4TT2A

Crystal structure of atad2a bromodomain complexed with h4(1-20)k5ac peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 53
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tt2A00
4TS8A 5D24A 5CUDA 4YY6A 4MR3A 4HBYA 5BT4A 4BW1A 2F6NA 2YELA 5DY7A 5LVRA 4HXLA 4CUPA 5EWWA 2WP2A 5DW1A 2DVSA 5C7NA 4NUEA 4ALGA 4PTBA 5E9YA 5CP5A 2G4AA 4HXNA 3UVXA 2R0SA 5ENJA 5CFWA 4MR5A 3K2JA 4CLBA 4MEQA 5DFDA 4HXSA 2RS9B 4HXPA 5D3HA 4NYXA 5L8UA 4WHUA 4YH4A 4HBWA 5AD2A 4IOOA 5I86A 4YBSA 3SVFA 4CURA 5D25A 5F61A 5C4QA 5FE2A 5I40A 4HBVA 4IR5A 4YH3A 5H1TA 3P1CA 4NR4A 5FBXA 5CQ6A 4QUUA 5E3GA 5CTLA 5EK9A 5HRXA 2OO1A 5TCMA 5BT5A 4TQNA 3I3JA 5AMEA 3JVKA 4LYSA 5CUEA 5EPBA 5ACYA 4LYIA 2L85A 5D3JA 5D0CA 3U5OA 4A9JA 4O78A 5FB1A 5ENIA 5D3SA 5E9LA 2YQDA 5ENHA 5JWMA 5E0RA 2DWWA 4YYJA 5FE0A 4YATA 4CUQA 2OUOA 3HMHA 4QSTA 5HQ7A 5LKUA 5LKXA 2E7NA 5COIA 4NR7A 4QBMA 3JVLA 2RNYA 2LSPB 2R0VA 4NS5A 5E9VA 2DVVA 3TLPA 4IR3A 5FE8A 3ZYUA 3UW9A 3QZVA 5A5SA 3IU6A 5EPSA 5LJ2A 4QY4A 4LDFA 5IGKA 3LXJA 5EI4A 4ZC9A 5F5ZA 4HXKA 4QEVA 4OGIA 5DLXA 1X0JA 4YK0A 5CRZA 5FH6A 5KO4A 4QSQA 3U5JA 4N4FA 4KV1A 5CUGA 3Q2FA 4MR4A 4CUUA 5E9MA 3UVWA 3U5MA 4YYDA 3U5PA 4YAXA 4NXJA 4QSUA 4BHWA 4XUAA 5K29A 4N4GA 4IORA 5F3AA 2FSAA 3G0LA 5FFWA 5E3DA 5EICA 3O37A 5L8TA 4LZ2A 5C87A 2GRCA 4BW4A 5G4SA 5HJCA 3U5LA 4UYFA 1EQFA 4A9FA 5FFYA 5F2PA 5HEMA 4ZQLA 5I83A 5IGMA 4NRBA 4QSXA 5CGPA 5DBMA 4A9NA 5ENGA 5CUCA 1WUGA 3S92A 2RNWA 5A81A 3RCWA 3D7CA 4UIWA 3DWYA 2R10A 5FE1A 5A5NA 5BT3A 5CQ3A 5AMFA 5LKZA 4O7FA 4Z1SA 3QZSA 2I8NA 5A5PA 5DFCA 3FKMX 5EPRA 4QC1A 5HRVA 5CU8A 4QYDA 5ETDA 3SVGA 4YYMA 5LJ0A 5EQ1A 2DATA 4IOQA 4A9MA 4IR6A 4ALHA 3MUKA 1N72A 4N3WA 4BW3A 5EISA 4X2IA 5EP7A 4CFKA 4HXOA 5LKTA 4UIZA 5DYAA 2L5EA 4PCEA 5TB6A 4O77A 4YYHA 3U5NA 4GPJA 5DKHA 1E6IA 2DVQA 5DFBA 5EM3A 5A7CA 4MENA 5FE9A 4Q0OA 4NYWA 5KTWA 1F68A 4QEWA 5ENCA 4YYKA 4YYNA 4ZW1A 4NRAA 3P1FA 5L96A 5EGUA 4O74A 4LZRA 4WHWA 3QZTA 4WIVA 5EWHA 4O7CA 4TT2A 4QSRA 4QNSA 4CL9A 5FE3A 3ONIA 4HXMA 5DKDA 5CQ4A 4KCXA 5F62A 4MEPA 4YC9A 5CQAA 5FG5A 3DAIA 3UVYA 5F36A 4CFLA 5A5QA 3O34A 3MQMA 2E3KA 3P1DA 4QYLA 5ENEA 5F63A 3MXFA 4QSSA 4TZ2A 5LJ1A 4E96A 5ENBA 5D3TA 2L84A 5E9IA 5HFQA 5CQ5A 2YEKA 4QSVA 4XYAA 4PS5A 3P1EA 4OGJA 4TU6A 5CS8A 5E7DA 2DVRA 3UVDA 2RNXA 5E74A 5CQ7A 4Z1QA 4Y03A 4UYHA 2E7OA 3JVJA 4LC2A 5E73A 4NR9A 5HFRA 5FDZA 2D9EA 3LQHA 4TT4A 5D3RA 2KTBB 4NUCA 5IBNA 4A9HA 4MEOA 1WUMA 4O7EA 4O75A 5CRMA 3JVMA 3MB4A 3AADA 5IGLA 4TYLA 4PCIA 4YABA 4MR6A 4TT6A 3O33A 3P5OA 4YY4A 5CQ8A 4F3IA 5I1QA 5DW2A 2F6JA 4Q0NA 2RFJA 4UITA 4UYFB 5II1A 4BW2A 3UV2A 5D26A 2D82A 5DYCA 4YYIA 3LQJA 5A5RA 3NXBA 4A9LA 5KTUA 5H1VA 5I80A 4O7AA 5CPEA 5KU3A 4YADA 3IU5A 4C67A 4QB3A 5F1LA 4QR4A 5A83A 5F1HA 5C89A 5HQ5A 4LR6A 4PKLA 5FH8A 5CQTA 5DKCA 4J0SA 4NR8A 4YYGA 5E9KA 5IGNA 4IR4A 4RVRA 1ZS5A 5L98A 5EWCA 5FH7A 4UIUA 5II2A 2N9GA 5FG6A 5DYXA 4NUDA 4QUTA 4A9EA 4XUBA 5ENFA 3UV5A 5LUUA 5CUAA 4BJXA 5G4RA 4N4HA 4UIYA 5FFVA 2NXBA 5CUBA 5A82A 5F60A 5EA1A 5FE7A 5I7YA 3O36A 2MJVB 5AD3A 5IIDA 5A85A 2YDWA 4O7BA 4QC3A 5H1UA 4NR5A 4CUSA 5KHMA 4NQNA 3U5KA 5I88A 4YBMA 4J0RA 4UYGA 4UYDA 4LRGA 5D3LA 2R0YA 5FE5A 2RI7A 4QR5A 4Z93A 5L99A 5L97A 5ETBA 2YYNA 2OSSA 2YEMA 5FE4A 4DONA 4TZ8A 2WP1A 4LYWA 5D7XA 5C8GA 5HM0A 5IG6A 5DX4A 5HLSA 5CZGA 4QSWA 3S91A 4Z6IA 5EU1A 3G0JA 5HENA 4NYVA 5F25A 5I7XA 5I29A 3O35A 4A9IA 4TU4A 4QR3A 1JSPB 5J0DA 4TTEA 3MULA 5I89A 3MB3A 3GG3A 4AKNA 4HXRA 5EVAA 4UIVA 5JI8A 5EV9A 4A9OA 5HCLA 4HBXA 5FB0A 4QEUA 4UIXA 4NRCA 5D3NA 4J1PA 3HMEA 4UYEA 4FLPA 4C66A 4QZSA 5H85A 4YBTA 5C85A 3LJWA 4PY6A 4A9KA 5DYUA 4LZSA 3UV4A 5D3PA 5CY9A 4NQMA 4Z6HA 4OUFA 4N4IA 4QSPA 1JM4B 4CUTA 5FG4A 4XY8A 4NR6A 3LQIA 4O76A 5HELA 5EWVA 5A5OA 5KTXA 3HMFA 4J3IA 5FE6A 3SVHA 4O72A 2H60A 5DLZA 5LVQA 2RO1A 2YW5A 2DKWA 4XY9A 4O70A 4KV4A 3Q2EA 5HQ6A 3AQAA 5EWDA 4O71A 2I7KA 5HRWA
chains in the Genus database with same CATH superfamily
4TS8A 5D24A 5CUDA 4YY6A 4MR3A 4HBYA 3VKHA 5BT4A 4BW1A 2F6NA 2YELA 5DY7A 5LVRA 4HXLA 4CUPA 5EWWA 2WP2A 5DW1A 2DVSA 5C7NA 4NUEA 4ALGA 4PTBA 5E9YA 5CP5A 2G4AA 4HXNA 3UVXA 2R0SA 5ENJA 5CFWA 4MR5A 3K2JA 4CLBA 4MEQA 5DFDA 4HXSA 2RS9B 4HXPA 5D3HA 4NYXA 5L8UA 4WHUA 4YH4A 4HBWA 5AD2A 4IOOA 5I86A 4YBSA 3SVFA 4CURA 5D25A 5F61A 5C4QA 5FE2A 5I40A 4HBVA 4AKIA 4IR5A 4YH3A 5H1TA 3P1CA 4NR4A 5FBXA 5CQ6A 4QUUA 5E3GA 5CTLA 5EK9A 5HRXA 2OO1A 5TCMA 5BT5A 4TQNA 3I3JA 5AMEA 3JVKA 4LYSA 5CUEA 5EPBA 5ACYA 4LYIA 2L85A 5D3JA 5D0CA 3U5OA 4A9JA 4O78A 5FB1A 5ENIA 5D3SA 5E9LA 2YQDA 5ENHA 5JWMA 5E0RA 2DWWA 4YYJA 5FE0A 4YATA 4CUQA 2OUOA 3HMHA 4QSTA 5HQ7A 5LKUA 5LKXA 2E7NA 5COIA 4NR7A 4QBMA 3JVLA 2RNYA 2LSPB 2R0VA 4NS5A 5E9VA 2DVVA 3TLPA 4IR3A 5FE8A 3ZYUA 1ZKRA 3UW9A 3QZVA 5A5SA 3IU6A 5EPSA 5LJ2A 4QY4A 4LDFA 5IGKA 3LXJA 5EI4A 4ZC9A 5F5ZA 4HXKA 4QEVA 4OGIA 5DLXA 1X0JA 4YK0A 5CRZA 5FH6A 5KO4A 4QSQA 3U5JA 4N4FA 4KV1A 5CUGA 3Q2FA 4MR4A 4CUUA 5E9MA 3UVWA 3U5MA 4YYDA 3U5PA 4YAXA 4NXJA 4QSUA 4BHWA 4XUAA 5K29A 4N4GA 4IORA 5F3AA 2FSAA 3G0LA 5FFWA 5E3DA 5EICA 3O37A 5L8TA 4LZ2A 5C87A 2GRCA 4BW4A 5G4SA 5HJCA 3U5LA 4UYFA 1EQFA 4A9FA 5FFYA 5F2PA 5HEMA 4ZQLA 5I83A 5IGMA 4NRBA 4QSXA 5CGPA 5DBMA 4A9NA 5ENGA 5CUCA 1WUGA 3S92A 2RNWA 5A81A 3RCWA 3D7CA 1PUOA 4UIWA 3DWYA 2R10A 5FE1A 5A5NA 5BT3A 5CQ3A 5AMFA 5LKZA 4AKGA 4O7FA 4Z1SA 3QZSA 2I8NA 5A5PA 5DFCA 3FKMX 5EPRA 4QC1A 5HRVA 5CU8A 4QYDA 5ETDA 3SVGA 4YYMA 5LJ0A 5EQ1A 2DATA 4IOQA 4A9MA 4IR6A 4ALHA 3MUKA 1N72A 4N3WA 4BW3A 5EISA 4X2IA 5EP7A 4CFKA 4HXOA 5LKTA 4UIZA 5DYAA 2L5EA 4PCEA 5TB6A 4O77A 4YYHA 3U5NA 4GPJA 5DKHA 1E6IA 2DVQA 5DFBA 5EM3A 3ERRA 5A7CA 4MENA 5FE9A 4Q0OA 4NYWA 5KTWA 1F68A 4QEWA 5ENCA 4YYKA 4YYNA 4ZW1A 4NRAA 3P1FA 5L96A 5EGUA 4O74A 4LZRA 4WHWA 3QZTA 4WIVA 5EWHA 4O7CA 4TT2A 4QSRA 4QNSA 4CL9A 5FE3A 3ONIA 4HXMA 5DKDA 5CQ4A 3D1BA 4KCXA 5F62A 4MEPA 4YC9A 5CQAA 5FG5A 3DAIA 3UVYA 5F36A 4CFLA 5A5QA 3O34A 3MQMA 2E3KA 3P1DA 4QYLA 5ENEA 5F63A 3MXFA 4QSSA 4TZ2A 5LJ1A 4E96A 5ENBA 5D3TA 2L84A 5E9IA 5HFQA 5CQ5A 2YEKA 4QSVA 4XYAA 4PS5A 3P1EA 4OGJA 4TU6A 5CS8A 5E7DA 2DVRA 3UVDA 2RNXA 5E74A 5CQ7A 4Z1QA 4Y03A 4UYHA 2E7OA 3JVJA 4LC2A 5E73A 4NR9A 5HFRA 4AI6A 5FDZA 2D9EA 3LQHA 4TT4A 5D3RA 2KTBB 4NUCA 5IBNA 4A9HA 4MEOA 1WUMA 4O7EA 4O75A 5CRMA 3JVMA 3MB4A 3AADA 5IGLA 4TYLA 4PCIA 4YABA 4MR6A 4TT6A 3O33A 3P5OA 4YY4A 5CQ8A 4F3IA 5I1QA 5DW2A 2F6JA 4Q0NA 2RFJA 4UITA 4UYFB 5II1A 4BW2A 3UV2A 5D26A 2D82A 5DYCA 4YYIA 3LQJA 5A5RA 3NXBA 4A9LA 5KTUA 5H1VA 5I80A 4O7AA 5CPEA 5KU3A 4YADA 3IU5A 4C67A 4QB3A 5F1LA 4QR4A 5A83A 2EJNA 5F1HA 5C89A 5HQ5A 4LR6A 4PKLA 5FH8A 5CQTA 5DKCA 4J0SA 4NR8A 4YYGA 5E9KA 5IGNA 4IR4A 4RVRA 1ZS5A 5L98A 5EWCA 5FH7A 4UIUA 5II2A 4AKHA 2N9GA 5FG6A 5DYXA 4NUDA 4QUTA 4A9EA 4XUBA 5ENFA 3UV5A 5LUUA 5CUAA 4BJXA 5G4RA 4N4HA 4UIYA 5FFVA 2NXBA 5CUBA 5A82A 5F60A 5EA1A 5FE7A 5I7YA 3O36A 2MJVB 5AD3A 5IIDA 5A85A 2YDWA 4O7BA 4QC3A 5H1UA 3D1DA 4NR5A 4CUSA 5KHMA 4NQNA 3U5KA 5I88A 4YBMA 4J0RA 4UYGA 4UYDA 4LRGA 5D3LA 2R0YA 5FE5A 2RI7A 4QR5A 4Z93A 5L99A 5L97A 5ETBA 2YYNA 2OSSA 2YEMA 5FE4A 4DONA 4TZ8A 2WP1A 4LYWA 5D7XA 5C8GA 5HM0A 5IG6A 5DX4A 3VKGA 5HLSA 5CZGA 4QSWA 3S91A 4Z6IA 5EU1A 3G0JA 5HENA 4NYVA 5F25A 5I7XA 5I29A 3O35A 4A9IA 4TU4A 4QR3A 1JSPB 5J0DA 4TTEA 3MULA 5I89A 3MB3A 3GG3A 4AKNA 4HXRA 5EVAA 4UIVA 5JI8A 5EV9A 4A9OA 5HCLA 4HBXA 5FB0A 4QEUA 4UIXA 4NRCA 5D3NA 4J1PA 3HMEA 4UYEA 4FLPA 4C66A 4QZSA 5H85A 4YBTA 5C85A 3LJWA 4PY6A 4A9KA 5DYUA 4LZSA 3UV4A 5D3PA 5CY9A 4NQMA 4Z6HA 4OUFA 4N4IA 4QSPA 1JM4B 4CUTA 5FG4A 4XY8A 4NR6A 3LQIA 4O76A 5HELA 5EWVA 5A5OA 5KTXA 3HMFA 4J3IA 5FE6A 3SVHA 4O72A 2H60A 5DLZA 5LVQA 2RO1A 2YW5A 2DKWA 4XY9A 4O70A 4KV4A 3Q2EA 5HQ6A 3AQAA 5EWDA 4O71A 2I7KA 5HRWA
chains in the Genus database with same CATH topology
4TS8A 5D24A 5CUDA 4YY6A 4MR3A 4HBYA 5BT4A 4BW1A 2F6NA 2YELA 5DY7A 5LVRA 4HXLA 4CUPA 5EWWA 2WP2A 5DW1A 2DVSA 5C7NA 4NUEA 4ALGA 4PTBA 5E9YA 5CP5A 2G4AA 4HXNA 3UVXA 2R0SA 5ENJA 5CFWA 4MR5A 3K2JA 4CLBA 4MEQA 5DFDA 4HXSA 2RS9B 4HXPA 5D3HA 4NYXA 5L8UA 4WHUA 4YH4A 4HBWA 5AD2A 4IOOA 5I86A 4YBSA 3SVFA 4CURA 5D25A 5F61A 5C4QA 5FE2A 5I40A 4HBVA 4IR5A 4YH3A 5H1TA 3P1CA 4NR4A 5FBXA 5CQ6A 4QUUA 5E3GA 5CTLA 5EK9A 5HRXA 2OO1A 5TCMA 5BT5A 4TQNA 3I3JA 5AMEA 3JVKA 4LYSA 5CUEA 5EPBA 5ACYA 4LYIA 2L85A 5D3JA 5D0CA 3U5OA 4A9JA 4O78A 5FB1A 5ENIA 5D3SA 5E9LA 2YQDA 5ENHA 5JWMA 5E0RA 2DWWA 4YYJA 5FE0A 4YATA 4CUQA 2OUOA 3HMHA 4QSTA 5HQ7A 5LKUA 5LKXA 2E7NA 5COIA 4NR7A 4QBMA 3JVLA 2RNYA 2LSPB 2R0VA 4NS5A 5E9VA 2DVVA 3TLPA 4IR3A 5FE8A 3ZYUA 3UW9A 3QZVA 5A5SA 3IU6A 5EPSA 5LJ2A 4QY4A 4LDFA 5IGKA 3LXJA 5EI4A 4ZC9A 5F5ZA 4HXKA 4QEVA 4OGIA 5DLXA 1X0JA 4YK0A 5CRZA 5FH6A 5KO4A 4QSQA 3U5JA 4N4FA 4KV1A 5CUGA 3Q2FA 4MR4A 4CUUA 5E9MA 3UVWA 3U5MA 4YYDA 3U5PA 4YAXA 4NXJA 4QSUA 4BHWA 4XUAA 5K29A 4N4GA 4IORA 5F3AA 2FSAA 3G0LA 5FFWA 5E3DA 5EICA 3O37A 5L8TA 4LZ2A 5C87A 2GRCA 4BW4A 5G4SA 5HJCA 3U5LA 4UYFA 1EQFA 4A9FA 5FFYA 5F2PA 5HEMA 4ZQLA 5I83A 5IGMA 4NRBA 4QSXA 5CGPA 5DBMA 4A9NA 5ENGA 5CUCA 1WUGA 3S92A 2RNWA 5A81A 3RCWA 3D7CA 4UIWA 3DWYA 2R10A 5FE1A 5A5NA 5BT3A 5CQ3A 5AMFA 5LKZA 4O7FA 4Z1SA 3QZSA 2I8NA 5A5PA 5DFCA 3FKMX 5EPRA 4QC1A 5HRVA 5CU8A 4QYDA 5ETDA 3SVGA 4YYMA 5LJ0A 5EQ1A 2DATA 4IOQA 4A9MA 4IR6A 4ALHA 3MUKA 1N72A 4N3WA 4BW3A 5EISA 4X2IA 5EP7A 4CFKA 4HXOA 5LKTA 4UIZA 5DYAA 2L5EA 4PCEA 5TB6A 4O77A 4YYHA 3U5NA 4GPJA 5DKHA 1E6IA 2DVQA 5DFBA 5EM3A 5A7CA 4MENA 5FE9A 4Q0OA 4NYWA 5KTWA 1F68A 4QEWA 5ENCA 4YYKA 4YYNA 4ZW1A 4NRAA 3P1FA 5L96A 5EGUA 4O74A 4LZRA 4WHWA 3QZTA 4WIVA 5EWHA 4O7CA 4TT2A 4QSRA 4QNSA 4CL9A 5FE3A 3ONIA 4HXMA 5DKDA 5CQ4A 4KCXA 5F62A 4MEPA 4YC9A 5CQAA 5FG5A 3DAIA 3UVYA 5F36A 4CFLA 5A5QA 3O34A 3MQMA 2E3KA 3P1DA 4QYLA 5ENEA 5F63A 3MXFA 4QSSA 4TZ2A 5LJ1A 4E96A 5ENBA 5D3TA 2L84A 5E9IA 5HFQA 5CQ5A 2YEKA 4QSVA 4XYAA 4PS5A 3P1EA 4OGJA 4TU6A 5CS8A 5E7DA 2DVRA 3UVDA 2RNXA 5E74A 5CQ7A 4Z1QA 4Y03A 4UYHA 2E7OA 3JVJA 4LC2A 5E73A 4NR9A 5HFRA 5FDZA 2D9EA 3LQHA 4TT4A 5D3RA 2KTBB 4NUCA 5IBNA 4A9HA 4MEOA 1WUMA 4O7EA 4O75A 5CRMA 3JVMA 3MB4A 3AADA 5IGLA 4TYLA 4PCIA 4YABA 4MR6A 4TT6A 3O33A 3P5OA 4YY4A 5CQ8A 4F3IA 5I1QA 5DW2A 2F6JA 4Q0NA 2RFJA 4UITA 4UYFB 5II1A 4BW2A 3UV2A 5D26A 2D82A 5DYCA 4YYIA 3LQJA 5A5RA 3NXBA 4A9LA 5KTUA 5H1VA 5I80A 4O7AA 5CPEA 5KU3A 4YADA 3IU5A 4C67A 4QB3A 5F1LA 4QR4A 5A83A 5F1HA 5C89A 5HQ5A 4LR6A 4PKLA 5FH8A 5CQTA 5DKCA 4J0SA 4NR8A 4YYGA 5E9KA 5IGNA 4IR4A 4RVRA 1ZS5A 5L98A 5EWCA 5FH7A 4UIUA 5II2A 2N9GA 5FG6A 5DYXA 4NUDA 4QUTA 4A9EA 4XUBA 5ENFA 3UV5A 5LUUA 5CUAA 4BJXA 5G4RA 4N4HA 4UIYA 5FFVA 2NXBA 5CUBA 5A82A 5F60A 5EA1A 5FE7A 5I7YA 3O36A 2MJVB 5AD3A 5IIDA 5A85A 2YDWA 4O7BA 4QC3A 5H1UA 4NR5A 4CUSA 5KHMA 4NQNA 3U5KA 5I88A 4YBMA 4J0RA 4UYGA 4UYDA 4LRGA 5D3LA 2R0YA 5FE5A 2RI7A 4QR5A 4Z93A 5L99A 5L97A 5ETBA 2YYNA 2OSSA 2YEMA 5FE4A 4DONA 4TZ8A 2WP1A 4LYWA 5D7XA 5C8GA 5HM0A 5IG6A 5DX4A 5HLSA 5CZGA 4QSWA 3S91A 4Z6IA 5EU1A 3G0JA 5HENA 4NYVA 5F25A 5I7XA 5I29A 3O35A 4A9IA 4TU4A 4QR3A 1JSPB 5J0DA 4TTEA 3MULA 5I89A 3MB3A 3GG3A 4AKNA 4HXRA 5EVAA 4UIVA 5JI8A 5EV9A 4A9OA 5HCLA 4HBXA 5FB0A 4QEUA 4UIXA 4NRCA 5D3NA 4J1PA 3HMEA 4UYEA 4FLPA 4C66A 4QZSA 5H85A 4YBTA 5C85A 3LJWA 4PY6A 4A9KA 5DYUA 4LZSA 3UV4A 5D3PA 5CY9A 4NQMA 4Z6HA 4OUFA 4N4IA 4QSPA 1JM4B 4CUTA 5FG4A 4XY8A 4NR6A 3LQIA 4O76A 5HELA 5EWVA 5A5OA 5KTXA 3HMFA 4J3IA 5FE6A 3SVHA 4O72A 2H60A 5DLZA 5LVQA 2RO1A 2YW5A 2DKWA 4XY9A 4O70A 4KV4A 3Q2EA 5HQ6A 3AQAA 5EWDA 4O71A 2I7KA 5HRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TS8 A;  5D24 A;  5CUD A;  4YY6 A;  4MR3 A;  4HBY A;  5BT4 A;  4BW1 A;  2F6N A;  2YEL A;  5DY7 A;  5LVR A;  4HXL A;  4CUP A;  5EWW A;  2WP2 A;  5DW1 A;  2DVS A;  5C7N A;  4NUE A;  4ALG A;  4PTB A;  5E9Y A;  5CP5 A;  2G4A A;  4HXN A;  3UVX A;  2R0S A;  5ENJ A;  5CFW A;  4MR5 A;  3K2J A;  4CLB A;  4MEQ A;  5DFD A;  4HXS A;  2RS9 B;  4HXP A;  5D3H A;  4NYX A;  5L8U A;  4WHU A;  4YH4 A;  4HBW A;  5AD2 A;  4IOO A;  5I86 A;  4YBS A;  3SVF A;  4CUR A;  5D25 A;  5F61 A;  5C4Q A;  5FE2 A;  5I40 A;  4HBV A;  4IR5 A;  4YH3 A;  5H1T A;  3P1C A;  4NR4 A;  5FBX A;  5CQ6 A;  4QUU A;  5E3G A;  5CTL A;  5EK9 A;  5HRX A;  2OO1 A;  5TCM A;  5BT5 A;  4TQN A;  3I3J A;  5AME A;  3JVK A;  4LYS A;  5CUE A;  5EPB A;  5ACY A;  4LYI A;  2L85 A;  5D3J A;  5D0C A;  3U5O A;  4A9J A;  4O78 A;  5FB1 A;  5ENI A;  5D3S A;  5E9L A;  2YQD A;  5ENH A;  5JWM A;  5E0R A;  2DWW A;  4YYJ A;  5FE0 A;  4YAT A;  4CUQ A;  2OUO A;  3HMH A;  4QST A;  5HQ7 A;  5LKU A;  5LKX A;  2E7N A;  5COI A;  4NR7 A;  4QBM A;  3JVL A;  2RNY A;  2LSP B;  2R0V A;  4NS5 A;  5E9V A;  2DVV A;  3TLP A;  4IR3 A;  5FE8 A;  3ZYU A;  3UW9 A;  3QZV A;  5A5S A;  3IU6 A;  5EPS A;  5LJ2 A;  4QY4 A;  4LDF A;  5IGK A;  3LXJ A;  5EI4 A;  4ZC9 A;  5F5Z A;  4HXK A;  4QEV A;  4OGI A;  5DLX A;  1X0J A;  4YK0 A;  5CRZ A;  5FH6 A;  5KO4 A;  4QSQ A;  3U5J A;  4N4F A;  4KV1 A;  5CUG A;  3Q2F A;  4MR4 A;  4CUU A;  5E9M A;  3UVW A;  3U5M A;  4YYD A;  3U5P A;  4YAX A;  4NXJ A;  4QSU A;  4BHW A;  4XUA A;  5K29 A;  4N4G A;  4IOR A;  5F3A A;  2FSA A;  3G0L A;  5FFW A;  5E3D A;  5EIC A;  3O37 A;  5L8T A;  4LZ2 A;  5C87 A;  2GRC A;  4BW4 A;  5G4S A;  5HJC A;  3U5L A;  4UYF A;  1EQF A;  4A9F A;  5FFY A;  5F2P A;  5HEM A;  4ZQL A;  5I83 A;  5IGM A;  4NRB A;  4QSX A;  5CGP A;  5DBM A;  4A9N A;  5ENG A;  5CUC A;  1WUG A;  3S92 A;  2RNW A;  5A81 A;  3RCW A;  3D7C A;  4UIW A;  3DWY A;  2R10 A;  5FE1 A;  5A5N A;  5BT3 A;  5CQ3 A;  5AMF A;  5LKZ A;  4O7F A;  4Z1S A;  3QZS A;  2I8N A;  5A5P A;  5DFC A;  3FKM X;  5EPR A;  4QC1 A;  5HRV A;  5CU8 A;  4QYD A;  5ETD A;  3SVG A;  4YYM A;  5LJ0 A;  5EQ1 A;  2DAT A;  4IOQ A;  4A9M A;  4IR6 A;  4ALH A;  3MUK A;  1N72 A;  4N3W A;  4BW3 A;  5EIS A;  4X2I A;  5EP7 A;  4CFK A;  4HXO A;  5LKT A;  4UIZ A;  5DYA A;  2L5E A;  4PCE A;  5TB6 A;  4O77 A;  4YYH A;  3U5N A;  4GPJ A;  5DKH A;  1E6I A;  2DVQ A;  5DFB A;  5EM3 A;  5A7C A;  4MEN A;  5FE9 A;  4Q0O A;  4NYW A;  5KTW A;  1F68 A;  4QEW A;  5ENC A;  4YYK A;  4YYN A;  4ZW1 A;  4NRA A;  3P1F A;  5L96 A;  5EGU A;  4O74 A;  4LZR A;  4WHW A;  3QZT A;  4WIV A;  5EWH A;  4O7C A;  4TT2 A;  4QSR A;  4QNS A;  4CL9 A;  5FE3 A;  3ONI A;  4HXM A;  5DKD A;  5CQ4 A;  4KCX A;  5F62 A;  4MEP A;  4YC9 A;  5CQA A;  5FG5 A;  3DAI A;  3UVY A;  5F36 A;  4CFL A;  5A5Q A;  3O34 A;  3MQM A;  2E3K A;  3P1D A;  4QYL A;  5ENE A;  5F63 A;  3MXF A;  4QSS A;  4TZ2 A;  5LJ1 A;  4E96 A;  5ENB A;  5D3T A;  2L84 A;  5E9I A;  5HFQ A;  5CQ5 A;  2YEK A;  4QSV A;  4XYA A;  4PS5 A;  3P1E A;  4OGJ A;  4TU6 A;  5CS8 A;  5E7D A;  2DVR A;  3UVD A;  2RNX A;  5E74 A;  5CQ7 A;  4Z1Q A;  4Y03 A;  4UYH A;  2E7O A;  3JVJ A;  4LC2 A;  5E73 A;  4NR9 A;  5HFR A;  5FDZ A;  2D9E A;  3LQH A;  4TT4 A;  5D3R A;  2KTB B;  4NUC A;  5IBN A;  4A9H A;  4MEO A;  1WUM A;  4O7E A;  4O75 A;  5CRM A;  3JVM A;  3MB4 A;  3AAD A;  5IGL A;  4TYL A;  4PCI A;  4YAB A;  4MR6 A;  4TT6 A;  3O33 A;  3P5O A;  4YY4 A;  5CQ8 A;  4F3I A;  5I1Q A;  5DW2 A;  2F6J A;  4Q0N A;  2RFJ A;  4UIT A;  4UYF B;  5II1 A;  4BW2 A;  3UV2 A;  5D26 A;  2D82 A;  5DYC A;  4YYI A;  3LQJ A;  5A5R A;  3NXB A;  4A9L A;  5KTU A;  5H1V A;  5I80 A;  4O7A A;  5CPE A;  5KU3 A;  4YAD A;  3IU5 A;  4C67 A;  4QB3 A;  5F1L A;  4QR4 A;  5A83 A;  5F1H A;  5C89 A;  5HQ5 A;  4LR6 A;  4PKL A;  5FH8 A;  5CQT A;  5DKC A;  4J0S A;  4NR8 A;  4YYG A;  5E9K A;  5IGN A;  4IR4 A;  4RVR A;  1ZS5 A;  5L98 A;  5EWC A;  5FH7 A;  4UIU A;  5II2 A;  2N9G A;  5FG6 A;  5DYX A;  4NUD A;  4QUT A;  4A9E A;  4XUB A;  5ENF A;  3UV5 A;  5LUU A;  5CUA A;  4BJX A;  5G4R A;  4N4H A;  4UIY A;  5FFV A;  2NXB A;  5CUB A;  5A82 A;  5F60 A;  5EA1 A;  5FE7 A;  5I7Y A;  3O36 A;  2MJV B;  5AD3 A;  5IID A;  5A85 A;  2YDW A;  4O7B A;  4QC3 A;  5H1U A;  4NR5 A;  4CUS A;  5KHM A;  4NQN A;  3U5K A;  5I88 A;  4YBM A;  4J0R A;  4UYG A;  4UYD A;  4LRG A;  5D3L A;  2R0Y A;  5FE5 A;  2RI7 A;  4QR5 A;  4Z93 A;  5L99 A;  5L97 A;  5ETB A;  2YYN A;  2OSS A;  2YEM A;  5FE4 A;  4DON A;  4TZ8 A;  2WP1 A;  4LYW A;  5D7X A;  5C8G A;  5HM0 A;  5IG6 A;  5DX4 A;  5HLS A;  5CZG A;  4QSW A;  3S91 A;  4Z6I A;  5EU1 A;  3G0J A;  5HEN A;  4NYV A;  5F25 A;  5I7X A;  5I29 A;  3O35 A;  4A9I A;  4TU4 A;  4QR3 A;  1JSP B;  5J0D A;  4TTE A;  3MUL A;  5I89 A;  3MB3 A;  3GG3 A;  4AKN A;  4HXR A;  5EVA A;  4UIV A;  5JI8 A;  5EV9 A;  4A9O A;  5HCL A;  4HBX A;  5FB0 A;  4QEU A;  4UIX A;  4NRC A;  5D3N A;  4J1P A;  3HME A;  4UYE A;  4FLP A;  4C66 A;  4QZS A;  5H85 A;  4YBT A;  5C85 A;  3LJW A;  4PY6 A;  4A9K A;  5DYU A;  4LZS A;  3UV4 A;  5D3P A;  5CY9 A;  4NQM A;  4Z6H A;  4OUF A;  4N4I A;  4QSP A;  1JM4 B;  4CUT A;  5FG4 A;  4XY8 A;  4NR6 A;  3LQI A;  4O76 A;  5HEL A;  5EWV A;  5A5O A;  5KTX A;  3HMF A;  4J3I A;  5FE6 A;  3SVH A;  4O72 A;  2H60 A;  5DLZ A;  5LVQ A;  2RO1 A;  2YW5 A;  2DKW A;  4XY9 A;  4O70 A;  4KV4 A;  3Q2E A;  5HQ6 A;  3AQA A;  5EWD A;  4O71 A;  2I7K A;  5HRW A; 
#chains in the Genus database with same CATH topology
 4TS8 A;  5D24 A;  5CUD A;  4YY6 A;  4MR3 A;  4HBY A;  3VKH A;  5BT4 A;  4BW1 A;  2F6N A;  2YEL A;  5DY7 A;  5LVR A;  4HXL A;  4CUP A;  5EWW A;  2WP2 A;  5DW1 A;  2DVS A;  5C7N A;  4NUE A;  4ALG A;  4PTB A;  5E9Y A;  5CP5 A;  2G4A A;  4HXN A;  3UVX A;  2R0S A;  5ENJ A;  5CFW A;  4MR5 A;  3K2J A;  4CLB A;  4MEQ A;  5DFD A;  4HXS A;  2RS9 B;  4HXP A;  5D3H A;  4NYX A;  5L8U A;  4WHU A;  4YH4 A;  4HBW A;  5AD2 A;  4IOO A;  5I86 A;  4YBS A;  3SVF A;  4CUR A;  5D25 A;  5F61 A;  5C4Q A;  5FE2 A;  5I40 A;  4HBV A;  4AKI A;  4IR5 A;  4YH3 A;  5H1T A;  3P1C A;  4NR4 A;  5FBX A;  5CQ6 A;  4QUU A;  5E3G A;  5CTL A;  5EK9 A;  5HRX A;  2OO1 A;  5TCM A;  5BT5 A;  4TQN A;  3I3J A;  5AME A;  3JVK A;  4LYS A;  5CUE A;  5EPB A;  5ACY A;  4LYI A;  2L85 A;  5D3J A;  5D0C A;  3U5O A;  4A9J A;  4O78 A;  5FB1 A;  5ENI A;  5D3S A;  5E9L A;  2YQD A;  5ENH A;  5JWM A;  5E0R A;  2DWW A;  4YYJ A;  5FE0 A;  4YAT A;  4CUQ A;  2OUO A;  3HMH A;  4QST A;  5HQ7 A;  5LKU A;  5LKX A;  2E7N A;  5COI A;  4NR7 A;  4QBM A;  3JVL A;  2RNY A;  2LSP B;  2R0V A;  4NS5 A;  5E9V A;  2DVV A;  3TLP A;  4IR3 A;  5FE8 A;  3ZYU A;  1ZKR A;  3UW9 A;  3QZV A;  5A5S A;  3IU6 A;  5EPS A;  5LJ2 A;  4QY4 A;  4LDF A;  5IGK A;  3LXJ A;  5EI4 A;  4ZC9 A;  5F5Z A;  4HXK A;  4QEV A;  4OGI A;  5DLX A;  1X0J A;  4YK0 A;  5CRZ A;  5FH6 A;  5KO4 A;  4QSQ A;  3U5J A;  4N4F A;  4KV1 A;  5CUG A;  3Q2F A;  4MR4 A;  4CUU A;  5E9M A;  3UVW A;  3U5M A;  4YYD A;  3U5P A;  4YAX A;  4NXJ A;  4QSU A;  4BHW A;  4XUA A;  5K29 A;  4N4G A;  4IOR A;  5F3A A;  2FSA A;  3G0L A;  5FFW A;  5E3D A;  5EIC A;  3O37 A;  5L8T A;  4LZ2 A;  5C87 A;  2GRC A;  4BW4 A;  5G4S A;  5HJC A;  3U5L A;  4UYF A;  1EQF A;  4A9F A;  5FFY A;  5F2P A;  5HEM A;  4ZQL A;  5I83 A;  5IGM A;  4NRB A;  4QSX A;  5CGP A;  5DBM A;  4A9N A;  5ENG A;  5CUC A;  1WUG A;  3S92 A;  2RNW A;  5A81 A;  3RCW A;  3D7C A;  1PUO A;  4UIW A;  3DWY A;  2R10 A;  5FE1 A;  5A5N A;  5BT3 A;  5CQ3 A;  5AMF A;  5LKZ A;  4AKG A;  4O7F A;  4Z1S A;  3QZS A;  2I8N A;  5A5P A;  5DFC A;  3FKM X;  5EPR A;  4QC1 A;  5HRV A;  5CU8 A;  4QYD A;  5ETD A;  3SVG A;  4YYM A;  5LJ0 A;  5EQ1 A;  2DAT A;  4IOQ A;  4A9M A;  4IR6 A;  4ALH A;  3MUK A;  1N72 A;  4N3W A;  4BW3 A;  5EIS A;  4X2I A;  5EP7 A;  4CFK A;  4HXO A;  5LKT A;  4UIZ A;  5DYA A;  2L5E A;  4PCE A;  5TB6 A;  4O77 A;  4YYH A;  3U5N A;  4GPJ A;  5DKH A;  1E6I A;  2DVQ A;  5DFB A;  5EM3 A;  3ERR A;  5A7C A;  4MEN A;  5FE9 A;  4Q0O A;  4NYW A;  5KTW A;  1F68 A;  4QEW A;  5ENC A;  4YYK A;  4YYN A;  4ZW1 A;  4NRA A;  3P1F A;  5L96 A;  5EGU A;  4O74 A;  4LZR A;  4WHW A;  3QZT A;  4WIV A;  5EWH A;  4O7C A;  4TT2 A;  4QSR A;  4QNS A;  4CL9 A;  5FE3 A;  3ONI A;  4HXM A;  5DKD A;  5CQ4 A;  3D1B A;  4KCX A;  5F62 A;  4MEP A;  4YC9 A;  5CQA A;  5FG5 A;  3DAI A;  3UVY A;  5F36 A;  4CFL A;  5A5Q A;  3O34 A;  3MQM A;  2E3K A;  3P1D A;  4QYL A;  5ENE A;  5F63 A;  3MXF A;  4QSS A;  4TZ2 A;  5LJ1 A;  4E96 A;  5ENB A;  5D3T A;  2L84 A;  5E9I A;  5HFQ A;  5CQ5 A;  2YEK A;  4QSV A;  4XYA A;  4PS5 A;  3P1E A;  4OGJ A;  4TU6 A;  5CS8 A;  5E7D A;  2DVR A;  3UVD A;  2RNX A;  5E74 A;  5CQ7 A;  4Z1Q A;  4Y03 A;  4UYH A;  2E7O A;  3JVJ A;  4LC2 A;  5E73 A;  4NR9 A;  5HFR A;  4AI6 A;  5FDZ A;  2D9E A;  3LQH A;  4TT4 A;  5D3R A;  2KTB B;  4NUC A;  5IBN A;  4A9H A;  4MEO A;  1WUM A;  4O7E A;  4O75 A;  5CRM A;  3JVM A;  3MB4 A;  3AAD A;  5IGL A;  4TYL A;  4PCI A;  4YAB A;  4MR6 A;  4TT6 A;  3O33 A;  3P5O A;  4YY4 A;  5CQ8 A;  4F3I A;  5I1Q A;  5DW2 A;  2F6J A;  4Q0N A;  2RFJ A;  4UIT A;  4UYF B;  5II1 A;  4BW2 A;  3UV2 A;  5D26 A;  2D82 A;  5DYC A;  4YYI A;  3LQJ A;  5A5R A;  3NXB A;  4A9L A;  5KTU A;  5H1V A;  5I80 A;  4O7A A;  5CPE A;  5KU3 A;  4YAD A;  3IU5 A;  4C67 A;  4QB3 A;  5F1L A;  4QR4 A;  5A83 A;  2EJN A;  5F1H A;  5C89 A;  5HQ5 A;  4LR6 A;  4PKL A;  5FH8 A;  5CQT A;  5DKC A;  4J0S A;  4NR8 A;  4YYG A;  5E9K A;  5IGN A;  4IR4 A;  4RVR A;  1ZS5 A;  5L98 A;  5EWC A;  5FH7 A;  4UIU A;  5II2 A;  4AKH A;  2N9G A;  5FG6 A;  5DYX A;  4NUD A;  4QUT A;  4A9E A;  4XUB A;  5ENF A;  3UV5 A;  5LUU A;  5CUA A;  4BJX A;  5G4R A;  4N4H A;  4UIY A;  5FFV A;  2NXB A;  5CUB A;  5A82 A;  5F60 A;  5EA1 A;  5FE7 A;  5I7Y A;  3O36 A;  2MJV B;  5AD3 A;  5IID A;  5A85 A;  2YDW A;  4O7B A;  4QC3 A;  5H1U A;  3D1D A;  4NR5 A;  4CUS A;  5KHM A;  4NQN A;  3U5K A;  5I88 A;  4YBM A;  4J0R A;  4UYG A;  4UYD A;  4LRG A;  5D3L A;  2R0Y A;  5FE5 A;  2RI7 A;  4QR5 A;  4Z93 A;  5L99 A;  5L97 A;  5ETB A;  2YYN A;  2OSS A;  2YEM A;  5FE4 A;  4DON A;  4TZ8 A;  2WP1 A;  4LYW A;  5D7X A;  5C8G A;  5HM0 A;  5IG6 A;  5DX4 A;  3VKG A;  5HLS A;  5CZG A;  4QSW A;  3S91 A;  4Z6I A;  5EU1 A;  3G0J A;  5HEN A;  4NYV A;  5F25 A;  5I7X A;  5I29 A;  3O35 A;  4A9I A;  4TU4 A;  4QR3 A;  1JSP B;  5J0D A;  4TTE A;  3MUL A;  5I89 A;  3MB3 A;  3GG3 A;  4AKN A;  4HXR A;  5EVA A;  4UIV A;  5JI8 A;  5EV9 A;  4A9O A;  5HCL A;  4HBX A;  5FB0 A;  4QEU A;  4UIX A;  4NRC A;  5D3N A;  4J1P A;  3HME A;  4UYE A;  4FLP A;  4C66 A;  4QZS A;  5H85 A;  4YBT A;  5C85 A;  3LJW A;  4PY6 A;  4A9K A;  5DYU A;  4LZS A;  3UV4 A;  5D3P A;  5CY9 A;  4NQM A;  4Z6H A;  4OUF A;  4N4I A;  4QSP A;  1JM4 B;  4CUT A;  5FG4 A;  4XY8 A;  4NR6 A;  3LQI A;  4O76 A;  5HEL A;  5EWV A;  5A5O A;  5KTX A;  3HMF A;  4J3I A;  5FE6 A;  3SVH A;  4O72 A;  2H60 A;  5DLZ A;  5LVQ A;  2RO1 A;  2YW5 A;  2DKW A;  4XY9 A;  4O70 A;  4KV4 A;  3Q2E A;  5HQ6 A;  3AQA A;  5EWD A;  4O71 A;  2I7K A;  5HRW A; 
#chains in the Genus database with same CATH homology
 4TS8 A;  5D24 A;  5CUD A;  4YY6 A;  4MR3 A;  4HBY A;  5BT4 A;  4BW1 A;  2F6N A;  2YEL A;  5DY7 A;  5LVR A;  4HXL A;  4CUP A;  5EWW A;  2WP2 A;  5DW1 A;  2DVS A;  5C7N A;  4NUE A;  4ALG A;  4PTB A;  5E9Y A;  5CP5 A;  2G4A A;  4HXN A;  3UVX A;  2R0S A;  5ENJ A;  5CFW A;  4MR5 A;  3K2J A;  4CLB A;  4MEQ A;  5DFD A;  4HXS A;  2RS9 B;  4HXP A;  5D3H A;  4NYX A;  5L8U A;  4WHU A;  4YH4 A;  4HBW A;  5AD2 A;  4IOO A;  5I86 A;  4YBS A;  3SVF A;  4CUR A;  5D25 A;  5F61 A;  5C4Q A;  5FE2 A;  5I40 A;  4HBV A;  4IR5 A;  4YH3 A;  5H1T A;  3P1C A;  4NR4 A;  5FBX A;  5CQ6 A;  4QUU A;  5E3G A;  5CTL A;  5EK9 A;  5HRX A;  2OO1 A;  5TCM A;  5BT5 A;  4TQN A;  3I3J A;  5AME A;  3JVK A;  4LYS A;  5CUE A;  5EPB A;  5ACY A;  4LYI A;  2L85 A;  5D3J A;  5D0C A;  3U5O A;  4A9J A;  4O78 A;  5FB1 A;  5ENI A;  5D3S A;  5E9L A;  2YQD A;  5ENH A;  5JWM A;  5E0R A;  2DWW A;  4YYJ A;  5FE0 A;  4YAT A;  4CUQ A;  2OUO A;  3HMH A;  4QST A;  5HQ7 A;  5LKU A;  5LKX A;  2E7N A;  5COI A;  4NR7 A;  4QBM A;  3JVL A;  2RNY A;  2LSP B;  2R0V A;  4NS5 A;  5E9V A;  2DVV A;  3TLP A;  4IR3 A;  5FE8 A;  3ZYU A;  3UW9 A;  3QZV A;  5A5S A;  3IU6 A;  5EPS A;  5LJ2 A;  4QY4 A;  4LDF A;  5IGK A;  3LXJ A;  5EI4 A;  4ZC9 A;  5F5Z A;  4HXK A;  4QEV A;  4OGI A;  5DLX A;  1X0J A;  4YK0 A;  5CRZ A;  5FH6 A;  5KO4 A;  4QSQ A;  3U5J A;  4N4F A;  4KV1 A;  5CUG A;  3Q2F A;  4MR4 A;  4CUU A;  5E9M A;  3UVW A;  3U5M A;  4YYD A;  3U5P A;  4YAX A;  4NXJ A;  4QSU A;  4BHW A;  4XUA A;  5K29 A;  4N4G A;  4IOR A;  5F3A A;  2FSA A;  3G0L A;  5FFW A;  5E3D A;  5EIC A;  3O37 A;  5L8T A;  4LZ2 A;  5C87 A;  2GRC A;  4BW4 A;  5G4S A;  5HJC A;  3U5L A;  4UYF A;  1EQF A;  4A9F A;  5FFY A;  5F2P A;  5HEM A;  4ZQL A;  5I83 A;  5IGM A;  4NRB A;  4QSX A;  5CGP A;  5DBM A;  4A9N A;  5ENG A;  5CUC A;  1WUG A;  3S92 A;  2RNW A;  5A81 A;  3RCW A;  3D7C A;  4UIW A;  3DWY A;  2R10 A;  5FE1 A;  5A5N A;  5BT3 A;  5CQ3 A;  5AMF A;  5LKZ A;  4O7F A;  4Z1S A;  3QZS A;  2I8N A;  5A5P A;  5DFC A;  3FKM X;  5EPR A;  4QC1 A;  5HRV A;  5CU8 A;  4QYD A;  5ETD A;  3SVG A;  4YYM A;  5LJ0 A;  5EQ1 A;  2DAT A;  4IOQ A;  4A9M A;  4IR6 A;  4ALH A;  3MUK A;  1N72 A;  4N3W A;  4BW3 A;  5EIS A;  4X2I A;  5EP7 A;  4CFK A;  4HXO A;  5LKT A;  4UIZ A;  5DYA A;  2L5E A;  4PCE A;  5TB6 A;  4O77 A;  4YYH A;  3U5N A;  4GPJ A;  5DKH A;  1E6I A;  2DVQ A;  5DFB A;  5EM3 A;  5A7C A;  4MEN A;  5FE9 A;  4Q0O A;  4NYW A;  5KTW A;  1F68 A;  4QEW A;  5ENC A;  4YYK A;  4YYN A;  4ZW1 A;  4NRA A;  3P1F A;  5L96 A;  5EGU A;  4O74 A;  4LZR A;  4WHW A;  3QZT A;  4WIV A;  5EWH A;  4O7C A;  4TT2 A;  4QSR A;  4QNS A;  4CL9 A;  5FE3 A;  3ONI A;  4HXM A;  5DKD A;  5CQ4 A;  4KCX A;  5F62 A;  4MEP A;  4YC9 A;  5CQA A;  5FG5 A;  3DAI A;  3UVY A;  5F36 A;  4CFL A;  5A5Q A;  3O34 A;  3MQM A;  2E3K A;  3P1D A;  4QYL A;  5ENE A;  5F63 A;  3MXF A;  4QSS A;  4TZ2 A;  5LJ1 A;  4E96 A;  5ENB A;  5D3T A;  2L84 A;  5E9I A;  5HFQ A;  5CQ5 A;  2YEK A;  4QSV A;  4XYA A;  4PS5 A;  3P1E A;  4OGJ A;  4TU6 A;  5CS8 A;  5E7D A;  2DVR A;  3UVD A;  2RNX A;  5E74 A;  5CQ7 A;  4Z1Q A;  4Y03 A;  4UYH A;  2E7O A;  3JVJ A;  4LC2 A;  5E73 A;  4NR9 A;  5HFR A;  5FDZ A;  2D9E A;  3LQH A;  4TT4 A;  5D3R A;  2KTB B;  4NUC A;  5IBN A;  4A9H A;  4MEO A;  1WUM A;  4O7E A;  4O75 A;  5CRM A;  3JVM A;  3MB4 A;  3AAD A;  5IGL A;  4TYL A;  4PCI A;  4YAB A;  4MR6 A;  4TT6 A;  3O33 A;  3P5O A;  4YY4 A;  5CQ8 A;  4F3I A;  5I1Q A;  5DW2 A;  2F6J A;  4Q0N A;  2RFJ A;  4UIT A;  4UYF B;  5II1 A;  4BW2 A;  3UV2 A;  5D26 A;  2D82 A;  5DYC A;  4YYI A;  3LQJ A;  5A5R A;  3NXB A;  4A9L A;  5KTU A;  5H1V A;  5I80 A;  4O7A A;  5CPE A;  5KU3 A;  4YAD A;  3IU5 A;  4C67 A;  4QB3 A;  5F1L A;  4QR4 A;  5A83 A;  5F1H A;  5C89 A;  5HQ5 A;  4LR6 A;  4PKL A;  5FH8 A;  5CQT A;  5DKC A;  4J0S A;  4NR8 A;  4YYG A;  5E9K A;  5IGN A;  4IR4 A;  4RVR A;  1ZS5 A;  5L98 A;  5EWC A;  5FH7 A;  4UIU A;  5II2 A;  2N9G A;  5FG6 A;  5DYX A;  4NUD A;  4QUT A;  4A9E A;  4XUB A;  5ENF A;  3UV5 A;  5LUU A;  5CUA A;  4BJX A;  5G4R A;  4N4H A;  4UIY A;  5FFV A;  2NXB A;  5CUB A;  5A82 A;  5F60 A;  5EA1 A;  5FE7 A;  5I7Y A;  3O36 A;  2MJV B;  5AD3 A;  5IID A;  5A85 A;  2YDW A;  4O7B A;  4QC3 A;  5H1U A;  4NR5 A;  4CUS A;  5KHM A;  4NQN A;  3U5K A;  5I88 A;  4YBM A;  4J0R A;  4UYG A;  4UYD A;  4LRG A;  5D3L A;  2R0Y A;  5FE5 A;  2RI7 A;  4QR5 A;  4Z93 A;  5L99 A;  5L97 A;  5ETB A;  2YYN A;  2OSS A;  2YEM A;  5FE4 A;  4DON A;  4TZ8 A;  2WP1 A;  4LYW A;  5D7X A;  5C8G A;  5HM0 A;  5IG6 A;  5DX4 A;  5HLS A;  5CZG A;  4QSW A;  3S91 A;  4Z6I A;  5EU1 A;  3G0J A;  5HEN A;  4NYV A;  5F25 A;  5I7X A;  5I29 A;  3O35 A;  4A9I A;  4TU4 A;  4QR3 A;  1JSP B;  5J0D A;  4TTE A;  3MUL A;  5I89 A;  3MB3 A;  3GG3 A;  4AKN A;  4HXR A;  5EVA A;  4UIV A;  5JI8 A;  5EV9 A;  4A9O A;  5HCL A;  4HBX A;  5FB0 A;  4QEU A;  4UIX A;  4NRC A;  5D3N A;  4J1P A;  3HME A;  4UYE A;  4FLP A;  4C66 A;  4QZS A;  5H85 A;  4YBT A;  5C85 A;  3LJW A;  4PY6 A;  4A9K A;  5DYU A;  4LZS A;  3UV4 A;  5D3P A;  5CY9 A;  4NQM A;  4Z6H A;  4OUF A;  4N4I A;  4QSP A;  1JM4 B;  4CUT A;  5FG4 A;  4XY8 A;  4NR6 A;  3LQI A;  4O76 A;  5HEL A;  5EWV A;  5A5O A;  5KTX A;  3HMF A;  4J3I A;  5FE6 A;  3SVH A;  4O72 A;  2H60 A;  5DLZ A;  5LVQ A;  2RO1 A;  2YW5 A;  2DKW A;  4XY9 A;  4O70 A;  4KV4 A;  3Q2E A;  5HQ6 A;  3AQA A;  5EWD A;  4O71 A;  2I7K A;  5HRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...