4TSSA

Toxic shock syndrome toxin-1: tetragonal p4(1)2(1)2 crystal form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
molecule tags Toxin
publication title Refined structures of three crystal forms of toxic shock syndrome toxin-1 and of a tetramutant with reduced activity.
pubmed rcsb
total genus 42
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 1996-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4tssA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4tssA01
4K6LA 4RH6A 1B44D 5TSSA 4RCOA 1EEFD 1UUPA 1STEA 4L6TB 1FGBD 1GOZA 1FD7D 1KTKA 3BYTB 5I4DA 1LO5D 3SEBA 1RD9D 1PRTB 3BYYB 1SBBB 1XTCD 1G8ZD 3R2TA 3KLSX 1LT3D 1M4VA 3EA6A 1LT6D 2RDHA 2XRSD 3EFXD 2R61A 4O1NA 1EEID 1TS5A 3W2DA 1EFID 3BZDB 1BCPB 1S5BD 2G9HD 1LTSD 1SE3A 3BVZA 3DWAA 1I4XA 1BXTA 2AQ3B 3V05A 4C56C 4RGTA 1TS3A 1HTLD 1L0YB 1TY2A 1PZID 1LTAD 4TSSA 1SJED 5ELFA 1I4PA 1TS2A 1I4GA 2NTTA 1JCKB 3DWQA 1UNSA 1XXGA 4RHRA 1KLGD 1LT5D 4NZLB 2QILA 1B1ZA 5D3DA 3O13A 1LTID 3GP7A 1ESFA 2XN9C 1I4QA 1FNVA 1LTTD 1PTOF 3DWPA 1KLUD 1LT4D 1I4HA 4Z9CB 1YN5A 1BCPD 1TY0A 1AW7A 1S5FD 2IPKD 4BWGB 2ICIA 1JWMD 1D6EC 1F77A 1PTOC 1V1OA 1LTGD 1JQYD 5ELBA 1JR0D 1SE2A 1DJRD 1YN3A 2WV6D 1T5XD 1PTOH 2TSSA 1FNUA 1MD2D 5FKAC 2NTSA 1PTOD 4DXGA 3MFGA 1YN4A 1PZJD 1CQVA 1HQRD 1I4RA 1CT1D 1V1PA 4RHSA 1S5ED 1DYQA 1BCPF 2IJ0A 4DXFA 4ZYSA 2O2LD 1SE4A 1LLRD 1L0XB 1AN8A 1V1PB 2XNAC 3MC0B 5ELCA 1RDPD 3BVGA 2AQ2B 2J4XA 1CHQD 1ET6A 4RGNA 1PRTF 3TSSA 1ET9A 1SJHD 4RGMA 1EU3A 1ENFA 1PTOB 3CHBD 4OHJA 1CK1A 1EWCA 1LTBD 1LTRD 1PRTC 2RDGA 3OWEB 3R8BA 5ELDA 1QILA 1TS4A 2AQ1B 1HXYD 3R2IA 1S5CD 5D3IB 1RF2D 1EU4A 1JWUD 4RGOS 1PZKD 2QEJC 1D5MC 1PRTD 3BVMA 1FNWA 1HA5A 1S5DD 1SXTA 2CHBD 1PYWD 1RCVD 4RFBA 5ELEA 4L63B 1SEBD 5FK9C 1D5ZC 4UDUC 2Z8LA 2SEBD 1BCPC 1JWSD 2XRQD 3URYA 1CHPD 1D5XC
chains in the Genus database with same CATH superfamily
2WB1E 3GTLB 2M2LA 5H1SE 2RPQA 1ISNA 4IOIE 1LYLA 2UUCQ 2OWOA 1WYGA 4JQWC 3SK6A 4G7OC 2HTHA 1WM2A 4E71A 3HKZB 1WRDB 1GHJA 3F2DA 2VRRB 2UXCQ 2RDBC 3K5MA 1X3FA 4DR7L 2VW9A 2KFJA 4QMGA 1QOAA 2HDMA 4JG2A 1H8CA 5M3FG 1JE4A 3TBIB 2VZAA 2MP1A 2K5WA 1K50A 3CD6A 5D94A 4YCUA 4ZYNA 3IFWB 1QT9A 4CDEC 2IGDA 1N9WA 2L4NA 2INCC 3V2TA 4LF6Q 5L95C 3CC7A 3DWAA 2WACA 3A33B 2KO3A 2A5HA 1NI3A 3HUIA 4J15A 5LL6S 3S14B 1EIYB 3DOWA 1UZXB 4P73A 1NENB 3L08A 2HUGA 1TVXA 3RPFC 2RKSA 2NMQA 4BY1H 3IL8A 2F0PA 4QGUA 1SSNA 4LF9L 1F9SA 1U5KA 4A3JB 3P1MA 4MACA 3W1YA 1LGRA 5FO8B 4XXEA 1N5WA 3NVWA 4PG3A 5I6WA 4R3DA 3DBRI 4G4KA 3CRKC 5IGEA 3TUOA 5M3MB 2XN9C 2EYFA 3NK9A 4DV7Q 2FUHB 2K6QA 3P4PB 2RD0A 1LTTD 1PTOF 2QGQA 3L16A 3RN2A 3I73A 1LTLA 2J52A 1BVSA 2JU6X 3Q3OC 3U52E 4KDIC 1FIQA 2M0AA 3X3NA 2HIVA 4HDOA 1WZ0A 3UI2A 2I38A 2N9PC 3PVLA 3DPDA 2IZVB 1HRJA 2G1EA 1F2YA 2ICIA 5EBCA 1QE6A 3VYUA 1N61A 2E74C 3CC4A 3KBGA 4CDCC 5IOCA 5KYIA 3R3MA 2F03A 1E0BA 2GBRA 3TEXA 3ZVVA 4QB4A 3UDGA 1FO4A 2AEHA 4NW2A 4NAWA 3PREA 4S3SA 5IP9G 3B9JA 3ZTCA 2KCNA 1STGA 3CF6E 4IM3A 1J7AA 1PFNA 1U4RA 2WAQE 1JC7A 3MFGA 1WM3A 5LLIA 1B9NA 4ZHPA 2L0CA 2XBBC 5IA7A 3K0YA 3M3YB 4X6AH 2F4VQ 2NBVB 2KAJA 3PF5A 1Z5SB 1SMYD 2AWNA 2BH8A 1YITA 1VDVA 4OGQC 3KF8A 5IAAC 2WFWA 5FLXL 4YHHL 1B3QA 5MPOA 2KJXA 3MZ5A 3DM3A 2KHJA 4RGMA 1GUNA 3JC66 1Z2MA 3NVZA 3CHBD 4DAVA 2PQEA 1I3QH 4O42A 2WU2B 4WWMA 1TWHH 2FMMA 5C6AA 3ZYYX 3TEWA 1P8LA 4GB9A 5D65A 3DWMA 2ZT9C 5GAEC 3Q3MC 3VUXA 1UEAB 2JQOA 3GTKH 4TVAB 3PLVA 4PYZA 2NVQH 4A55A 2GBMA 2A68D 4KGRA 1GB1A 1JW9D 3T4AC 4DR6Q 4LF6L 1WR6E 2GB1A 2WXRA 4UY8C 1FPYA 2Z6KC 4U68A 4JVZA 2DNCA 3NVVA 1TWAH 2YU9H 3NWTA 4ANUA 4EQNA 2CFMA 4GOPA 2N78A 3TL5A 3D3RA 3HOXG 1TIID 2GLSA 4PT5A 4AYBE 3NRZA 5A35A 1EL0A 3I3TB 1ZOYB 2KDFB 3NS8A 3OJ4B 2OTJA 4MH0E 5AUKA 2LGYA 1NE3A 3OTOQ 4L1BA 3I70A 3S16H 4J6IA 4IUTA 3KOJA 3QOJA 1PYSB 3S15B 3R7QA 4KI0A 1X1MA 3GTOH 1F9RA 4EFOA 1EY4A 3MXUA 2WX1A 5E6PA 1C77A 1LT3D 3CCEA 2HTME 5KHOA 2IX3A 3J80L 3WALA 3W2DA 2X6LA 1CA5A 2ALYB 1VMPA 4UHVA 1WH3A 3UF8A 1LTSD 4P16A 4OEMB 3BZKA 4BY1G 4MSQB 3ZDMC 1TWFB 1ROEA 3NXWA 3HEJA 3FDTA 5ELFA 2BB6A 1HA6A 3CPFA 3WAPA 3CRLC 4MT5A 4M0WA 3H0GB 1G6PA 3VFKA 2R7DA 1L7YA 3DMUA 1WXVA 1TWHB 1C48A 5G3LF 2ASQA 2GOWA 4GNXC 2QILA 1E8YA 5LL6X 1K52A 3W5OA 2NS5A 4F7ZA 3UDIA 4FF4A 3CWIA 1AARA 2LGIA 3GB1A 3C2PA 2LJ5A 1HTQA 1O7LA 2K8CA 2PI2A 1HZCA 3JW0X 1I4HA 3A55A 1EY7A 2NBUA 4KSKC 4HPMB 3OJ3A 5EGTA 2KLCA 2V9HA 1SR3A 5GXGB 2SOBA 4POGA 1V1QA 1UE1A 5IWAL 3STBD 4B3SL 1D6EC 3N52A 3Q3NC 1VQHA 2VXWA 4IWOA 3QIJA 4DDGD 1WYDA 4QIWE 4DQOC 1YN3A 2QEXA 2E6XA 4ODGA 5FO9B 1HR0Q 2LEKA 1NY4A 3QB3A 2JWUA 3OW2A 4BA1I 4G50A 2IHEA 2W9NA 3VR9B 4XDCA 1ZUD2 4BKSA 1S5ED 4DA2A 1GUTA 2M8SA 2EXZA 1DD2A 3RZDH 3MC0B 3J80c 5M3FB 4DR3Q 1EOTA 1V8QA 2JEAI 5FR3A 2J4XA 3NQIA 1ET6A 1Q10A 4PQXA 3VR2A 1Y8RC 2RR9A 2HJ1A 2WU5B 2MJDA 3QCAA 4GU2A 3C8YA 5LMUQ 1CZWA 1KRSA 2E2DC 1HUNA 4XC2A 3AB9A 1L1OA 5CGKA 4A3CG 3NHHA 4R1JA 1IBKQ 1LTRD 4U673 4JBMA 2B3AA 2RPVA 5T1GA 2BQQA 1J7CA 3IG3A 4A3EH 4JGHB 2BYTA 2MJ3A 3OTOL 2VL6A 3HZXA 3AEVA 4DV0L 4ULLA 1EU4A 1XPRA 1NTGA 4MGIE 1FCLA 1NVID 1SXTA 3CCMA 1CI3M 4DV7L 2YTYA 1WJJA 1R4NB 3G6EA 3A9KA 2O2VB 2I1JA 1YQ4B 1N32Q 1HNZL 2DJGC 2LSSA 2L8JA 5IN7A 1EFWA 1ENCA 1ZYRD 5C0XJ 1LACA 1I50B 1E2WA 5GMVA 4A3BG 2UXCL 4HJ9A 3AE5B 2Q5WD 1GD7A 4IM0A 1NNXA 4MSMB 3HOZG 2KCCA 1STEA 1QG7A 1R4QB 2Q2IA 1D1IA 3HS0C 4DFAA 1V6EA 2ZEQA 4QIWB 4BY1B 2WINB 4GNXB 2UXBQ 3SEBA 3ECIA 4WORA 3BYYB 3S17H 2KTRB 3FAHA 2FNJB 2L52A 1LUZA 1N5XA 3JSVB 1Q1BA 4TQ1A 1BNZA 2JX5A 2F1MA 4XYOA 2RSNA 4F87A 4JI7Q 3AMZA 1VQBA 4A3DH 3VUYA 4A3KB 1OEYA 4IM2A 1FJGQ 1I4XA 3HOVG 3CCRA 2ZXOA 2G3QB 2VZKD 3IAS1 4BZAA 3UQAA 3ONAB 1S3OA 3QQ8B 1L5PA 1QQRA 4MTNA 4DR1Q 1BOSA 1SE8A 4J1MA 4N9PA 1B8AA 4W9KA 1C3TA 4X65L 4JV5L 2LS01 5F2DA 2KZRA 5I2YA 2QDLA 3NTKA 1LT5D 3PO3H 3AFQA 2EKIA 3IBEA 3E5SA 4MIUA 1K0RA 3F8TA 4K2KA 1JB3A 1V9PA 5E1FA 1HZ6A 1YNXA 3IAM1 4KMUC 4M00A 4NB3A 4ANXA 3VAWA 4RCNA 4NNJB 2DZIA 4OZCA 2UUBL 5AFWA 4BBSG 2QCPX 1EIHA 4FJYA 1NDDA 3VTWA 5KNDA 3VXWA 4RG1A 3AM9A 4JI4Q 4ZQ3A 4ZUJA 4ZRPA 4DAPA 3Q3FA 1SNQA 4YCWA 2BCOA 3RI7C 2IPKD 1Y1VB 3E6ZX 4GLSC 1E6EB 1VF7A 3H91A 4BVUC 4HCNB 4X62Q 3CCSA 2R92B 1D1KA 4FDBA 4BY7B 4M0WB 1RJTA 4WJOA 3MTNB 2Z4IA 1C0AA 2ACZB 1E1OA 3M85A 1A3TA 3G48A 2VB2X 1Q5WB 1WJUA 5KGUA 1EOVA 2CQAA 1AWDA 3M3JA 5CYUA 3QA8A 1BBUA 2EYLA 1EM7A 3DBLI 3HOXB 1D7QA 1WXMA 2VY3A 4YHHQ 2Z0EB 4PMWA 1EY6A 2FFKB 4IWPA 4HJKA 1LLRD 1V1PB 3E0EA 3RR5A 2ZJRA 2OEDA 4Q2JA 4BFRA 1SIJA 2IL8A 1C9FA 2VH2A 1RDPD 3BVGA 1QOGA 4GMVA 1AEXA 3FEWX 3VA5A 4A3GB 4IPDA 4HCSA 2I07B 1TIFA 4DV2L 3AEGB 4LCDE 1DXMA 3J7ZC 2J7ZA 3GTGH 1PH5A 3M4OB 2R93G 4YSXB 3LNNA 2AUKA 1K9MC 1O78A 2BYVE 3KDFA 2KQ4X 3Q69A 3L17A 2FE8A 1HZAA 5ELDA 3MXGA 4IWQA 1FD6A 2WXMA 1HNXQ 1E7PB 4W9EA 3T3OA 5C4XG 4ZRJA 1RYJA 3Q8EA 3CPWA 3S24A 1OTRB 2QEJC 1MHWC 3BVMA 2J42A 2L1AA 3NTIA 5CV6A 1ILPA 2DZKA 4GKJQ 3S15H 1ESRA 5KHQA 4KGSA 2EKEC 1JICA 3R3OA 4A3IB 5FK9C 1XMQQ 4UDUC 3L0WB 2FIFA 1MIUA 1WXAA 2LHEA 4C00A 1A5RA 1EIFA 1ICWA 1X3QA 2UXBL 1EY8A 2Z6BA 4KKJA 3HOYH 3STBC 5EQ0A 4IOAA 1IPGA 1FFVA 3W1SC 2JA5G 4K7SA 1N60A 5TSSA 3RMHA 1TWGH 2O6VB 2JP1A 3NBHB 2KDEB 2N9KA 4L6TB 2BH2A 1N63A 1FGBD 1TWCB 3S1NB 2EY2A 3NTHA 2MLBA 1R4PB 1Q8IA 1WD1A 3H3VC 1XTCD 4DAMA 2KXJA 3C46A 4DK5A 4FXGC 2AKWB 2XRSD 5BR8Q 1KRHA 3AEEB 2L12A 2E2IH 1PH2A 4KIKA 2JA6H 4ZRZA 4C56C 1ZXHA 2JYTA 4RGTA 4X64Q 1HFGA 3K58A 3CCVA 3EFUA 5C3EG 2NZ1D 2DNEA 1I4PA 4A3PA 2UUCL 3K9OB 3SR1A 3I91A 3PIOA 4CO7A 5G5HA 2MBQA 4XWTA 3AI5A 4YWLA 4M8MA 2EZVA 1BUVT 1F1HA 2LMCA 2I46A 3AQQA 2K6DB 5ISRA 4XYCA 4W9IA 2KECA 2IHFA 1KIXA 2R7ZG 1R4NI 4K7WA 1TTNA 3T56B 2MJEA 1T9HA 1XYIA 3RYTA 2E76C 3T13A 2K5HA 4Z9CB 1ZW7A 2NN6I 2M1MA 4X3UA 3I55A 4ZUIA 1Q12A 4KLKA 3J7YW 2WXFA 2WB1G 3J81c 3CCQA 1AYFA 1X9NA 1LTGD 4DGZA 3J81L 2OCEA 3SXHA 2H89B 4WRDA 2NVUI 1E3PA 1F9QA 1OEYJ 1ZKOA 2NBWB 3HOYG 1G91A 3K59A 3F1ZA 3ABVB 4K3BA 1UGJA 1DYQA 1HNXL 1JQ4A 2F0VA 4IC7B 3KJPA 4LF9Q 2A73B 4XGAB 1C4AA 2XNAC 2CJNA 1OGWA 2ZJDA 1XCTL 4DDID 2NR2A 5M5YH 4LFCL 1XMOQ 3N32A 3TSSA 3QC8B 2WKCA 1YOVB 4KVGB 3I4MB 3E9IA 4WURA 2E2IB 4FBJB 3DHGC 2M00A 4C1NK 2D3AA 1ENFA 1FMAD 2GBNA 2ZPNA 2F0FA 4HCEA 4HTHA 5JVG3 2G45B 2EY5A 1IYFA 2MP2B 4HVBA 1FGUA 2D2QA 1SN8A 5C4XH 4EQPA 5J2RA 1P9DU 4DR1L 4N59A 1NYQA 2NVTB 1TS4A 1N8RC 2CW0D 2VS1A 4JI1Q 1EQQA 3RZFA 1NI2A 2W82A 2KX0A 3JAME 3QG1A 2FAZA 4WIPA 1PZKD 1FNWA 2B2VA 1HA5A 2H1EA 3MA2B 1AH9A 3L10B 4C7YA 4IPHA 3S17B 4K3CA 4I6PA 1KAWA 3W5UB 1P98A 2MW5A 1XLQA 4IUPA 2XRQD 1MGSA 2MBBB 5D2MB 1HEZE 4DV4L 1CHPD 3HKZE 4EX5A 4PV1C 1CFMA 5IP7H 1DONA 1T6BX 1EY0A 1PH3A 4BOZB 4US8A 1WFYA 4K6LA 3GTLH 2N8NA 1M1KC 4RH6A 4X65Q 2D3GA 1B44D 2EPBA 2KN4A 2X38A 3DHHC 2L15A 4DF7A 4DHZB 4WJWA 2JA9A 4DNIA 5M3FH 3S1RH 4LF8Q 2DZJA 1U4LA 1ZYRC 1HUMA 4MTKA 2MEKA 1PYBA 4B9KA 1CSPA 4XZ4A 1OXXK 3MJWA 1G8ZD 3KLSX 1F2RC 1XD3B 4YXDB 2G9DA 2F0KA 1B2TA 1UD7A 4K1RB 3P20A 4FP5D 2JXTA 3V6EB 3DVGY 3BZDB 5CV7A 1S5BD 1XT9B 3AN1A 4QUFA 3LXFA 1U4AA 3UQBA 3IHPC 2EYOA 2B63H 3K80C 1HE8A 1OXTA 3PSEB 1WX7A 2A74C 3RNEC 3H7SA 1TY2A 4DV5Q 1A6XA 4W9DA 1VQ7A 2WDRB 4X3TA 4P1BC 4TKOB 3H8HA 1P3QU 1HJPA 4OW0A 1Y14B 5IYCG 1UNSA 2HCIA 5ELOA 4WJPA 2RSOA 4K8IA 3P4QB 5JEAH 4J6HA 4AH6A 2F3VA 1PA6A 1ZPSA 1C78A 3H0GH 1RAXA 3RZDB 5L83A 1TT2A 2PZWA 4G11A 2IY0B 5AJ3Q 4A3MB 4RM9A 4JW0A 1NBFC 2VUMH 3ZDTA 1OXSC 3A54A 1FR3A 2KQ7A 4FXCA 1DOYA 4GDLB 1PFBA 4NXMQ 4CKEA 4BWGB 3VR8B 3T8MA 4AQYL 2C35B 1SYEA 1T3QA 3E3XA 4P1CC 2C9WB 3GV6A 5FJ8H 1LXDA 1PLFA 3TS0A 2BPSA 1K8GA 1T5XD 1VQGA 1OFFA 5IP7G 2UU9Q 1QOHA 2EJMA 2BWFA 2QA4A 2R7FA 2JEBI 4Q5VA 3MFYA 5C5LA 4DV2Q 3J80i 2KQ3A 2K8HA 2C5CA 3U4ZA 4NY0A 1X3PA 2K01A 5CV9A 5IP9H 3NZ3A 2Y3AA 4ZYSA 1PGAA 4G3XB 4FN2A 4IPGA 1A62A 4PZ6A 3ALBA 1UWXA 1MBYA 4HIDA 5ELCA 1FVIA 2ZVNA 3E9SA 3ZJUA 1E5WA 4LF4Q 3GTJB 4LK0M 1A8VA 4Y7NB 3DLLA 3HFZB 3J7AV 3ULLA 4ZKBB 4DV6Q 1GVPA 1CKMA 2IY1B 2ZPYA 5E4WC 2WXHA 3RULA 4XYQA 1UGMA 2Z6KA 4PZ7A 5BYSA 2E3TA 4XDDA 3MWYW 4GKJL 1XLPA 3AE3B 5E6NA 2CHWA 2X8XX 3OIQA 5CBEE 4JL9A 4UAIA 1K73C 3P1HA 1V97A 1YNNC 4DK6C 4IFDH 4DV5L 3OWFA 4QJFA 4B3RL 1MJCA 4B3MQ 1S5CD 4H02A 4P7IA 2Z9HA 3J9CA 1WIAA 3Q14C 4YSZB 1EO6A 1V81A 4NMZA 1A15A 2CKHB 1K8AC 2N7DA 2VQEQ 4HJGE 2DLBA 3U4VA 4L63B 1DZ1A 3X23A 4DWFA 4RM8A 4F88A 4AQYQ 3URYA 4I6LB 3OW7A 4X66L 1EUJA 3V3XA 5C5MA 3EBEA 4DR3L 1IXRA 3M7GA 3E9HA 4BKGA 2QCZA 2PZTA 3MC9A 5IT9E 4B0EA 4DN4M 3OLMD 3I2ZA 4HRSA 4K5WA 3B2GA 1Y1WB 1KJTA 2LZ6A 1RD9D 3KLRA 2D5GA 3R2TA 3QWZB 2F0WA 1GAQB 4O2DA 1SNMA 2YLMA 1ZDXA 4NAMA 2BE5D 1C4PA 1AE2A 3KQ4A 2KWUB 4GN1A 2V4DA 4RF0A 2R93H 3JVZX 1CM9A 4A3GH 5FLMG 3GTJH 3D4DA 1CTMA 2L0TA 2Y5PA 1IYUA 3MHBA 2AUJD 4QY7A 1SJED 4JI3L 4P75A 3DVNU 3PV1A 3RT3B 2F0QA 1QOFA 1AZQA 2LRWA 3N1YC 2LKVA 1PH7A 1XXGA 3EGRA 1UBIA 1YEZA 2BT6A 2KC2A 3DQVA 4DK1A 3TP8A 4K0KQ 1LTID 3PIO3 1E8XA 2VUMG 3LYYA 2K14A 3K8AA 2KJ6A 4IFDG 2KANA 2K0PA 2Q8TA 2DNFA 1H95A 1YNJD 5EAYA 3TP6A 3SU8X 4A6QA 1K28A 4B3ML 3WCQA 2MJ8A 2PZUA 2DX5B 4ZOHC 4GSWA 4JI4L 1V1OA 2B2TC 2F0GA 3CF5A 2FCSA 3BIID 3DEPA 3J7AF 1JT8A 2PW7A 3PMFA 1CKOA 1JR0D 2R3ZA 1DJRD 5JOBA 4JBKA 1K51A 1P0RA 3VTUA 1XPUA 3U4EG 4MM3A 2WXOA 1FNUA 4NJ7A 4BY7G 4DXGA 3PIP3 2R92G 2N9EB 1PZJD 1MVKA 2EELA 2UXDQ 4DR4Q 3UE0A 4DXFA 5KIXA 3I4MG 3N3KB 5GAHC 3Q8AA 2LMCB 2I5HA 4KKIA 2FXQA 3HOWB 3G6JB 2JA8H 4OO1H 4POFA 2E5LL 3HRZC 3ZNHB 4M8AA 3EJIA 1UF0A 5BMGA 2K5QA 4JE3B 2BKFA 4X66Q 3GTMB 1ET9A 4GXBA 1SNOA 1YX6B 2MH7A 4WWPA 4BBNF 1HR0L 1RL2A 3RNUA 3SD5A 2F0SA 5FLMH 3N9YC 2CCZA 4OIKA 2BYFA 3U2SC 3V60A 3D6WA 1RFAA 4OONA 3CMAA 2EOTA 4RKBA 4TV3A 1RTOA 1F2MA 1QILA 2AQ1B 2TMPA 5CHFA 4EOYA 2CWPA 4PZ8A 1FRRA 3C0RB 5BMHA 3ENEA 4GLVB 2OTLA 2FHTA 3PZDA 5D3IB 3VTVA 3NY5A 3H7PB 2B2VC 2KC1A 4BBRH 5IGGA 3MHSD 3PO0A 2CW0C 1N36L 1ZXTA 5CV8A 2A6EC 1WTHA 4K0KL 1XEEA 2LJIA 3WAOA 1YVCA 2YYZA 4O0AA 4R4CA 3ULPA 3AV8A 4DR2L 2MO0A 1Q8KA 2LXJA 3QHTA 4R4TA 1HZ5A 2B76B 2F4IA 1PV4A 2IGHA 2HQLA 1UUPA 2R6GA 2IYDB 4DNTB 3PUZA 2Z1CA 4DR4L 4A3BB 4MDKE 3PUVA 1SYFA 2EQSA 4C3IH 5IGDA 2ON8A 3HOUG 1UWVA 4C3JG 3QK0A 5M5WH 3VYRA 1NEKB 1KF6B 1WMHA 1STNA 3GTQH 4KHPQ 3HOVH 2QC8A 2R2OA 2RDHA 5G5GA 4IUQA 5E4XA 5JAVA 2MBOA 5IKCM 1Z47A 1Q1EA 1NMFA 4A8XC 1V5OA 4C4VA 3IKJA 1J9OA 1BXTA 4NXML 5C44B 2EXDA 2R7ZB 1H4RA 2X6GA 4PNYA 3MXNB 1VZ7A 3IXSA 1VF5C 1V5TA 1WZ3A 2A8VA 1MHHE 1H9KA 2ICEC 4LK1C 4M8NA 4P72A 2N4FA 4HMIA 3FILB 1B53A 4A76A 3CMEA 2N9XA 3RZWC 5LXIB 3SFDB 4OL7A 3GO5A 4QL5A 4RHRA 2UXDL 1KLGD 3CC2A 2RGFA 3GZNB 3LB8C 5JVH3 3O13A 1XPOA 4DBGA 2F0TA 3KYHC 5BYRA 1YNND 4CJ2C 3L4PA 2LXAA 5EJWA 3U9OA 1WGRA 2XIWA 4G57A 4DR6L 5M5YB 3LWEA 2J0KA 5C4JH 2K22A 4ANVA 3T1HL 1B9MA 2DY7A 2C7MB 3M4PA 1YIWA 2BVCA 1FL0A 2WDVB 5H92C 3PS6A 3KVFB 3EFCA 1JQYD 2UU9L 4BY7H 3T51B 2DAFA 1IKLA 1YJIA 1ILQA 2XSCA 2KN5A 3DCGA 2BA0A 3S1RB 5EBDA 1JROA 2F3WA 1FM0D 4L5SA 1YN4A 1B3AA 2K5NA 1I5FA 4RHSA 1BR9A 4YIJA 1CJEA 5C0XH 1LQBA 1BKBA 2F0OA 4DHJD 3PUXA 4JI5L 1SF0A 3EC8A 4ITKA 2K6AA 4A3FH 1VQLA 1SSOA 5JHBA 1E7UA 3VYTA 2D10A 2UUBQ 4JIOU 4S17A 4LJZC 3PO2G 3GDEA 1QB5D 2NN6G 4EVOA 3Q22A 1AFPA 2K1BA 1WRIA 4HWIB 4LNNA 4L2YA 4CDDC 4FF2A 2A1AA 1WI0A 2OQ0A 2PVGC 4LF7Q 1TQOA 3Q6SA 2LGSA 1Y8NB 2OXPA 2BS3B 3OWEB 2RDGA 2WXLA 4PS3A 3R7RA 3H15A 3H0GG 1I94L 4WQOB 3K7AB 1WYWB 5IOIA 4B3RQ 4REZA 4YTNB 4LMQD 2F0NA 3HGBA 5IT9c 1P7EA 4WJ4A 1CMXB 4WJQA 3J7A5 1SMXA 4EGVA 4LFBL 4KK7A 5ELEA 1VQ6A 4KHPL 4BBSB 3AU7A 5FO7B 4X62L 1D5ZC 3C19A 1G2SA 3D32A 2UWQA 2SNMA 1YNJC 1L2FA 1WI5A 1BF4A 4WAAA 3U7ZA 3VRBB 4ZHOA 3RMKC 4PS7A 2FMCA 3QJYA 4LF8L 1MG8A 4LTUA 3T1HQ 4C3IG 2EE1A 2PKOA 4C3HB 4KTAA 1TWGB 2KCTA 2PE6B 2WB1B 4R9WA 4AJWA 3FMCA 1KTKA 1E90A 5IGBA 3I5JC 3DUZA 3MVVA 4OVVA 1Y1VG 3M3YH 4JPSA 4KY6A 1EQVA 1NR4A 2B8FA 4QF4A 4CHKA 2IWHA 1J5EL 2KTRA 1EEID 4MELA 4NPNA 1VQJA 4N58A 2ZM6Q 1Q7YC 5CHVC 4DUZQ 3OSOA 5DLQE 3QO2A 1W3SA 3SK8A 1F2ZA 1KNAA 2D9UA 1NUCA 4X64L 3WWVA 1MFWA 3DXJC 2XWBB 3HOWH 3VA7A 2BE5C 4C7ZA 1N34L 2ENBA 2HJ8A 5C0XI 4A20A 1XTDA 1PH9A 1IBKL 1XF5L 1HH2P 2WAQG 3PGZA 2BOSA 2NPTB 4KHVA 4IDIA 2MQHA 1WTWA 2FUG1 3HP3A 2IO1B 4LF5Q 2A69C 2QJLA 4M02A 3NQTA 4K81A 4I65A 5DPTA 4US9A 5JPNC 1KLUD 1KHIA 3R93A 2E5LQ 3ZJTA 1MPEA 2R7ZH 2PPHA 2JVCA 2XTIA 1MKHA 3L9AX 2WDQB 2MRPA 3RD2A 3U7DA 1KNEA 2KJRA 5K36H 3SVMA 4ME3A 2UYZB 5JXVA 3TN2A 4AYBG 1SFOH 2CQOA 2EYMA 4HJAA 2KUMA 4MN3A 5CBAE 5J22A 5FKAC 4ZRIA 3S2AA 1GUOA 4JWSC 3MHZA 4A3IG 5C3EB 1LFDA 1ML0D 1V1PA 1VCIA 5AZFA 4BKTA 4JI0L 1VQPA 1VQNA 3V96A 3CCJA 1J19A 2BF8B 3CW2C 4MH8A 4KN4C 3LGJA 1S40A 4ZRQA 2LI5A 2N7JA 1Z7TA 3A4RA 2KK8A 4RGNA 1VQEA 1SYDA 2PJHA 2F0DA 4A90A 5ELNA 1H9SA 4NXNQ 3I56A 4DV3Q 2V4LA 4XQNA 5J17A 1J8IA 3RFZB 1VJKA 1RIPA 3E0JA 2D2CC 4EQ5A 1QVGA 1J5EQ 2KFKB 1J0GA 1LTBD 1OXUA 4BXXH 4JV5Q 5COYA 5EE9A 1C4QA 2L11A 5C44H 3DVNV 4MHEA 2PYKA 1VZ6A 4KJNA 3P42A 5L37A 3K7UC 4MZ9A 1YHAA 4ZRKA 2E2JH 1TKWB 2E8GA 3MEHA 4HPLB 1D5MC 4OX9L 2KENA 4V190 2EVBA 3SDZA 1PYWD 4NJ6A 1S4ZA 4RFBA 3DDCB 1L0VB 3NBIA 2B2YC 1PVOA 3H6MA 3PZ8A 5J1ZA 1A3UA 1EWHA 3A5ZB 4EQOA 3GTPB 3RNBC 3TMPB 3VH3B 2HE7A 4LFCQ 1XNRQ 4DHZE 5HFYA 4EZJA 1VQAA 3PUWA 4QUCA 4LFAQ 2LVPA 1HTPA 4MM3B 4HR7B 3MAQA 1JOOA 1EZ8A 1FYCA 1E9MA 2LRUA 3AE4B 3JAMc 1L6VA 1Q86C 1ZDVA 5JH5C 4DUZL 2KQSA 3NBHA 1YD8U 4LNOA 5LMNW 2B2WA 2OOBB 3HIZA 1WVLA 2JWZA 3DBSA 1QVFA 1PMRA 2MNAA 4IUNA 4IZ8A 1TS5A 4O1NA 1IL2A 2NVQB 3Q8DA 1BUIC 3MXPA 1ZXIA 1SE3A 4YWKA 5T1IA 4JI3Q 3B2FA 1QWYA 2EYPA 5LMNL 1KXLA 3V05A 1Y56A 4OWTB 2KT7A 5IWAQ 4LUOA 5C4ZA 1L0YB 2FCQA 5EKIA 1HHVA 4GS3A 2A69D 4LWCA 4HIKA 2VNUD 2LXCA 2WXGA 4G0NB 2B8GA 4II2B 3NZSA 1PDQA 3GTPH 4XE0A 3DWQA 3HKSA 1HCZA 1O7IA 1N33Q 2XK5B 3IFDA 2N0SB 3PCOB 1EQRA 1Y8PB 3HOVB 3FPUB 2HHHL 1NYRA 3MP9A 2WGSA 4A9AA 1EQTA 4A3KG 1QKZA 3AE1B 2WS3B 1TJEA 2JA8B 1VQ5A 1Y1WH 1YIJA 1SFOB 2E2JB 2CWAA 3D6CA 1V9JA 3A7LA 3HOXH 2Y5BB 2B2TA 1BCPD 3GV3A 2DAJA 3NENA 1VS0A 2PQAB 3RD4A 3RZOH 3A56A 3F2CA 3V62A 5JJZA 2WDTB 1TZOA 2J53A 1TZ1A 2KVMA 3P2BA 1SE2A 3X3MA 4I7ZC 2IBIB 2B3GA 4HCPB 3GTGB 3FKIG 2MHVA 4QCLA 3PHWB 4BOSC 4W9JA 2HT1A 1FEHA 2F0MA 4DUYL 4B0MA 1PTOD 3L3OC 2PNRC 2VB3X 4PYUA 4F8MA 4KD3A 2JZZA 2KKCA 1BCPF 1CQFA 4X3KA 5DNFA 1VMCA 2I5MX 1UH6A 3NG0A 3TQYA 1XO3A 2REXA 4IKGA 1GKHA 2KTFA 2XVSA 1HZBA 2G4DB 1VLBA 1CHQD 1R9TB 4C4VB 2L55A 1C1YB 2PO4A 2DYMA 1J7BA 1SJHD 1WOCA 3LJ3A 1N32L 4IUUA 3DBRB 4JK1C 1I50H 1G6JA 1JORA 2IY5B 2JA6G 1W2BA 3EHVA 1B70B 1N33L 1FXTB 2PMZB 3M95A 3MEFA 3CCLA 4ILWA 3WA0A 3APFA 4NQLB 2XGTA 1WTOA 1Q1OA 4GZYC 1UBQA 3HG9A 1PGXA 1M94A 4C3HH 5EKLA 2JJQA 4A3EG 4IJHA 2K05A 4YT0B 1JMCA 3C1FA 5CV5A 4C2MB 1S5DD 4A3KH 4A3EB 4JI7L 2O5IC 2RSUA 4N8FA 1LV9A 3ML9A 1STHA 3M62B 1L2NA 1WX9A 3TCAA 3S1NH 1IP9A 2GVBA 1EF1A 1X6OA 1I6HH 2GRIA 4N6EB 1O7YA 1JWSD 3OAWA 2KWDA 4EKUA 3E56A 2GI9A 5CTRC 1NAPA 1GJZA 2QDFA 2B2UA 2KFKA 3RLNA 1T0RC 3AE8B 1VQMA 3D8GA 2AL6A 3L13A 3TP5A 4R8IA 3I4NB 3EECA 1GOZA 4OWWB 1SNCA 1ZE3D 3ZKJC 3VR5A 5GQOA 2BS4B 1M90C 1JWBD 3GE8C 1WXQA 3CCUA 1LT6D 3CXCA 3PO2H 1JJGA 3TIXA 3GD7A 5EDSA 2EYJA 4IQZA 2AQ3B 3DWGC 5M5WB 3Q24A 1IBML 4A3DG 3SK4A 2EMTA 4GGQA 2LUEA 1JJCB 4JI1L 5IGFA 3N20C 1H9JA 3X0WA 3ZW3A 2JSOA 3NS1A 1II3A 3OMGA 2KOLA 4OXPA 4WAFA 4URKA 3EUB2 1CKNB 4JBWA 4LNFA 2AHOB 4LDTB 3A1QB 3BS1A 3K5LA 2VH1A 1PH6A 2JXMB 4GIVA 1C8CA 4APVA 5M5XB 2M4NA 3HHMA 2Q8IB 4TKNA 5DM63 1E2VA 2VQEL 4TUUA 5AZHA 4YY3L 1F9JA 4BKSD 4WJNA 1L4ZB 2LGDA 2ZTCA 4GDLA 2K04A 1ZGUB 2WXQA 4S0RA 3T16A 2V3NA 4ARCA 2B63B 2FCMA 1WE6A 4B3SQ 1KDCA 2I1KA 5EPKA 3BINA 4HXDA 5AEKB 2LY7A 4JI0Q 1E8ZA 3VQIA 1IL8A 3QWNA 3FKIH 1FCCC 1PTOC 3I7FA 2JXXA 2PEAA 3KYDD 5G3LD 3HM3A 1VQOA 2WAQB 1MSHA 2L1BA 1TBEA 4RKLA 1MD2D 1Y1VH 2V1YA 3I9V1 1RODA 2ES2A 3I4MH 1L6UA 1R4MB 3I8ZA 1K0SA 1R9TH 1I6VC 4JYAQ 1HTOA 2KDBA 2GMIC 2CHZA 3HRDD 2WKDA 3I63C 4ID6A 1JOKA 4DR7Q 4A3MH 2DENB 5KEEA 3JSVA 2BB5A 1WTVA 3S1MH 4RF1A 1AN8A 3CAMA 1GG3A 2ZW1A 3WDNA 1S72A 1WGGA 1V80A 1VDZA 1PRTF 4MJSA 1SNPA 5K5PA 1U4PA 1KLVA 2PMZE 4ZCKA 3TREA 3HOYB 3HOZB 4FXDA 2FINB 4DXAB 2WLBA 1EYDA 3ZNZB 1XX8A 5I6YA 3PO3G 2N49A 4XX5A 2K25A 4C3HG 4ME5A 2KNBA 3KUPA 2KBNA 4JI6L 1J6QA 1F9PA 4BBRG 2XWJB 1BO0A 4M1UB 4V0BA 2KHSA 3Q0AA 2F4VL 1C76A 4FA6A 4TRDA 3AULA 1WJ6A 1CUKA 3PT2B 4HSPA 1EUVB 2CKZB 1UEBA 1WWTA 2ZZPB 3S2DB 4R4OA 1PRTD 5JEAG 1C7YA 2MBEA 4JLCA 4GKKQ 4ICUA 5AJ3L 1S3SG 2PW9A 4RMAA 2CHBD 3MXNA 1L1OC 1RCVD 2DN8A 4P71A 2E2HH 3BJUA 5LHY1 2ONQA 3I4NH 1BCPC 2G4SA 5C3WA 4EE2A 4A3FB 1FXIA 5JHAA 4PMCA 1IBLL 5HKHA 2WIIB 1PGBA 2OF1A 3TRZA 3BK1A 1GJXA 2LVQA 1SNDA 1UE5A 2K5DA 2JF5A 3CIRB 4C3JH 3H09A 4WH4A 3NP8A 2B2UC 3BYTB 4HJ5A 1GC7A 1TKGA 4JYAL 2B2WC 5FLXE 2YEPF 4GN5A 1BBWA 1EWIA 2W3RA 3N6RA 3Q8BA 2HD3A 3PO2B 4W9LA 4CKCA 1M4VA 1V8CA 3ND8A 3M4OH 1BT0A 4A93B 2N7EA 2B39A 1YBYA 4ZK9B 4DR5Q 3A8JE 3NPPA 2EMSA 2M56B 2BYEA 2IO0B 2Z0SA 3WOEA 1MI2A 1PUTA 4JWUC 5AUIA 4RA8A 1E7VA 5CORA 1HTLD 1WY8A 2K4KA 3DBLB 5T8IA 2KACA 2C5LC 2RCFA 1B4OA 1TS2A 3VR6A 4ICVA 3H3VI 2V0GA 4KKUA 4HIOA 4K5VA 5JJIA 4FULA 3SR6A 3D4WA 4OWXB 1YJ9A 4IN3A 3QAQA 1IBXA 2MA9B 4DPGA 1A3VA 5IP4D 2QSDA 4NP5A 2Y0SG 4CKBA 3OIPA 1N36Q 2I2YA 1VQIA 2ZXPA 2PIAA 4IALA 4GKKL 1I42A 2PI2E 3GQBA 1LT4D 2JY6A 2MPMA 1SLJA 3VDYA 1QF6A 5BO4B 2D0OA 3A9KB 3AU5A 3PZ7A 4LUZA 1S5FD 3PRPB 4TQUS 1RHPA 2ZTDA 1QUQB 2A6ED 3HKZG 3U58A 5ELBA 5E7NA 3I4NG 4II3B 2FIDA 2MSED 1VQ4A 5LNK1 5IT9L 1E8WA 4A3JG 2K3UA 3PTFC 1SYGA 1STAA 2TSSA 1JMLA 2PLPA 3U30A 5A2QL 3G7LA 1SYCA 2D0PA 3J80E 3MTSA 2KJHB 3PUYA 2LFIA 3QARA 1IW7C 1VQFA 2O4XA 2E75C 2R2QA 1GO3E 1PFSA 3KF6B 3TZUA 2KD0A 3VRAB 4PK1A 4AS1A 4KV6A 1SE4A 1SDFA 3RZOB 4PS8A 1XWEA 2LFNA 4C1NI 1QCBD 2BDOA 4AOFA 4HEDA 1G51A 1PH8A 4TQ0A 5BN4A 2KOXA 5C3EH 3K5NA 1F2LA 2RHSB 4KIKB 3G4SA 1WF9A 4W9CA 1F2RI 1F52A 3GZNI 1W6KA 4FNFA 1EU3A 2LVOA 3ZQ4A 2RCNA 3JYUA 4ACFA 1A2UA 3IRBA 4K14A 4RAUC 2FJ2A 3NSWA 4FADA 3JAMi 1MJDA 1G2TA 1WCMH 2KCMA 3T3NA 1PRTC 1Y8OB 2NYZD 3SHQA 3R8BA 1T0YA 4UPAA 2JA6B 4LJOB 3OOCA 1U0LA 1XCQL 1SB3C 4EZKA 2WXJA 3A5UA 4OZAA 3KUDB 2I0QA 1TXYA 3NEMA 4LW1A 1Q3LA 1E2ZA 4GLAC 3ZTDA 4JOIC 3TS2A 5FOBB 1F0ZA 3UDFA 3KLWA 1YJJA 4KV2A 2BWES 3GTMH 4MJSB 3J81j 4BAXA 2K50A 4BBSH 2CJOA 3P75A 5BN5A 3A8IE 3V6CB 1E1TA 1X32A 2L7RA 5IO9A 4YTMB 2F0UA 4USAA 2N1WA 3H1UA 4GN3B 2EYHA 1XJVA 1VQDA 4AUQC 2EDGA 3Q8FA 4HKQA 1GUAB 1Q46A 2V3SA 3Q23A 2OJWA 5CX3A 4RCOA 3I57A 4Q0FA 1X56A 1EWYC 2MFIA 1TYGB 2EIFA 3MC8A 1LO5D 4CJ1B 5CHWA 4ZDVA 1TKEA 3T1YQ 3PRMB 1SBBB 4A93H 1TU2B 3A74A 1SROA 4JX1C 4I7AA 3EA6A 2MO1A 2HD5B 4HKZE 1SE9A 3SK5A 3N1ZC 2INDC 1AZPA 1BCPB 4UP7A 3HOWG 4LLGM 3BVZA 3DHIC 2NUCA 2B2YA 1EY5A 1NR2A 4HAEA 3NE5B 2JA8G 1JOQA 2FBWB 4ARIA 2F0LA 2CU3A 3D4RA 4LJPB 3AEDB 1PZID 1ASYA 4A3LH 1I94Q 1WR1A 4YCVA 3S16B 3W1BA 2Y0SE 2OHFA 2CHXA 1RFKA 2WXIA 5AZGA 3KW5B 4MEMA 2YTVA 3A8KE 2KWCA 3W9CB 3R66C 4NZLB 4AQ7A 4MGZE 3VDZA 2NWGA 3I4OA 3FILA 4LF5L 1XLNA 4ZLTF 5IODA 1TR5A 2HCCA 4LFBQ 4H2AA 5HI1A 1D2BA 2L83A 2MQJA 1K83H 4ABNA 3APCA 4IPCA 2NZOA 2NVXB 3OG5A 1HNWQ 1TKYA 2KHWB 2SNSA 3AEBB 1DOMA 4KX6B 2DBYA 2ZW0A 1A0IA 1BDOA 3RNFC 3AFPA 3PSIA 4H7BA 4A3IH 4F7XA 5K36G 1H9RA 2O6VA 2INPE 2WXPA 2H88B 4KGTA 4FVMA 5FJ8G 3T1YL 2HHHQ 2GBJA 3VR3A 5JPMC 3DEOA 1AE3A 1CT1D 1K8MA 3A1QA 4E6IA 3D31A 3WANA 1Q90A 2IJ0A 4XQQA 4HJ8A 3TBLD 3ONSA 1A70A 4KZ0A 2CH4W 3SE0A 5D7GA 4JBJA 3PHXB 4NPSA 3RLOA 3HOUH 3N1XC 4NKLA 3PLUA 5HG2A 3FRPB 4DR2Q 3QR8A 2PMVA 1QOBA 2RF4A 3KF8B 1SAPA 3AEFB 1HFNA 1YJWA 4X3SA 5CR3A 1STYA 2JA7H 2DWQA 2MWSB 3Q6BA 2J0MA 2KLGA 1EWCA 1IGCA 3EROA 3ZRFA 5C3JB 4FJVB 4JI8L 1PXUA 1B7YB 4H13C 1GM5A 1GUWA 1M8AA 2NVTH 2MBHA 2IW3A 4HIMA 5DEHA 4BXXG 1KQSA 1B50A 2WQYB 3R2IA 4MNOA 2D11A 4CYEA 1RF2D 4YTPB 2M19A 1D4BA 1WGKA 2Z0DB 3TJPA 3CSFA 4QAYA 1NSNS 4DR5L 5GADC 3L54A 3ZO5B 3K6OA 3P63A 2G5DA 3C1EA 1QZEA 2VQFQ 3BU2A 1YI2A 3GTQB 3FKYA 4AWJA 4CHTB 2JA5H 1SRUA 1CZGA 4YWGG 3HOUB 3UGBB 2JE6I 2IDYA 3FKIB 4GOCA 3ZIMA 2WXKA 1YHQA 1X65A 4GOPB 1WD0A 1E0ZA 4FF3A 5IYBH 2N1VA 2QF7A 3ER0A 4JI5Q 2DYOA 3GOEA 1ONLA 4CBVA 2PW5A 4K8JA 4DV1Q 1I7HA 1FD7D 1GB4A 3NHEB 2PCFB 3PPAA 2AL3A 1YMHE 3RLFA 1Z6HA 3SFEB 1HZ9A 2JRHA 4P2CB 3PGEA 3P7JA 2K5VA 4F8CB 2Z4HA 1XNQQ 3FPPA 2IGGA 2P5ZX 2JQRB 1OQYA 2G9HD 5JEAJ 5D14A 4BA2I 4UP8A 3U50C 4G7HC 4E3CA 5C4JB 1PHJA 3S1QH 4W9HA 5I9PA 1IYVA 2YV5A 4TSSA 5BYQA 3ZXRA 2KA7A 3K81C 1I4GA 3OMCA 2LD9A 1OXVA 2NTTA 2FCNA 3B1LX 2NN6H 4LF7L 1JCKB 1XNRL 3N30A 3RUZA 2GVAA 4Y7NH 2DHZA 1S1QB 2L5TA 4JI2Q 5LMUL 2YU9B 3M7NA 4HPPA 3GP7A 5M3MH 2F0HA 3S1MB 1I4QA 2PNHA 3BDLA 3IT4B 3IVFA 2BA1A 2ZNVC 2K03A 3ND9A 1IUEA 3D0FA 4WQMA 1ICFB 3H3VH 3B6YA 3A9JB 1AW7A 4XWWA 1X54A 3KLSA 4H44C 1VRAB 3BDCA 1IZ6A 1IBMQ 2MUYA 3ZRCA 2SAKA 5LXHA 1JWMD 5M9OA 2ZM6L 4GLXA 5C4XB 4KJOA 1KRTA 1TGZB 2BGFA 1FJGL 4JI8Q 1YQBA 2DUDA 2PVOD 4TMAB 1QLBB 1DCZA 4DK0A 5IY0A 1PTOH 1Q0WB 2KVZA 2QHOA 1EY9A 3I90A 1LABA 2DY8A 2F52A 1TWCH 3CQZH 4KY7A 2NTSA 4UP9A 4C2MH 4DV0Q 2W54A 5IYBG 2ZJPA 1L4DB 3KH0A 1BMLC 1I4RA 4K5XA 3S2DH 2WP9B 3BY4B 2QKIC 4IG7B 4OVUA 3TMEA 4BBNC 3ETRA 1RLFA 4DHJB 1QZHA 2L00B 2D5DA 4KKSA 3U9SA 1H9SB 1C9OA 4NDXA 2JA7G 4IFDJ 4OO1G 1L1OB 2C7NB 2IX1A 3UE1A 1RRBA 2LGXA 1EZ6A 3QOLA 2QW7A 1IGDA 1GC6A 1N62A 3RNAC 5NUCA 2Q2UA 1W6JA 1C4CA 2NZHA 1JALA 3T9LA 3TEZA 4LAAA 4JPBW 5TR5A 5DPRA 3AMUA 2O6VD 4ANWA 1MSGA 1U9RA 2MX2A 3AE2B 1FRDA 3A7AB 3W5VB 5E6JA 3EQLC 4JI6Q 2OJRA 1OO9B 4RGOS 4DUYQ 2ZCCA 2M0XA 1T0SC 3MJ5A 1UE6A 4H0LC 5M3MG 4OELB 4GDKA 1IBLQ 2F0EA 1GNUA 3BK2A 4C80A 4XDXA 1GPXA 4P74A 1YJNA 2D3BA 4K2LA 1RM6C 1EYAA 1CKNA 4DV6L 4A3JH 3DBHB 4NQKE 1D5XC 3O65B 4PMBA 4OO1I 4HDQA 5J18A 2BS2B 1KC8C 5J3BA 3KYCD 2RHQB 2K9XA 4AYBB 1EEFD 2WX0A 3EVQA 5IGCA 1QJOA 1C79A 5EE0A 2F0JA 4HROA 2OEOA 3KWVA 2F0IA 2NVYB 4BS9A 3AB5A 1PRTB 1CSQA 3W3AA 4WWOA 3M9BA 1KDAA 1PQSA 2KMCA 3AE7B 1V86A 4ASWC 5DCNA 2NB0A 1E24A 4L5TA 3RNCC 5JZEB 1K3BC 1V43A 1MI0A 4FHKA 3S2HH 3VH4B 1PH1A 4B3TQ 2PQAA 3ICEA 3VVWB 4F1SA 2RBMA 1WFQA 1WCMG 2YTXA 5EPJA 3ZJYC 3TP7A 2UUAL 3ZJVA 2WP8J 3I72A 5I9OA 4A4IA 2ZCBA 3QJZA 2GBKA 1WCMB 2N3SA 5DAUA 4M01A 3K0XA 2RMMA 3NJTA 1UELA 1IYJB 2I5LX 1VQ9A 1AP0A 1QNKA 3S9WA 2ZNVB 1XLOA 2MHJA 3NVYA 4DAYB 2F3IA 2XK5A 4I6NB 1SGHA 5C44G 4KSLC 2A19A 1FNVA 3A4SC 3H7PA 4K6DA 3DWPA 3LDZE 4OVZA 3NWSA 1IKMA 4YWMA 1RKNA 4QQBX 1A2TA 2KHIA 4R8NA 5HHDG 1T5EA 4KKTA 1VZ8A 4N9TA 4B08A 3L7ZC 1YZ6A 1CZPA 1JRPA 2VQFL 2V1CC 1D8LA 3S14H 4W9FA 1KL9A 4XTCS 3KUZA 2RVLA 2K52A 3ZUNA 3CQZB 1WJNA 2CS4A 3OPOA 4AIMA 1HPCA 4R4IA 5DPSA 4LNQA 1JJ2A 1PFDA 1STBA 1VQCA 3SHLA 1HQRD 5A2QE 4HMJA 2JSVX 1BQQT 1P16A 2L05A 4DV1L 2NVYH 1NCVA 3APDA 1OQQA 2JK8A 1L0XB 3TEYA 5IE8A 4CDFC 2QIEB 3I3CA 3RN5A 3KJOA 5C0XG 3A9JA 2D07B 1YX5B 2L32A 1P7FA 4GOPC 2XEWA 4LNIA 5G2NA 2IO3B 1O7ZA 2MCNB 2EY1A 4J8QA 2W55A 3AU4A 4XT3B 2K8BA 2BBCA 1X55A 5HY6A 1UWMA 2UU7A 4LF4L 4CQNA 5I2XA 3FVQA 3H94A 3G71A 2CR5A 2PPBC 4KD4A 1E10A 4R4QA 3KDFB 2H5XA 5CMDA 4A3CH 2YVCA 1HXYD 2D3CA 1KH0A 1QNUA 2ASBA 5D6JB 3KUCB 4OIJA 3NUCA 1FXAA 2IO2B 1X3EA 4HK2A 3M4YA 3HVDA 3AXCA 2J0JA 1UAPA 2VUMB 2NVXH 1I6HB 1VD2A 1WJ4A 3BDOA 3CP0A 1DOIA 2A5UA 1KDBA 1N6ZA 4A3OA 1HNZQ 2ID0A 3ULJA 2Z8LA 1PDXA 2RA4A 3BZCA 2DJFC 2Z59B 3K5OA 2WXNA 4RMFA 2K1FA 1DOXA 1JE5A 4B9WA 1A63A 3WAMA 5EKKA 4B6WA 2HDEA 4IO9A 1IBXB 3J81E 2KEEA 2UUAQ 1P1AA 3ITPA 3LWUA 3UINB 2CVRA 1K8OA 2NCNA 3Q3JA 1VQKA 3S2HB 2R93B 4B3TL 5DPWA 2Q8RE 3SGIA 4G7ZC 3BWUD 1SYBA 1PFMA 3U8ZA 1WXSA 2KYWA 2R92H 5IYDG 1R4MI 4A3GG 2V4IB 2JA7B 4JOIA 1XNQL 1ASZA 2ZTEA 3AEAB 4EUTA 4GDKB 2A4ZA 3RUIB 4CJ0B 4HJ7A 1QZGA 3ZNGC 1TS3A 1UE7A 3IFTA 5GROA 2RDFA 3KBXA 2AX5A 2K39A 3B08A 1LTAD 2KMMA 4FO2A 3DHQA 4ALPA 3WIMA 4KN7C 2LHDA 1WGYA 2RQXA 5EE3A 5C1ZA 5M5XH 4RNAA 1E7ZA 1Z9FA 3PO3B 1ZKHA 1LM8B 3LX0A 2E2HB 2SDFA 2N9LA 1GXDC 1B1ZA 3ZLZA 3ZXVA 5BMIA 5HGTA 2ZVOA 3M4QA 1KM7A 1EF5A 4HLEA 2LXKA 1ESFA 2Y5CA 4ZAIA 2A6HC 1O80A 5JJKA 4GNXA 3AE9B 3S1QB 2KX3A 1L0WA 1QVCA 2PTLA 1EYGA 3DBHI 4C3JB 1TY0A 3A0JA 3OHXC 1YNTE 2JZ3B 4KZCA 1WGDA 4DU9A 3QIAA 3L2PA 2IX0A 1WSPA 2Q2HA 4CGYB 2EJFC 4LNKA 2L0FA 4YL8A 1F77A 4P6VF 1K83B 3KK7A 3TDQA 2BW2A 3RN9C 4HSVA 1XMQL 3VR4A 1WTRA 2JT4B 4B95A 5H8YE 2CU1A 2ZXRA 4OX9Q 3SDLC 5C2TB 4MGKE 3UIPB 2K7VA 1CQVA 2C60A 2D62A 4L8JA 5HGQA 1EIGA 1JB7A 1VQ8A 1WMHB 2O2LD 2JPHA 3CKIB 3HVZA 2B63G 1RTNA 1DM0B 4LFAL 3QX1A 4EEWA 3AE6B 2AQ2B 1G6ZA 2WYQA 4XT1B 3HK0A 1GUSA 5IYDH 4DV4Q 2M9VA 1VR9A 4IUMB 1IHZA 3TEHB 4EZLA 1YJ1A 2MP2A 3AECB 4D2KA 1PTOB 4DNRB 1OTCA 4L5QA 3CMMB 2K28A 5IYCH 1PH4A 1CK1A 1EYCA 3ERSX 3J81i 3FP9A 3OYYA 2K75A 3IT6B 3PRZA 2MGSA 1V49A 2DYBA 1K3RA 3GE3C 3RCZA 2AYOB 3FHWA 2KMAA 2NPTA 4WWNA 3K7AH 4YSYB 4XIGS 2LWPA 4FHJA 3VYSA 5EE1A 4IOCA 5LMNQ 4A3DB 3CSTA 5BN3A 2JRIB 5G55A 1JWUD 5HURA 2QMTA 3VHTC 1HQMC 1MHXA 1DGSA 4YY3Q 5KRUA 1WTQA 4NJCA 4JC0A 2AWTA 2WHIA 2JYOA 1KD1C 3FC4A 4K7UA 2K32A 2N88A 1ZEQX 3EIVA 4AJYB 2HQEA 1GHKA 1I3QB 3NZUA 4FYDA 2M17A 1CA6A 1LM0A 2KEDA 1K53A 4E74A 4C3IB 4FXKC 1TT5B 3ML8A 4W9GA 4XQJA 2W3SA 1TWFH 3AH7A 3WOFA 5C4HA 2JA5B 2L3ZA 3H9DA 5I4DA 2WWZA 2N55A 1ACCA 3NUHB 3CU7A 1NMGA 2HDLA 4KDLB 1IW7D 2GA4B 3W1GA 5BR8L 2AMCB 3EFXD 1NJIC 2JZPA 2YEPB 2R61A 3M63B 1KABA 3DVGX 1EFID 5J39A 4A3MG 3TZDA 4DKAC 4A93G 3W1SA 4J3OD 1XQQA 4N9F4 3AYHB 3VUWA 2Y0SB 2J7QB 4L5RC 2VZKB 4A75A 1YQ3B 1Q81C 1Q82C 2BTEA 2KDMA 3F2BA 1YHBA 3C3LA 2Q2TA 1HR0W 4MGYE 4A3LG 4NAWB 5IIFA 2C7HA 3UDXA 2BKRB 2A68C 1KAAA 4IURA 1DGJA 4OZBA 5D3DA 4AP4C 1GUGA 2HIXA 3JAML 3NELA 1ENAA 1RWSA 2INNE 2LASA 3Q2AC 3KF6A 1G291 2X69A 1OQRA 2EJGC 1WGHA 1XMOL 3DM1A 5CC4A 1V2YA 3P4RB 3UI3A 1B9RA 4Y52H 4GN4B 1N34Q 2V3PA 1E22A 1QUQA 3K57A 2ATWA 1YN5A 4FF1A 4FJZA 4X57B 2KWVB 3I4LA 2QDBA 1Y1WG 1FFUA 5KNCA 3IAYA 4RWSC 3ZGZA 2DGYA 1KFYB 1WE7A 3PF4A 2GN5A 2DZMA 1WTPA 4FLHA 4LDTD 1WX8A 3GTOB 5C3XA 1JWAD 3B0AA 2WV6D 5DM73 1X3GA 4ZKCB 4HEA1 3F2UA 1I35A 2CH4A 1JRUA 1ZP0B 4A3BH 4DV3L 1BBXC 5GAGC 4JI2L 1H9MA 4HN7A 1NBWA 1D3ZA 1Y69U 2KVRA 3HOZH 4A3FG 2L76A 3H6NA 2EY6A 3GTKB 3L0OA 4IFDI 2OQKA 2O2VA 3BG3A 4KY5A 1J8CA 4DAYA 3PV0A 4WJ3M 3ERQA 3GS2A 4WFN3 2PE9A 2L9HA 3T53B 5EPLA 1T0QC 2OT2A 1TWAB 3HM6X 4IW0A 3V61A 2WNMA 1SMYC 4B9XA 5CV4A 2AWOA 2ZJQA 2JYEA 1U4MA 1VCBA 3P4SB 4OHJA 4BBRB 2O5JC 2K33A 2NBFA 4JCVE 2B29A 2KDIA 4LUVA 3Q8CA 2K5PA 1R7SA 1MJEA 1DOKA 3NOBA 1DOLA 3KFUA 3EN2A 5FR6A 5E3FA 3PQIA 4DK3C 1WTXA 3UIOB 4L23A 1HNWL 5KYLA 1MG4A 2BDNA 1SIFA 2LUMA 3RNGC 2H4OA 3PIPA 2A6HD 1K8RB 2IT1A 4KHZA 3KWLA 2JN4A 4IUVA 3K9PB 1SEBD 5FLXc 4IJLA 5C23A 3ZNID 2C9OA 2SEBD 1KOTA 4NXNL 2J0TD 4N8X1 5KNBA 5JJLA 2JUOA 5E6OA
chains in the Genus database with same CATH topology
3GTLB 2M2LA 4IOIE 1WYGA 3SK6A 4G7OC 3HKZB 1GHJA 3K5MA 4QMGA 1QOAA 2HDMA 1JE4A 3TBIB 2MP1A 2K5WA 1K50A 1QT9A 2IGDA 2L4NA 3V2TA 3DWAA 2WACA 2A5HA 1NI3A 3HUIA 5LL6S 3S14B 1NENB 2HUGA 1TVXA 3RPFC 2RKSA 2NMQA 3IL8A 2F0PA 1SSNA 1F9SA 3P1MA 4A3JB 4MACA 5FO8B 4XXEA 1N5WA 3NVWA 5I6WA 4R3DA 4G4KA 3CRKC 5IGEA 3TUOA 5M3MB 2XN9C 2EYFA 3NK9A 3P4PB 1LTTD 1PTOF 3I73A 2J52A 2JU6X 3U52E 1FIQA 2M0AA 3X3NA 3UI2A 2I38A 1HRJA 2G1EA 1F2YA 2ICIA 5EBCA 1QE6A 3VYUA 1N61A 2E74C 2QMTA 3KBGA 5IOCA 5KYIA 2F03A 1E0BA 3TEXA 4QB4A 1FO4A 4NW2A 4S3SA 3B9JA 2KCNA 1STGA 1J7AA 1PFNA 1U4RA 3MFGA 1JC7A 4ZHPA 1B9NA 2L0CA 3K0YA 3M3YB 2KAJA 1SMYD 2AWNA 1VDVA 4OGQC 3KF8A 5FLXL 5MPOA 2KJXA 3MZ5A 4RGMA 1GUNA 3NVZA 3CHBD 4DAVA 2PQEA 4O42A 2WU2B 4WWMA 2FMMA 5C6AA 3ZYYX 3TEWA 5D65A 3DWMA 2ZT9C 1UEAB 4A55A 4KGRA 2A68D 1GB1A 1JW9D 3T4AC 2GB1A 2WXRA 4U68A 2DNCA 3NVVA 3NWTA 4EQNA 3D3RA 1TIID 4PT5A 3NRZA 5A35A 1EL0A 1ZOYB 5AUKA 4L1BA 3I70A 4IUTA 3QOJA 3S15B 4KI0A 1F9RA 1EY4A 3MXUA 1C77A 1LT3D 2HTME 2IX3A 3J80L 3W2DA 2X6LA 1CA5A 1VMPA 1LTSD 4P16A 1TWFB 1ROEA 3NXWA 3HEJA 3FDTA 5ELFA 2BB6A 1HA6A 3CRLC 4MT5A 4M0WA 3H0GB 3DMUA 1TWHB 1C48A 5G3LF 2QILA 5LL6X 1K52A 4FF4A 3CWIA 2LGIA 3GB1A 3C2PA 1O7LA 1I4HA 3A55A 1EY7A 5EGTA 5GXGB 2SOBA 1D6EC 3N52A 2VXWA 4DQOC 1YN3A 2E6XA 4ODGA 5FO9B 2LEKA 3QB3A 2JWUA 4BA1I 3VR9B 4XDCA 1ZUD2 1S5ED 4DA2A 1GUTA 2EXZA 1DD2A 3MC0B 5M3FB 1EOTA 2JEAI 1V8QA 5FR3A 2J4XA 3NQIA 1ET6A 1Q10A 4PQXA 3VR2A 2WU5B 2MJDA 3C8YA 1CZWA 2E2DC 1HUNA 3AB9A 5CGKA 3NHHA 1LTRD 4U673 2RPVA 5T1GA 1J7CA 2BYTA 2MJ3A 3HZXA 4ULLA 1EU4A 1FCLA 1NVID 1SXTA 1CI3M 1YQ4B 1ENCA 1ZYRD 5C0XJ 1LACA 1I50B 1E2WA 3AE5B 2Q5WD 2KCCA 1STEA 1QG7A 1R4QB 4DFAA 1D1IA 3HS0C 4BY1B 4QIWB 2WINB 3SEBA 4WORA 3BYYB 3FAHA 2L52A 1N5XA 1Q1BA 4TQ1A 1BNZA 2JX5A 2F1MA 4XYOA 2RSNA 4F87A 3AMZA 4A3KB 1I4XA 3IAS1 2ZXOA 2VZKD 3ONAB 1L5PA 1QQRA 1BOSA 4J1MA 4N9PA 2LS01 5F2DA 5I2YA 3NTKA 1LT5D 2EKIA 3E5SA 4MIUA 4K2KA 1HZ6A 1JB3A 5E1FA 3IAM1 4KMUC 4RCNA 4OZCA 5AFWA 2QCPX 1EIHA 5KNDA 3AM9A 4ZQ3A 4ZUJA 4ZRPA 4DAPA 1SNQA 2BCOA 2IPKD 1Y1VB 3E6ZX 4GLSC 1E6EB 1VF7A 3H91A 2R92B 1D1KA 4BY7B 1RJTA 2Z4IA 2ACZB 3M85A 1A3TA 2VB2X 5KGUA 2CQAA 1AWDA 5CYUA 2EYLA 1EM7A 3HOXB 4PMWA 1EY6A 2FFKB 1LLRD 1V1PB 2OEDA 4Q2JA 1SIJA 2IL8A 1C9FA 1RDPD 3BVGA 1QOGA 1AEXA 3FEWX 3VA5A 4A3GB 4HCSA 2I07B 3AEGB 1DXMA 2J7ZA 3M4OB 4YSXB 3LNNA 2AUKA 1O78A 2KQ4X 3Q69A 2FE8A 5ELDA 3MXGA 1FD6A 2WXMA 1E7PB 3T3OA 1RYJA 3Q8EA 2QEJC 3BVMA 2J42A 2L1AA 3NTIA 5CV6A 1ILPA 1ESRA 4KGSA 1JICA 3R3OA 4A3IB 5FK9C 4UDUC 2LHEA 1X3QA 1ICWA 1EY8A 4KKJA 5EQ0A 1FFVA 1N60A 5TSSA 3RMHA 2JP1A 2N9KA 4L6TB 1N63A 1FGBD 1TWCB 3S1NB 2EY2A 3NTHA 1R4PB 1Q8IA 1WD1A 3H3VC 1XTCD 3C46A 4FXGC 2XRSD 1KRHA 3AEEB 2L12A 4ZRZA 4C56C 1ZXHA 2JYTA 4RGTA 1HFGA 3K58A 2NZ1D 2DNEA 1I4PA 3SR1A 3I91A 5G5HA 4XWTA 2EZVA 1BUVT 2LMCA 2I46A 5ISRA 2KECA 2MJEA 3T56B 1XYIA 2E76C 3T13A 4Z9CB 2NN6I 4X3UA 4ZUIA 1Q12A 3J7YW 2WXFA 1AYFA 1LTGD 4DGZA 3J81L 3SXHA 2H89B 4WRDA 1F9QA 1ZKOA 1G91A 3K59A 3ABVB 1UGJA 1DYQA 1JQ4A 2F0VA 2A73B 1C4AA 2XNAC 2CJNA 1XCTL 3TSSA 2WKCA 3I4MB 4WURA 2E2IB 2M00A 4C1NK 1ENFA 1FMAD 2F0FA 4HCEA 4HTHA 5JVG3 2EY5A 4EQPA 4N59A 1NYQA 2NVTB 1TS4A 2CW0D 2W82A 3JAME 3QG1A 4WIPA 1PZKD 1FNWA 2B2VA 1HA5A 2H1EA 3MA2B 4C7YA 3S17B 3W5UB 1XLQA 4IUPA 2XRQD 1MGSA 1HEZE 1CHPD 1DONA 1T6BX 4PV1C 1CFMA 1EY0A 4K6LA 4RH6A 2X38A 2KN4A 1B44D 2EPBA 4DF7A 4WJWA 1U4LA 1ZYRC 1HUMA 2MEKA 1OXXK 1G8ZD 3KLSX 1F2RC 4YXDB 2G9DA 2F0KA 1B2TA 3P20A 4FP5D 2JXTA 3BZDB 5CV7A 1S5BD 3AN1A 4QUFA 3LXFA 2EYOA 1OXTA 2A74C 1TY2A 1A6XA 2WDRB 4X3TA 4TKOB 3H8HA 4OW0A 1UNSA 2HCIA 2RSOA 4K8IA 3P4QB 5JEAH 4J6HA 2F3VA 1ZPSA 1C78A 3RZDB 1TT2A 2PZWA 4A3MB 1OXSC 3A54A 1FR3A 4FXCA 1DOYA 4GDLB 1PFBA 4CKEA 4BWGB 3VR8B 1SYEA 1T3QA 3GV6A 1PLFA 1T5XD 1OFFA 1QOHA 2EJMA 2JEBI 4Q5VA 3MFYA 5C5LA 2KQ3A 2C5CA 1X3PA 2K01A 5CV9A 3NZ3A 2Y3AA 4ZYSA 1PGAA 1UWXA 1MBYA 5ELCA 3E9SA 3ZJUA 3GTJB 4LK0M 4Y7NB 3J7AV 4ZKBB 5E4WC 2WXHA 4XYQA 5BYSA 2E3TA 4XDDA 3MWYW 1XLPA 3AE3B 3OIQA 5CBEE 4UAIA 3P1HA 1V97A 1YNNC 4IFDH 3OWFA 1S5CD 3J9CA 4YSZB 4NMZA 1A15A 4HJGE 2DLBA 4L63B 1DZ1A 4F88A 3URYA 3OW7A 3V3XA 5C5MA 3M7GA 2PZTA 5IT9E 4B0EA 4DN4M 4HRSA 4K5WA 3B2GA 1Y1WB 1RD9D 3KLRA 2D5GA 3R2TA 2F0WA 1GAQB 1SNMA 1ZDXA 4NAMA 2BE5D 1C4PA 3KQ4A 4RF0A 2V4DA 1CM9A 3D4DA 1CTMA 2Y5PA 1IYUA 3MHBA 2AUJD 1SJED 2F0QA 1QOFA 1AZQA 2LKVA 1XXGA 3EGRA 2BT6A 4DK1A 3TP8A 1LTID 3PIO3 3LYYA 4IFDG 2K0PA 2Q8TA 1YNJD 3TP6A 4A6QA 3WCQA 2MJ8A 2PZUA 4ZOHC 1V1OA 2B2TC 2F0GA 3BIID 3DEPA 3J7AF 2PW7A 3PMFA 1JR0D 2R3ZA 5JOBA 1DJRD 1K51A 3U4EG 2WXOA 1FNUA 4DXGA 3PIP3 1PZJD 1MVKA 2EELA 4DXFA 5KIXA 3Q8AA 2LMCB 4KKIA 3HOWB 4OO1H 3G6JB 3HRZC 4M8AA 3EJIA 5BMGA 2K5QA 4JE3B 3GTMB 1ET9A 1SNOA 2MH7A 2F0SA 3N9YC 4OIKA 3U2SC 3D6WA 2EOTA 4RKBA 1RTOA 1F2MA 1QILA 2AQ1B 2TMPA 5BMHA 1FRRA 2FHTA 5D3IB 2B2VC 5IGGA 3PO0A 2CW0C 1ZXTA 5CV8A 2A6EC 1XEEA 2LJIA 2YYZA 3AV8A 1HZ5A 2B76B 2F4IA 2IGHA 2R6GA 1UUPA 4DNTB 3PUZA 2Z1CA 4A3BB 3PUVA 1SYFA 5IGDA 2ON8A 4C3JG 3VYRA 1NEKB 1KF6B 1STNA 2RDHA 5G5GA 4IUQA 5E4XA 5JAVA 1Z47A 1Q1EA 4A8XC 3IKJA 1J9OA 1BXTA 2R7ZB 5C44B 2X6GA 4PNYA 1VZ7A 3IXSA 1VF5C 1MHHE 1H9KA 2ICEC 4LK1C 4HMIA 3FILB 1B53A 3SFDB 4OL7A 3GO5A 4RHRA 1KLGD 3LB8C 5JVH3 3O13A 2F0TA 5BYRA 1YNND 4CJ2C 3L4PA 5EJWA 3U9OA 2XIWA 4G57A 5M5YB 3LWEA 2K22A 1B9MA 2DY7A 2WDVB 5H92C 1JQYD 3T51B 1IKLA 1YJIA 1ILQA 2XSCA 2BA0A 3S1RB 5EBDA 1JROA 2F3WA 1FM0D 1YN4A 1B3AA 4RHSA 1BR9A 4YIJA 1CJEA 5C0XH 2F0OA 3PUXA 1SF0A 4ITKA 2K6AA 1SSOA 3VYTA 4LJZC 1QB5D 2NN6G 4EVOA 3Q22A 1AFPA 2K1BA 1WRIA 4L2YA 4FF2A 2PVGC 1TQOA 3Q6SA 1Y8NB 2OXPA 2BS3B 3OWEB 2RDGA 2WXLA 3K7AB 4REZA 4YTNB 4LMQD 2F0NA 3HGBA 1P7EA 4EGVA 4KK7A 5ELEA 4BBSB 3AU7A 5FO7B 1D5ZC 1G2SA 3U7ZA 2SNMA 1YNJC 4ZHOA 1BF4A 3VRBB 2FMCA 3QJYA 4LTUA 4C3IG 2EE1A 2PKOA 4C3HB 4KTAA 1TWGB 2WB1B 4R9WA 3FMCA 1KTKA 5IGBA 3DUZA 3MVVA 4JPSA 4KY6A 1EQVA 1NR4A 2B8FA 4QF4A 2IWHA 1EEID 4N58A 3OSOA 3SK8A 3QO2A 1F2ZA 1KNAA 2D9UA 1NUCA 3DXJC 2XWBB 3VA7A 2BE5C 4C7ZA 2ENBA 5C0XI 1XF5L 4IDIA 2BOSA 4KHVA 1WTWA 2FUG1 3HP3A 2QJLA 2A69C 3NQTA 4I65A 4US9A 5JPNC 1KLUD 3R93A 3ZJTA 1MPEA 2WDQB 3L9AX 1KNEA 5JXVA 5K36H 3SVMA 3TN2A 2EYMA 2KUMA 4MN3A 5CBAE 5J22A 5FKAC 1GUOA 4JWSC 3MHZA 5C3EB 1V1PA 1ML0D 1VCIA 3V96A 4MH8A 4KN4C 4ZRQA 2N7JA 1Z7TA 4RGNA 4A90A 1SYDA 2F0DA 1H9SA 4XQNA 1J8IA 3RFZB 1VJKA 3E0JA 2D2CC 1LTBD 1OXUA 5COYA 5EE9A 1C4QA 2L11A 4MHEA 2PYKA 1VZ6A 4KJNA 3P42A 1TKWB 3MEHA 1D5MC 4V190 2EVBA 3SDZA 1PYWD 1S4ZA 4RFBA 1L0VB 3NBIA 2B2YC 3H6MA 3PZ8A 5J1ZA 1A3UA 1EWHA 4EQOA 3GTPB 5HFYA 3PUWA 4QUCA 1HTPA 4MM3B 4HR7B 3MAQA 1JOOA 1EZ8A 1FYCA 1E9MA 3AE4B 1L6VA 1ZDVA 3NBHA 2B2WA 1WVLA 1PMRA 4IUNA 4IZ8A 1TS5A 4O1NA 2NVQB 1BUIC 3MXPA 1ZXIA 1SE3A 5T1IA 3B2FA 1QWYA 2EYPA 1Y56A 3V05A 5C4ZA 1L0YB 5EKIA 1HHVA 2A69D 2VNUD 2WXGA 4US8A 2B8GA 1PDQA 4XE0A 3DWQA 1HCZA 3IFDA 2N0SB 1Y8PB 3HOVB 3FPUB 1NYRA 3MP9A 4A9AA 1EQTA 1QKZA 3AE1B 2WS3B 1TJEA 2JA8B 1SFOB 2E2JB 3D6CA 3A7LA 2B2TA 1BCPD 3GV3A 3RD4A 3A56A 5JJZA 1TZOA 2J53A 2KVMA 1SE2A 3X3MA 4I7ZC 3GTGB 2MHVA 4QCLA 1FEHA 2F0MA 4B0MA 1PTOD 3L3OC 2PNRC 2VB3X 4F8MA 4KD3A 1BCPF 1CQFA 4X3KA 5DNFA 1VMCA 1XO3A 4IKGA 2XVSA 1VLBA 1CHQD 1R9TB 2L55A 2PO4A 2DYMA 1J7BA 1SJHD 4IUUA 4JK1C 1JORA 2PMZB 4ILWA 1WTOA 4GZYC 3HG9A 1PGXA 5EKLA 2K05A 4YT0B 3C1FA 5CV5A 4C2MB 1S5DD 2O5IC 4A3EB 1LV9A 1STHA 4N6EB 2GRIA 1JWSD 1O7YA 2KWDA 3E56A 2GI9A 1NAPA 2B2UA 3AE8B 3D8GA 3TP5A 4R8IA 3I4NB 1GOZA 1SNCA 1ZE3D 3VR5A 2BS4B 1JWBD 1WXQA 1LT6D 3GD7A 2EYJA 4IQZA 2AQ3B 3DWGC 5M5WB 3Q24A 3SK4A 5IGFA 1H9JA 2JSOA 3NS1A 1II3A 3OMGA 2KOLA 4WAFA 3EUB2 4JBWA 3BS1A 3K5LA 2JXMB 1C8CA 5M5XB 2Q8IB 5DM63 1E2VA 1L4ZB 2K04A 2WXQA 3T16A 2V3NA 4ARCA 2B63B 1KDCA 5EPKA 2LY7A 3VQIA 1IL8A 3QWNA 1FCCC 1PTOC 5G3LD 2WAQB 1MSHA 2L1BA 4RKLA 1MD2D 3I9V1 1RODA 1L6UA 3I8ZA 3HRDD 1I6VC 2WKDA 4ID6A 1JOKA 5KEEA 2BB5A 1WTVA 4RF1A 1AN8A 2ZW1A 3WDNA 1VDZA 1PRTF 1SNPA 5K5PA 1U4PA 3HOYB 3HOZB 4FXDA 2FINB 2WLBA 1EYDA 1XX8A 5I6YA 4C3HG 4ME5A 3KUPA 1F9PA 3Q0AA 2XWJB 1BO0A 4M1UB 4V0BA 2KHSA 1C76A 1QF6A 4TRDA 4HSPA 1WWTA 3S2DB 1PRTD 5JEAG 2PW9A 2CHBD 3MXNA 1RCVD 2DN8A 5LHY1 2ONQA 4EE2A 1BCPC 5C3WA 4A3FB 1FXIA 4PMCA 2WIIB 1PGBA 2OF1A 3BK1A 1GJXA 1SNDA 2K5DA 3CIRB 3H09A 4WH4A 3NP8A 2B2UC 3BYTB 1TKGA 2B2WC 5FLXE 2YEPF 2W3RA 3N6RA 3Q8BA 3PO2B 4CKCA 1M4VA 1V8CA 3ND8A 4A93B 2B39A 4ZK9B 3A8JE 3NPPA 2M56B 3WOEA 1MI2A 1PUTA 4JWUC 5AUIA 4RA8A 5CORA 1HTLD 5T8IA 2KACA 1B4OA 1TS2A 3VR6A 2V0GA 4KKUA 4K5VA 3SR6A 3D4WA 4IN3A 1IBXA 1A3VA 2QSDA 4NP5A 2I2YA 4CKBA 3OIPA 2ZXPA 2PIAA 4IALA 3GQBA 1LT4D 2MPMA 3PZ7A 1S5FD 4TQUS 1RHPA 2A6ED 5ELBA 5LNK1 5IT9L 2K3UA 1SYGA 1STAA 2TSSA 1JMLA 2PLPA 5A2QL 3G7LA 1SYCA 3J80E 3MTSA 3PUYA 2LFIA 1IW7C 2O4XA 2E75C 3TZUA 3VRAB 4AS1A 4KV6A 1SE4A 1SDFA 3RZOB 1XWEA 2LFNA 4C1NI 1QCBD 2BDOA 4HEDA 4TQ0A 5BN4A 3K5NA 1F2LA 1F2RI 1W6KA 4FNFA 1EU3A 3ZQ4A 1A2UA 4K14A 4RAUC 2FJ2A 3NSWA 1G2TA 3T3NA 1PRTC 1Y8OB 2NYZD 3R8BA 2JA6B 3OOCA 1XCQL 1SB3C 2WXJA 4OZAA 1E2ZA 1Q3LA 5FOBB 1F0ZA 1YJJA 2CJOA 3P75A 5BN5A 3A8IE 4YTMB 1X32A 2F0UA 4USAA 2EYHA 2EDGA 3Q8FA 4HKQA 3Q23A 4RCOA 3I57A 4Q0FA 1EWYC 1TYGB 1LO5D 4CJ1B 1TKEA 1SBBB 1TU2B 4JX1C 4HKZE 3EA6A 3SK5A 1AZPA 1BCPB 4LLGM 3BVZA 2NUCA 2B2YA 1EY5A 1NR2A 4HAEA 3NE5B 1JOQA 2FBWB 4ARIA 2F0LA 2CU3A 3D4RA 3AEDB 1PZID 2WXIA 3S16B 2OHFA 1RFKA 3A8KE 3W9CB 4NZLB 4AQ7A 2NWGA 3FILA 1XLNA 4ZLTF 5IODA 1TR5A 2HCCA 4H2AA 5HI1A 1D2BA 2L83A 4ABNA 2NVXB 1TKYA 2SNSA 3AEBB 1DOMA 4KX6B 2DBYA 2ZW0A 1BDOA 4H7BA 4F7XA 5K36G 1H9RA 2INPE 2WXPA 2H88B 4KGTA 4FVMA 3VR3A 5JPMC 3DEOA 1CT1D 1K8MA 4E6IA 3D31A 1Q90A 2IJ0A 4XQQA 1A70A 3SE0A 5D7GA 4NKLA 5HG2A 3FRPB 2PMVA 1QOBA 1SAPA 3AEFB 1HFNA 4X3SA 5CR3A 1STYA 2DWQA 1EWCA 1IGCA 3EROA 5C3JB 1PXUA 4H13C 1GUWA 1M8AA 2IW3A 5DEHA 1B50A 2WQYB 3R2IA 1RF2D 4YTPB 2M19A 1D4BA 1WGKA 1NSNS 3K6OA 3P63A 3C1EA 3GTQB 4CHTB 1CZGA 4YWGG 3HOUB 2JE6I 2IDYA 3FKIB 2WXKA 1E0ZA 1WD0A 4FF3A 2QF7A 2DYOA 1ONLA 4CBVA 2PW5A 4K8JA 1I7HA 1GB4A 1FD7D 2PCFB 1YMHE 3RLFA 1Z6HA 3SFEB 4P2CB 3P7JA 2Z4HA 2IGGA 3FPPA 2JQRB 2G9HD 5JEAJ 5D14A 4BA2I 4G7HC 5C4JB 5I9PA 1IYVA 5BYQA 4TSSA 2KA7A 1I4GA 3OMCA 1OXVA 2NTTA 2NN6H 1JCKB 3RUZA 2L5TA 3M7NA 2YU9B 3GP7A 2F0HA 3S1MB 1I4QA 3BDLA 3IT4B 2BA1A 2K03A 3ND9A 1IUEA 4WQMA 4XWWA 1AW7A 3KLSA 4H44C 1VRAB 3BDCA 2MUYA 2SAKA 1JWMD 5M9OA 5C4XB 4KJOA 2PVOD 4TMAB 1QLBB 1DCZA 4DK0A 1PTOH 1EY9A 3I90A 1LABA 2DY8A 4KY7A 2NTSA 2W54A 1L4DB 1BMLC 1I4RA 4K5XA 2WP9B 2QKIC 3TMEA 3ETRA 2D5DA 4KKSA 3U9SA 1H9SB 4NDXA 4IFDJ 4OO1G 2IX1A 1EZ6A 3QOLA 1N62A 1IGDA 5NUCA 1W6JA 1C4CA 1JALA 3TEZA 4LAAA 3AMUA 1MSGA 1U9RA 3AE2B 1FRDA 3A7AB 3W5VB 5E6JA 3EQLC 1OO9B 4RGOS 3MJ5A 4H0LC 3BK2A 2F0EA 4C80A 4XDXA 1GPXA 4K2LA 1RM6C 1EYAA 1D5XC 4PMBA 4OO1I 2BS2B 2K9XA 4AYBB 1EEFD 3EVQA 5IGCA 1QJOA 1C79A 5EE0A 2F0JA 4HROA 2OEOA 3KWVA 2F0IA 2NVYB 4BS9A 3AB5A 1PRTB 3W3AA 1KDAA 3AE7B 2NB0A 1V43A 1MI0A 2RBMA 5EPJA 3TP7A 3ZJVA 2WP8J 3I72A 5I9OA 1WCMB 5DAUA 2RMMA 1AP0A 1QNKA 3S9WA 1XLOA 3NVYA 1FNVA 4K6DA 3DWPA 4OVZA 3NWSA 1IKMA 1RKNA 1A2TA 4R8NA 5HHDG 1T5EA 4KKTA 1VZ8A 4N9TA 4B08A 3L7ZC 1CZPA 1JRPA 4XTCS 2RVLA 3CQZB 3OPOA 1HPCA 1PFDA 1STBA 3SHLA 1HQRD 5A2QE 4HMJA 2JSVX 1BQQT 1NCVA 1OQQA 1L0XB 3TEYA 2QIEB 3I3CA 5C0XG 2L32A 1P7FA 1O7ZA 2EY1A 4J8QA 2W55A 4XT3B 2BBCA 1UWMA 4CQNA 5I2XA 3FVQA 3H94A 2PPBC 4KD4A 1E10A 5CMDA 1HXYD 1KH0A 1QNUA 4OIJA 3NUCA 1FXAA 3M4YA 3HVDA 1UAPA 2VUMB 1I6HB 3BDOA 1DOIA 1KDBA 2ID0A 2Z8LA 1PDXA 2RA4A 3K5OA 2WXNA 1DOXA 4B9WA 5EKKA 2HDEA 1IBXB 3J81E 2KEEA 3ITPA 3LWUA 2CVRA 1K8OA 3S2HB 2R93B 2Q8RE 4G7ZC 3BWUD 1SYBA 1PFMA 2V4IB 2JA7B 3AEAB 4GDKB 4CJ0B 1TS3A 3IFTA 2AX5A 2RDFA 3KBXA 1LTAD 2KMMA 4FO2A 3DHQA 4KN7C 2LHDA 5EE3A 2RQXA 4RNAA 2N9LA 3PO3B 3LX0A 2E2HB 2SDFA 5BMIA 1GXDC 1B1ZA 5HGTA 2Y5CA 1ESFA 4ZAIA 2A6HC 1O80A 3AE9B 3S1QB 2PTLA 4C3JB 1TY0A 3OHXC 1YNTE 4DU9A 3QIAA 2IX0A 1WSPA 4CGYB 2EJFC 1F77A 4P6VF 1K83B 3KK7A 3TDQA 2BW2A 4HSVA 3VR4A 1WTRA 5H8YE 2ZXRA 5C2TB 1CQVA 2K7VA 2D62A 4L8JA 1EIGA 2O2LD 3HVZA 3CKIB 1RTNA 1DM0B 3AE6B 2AQ2B 1G6ZA 4XT1B 1GUSA 2M9VA 1VR9A 1IHZA 3AECB 4D2KA 1PTOB 4DNRB 2K28A 1CK1A 1EYCA 3IT6B 2MGSA 4YSYB 4XIGS 3VYSA 5EE1A 4A3DB 5BN3A 1JWUD 5HURA 1HQMC 1MHXA 1WTQA 4NJCA 5KRUA 3FC4A 2JYOA 2K32A 2N88A 1ZEQX 2HQEA 1GHKA 1I3QB 4FYDA 1CA6A 2KEDA 1K53A 4C3IB 4FXKC 4XQJA 2W3SA 3AH7A 3WOFA 5C4HA 2JA5B 5I4DA 2N55A 1ACCA 3NUHB 2HDLA 3CU7A 1IW7D 2GA4B 3EFXD 2JZPA 2YEPB 2R61A 1KABA 1EFID 5J39A 3W1SA 3TZDA 4J3OD 2Y0SB 2VZKB 1YQ3B 2BTEA 2KDMA 3C3LA 4NAWB 5IIFA 2A68C 1KAAA 4IURA 1DGJA 4OZBA 5D3DA 1GUGA 3JAML 1RWSA 1ENAA 2INNE 1G291 2X69A 1OQRA 2EJGC 3DM1A 5CC4A 3P4RB 3UI3A 1B9RA 2V3PA 3K57A 1YN5A 4FF1A 3I4LA 2QDBA 1FFUA 5KNCA 3IAYA 4RWSC 3ZGZA 1KFYB 1WTPA 3GTOB 5C3XA