA 3IKJA 4AYBB 3KBXA 2BF8B 3R7RA 2KNBA 4K3CA 4KZ0A 5E4XA 1WFQA 1P1AA 4RMAA 4MZ9A 2HE7A 1XPOA 2OCEA 4HAEA 5LXHA 4LFAL 3D32A 4A93G 4WJQA 4LFCL 2E2DC 4LFAQ 1WZ3A 1TZOA 4K5WA 3U50C 3M4OB 2KJXA 1DOMA 4GLVB 4KHPL 4IJLA 4A3KB 4FXDA 3ZXRA 3I4NG 2DHZA 4A75A 1BDOA 4JPSA 1Q1BA 2L00B 4MIUA 5IWAQ 2L7RA 5E6JA 2N9PC 1J19A 3FILB 1STHA 1N5WA 1H8CA 3DWMA 2L32A 2ZXOA 1AH9A 1TS2A 3I90A 4C2MH 4CQNA 2Y0SG 2L05A 1HA6A 3RZOH 1R4PB 2D5GA 5C3WA 3RN9C 4JI3L 5CMDA 1IL2A 1QLBB 3A7LA 1WX8A 3AV8A 5C4ZA 3N1ZC 1TKEA 2H89B 1GUTA 2F0FA 3B2FA 1PTOD 3F2DA 4ZDVA 4FA6A 3UDXA 2C5CA 4JOIC 1TKWB 5F2DA 3C8YA 3RZFA 1E2VA 1S5DD 4A3EG 1T0YA 1VQPA 1NBFC 1LFDA 3H6MA 1A0IA 1S3SG 3VHTC 1JOKA 2HTHA 3ZVVA 3NZSA 2F0EA 1KRSA 1R4QB 1XX8A 4I6LB 2ZVOA 3AMZA 4TQUS 3HOWB 3ZRCA 4W9LA 3OWEB 1ZEQX 5I2YA 4P74A 4XQJA 3KJPA 4JCVE 5GROA 2M0AA 4IUMB 4ZOHC 2JY6A 4A3MB 1O7YA 5BYQA 1GB1A 2L1BA 3DPDA 2VNUD 1WTVA 1Q5WB 1IP9A 2DENB 2F4IA 4H2AA 4ASWC 3W1BA 1E8WA 3UE1A 1OTCA 3CPFA 1PDXA 3H8HA 4EKUA 4LMQD 1PZJD 3VRAB 3PT2B 3QWZB 1QB5D 1HR0L 2QJLA 3E0JA 1NAPA 2B3GA 4R4TA 4FF1A 1Z5SB 1ZP0B 4M00A 1X56A 4I6NB 1MI0A 4RCOA 1Q1OA 4HJAA 1Y1VB
chains in the Genus database with same CATH topology
1VRAB 5KNDA 4XQQA 3U9OA 3W5VB 4KMUC 4QUFA 1HQMC 4S3SA 1GUWA 2FE8A 2E76C 1U4PA 5T1IA 3GS2A 3Q69A 4HSPA 2YYZA 1TS3A 1JRPA 1GXDC 1J8IA 5IT9E 2JYEA 4BS9A 4ZHPA 2F1MA 3J7AV 3MHZA 3A7AB 3T53B 2JEAI 4NP5A 3QWNA 3NHHA 1L4DB 1STNA 1DXMA 1D6EC 3A8JE 3GTJB 5DNFA 2RSNA 4US9A 5C4XB 2WLBA 4RHRA 3GB1A 2BYTA 5I6WA 2L83A 3NUHB 4FXKC 1XCQL 2L12A 2MJDA 3AB5A 4L1BA 3U7ZA 1XWEA 3HEJA 4C1NI 1SNPA 2A69C 1FIQA 4REZA 3K6OA 1I50B 3I8ZA 2MHVA 1I4HA 2G1EA 4IKGA 2ENBA 4BBRB 2XWJB 4IURA 2EY6A 5T8IA 3P1MA 2L55A 4ZUJA 1G291 3DXJC 5I6YA 4XTCS 5IIFA 1JALA 2Q8RE 3PUWA 3BK1A 1Y8NB 1XLOA 4C1NK 2WXJA 4KJNA 1J9OA 2KACA 1L0XB 4WWMA 1CA5A 3QIAA 3TEXA 3I4LA 3I70A 3URYA 3S1MB 4AS1A 1TWHB 3Q6SA 1WTXA 1D1IA 1PTOC 4G7OC 3MWYW 1M8AA 5KGUA 5K5PA 3D6WA 4A3JB 3HOZB 1QOHA 3G6JB 2N9LA 1I6VC 1WD0A 3PO3B 1BF4A 3GTOB 1WVLA 1QQRA 3SE0A 4C3IB 3PUXA 5G3LF 1DD2A 2B2YC 1ZDVA 2PPBC 1PTOB 2KWDA 3K5MA 4UDUC 2B8GA 2XVSA 4HTHA 3U52E 1LTRD 2AUJD 4WORA 4H0LC 4Q0FA 4CKEA 3T56B 1VF5C 1RTNA 1EY8A 4KKJA 5CV8A 3TP5A 3NVWA 1SYCA 2IX0A 2B76B 4ABNA 2LHDA 1Y1WB 2O5IC 2TMPA 1FMAD 2W54A 1O7ZA 2LS01 3P63A 2MJ8A 3EGRA 5FKAC 4B9XA 2WV6D 1GJXA 2FUG1 2QF7A 4KHZA 3NVYA 2A68D 1AP0A 2IGGA 2BS4B 3CRKC 4YTPB 2EYJA 1KH0A 1UNSA 3RFZB 3CRLC 1B53A 1G8ZD 2KQ4X 1OXUA 1B44D 4JBWA 2NVTB 3DHQA 1VF7A 3OMCA 3DWGC 2AWNA 1PRTB 3SVMA 2DYMA 4M8AA 3I3CA 1JMLA 2Y5PA 4FF4A 5IT9L 4BA2I 1RCVD 3NRZA 3RPFC 4ZRZA 5JEAJ 1PGXA 2F0PA 1ZUD2 3Q8EA 2KCCA 4HEA1 2AX5A 2WU5B 1OXXK 1LT5D 4K6DA 3VR5A 4CJ0B 4ILWA 2B63B 3I4NB 2W3RA 2AQ2B 2D62A 3TMEA 2QILA 3DUZA 4K6LA 2K5WA 1BXTA 4Y7NB 3P4RB 4RF0A 4V190 4KY5A 3CU7A 3V2TA 4A3FB 1C76A 1F2LA 4NDXA 3BVMA 3DEOA 4K8JA 4G7ZC 1H9KA 1WGKA 4F7XA 3NTIA 2L11A 3IFDA 4IQZA 1XLPA 3J80L 4O42A 3ZGZA 2EJFC 2K3UA 1HA5A 1DOYA 4ZQ3A 2F0HA 1LT6D 1RKNA 2HDMA 3LWEA 5C5MA 1II3A 1WTWA 2C9OA 4IALA 4CJ1B 4K14A 5MPOA 3HUIA 3MHBA 2GRIA 4MHEA 1YNTE 1EY4A 1V1OA 3P75A 2LFIA 4ZUIA 3P42A 2IWHA 3X3NA 5BN4A 1SF0A 3T16A 4K2KA 2CW0D 3ZYYX 4J6HA 4BWGB 4C56C 3HP3A 1V8QA 1IL8A 2W55A 2J0TD 3J80E 2HTME 3P20A 4NMZA 1OXVA 5HGTA 1F0ZA 2A6EC 1EYAA 1MVKA 2K0PA 2EYFA 4EQNA 4ARIA 2F0OA 2WQYB 4ZRQA 2IGHA 2EE1A 2J4XA 2K5PA 5LNK1 2EY5A 3Q0AA 2F3VA 5BYSA 4GDKB 3K5OA 4L8JA 1PYWD 1MHXA 1B9NA 5LL6S 4DN4M 3S16B 2MP1A 4OHJA 3I72A 3AE7B 3D3RA 2F0SA 1ESRA 1BNZA 1WYGA 2JWUA 5JVG3 2K05A 1CFMA 1AN8A 5EBCA 4OZAA 1A3UA 3PUVA 2R61A 3PO2B 2HQEA 4A93B 2K32A 1E6EB 1PFDA 1K83B 1F2RI 3P4PB 1LTID 4L2YA 1FRRA 2WB1B 2VZKB 1TWAB 1GHJA 1ILPA 2HDEA 4WIPA 3PIO3 3LYYA 5C0XI 5G3LD 3IAYA 3M3YB 1SJHD 1QOAA 4IUPA 5KRUA 1EWHA 2NN6H 3DM1A 1STEA 2DY7A 5CR3A 1Y8OB 3J81E 1UUPA 5A2QL 3VR3A 3E9SA 1EM7A 3KK7A 4G57A 1DOLA 2WIIB 1SYBA 1FD6A 5IGDA 1EZ6A 5IGFA 2O5JC 2PTLA 5FO7B 5CV6A 3K59A 3C46A 2B2TC 3AEAB 1QG7A 5TSSA 2KDMA 3BK2A 1CK1A 3GD7A 4AQ7A 4KD3A 5JOBA 4C80A 1OO9B 2L52A 3IFTA 2J7ZA 1BR9A 3HKZB 3GO5A 5C3XA 2YU9B 2SEBD 1PDQA 1RDPD 1IKMA 4YXDB 5M9OA 2F0WA 3T3OA 4J8QA 5LHY1 2I07B 3HG9A 1XCTL 4KJOA 2XN9C 1C9FA 4BY7B 1E2ZA 2DN8A 2WKCA 2PCFB 4M0WA 3BDOA 3FAHA 3Q8BA 5HURA 4DA2A 1A2UA 3MXPA 3S1RB 2PKOA 2BBCA 1ZYRC 1CT1D 3H3VC 1DOIA 4N9PA 2PIAA 4USAA 1SE2A 1BMLC 1EFID 2DLBA 5M5YB 4XWTA 1CHPD 3GTQB 3EROA 1L6UA 2OEOA 1B9RA 5FK9C 1LTAD 4CGYB 5AUIA 5DEHA 2R92B 3A8KE 2PW7A 3E56A 5KNBA 1A2TA 1SSOA 2M19A 4XDDA 2XRQD 1F9SA 5I4DA 2IW3A 2QCPX 3NP8A 2CHBD 4RAUC 1IBXB 2BCOA 4IFDJ 2PZTA 4IUQA 4FO2A 3AE6B 1LTTD 3NE5B 4ZK9B 3TP6A 5AUKA 2ZW1A 2E3TA 1G6ZA 4XWWA 3L3OC 3IT6B 3OWFA 2H4OA 4U68A 2BS3B 1EEFD 1I4RA 2G9DA 2BE5C 5M3FB 1ENCA 1P7EA 3BZDB 1A3TA 1LLRD 1SYGA 4KHVA 4QMGA 5I9PA 2B2YA 1F77A 3RZOB 3AE9B 1OQRA 3EUB2 2F0TA 1RHPA 2CJNA 2V4DA 5IODA 1PGBA 1GPXA 3TZDA 2MJEA 3HVZA 3M85A 3U2SC 1HFGA 4MM3B 1YNJC 3L4PA 2PW9A 2NUCA 2KVMA 2E2JB 2Z8LA 4P16A 3DEPA 1D4BA 4YSYB 4X3UA 5EJWA 1LTBD 2XWBB 4CJ2C 3I73A 1O7LA 2LJIA 3ND9A 2K1BA 3HVDA 2BW2A 2KECA 1V8CA 5EKIA 1U4RA 5A2QE 4BA1I 1L4ZB 4MACA 1KDCA 4EE2A 3NSWA 3K57A 5C2TB 2JA8B 2ON8A 1I3QB 1UWMA 2SNSA 1OXSC 2JZPA 2BA0A 2NN6G 3AN1A 1JOOA 1T6BX 4HMJA 5BN5A 1MHHE 2B2UC 3Q8FA 4EVOA 4UAIA 4YTMB 3BVGA 2CW0C 4RA8A 5E4WC 1FFVA 3PO0A 5IGBA 3VR2A 1GUNA 1F2MA 2A68C 2ZT9C 1I4PA 1XTCD 1ZE3D 1I4XA 4NJCA 2R3ZA 3C2PA 1E7PB 3TP7A 3NBIA 5ELDA 4XE0A 1STAA 4RNAA 1CTMA 2BS2B 2NN6I 5ISRA 3P1HA 3HOUB 1RJTA 1N60A 3H09A 3EVQA 3HRDD 4KGTA 1FRDA 3MC0B 2FMCA 2EYLA 4CKBA 5I2XA 2WKDA 3IT4B 1SEBD 2KMMA 2M56B 4KX6B 1KNAA 4XT3B 1WRIA 4N58A 1SNOA 2A73B 2O4XA 3C1EA 2RPVA 2K5DA 4MN3A 2D5DA 2BB5A 2EYMA 1SSNA 4KGSA 1JWAD 2MUYA 2L9HA 2E2IB 4HCEA 4PV1C 4NAMA 1A70A 1V1PB 3R93A 4HSVA 2WS3B 3LWUA 4WQMA 1M4VA 5G5GA 5KEEA 3HS0C 5J1ZA 1HUNA 4RFBA 1PGAA 4C3JB 1I4QA 1Z47A 2BTEA 3T3NA 2EELA 3BDLA 4F87A 1QOBA 4RH6A 4H7BA 1LT3D 3PZ8A 1SYEA 1KAAA 1D5MC 4TQ1A 2PMVA 1QWYA 2M9VA 2K6AA 3N9YC 1YNND 2R6GA 4L6TB 3BYYB 1RYJA 1TIID 4A55A 1VR9A 3M4YA 5IOCA 2KAJA 3NWTA 2BT6A 3TBIB 1C4AA 3MA2B 3T51B 2MH7A 1KDAA 2QMTA 1YMHE 2WXGA 1WCMB 3SR1A 1Y56A 4R9WA 3VYUA 4C3JG 1STGA 1SNMA 4RGMA 1MBYA 1Z7TA 3VQIA 1GHKA 4WRDA 1FCCC 2MEKA 2AQ3B 2WDRB 2WP8J 5EBDA 2IDYA 3AE4B 3W5UB 3SFDB 4HKZE 4FYDA 3S15B 5C3JB 3L9AX 5CBEE 1MGSA 1JC7A 4KI0A 1B1ZA 4A9AA 1HPCA 1D5XC 2EVBA 3TSSA 2Z1CA 2E75C 1JQ4A 3ONAB 1HTLD 1LTGD 3MP9A 3Q8AA 1HZ6A 1SFOB 1TQOA 1PZKD 3E5SA 1EU4A 4KKTA 2E2HB 3VR6A 1QNUA 3P7JA 5D3DA 3SEBA 4QB4A 1L5PA 2Y5CA 5DAUA 1NVID 4CKCA 1PXUA 3HOVB 1W6JA 5FO8B 3HRZC 4MT5A 4OIKA 2LMCA 4DAVA 4ZKCB 2B2WC 2H88B 1BUIC 4RGNA 5E1FA 1IYVA 2EYHA 2H1EA 1RWSA 2YEPB 2LY7A 3W2DA 1CZPA 2RDGA 2WU2B 1XXGA 3OHXC 4DAYA 1RM6C 3SK8A 2B2UA 1CQFA 1NYRA 3I9V1 4IZ8A 1PRTC 4TMAB 1TT2A 2JYTA 4WFN3 5J22A 3RUZA 1HUMA 4YSZB 4FF2A 5AFWA 2KQ3A 4ARCA 1SE4A 1C4CA 1NCVA 3GTMB 2OXPA 1BCPF 1JICA 4TKOB 4XIGS 2A5HA 5IGEA 1RD9D 3D4WA 3FILA 2INNE 1UGJA 2F3WA 5GXGB 2ZXRA 2KEEA 2JXTA 3I57A 1JWMD 1J7CA 1SYFA 3IL8A 2MJ3A 2J42A 1H9JA 5COYA 2FINB 2NBFA 4ZRPA 4OZCA 3SFEB 3HOYB 1SNDA 1O78A 5HI1A 4OO1G 4WAFA 1E0ZA 1F2RC 2WAQB 1FNVA 2IJ0A 3LX0A 4KY7A 1YN3A 3NTKA 2N55A 3AE5B 1S5FD 2KCNA 2WXFA 4GZYC 1ILQA 4GLSC 2INPE 3T13A 3FC4A 1B4OA 3DWPA 4WURA 2NTTA 5HG2A 5DM73 2X69A 3S14B 1WTRA 3Q8CA 5BMHA 3VRBB 3W1SA 4DU9A 1DCZA 4JK1C 3PUZA 3K58A 1RFKA 3MEHA 3VR9B 1FFUA 1FO4A 4HEDA 3RD4A 3FDTA 3NUCA 1AZQA 2BDNA 1E0BA 4C2MB 4YWGG 1AZPA 1ZXHA 5ELFA 1K8MA 3ETRA 3MXGA 1ZDXA 1X3PA 1JW9D 3CWIA 2N9KA 5EKKA 4B0EA 1STBA 2VZKD 1UWXA 4N9TA 3ERQA 4QIWB 2X6GA 3GTLB 3NZ3A 1DOXA 4C7ZA 2CJOA 4C3HG 3TEWA 2DYOA 3A8IE 3K5LA 4DFAA 2NVYB 1EYCA 1R7SA 3ZJTA 1SJED 2RKSA 2A6HC 3CKIB 2J53A 3H0GB 1U4LA 1CQVA 1KABA 1JB3A 1N62A 2F0IA 5M5WB 3NVVA 3MXUA 1PRTF 1C48A 1T3QA 3N6RA 1BO0A 2PZUA 5EPJA 3SXHA 2VB3X 4N59A 1LV9A 4IUVA 3RMHA 4ZHOA 1G2TA 3BG3A 5KYIA 2VB2X 1I7HA 1K50A 2WXNA 3S1NB 3CHBD 4TQ0A 3OSOA 5G5HA 4G7HC 3G7LA 3SDZA 3MXNA 2EYOA 2K01A 5FR3A 5LL6X 2XSCA 4K2LA 2VXWA 4IFDI 2WXLA 2MGSA 1NSNS 4IUTA 4IOIE 4CBVA 1XF5L 4OIJA 2RDFA 3VR4A 3FEWX 3EJIA 1QILA 2V3NA 3HZXA 1FGBD 4RWSC 5BYRA 1QE6A 2JX5A 4XQNA 2WXIA 1TS5A 1D5ZC 1IKLA 2JSOA 4B08A 5CV5A 2PLPA 3KWLA 3J7AF 2BA1A 1HCZA 2WP9B 4ITKA 4US8A 1QT9A 2QSDA 1GUOA 4IUNA 3EA6A 3KWVA 2X38A 4RGOS 4HKQA 3K0YA 2E6XA 5EGTA 4KY6A 4A3DB 5EE0A 1B9MA 1SNCA 3J7YW 1SNQA 2EY2A 4KTAA 1S5CD 2A6HD 2KUMA 1BCPC 2PW5A 3VYRA 2Z4HA 4QF4A 3B9JA 5EKLA 1IYUA 3NK9A 5C3EB 2WDVB 4PMBA 2RQXA 4RHSA 4YTNB 2V4IB 4NW2A 1W6KA 3AEFB 1CJEA 1ESFA 2AUKA 2WDQB 2DNCA 1TKGA 3UI3A 2ONQA 2GA4B 3R8BA 3U9SA 3ZQ4A 5FLXE 3DMUA 4PQXA 2SNMA 5C0XJ 1XLNA 4Q2JA 3AMUA 2ACZB 2BOSA 3PMFA 2W82A 2PQEA 1RODA 5KNCA 2LHEA 1XLQA 5D3IB 4P6VF 2EYPA 2Z4IA 5JEAH 2PNRC 2ICEC 4XYOA 2B39A 2SOBA 4PNYA 5BN3A 3U4EG 1H9RA 3JAME 1HRJA 5CV7A 1SYDA 4ZKBB 1QCBD 1QJOA 3H91A 1SIJA 1S5BD 2SDFA 4XYQA 1Q3LA 2L4NA 4C3IG 5EQ0A 1LTSD 1PLFA 2Y0SB 2RMMA 1JQYD 1BCPB 1I4GA 3JAML 4RKBA 4KKSA 5K36G 3GTKB 1PTOF 4KKIA 2CVRA 2NWGA 1VZ8A 1T5EA 1L0YB 1ZYRD 2SAKA 4YT0B 2KN4A 1O80A 2K04A 2KHSA 1TVXA 5A35A 1F9RA 1C8CA 4G4KA 3PIP3 4NZLB 1Q1EA 5FOBB 2WXHA 2A69D 3A54A 4FP5D 4A3IB 2EZVA 3W3AA 1KF6B 4HMIA 1MI2A 5KIXA 3VA7A 3NQIA 2IL8A 1CZGA 2LKVA 4DK0A 1FNWA 1TKYA 3AEBB 1KLUD 3TUOA 2HUGA 2QIEB 2Y3AA 3BWUD 1GUGA 4DXGA 3OIQA 1UEAB 1JORA 1EYDA 1YN5A 2OT2A 1GB4A 1ET9A 2GB1A 2B2VA 1HZ5A 5JPNC 1QOGA 2BB6A 1TU2B 2BE5D 1LABA 4WH4A 3OOCA 1ML0D 4DAPA 4LJZC 1IW7C 3BS1A 4XDXA 2OHFA 1RF2D 4M1UB 1EY7A 1ONLA 1F2YA 3A55A 3UI2A 2RBMA 1KTKA 1YNNC 3E6ZX 3R2TA 1EY6A 2WINB 1IGCA 4ME5A 2GI9A 4NAWB 2ZW0A 1CM9A 1U4MA 5J39A 4PMWA 5JVH3 2R7ZB 2WXMA 1K51A 3D4RA 2NVQB 2JU6X 3CIRB 1HXYD 2CQAA 3D31A 4B0MA 4LLGM 5C4JB 1E2WA 1RTOA 2QEJC 1FXAA 4TRDA 1PMRA 1SBBB 1GAQB 2F0QA 2K33A 4ULLA 1WTPA 2M2LA 1JWSD 3C1FA 3SK6A 1EY5A 1H9SA 1DYQA 2N88A 3VYSA 1F2ZA 3AEDB 1EOTA 4XXEA 3NXWA 2KEDA 4JWUC 2I38A 2LFNA 3O13A 5I9OA 3I4MB 4LK0M 5CV9A 3V05A 1WXQA 1ET6A 1LO5D 4ODGA 1VZ7A 3HOXB 4K8IA 5C4HA 1KLGD 4KD4A 1B50A 1PFMA 1JE4A 4DF7A 1MSHA 2F0GA 4YSXB 2O2LD 4GDLB 2EKIA 1OQQA 3PV0A 5JJZA 3LXFA 3FKIB 2BDOA 3OIPA 3M7GA 4QCLA 1BOSA 1T5XD 2FFKB 4ZLTF 1FYCA 4TSSA 3H94A 4YIJA 4HRSA 1J7BA 5D7GA 1A15A 1JWUD 3RZDB 3HGBA 3QB3A 1HHVA 3EQLC 1QOFA 1LACA 1WSPA 1WTQA 1DOKA 3P4SB 1V97A 2EXZA 3LB8C 4LTUA 1TJEA 3W9CB 1B3AA 4F8MA 1TWGB 4FF3A 1SXTA 2JP1A 2EY1A 4OL7A 5EPLA 2EDGA 3BDCA 4A3EB 1ZXTA 2N0SB 1MSGA 2DY8A 1KRHA 3AECB 1D1KA 1TY2A 3VYTA 4DGZA 1Y69U 2V0GA 1ICWA 3T4AC 4HROA 1KNEA 3SHLA 1VMPA 3EFXD 2F0DA 1Q90A 1K8OA 2NZ1D 4X3SA 1ENFA 4XT1B 2JYOA 1E9MA 4IDIA 1R9TB 1AW7A 2NB0A 2CU3A 3AM9A 3PZ7A 2K9XA 2JEBI 4XDCA 2HCIA 2E74C 2R93B 2DWQA 5CBAE 1WD1A 2WACA 3Q23A 3QOJA 1GOZA 3KUPA 1SDFA 4LK1C 3ND8A 2Q5WD 1HEZE 1MPEA 2AQ1B 1XO3A 1ZXIA 5BMIA 3AB9A 1DONA 2F03A 3V96A 3WOFA 5E3FA 4EGVA 1JWBD 5HFYA 3M7NA 1HQRD 1QF6A 4L63B 1IGDA 2W3SA 4DK1A 2LMCB 1J7AA 4ID6A 5NUCA 3NQTA 2PVOD 1EL0A 2IT1A 5CORA 2K5QA 4H13C 2XIWA 3KQ4A 3KLSX 3IXSA 1N5XA 3K7AB 1C79A 2L5TA 3MTSA 1C78A 1N63A 1YQ3B 1C4PA 4MH8A 3D6CA 1SE3A 4N6EB 2M00A 1ROEA 1I6HB 1NYQA 1P7FA 3FVQA 5EE9A 3WOEA 1TR5A 4DNTB 2JA6B 1WWTA 1CI3M 3S17B 3IAM1 1BBXC 2LGIA 4KGRA 3Q24A 4RKLA 3MAQA 3S9WA 3R3OA 4C7YA 2FMMA 1A3VA 3VR8B 1H9MA 4FVMA 3Q22A 2F0MA 5ELCA 4WJWA 1PFBA 3GP7A 2OEDA 3FMCA 2K28A 1FM0D 1D2BA 4RF1A 5HHDG 1FCLA 4L23A 5K36H 1F9PA 3AU7A 4A6QA 1KDBA 1ENAA 1YJJA 3ABVB 3GTGB 1YJIA 2A6ED 1Q12A 4A8XC 1FXIA 2XNAC 2XRSD 2NYZD 2EJMA 1AYFA 1X3QA 2F0LA 1YN4A 2JE6I 4X3TA 1STYA 3MFYA 2N7JA 1K53A 3MZ5A 3WDNA 1LT4D 1EQTA 5C0XH 3P4QB 1Z6HA 2I2YA 1EWCA 1EIHA 5JEAG 2WXQA 1EWYC 4OO1H 2D9UA 3ITPA 1FD7D 1A6XA 2QDBA 4K5XA 3BVZA 2MPMA 1UAPA 2AWOA 2D2CC 4JX1C 1G2SA 1EIGA 2JA5B 3FPPA 1VCIA 1XYIA 3QO2A 2F0UA 1IHZA 4KKUA 5T1GA 4J3OD 4B9WA 2J52A 1IW7D 3TEYA 4C3HB 3CQZB 4H44C 3NVZA 2IX1A 3SR6A 3QG1A 1IBXA 1NR4A 3OW7A 1BCPD 1NUCA 1YQ4B 1SB3C 2NTSA 3GTPB 1FEHA 2EPBA 1HTPA 2PMZB 2IX3A 1NEKB 1JCKB 3AE2B 3SK5A 2PZWA 1PUTA 3J81L 1EZ8A 1C77A 4IUUA 3WCQA 5M5XB 1PTOH 4RGTA 4HN7A 3AE3B 4R8IA 1N61A 4X3KA 1AEXA 3KF8A 1VJKA 1JR0D 3F2UA 3S1QB 2WXPA 2EJGC 2K7VA 2RVLA 3AH7A 3SK4A 4Q5VA 3BYTB 1PRTD 1PFNA 1MD2D 1V1PA 3ZJVA 1NR2A 4RCNA 1K52A 1ZOYB 4JWSC 5ELEA 3C3LA 2RSOA 1VDVA 1FR3A 2B2VC 3BIID 3IAS1 1ZKOA 2Q8IB 1ACCA 5H92C 1AWDA 1U9RA 3OMGA 1TS4A 5EE1A 4F88A 1F9QA 1DZ1A 4EQOA 1B2TA 1NENB 4PMCA 2KA7A 4J1MA 1CHQD 1H9SB 3I91A 4KK7A 5IGCA 1JROA 3MFGA 5JPMC 3QJYA 4U673 2LEKA 4KN7C 4FNFA 1X32A 2G9HD 4K5VA 5FLXL 2ZXPA 5CV4A 3NS1A 1YNJD 4A3BB 2JSVX 4FXCA 4OW0A 1GUSA 5IGGA 5ELBA 4O1NA 5KYLA 1OXTA 4R3DA 4ZYSA 2HDLA 1BQQT 1Q8IA 2F0NA 1TWFB 5JAVA 4FXGC 3PUYA 2PVGC 4NKLA 4KV6A 5C0XG 2FHTA 1OFFA 1QKZA 5C44B 5JXVA 3NWSA 1C4QA 2L1AA 3A56A 4P2CB 5CC4A 3KLSA 1CZWA 3GV6A 2JXMB 3N52A 3LNNA 4OVZA 1ZPSA 1Y8PB 3V3XA 1WTOA 2NVXB 5EE3A 5FO9B 1V43A 3RLFA 3D4DA 1DJRD 5M3MB 4HJGE 4A90A 4EQPA 5BMGA 1JOQA 1DGJA 1DM0B 5EPKA 2PO4A 4IN3A 5CYUA 3AEGB 2PYKA 2IGDA 1IUEA 1EU3A 4PT5A 1SAPA 3AEEB 4KN4C 4DQOC 4OZBA 2WXOA 4OO1I 5C5LA 2LUMA 2DNEA 4V0BA 2IPKD 2WXRA 4IFDH 1HFNA 4BBSB 3TP8A 4A3GB 3B2GA 4HR7B 4E6IA 2WNMA 2ID0A 5CGKA 3DWQA 1EQVA 4R8NA 2A74C 3TEZA 1BUVT 3QOLA 4HCSA 3FRPB 1TYGB 4DNRB 1L0VB 1E10A 3S2DB 5DM63 1SMYC 2HCCA 2EOTA 4I65A 2OF1A 1EEID 3DWAA 3L7ZC 2F0VA 2JA7B 3NTHA 2ICIA 1VMCA 2F0KA 1EY9A 1VLBA 1QNKA 3KLRA 2I46A 4DXFA 1VDZA 5H8YE 1TY0A 1EY0A 2KOLA 4IFDG 1TWCB 3X3MA 3AE8B 2VUMB 2NMQA 1FNUA 2FJ2A 5D65A 2F0JA 3FPUB 3GQBA 1S5ED 2Q8TA 2QKIC 1S4ZA 1KFYB 3D8GA 2K22A 4I7ZC 4OGQC 3NPPA 4ZAIA 5C6AA 1L6VA 4CHTB 2K03A 4LAAA 2B8FA 2X6LA 1NI3A 1Q10A 3MJ5A 1G91A 2RDHA 3VA5A 1VZ6A 2RA4A 3TN2A 2WXKA 1XEEA 2L0CA 3KBGA 2FBWB 4Z9CB 1AFPA 1CA6A 1SMYD 5D14A 4D2KA 3K5NA 4BY1B 2DBYA 3TDQA 2YEPF 2B2WA 4JE3B 4QUCA 3R2IA 3OPOA 2B2TA 3TZUA 3ZJUA 2V3PA 3GV3A 3S2HB 3MVVA 3AE1B 1PZID 2JQRB 2TSSA 3NBHA 3J9CA 3IKJA 4AYBB 3KBXA 5E4XA 4HAEA 2E2DC 1TZOA 4K5WA 3M4OB 2KJXA 1DOMA 4A3KB 4FXDA 4JPSA 1BDOA 1Q1BA 4MIUA 5E6JA 3FILB 1STHA 1N5WA 3DWMA 2L32A 2ZXOA