4TT6A

Crystal structure of atad2a bromodomain double mutant n1063a-y1064a in apo form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEAAPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
molecule keywords ATPase family AAA domain-containing protein 2
molecule tags Gene regulation
source organism Homo sapiens
total genus 53
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tt6A00
5F60A 3ONIA 4QR4A 2DVSA 4Z6IA 2YDWA 5A81A 5D3NA 2LSPB 5F62A 3JVJA 5ACYA 4MR6A 3UW9A 2YYNA 3IU6A 5LKUA 4CUSA 4QC3A 4BHWA 2RNYA 3U5OA 5EICA 5FB1A 4UITA 4A9JA 2OUOA 4UYDA 5KU3A 4GPJA 4MEPA 3FKMX 5D3HA 3UVDA 3LJWA 5HQ6A 4HBYA 5FH6A 2H60A 5A5PA 3ZYUA 5E7DA 1JM4B 5CQ5A 5KTWA 5C87A 5DFCA 4QSVA 4PTBA 4A9EA 4J3IA 4MR4A 4UYEA 5CUAA 2OSSA 5D3SA 4O7EA 4TZ2A 4KV1A 4C67A 2R10A 4QNSA 1F68A 4XUBA 5L96A 5AMEA 3UVXA 4HXPA 5CUEA 4UIZA 5AD3A 4IR4A 4CUPA 4O71A 5I7YA 2NXBA 2L85A 4CL9A 4F3IA 4YYGA 3G0LA 3MB3A 3JVMA 4PCIA 4QSUA 3S91A 5DW2A 2OO1A 5LJ0A 2GRCA 5IGKA 5CQ3A 4A9KA 4FLPA 5DYAA 2RNXA 5CUBA 4BW3A 3HMHA 5EA1A 5DKCA 4QEWA 5F5ZA 4YYDA 4X2IA 2FSAA 4NUDA 5F3AA 3HMEA 4KCXA 4HXNA 5HM0A 5D26A 4O74A 4XY8A 5FFYA 2R0SA 4LDFA 3IU5A 4ZC9A 1X0JA 5HRWA 4MR3A 4BW2A 2DVVA 2D82A 5FE4A 5I29A 5KO4A 5FFWA 4TT4A 4XY9A 4NRAA 4UIXA 2I8NA 4Q0OA 3O34A 4LYIA 4N3WA 5BT5A 4HXKA 5CRMA 2WP1A 2RNWA 4QR5A 4N4HA 2WP2A 4HXLA 4UIVA 5FH7A 5EGUA 4J0RA 5TCMA 4TYLA 5CY9A 4A9MA 2N9GA 2F6NA 3MULA 4O7BA 4O7CA 2DATA 5G4RA 4BW1A 5FH8A 4QC1A 2YELA 3AQAA 5LUUA 4CLBA 4DONA 4IORA 5A5QA 5EPRA 5F36A 4LYWA 5DY7A 5C8GA 5G4SA 4UYFB 5CUGA 4NR4A 5DBMA 5L99A 5LKZA 3Q2FA 4IOQA 3S92A 4Z1SA 5FE8A 3JVLA 2YW5A 5ETDA 4NR6A 4UYFA 5CQ6A 5E9YA 5I80A 4NUCA 2R0VA 5EISA 4ALHA 5E9VA 3UVWA 2DKWA 4HXSA 4LZRA 5EVAA 5HRVA 4A9IA 2YEMA 5CUCA 4YABA 4LZSA 5L8TA 4TTEA 5FG5A 5LVQA 5CQTA 4QYDA 5CS8A 4C66A 4QSXA 2RFJA 4WIVA 5ENEA 4HXMA 3LXJA 4YBTA 3QZVA 4A9NA 4LYSA 4XYAA 5FBXA 4NQNA 5CPEA 5D25A 3UV2A 5E73A 4CURA 3MUKA 4N4IA 4TS8A 5JI8A 5KTUA 5ENJA 1WUMA 5EWCA 4Z1QA 5FE2A 5I88A 4LRGA 4QEVA 4UIYA 4QSQA 3U5KA 3K2JA 4TU4A 3U5NA 5FE3A 2DVQA 4MENA 5II2A 4Q0NA 5LJ2A 5H1TA 5DW1A 5FE7A 2G4AA 4MEOA 5DKDA 4AKNA 5IGMA 5J0DA 4O70A 5CU8A 3D7CA 3QZTA 4NQMA 5HENA 2E3KA 4TT6A 4QUTA 5II1A 2D9EA 1N72A 4KV4A 5D0CA 5I7XA 4OGJA 2YEKA 2DVRA 4A9HA 4TU6A 5CQ7A 2YQDA 5I40A 5FE9A 4CUQA 4PCEA 5KTXA 4QR3A 4YYMA 5TB6A 3DAIA 3LQJA 1WUGA 4PKLA 4QSPA 5DFBA 5C4QA 5IBNA 5A5SA 5EU1A 4YY4A 5CZGA 5F61A 5I1QA 3QZSA 5HJCA 2L5EA 5DLZA 5F1LA 4LC2A 5L8UA 4TZ8A 3HMFA 4QSSA 4ZW1A 5F1HA 5D7XA 5FG6A 4QUUA 5E9KA 5ENFA 5CRZA 3AADA 4IR3A 5EQ1A 5IG6A 4YY6A 5CP5A 5EM3A 3SVHA 3LQIA 5H1VA 5H85A 4YADA 5BT3A 5HLSA 4A9LA 4HXOA 5IGNA 5DYXA 4A9OA 5D3JA 4QSRA 5C85A 3Q2EA 2I7KA 4MEQA 4CFKA 5FE1A 5FE5A 5CQ4A 5D3TA 5E9MA 5K29A 4LZ2A 3P5OA 5E9LA 3U5MA 4UYGA 4A9FA 4YYJA 4CUTA 5E3DA 5E9IA 5A5RA 4IR6A 5ENCA 3P1EA 4NR8A 5E74A 5COIA 3SVFA 4UIWA 3MXFA 4UIUA 4ALGA 5EWDA 3SVGA 4WHUA 5HELA 4YYIA 3O36A 4YK0A 5E3GA 4J0SA 4TT2A 5H1UA 4QZSA 5DYCA 5C89A 5F2PA 4QEUA 4YBMA 5EWVA 4HBWA 1EQFA 4NYWA 4BJXA 5LVRA 4QSWA 5ENGA 4Z93A 5I86A 5C7NA 3GG3A 1E6IA 4NR7A 4Y03A 4UYHA 4YYKA 5FFVA 3P1DA 4O76A 5D3RA 4O7AA 5D3LA 5DYUA 5FDZA 4CUUA 5KHMA 4O77A 4QBMA 2DWWA 4YH3A 5DFDA 4NUEA 4QSTA 5CQ8A 4RVRA 5ENIA 4QB3A 4O75A 2R0YA 4YC9A 5JWMA 3NXBA 5FB0A 4YAXA 5F63A 5EWHA 4BW4A 3DWYA 4YYHA 5HFQA 4ZQLA 1ZS5A 5L98A 5ETBA 5A5OA 5FE0A 3UV5A 5A7CA 4XUAA 4NYVA 4IOOA 2RO1A 2RI7A 4YBSA 1JSPB 5HRXA 5ENBA 5EI4A 3G0JA 4PY6A 3U5PA 2MJVB 5HQ7A 5AD2A 5EWWA 3MQMA 5L97A 5HQ5A 4QY4A 5LKXA 5CGPA 4YH4A 4HBVA 4Z6HA 2L84A 4NYXA 4CFLA 3TLPA 5IGLA 5HEMA 4QYLA 3U5JA 4NRCA 4J1PA 5LKTA 2RS9B 3O33A 5A5NA 5DX4A 5DLXA 4YATA 5HFRA 5EPSA 4O7FA 4NR9A 5EV9A 3UVYA 4E96A 4OGIA 5I83A 5DKHA 4LR6A 3P1FA 3JVKA 4WHWA 5IIDA 5E0RA 3P1CA 5A83A 5I89A 5A82A 3O37A 5CTLA 5A85A 5D24A 5FG4A 2KTBB 4O72A 3O35A 5CUDA 4HXRA 4IR5A 5D3PA 5F25A 5CQAA 4N4GA 4O78A 4NRBA 5CFWA 5EP7A 4TQNA 4NXJA 4YYNA 4NS5A 5HCLA 5LJ1A 3MB4A 3RCWA 3I3JA 5BT4A 4N4FA 5AMFA 4HBXA 4PS5A 5EPBA 3UV4A 3U5LA 2E7NA 4NR5A 5ENHA 5EK9A 2E7OA 5FE6A 3LQHA 2F6JA 4MR5A 4OUFA
chains in the Genus database with same CATH superfamily
5F60A 3ONIA 4QR4A 2DVSA 4Z6IA 2YDWA 5A81A 5D3NA 2LSPB 5F62A 3JVJA 5ACYA 4MR6A 3UW9A 2YYNA 3IU6A 5LKUA 4CUSA 4QC3A 4BHWA 2RNYA 3U5OA 5EICA 5FB1A 4UITA 4A9JA 3D1BA 2OUOA 4UYDA 5KU3A 4GPJA 4MEPA 4AKIA 3FKMX 5D3HA 3UVDA 3LJWA 5HQ6A 4HBYA 5FH6A 2H60A 5A5PA 3ZYUA 5E7DA 1JM4B 5CQ5A 5KTWA 5C87A 5DFCA 4QSVA 4PTBA 4A9EA 4J3IA 4MR4A 4UYEA 5CUAA 2OSSA 5D3SA 4O7EA 4TZ2A 4KV1A 4C67A 2R10A 4QNSA 1F68A 4XUBA 5L96A 5AMEA 3UVXA 4HXPA 5CUEA 4UIZA 5AD3A 4IR4A 4CUPA 4O71A 5I7YA 2NXBA 2L85A 4CL9A 4F3IA 4YYGA 3G0LA 3MB3A 3ERRA 3JVMA 4PCIA 4QSUA 3S91A 5DW2A 2OO1A 5LJ0A 2GRCA 5IGKA 5CQ3A 4A9KA 4FLPA 5DYAA 2RNXA 5CUBA 4BW3A 3HMHA 5EA1A 5DKCA 4QEWA 5F5ZA 4YYDA 4X2IA 2FSAA 4NUDA 5F3AA 3HMEA 4KCXA 4HXNA 5HM0A 5D26A 4O74A 4XY8A 5FFYA 2R0SA 4LDFA 3IU5A 4ZC9A 1X0JA 5HRWA 4MR3A 4BW2A 2DVVA 2D82A 2EJNA 5FE4A 5I29A 5KO4A 5FFWA 4TT4A 4XY9A 4NRAA 4UIXA 2I8NA 4Q0OA 3O34A 4LYIA 4N3WA 5BT5A 4HXKA 5CRMA 2WP1A 2RNWA 4QR5A 4N4HA 2WP2A 4HXLA 4UIVA 5FH7A 5EGUA 4J0RA 5TCMA 4TYLA 5CY9A 4A9MA 2N9GA 2F6NA 3MULA 4O7BA 4O7CA 2DATA 5G4RA 4BW1A 5FH8A 4QC1A 2YELA 3AQAA 5LUUA 4CLBA 4DONA 1ZKRA 4IORA 5A5QA 5EPRA 5F36A 4LYWA 5DY7A 5C8GA 5G4SA 4UYFB 5CUGA 4NR4A 5DBMA 5L99A 5LKZA 3Q2FA 4IOQA 3S92A 4Z1SA 5FE8A 3JVLA 2YW5A 5ETDA 4NR6A 4UYFA 5CQ6A 5E9YA 5I80A 4NUCA 2R0VA 5EISA 4ALHA 5E9VA 3UVWA 2DKWA 4HXSA 4LZRA 5EVAA 5HRVA 4A9IA 2YEMA 5CUCA 4YABA 4LZSA 5L8TA 4TTEA 5FG5A 5LVQA 5CQTA 4QYDA 5CS8A 4C66A 4QSXA 2RFJA 4WIVA 5ENEA 4HXMA 3LXJA 4YBTA 4AKHA 3VKHA 3QZVA 4A9NA 4LYSA 1PUOA 4XYAA 5FBXA 4NQNA 5CPEA 5D25A 4AKGA 3UV2A 5E73A 4CURA 3MUKA 4N4IA 4TS8A 5JI8A 5KTUA 5ENJA 1WUMA 5EWCA 4Z1QA 5FE2A 5I88A 4LRGA 4QEVA 4UIYA 4QSQA 3U5KA 3K2JA 4TU4A 3U5NA 5FE3A 2DVQA 4MENA 5II2A 4Q0NA 5LJ2A 5H1TA 5DW1A 5FE7A 2G4AA 4MEOA 5DKDA 4AKNA 5IGMA 5J0DA 4O70A 5CU8A 3D7CA 3QZTA 4NQMA 5HENA 2E3KA 4TT6A 4QUTA 5II1A 2D9EA 1N72A 4KV4A 5D0CA 5I7XA 4OGJA 2YEKA 2DVRA 4A9HA 4TU6A 3VKGA 5CQ7A 2YQDA 5I40A 5FE9A 4CUQA 4PCEA 5KTXA 4QR3A 4YYMA 5TB6A 3DAIA 3LQJA 1WUGA 4PKLA 4QSPA 5DFBA 5C4QA 5IBNA 5A5SA 5EU1A 4YY4A 5CZGA 5F61A 5I1QA 3QZSA 5HJCA 2L5EA 5DLZA 5F1LA 4LC2A 5L8UA 4TZ8A 3HMFA 4QSSA 4ZW1A 5F1HA 5D7XA 5FG6A 4QUUA 5E9KA 5ENFA 5CRZA 3AADA 4IR3A 5EQ1A 5IG6A 4YY6A 5CP5A 5EM3A 3SVHA 3LQIA 5H1VA 5H85A 4YADA 5BT3A 5HLSA 4A9LA 4HXOA 5IGNA 5DYXA 4A9OA 5D3JA 4QSRA 5C85A 3Q2EA 2I7KA 4MEQA 4CFKA 5FE1A 5FE5A 5CQ4A 5D3TA 5E9MA 5K29A 4LZ2A 3P5OA 5E9LA 3U5MA 4UYGA 4A9FA 4YYJA 4CUTA 5E3DA 5E9IA 5A5RA 4IR6A 5ENCA 3P1EA 4NR8A 5E74A 5COIA 3SVFA 4UIWA 3MXFA 4UIUA 4ALGA 5EWDA 3SVGA 4WHUA 5HELA 4YYIA 3O36A 4YK0A 5E3GA 4J0SA 4TT2A 5H1UA 4QZSA 5DYCA 5C89A 5F2PA 4QEUA 4YBMA 5EWVA 4HBWA 1EQFA 4NYWA 4BJXA 5LVRA 4QSWA 5ENGA 4Z93A 5I86A 5C7NA 3GG3A 1E6IA 4NR7A 3D1DA 4Y03A 4UYHA 4YYKA 5FFVA 3P1DA 4O76A 5D3RA 4O7AA 5D3LA 5DYUA 5FDZA 4CUUA 5KHMA 4O77A 4QBMA 2DWWA 4YH3A 5DFDA 4NUEA 4QSTA 5CQ8A 4RVRA 5ENIA 4QB3A 4O75A 2R0YA 4YC9A 5JWMA 3NXBA 5FB0A 4YAXA 5F63A 5EWHA 4BW4A 3DWYA 4YYHA 5HFQA 4ZQLA 1ZS5A 5L98A 5ETBA 5A5OA 5FE0A 3UV5A 5A7CA 4XUAA 4NYVA 4IOOA 2RO1A 2RI7A 4YBSA 1JSPB 5HRXA 5ENBA 5EI4A 3G0JA 4PY6A 3U5PA 2MJVB 5HQ7A 5AD2A 5EWWA 3MQMA 5L97A 5HQ5A 4QY4A 5LKXA 5CGPA 4YH4A 4HBVA 4Z6HA 2L84A 4NYXA 4CFLA 3TLPA 5IGLA 5HEMA 4QYLA 3U5JA 4NRCA 4J1PA 5LKTA 2RS9B 4AI6A 3O33A 5A5NA 5DX4A 5DLXA 4YATA 5HFRA 5EPSA 4O7FA 4NR9A 5EV9A 3UVYA 4E96A 4OGIA 5I83A 5DKHA 4LR6A 3P1FA 3JVKA 4WHWA 5IIDA 5E0RA 3P1CA 5A83A 5I89A 5A82A 3O37A 5CTLA 5A85A 5D24A 5FG4A 2KTBB 4O72A 3O35A 5CUDA 4HXRA 4IR5A 5D3PA 5F25A 5CQAA 4N4GA 4O78A 4NRBA 5CFWA 5EP7A 4TQNA 4NXJA 4YYNA 4NS5A 5HCLA 5LJ1A 3MB4A 3RCWA 3I3JA 5BT4A 4N4FA 5AMFA 4HBXA 4PS5A 5EPBA 3UV4A 3U5LA 2E7NA 4NR5A 5ENHA 5EK9A 2E7OA 5FE6A 3LQHA 2F6JA 4MR5A 4OUFA
chains in the Genus database with same CATH topology
5F60A 3ONIA 4QR4A 2DVSA 4Z6IA 2YDWA 5A81A 5D3NA 2LSPB 5F62A 3JVJA 5ACYA 4MR6A 3UW9A 2YYNA 3IU6A 5LKUA 4CUSA 4QC3A 4BHWA 2RNYA 3U5OA 5EICA 5FB1A 4UITA 4A9JA 2OUOA 4UYDA 5KU3A 4GPJA 4MEPA 3FKMX 5D3HA 3UVDA 3LJWA 5HQ6A 4HBYA 5FH6A 2H60A 5A5PA 3ZYUA 5E7DA 1JM4B 5CQ5A 5KTWA 5C87A 5DFCA 4QSVA 4PTBA 4A9EA 4J3IA 4MR4A 4UYEA 5CUAA 2OSSA 5D3SA 4O7EA 4TZ2A 4KV1A 4C67A 2R10A 4QNSA 1F68A 4XUBA 5L96A 5AMEA 3UVXA 4HXPA 5CUEA 4UIZA 5AD3A 4IR4A 4CUPA 4O71A 5I7YA 2NXBA 2L85A 4CL9A 4F3IA 4YYGA 3G0LA 3MB3A 3JVMA 4PCIA 4QSUA 3S91A 5DW2A 2OO1A 5LJ0A 2GRCA 5IGKA 5CQ3A 4A9KA 4FLPA 5DYAA 2RNXA 5CUBA 4BW3A 3HMHA 5EA1A 5DKCA 4QEWA 5F5ZA 4YYDA 4X2IA 2FSAA 4NUDA 5F3AA 3HMEA 4KCXA 4HXNA 5HM0A 5D26A 4O74A 4XY8A 5FFYA 2R0SA 4LDFA 3IU5A 4ZC9A 1X0JA 5HRWA 4MR3A 4BW2A 2DVVA 2D82A 5FE4A 5I29A 5KO4A 5FFWA 4TT4A 4XY9A 4NRAA 4UIXA 2I8NA 4Q0OA 3O34A 4LYIA 4N3WA 5BT5A 4HXKA 5CRMA 2WP1A 2RNWA 4QR5A 4N4HA 2WP2A 4HXLA 4UIVA 5FH7A 5EGUA 4J0RA 5TCMA 4TYLA 5CY9A 4A9MA 2N9GA 2F6NA 3MULA 4O7BA 4O7CA 2DATA 5G4RA 4BW1A 5FH8A 4QC1A 2YELA 3AQAA 5LUUA 4CLBA 4DONA 4IORA 5A5QA 5EPRA 5F36A 4LYWA 5DY7A 5C8GA 5G4SA 4UYFB 5CUGA 4NR4A 5DBMA 5L99A 5LKZA 3Q2FA 4IOQA 3S92A 4Z1SA 5FE8A 3JVLA 2YW5A 5ETDA 4NR6A 4UYFA 5CQ6A 5E9YA 5I80A 4NUCA 2R0VA 5EISA 4ALHA 5E9VA 3UVWA 2DKWA 4HXSA 4LZRA 5EVAA 5HRVA 4A9IA 2YEMA 5CUCA 4YABA 4LZSA 5L8TA 4TTEA 5FG5A 5LVQA 5CQTA 4QYDA 5CS8A 4C66A 4QSXA 2RFJA 4WIVA 5ENEA 4HXMA 3LXJA 4YBTA 3QZVA 4A9NA 4LYSA 4XYAA 5FBXA 4NQNA 5CPEA 5D25A 3UV2A 5E73A 4CURA 3MUKA 4N4IA 4TS8A 5JI8A 5KTUA 5ENJA 1WUMA 5EWCA 4Z1QA 5FE2A 5I88A 4LRGA 4QEVA 4UIYA 4QSQA 3U5KA 3K2JA 4TU4A 3U5NA 5FE3A 2DVQA 4MENA 5II2A 4Q0NA 5LJ2A 5H1TA 5DW1A 5FE7A 2G4AA 4MEOA 5DKDA 4AKNA 5IGMA 5J0DA 4O70A 5CU8A 3D7CA 3QZTA 4NQMA 5HENA 2E3KA 4TT6A 4QUTA 5II1A 2D9EA 1N72A 4KV4A 5D0CA 5I7XA 4OGJA 2YEKA 2DVRA 4A9HA 4TU6A 5CQ7A 2YQDA 5I40A 5FE9A 4CUQA 4PCEA 5KTXA 4QR3A 4YYMA 5TB6A 3DAIA 3LQJA 1WUGA 4PKLA 4QSPA 5DFBA 5C4QA 5IBNA 5A5SA 5EU1A 4YY4A 5CZGA 5F61A 5I1QA 3QZSA 5HJCA 2L5EA 5DLZA 5F1LA 4LC2A 5L8UA 4TZ8A 3HMFA 4QSSA 4ZW1A 5F1HA 5D7XA 5FG6A 4QUUA 5E9KA 5ENFA 5CRZA 3AADA 4IR3A 5EQ1A 5IG6A 4YY6A 5CP5A 5EM3A 3SVHA 3LQIA 5H1VA 5H85A 4YADA 5BT3A 5HLSA 4A9LA 4HXOA 5IGNA 5DYXA 4A9OA 5D3JA 4QSRA 5C85A 3Q2EA 2I7KA 4MEQA 4CFKA 5FE1A 5FE5A 5CQ4A 5D3TA 5E9MA 5K29A 4LZ2A 3P5OA 5E9LA 3U5MA 4UYGA 4A9FA 4YYJA 4CUTA 5E3DA 5E9IA 5A5RA 4IR6A 5ENCA 3P1EA 4NR8A 5E74A 5COIA 3SVFA 4UIWA 3MXFA 4UIUA 4ALGA 5EWDA 3SVGA 4WHUA 5HELA 4YYIA 3O36A 4YK0A 5E3GA 4J0SA 4TT2A 5H1UA 4QZSA 5DYCA 5C89A 5F2PA 4QEUA 4YBMA 5EWVA 4HBWA 1EQFA 4NYWA 4BJXA 5LVRA 4QSWA 5ENGA 4Z93A 5I86A 5C7NA 3GG3A 1E6IA 4NR7A 4Y03A 4UYHA 4YYKA 5FFVA 3P1DA 4O76A 5D3RA 4O7AA 5D3LA 5DYUA 5FDZA 4CUUA 5KHMA 4O77A 4QBMA 2DWWA 4YH3A 5DFDA 4NUEA 4QSTA 5CQ8A 4RVRA 5ENIA 4QB3A 4O75A 2R0YA 4YC9A 5JWMA 3NXBA 5FB0A 4YAXA 5F63A 5EWHA 4BW4A 3DWYA 4YYHA 5HFQA 4ZQLA 1ZS5A 5L98A 5ETBA 5A5OA 5FE0A 3UV5A 5A7CA 4XUAA 4NYVA 4IOOA 2RO1A 2RI7A 4YBSA 1JSPB 5HRXA 5ENBA 5EI4A 3G0JA 4PY6A 3U5PA 2MJVB 5HQ7A 5AD2A 5EWWA 3MQMA 5L97A 5HQ5A 4QY4A 5LKXA 5CGPA 4YH4A 4HBVA 4Z6HA 2L84A 4NYXA 4CFLA 3TLPA 5IGLA 5HEMA 4QYLA 3U5JA 4NRCA 4J1PA 5LKTA 2RS9B 3O33A 5A5NA 5DX4A 5DLXA 4YATA 5HFRA 5EPSA 4O7FA 4NR9A 5EV9A 3UVYA 4E96A 4OGIA 5I83A 5DKHA 4LR6A 3P1FA 3JVKA 4WHWA 5IIDA 5E0RA 3P1CA 5A83A 5I89A 5A82A 3O37A 5CTLA 5A85A 5D24A 5FG4A 2KTBB 4O72A 3O35A 5CUDA 4HXRA 4IR5A 5D3PA 5F25A 5CQAA 4N4GA 4O78A 4NRBA 5CFWA 5EP7A 4TQNA 4NXJA 4YYNA 4NS5A 5HCLA 5LJ1A 3MB4A 3RCWA 3I3JA 5BT4A 4N4FA 5AMFA 4HBXA 4PS5A 5EPBA 3UV4A 3U5LA 2E7NA 4NR5A 5ENHA 5EK9A 2E7OA 5FE6A 3LQHA 2F6JA 4MR5A 4OUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F60 A;  3ONI A;  4QR4 A;  2DVS A;  4Z6I A;  2YDW A;  5A81 A;  5D3N A;  2LSP B;  5F62 A;  3JVJ A;  5ACY A;  4MR6 A;  3UW9 A;  2YYN A;  3IU6 A;  5LKU A;  4CUS A;  4QC3 A;  4BHW A;  2RNY A;  3U5O A;  5EIC A;  5FB1 A;  4UIT A;  4A9J A;  2OUO A;  4UYD A;  5KU3 A;  4GPJ A;  4MEP A;  3FKM X;  5D3H A;  3UVD A;  3LJW A;  5HQ6 A;  4HBY A;  5FH6 A;  2H60 A;  5A5P A;  3ZYU A;  5E7D A;  1JM4 B;  5CQ5 A;  5KTW A;  5C87 A;  5DFC A;  4QSV A;  4PTB A;  4A9E A;  4J3I A;  4MR4 A;  4UYE A;  5CUA A;  2OSS A;  5D3S A;  4O7E A;  4TZ2 A;  4KV1 A;  4C67 A;  2R10 A;  4QNS A;  1F68 A;  4XUB A;  5L96 A;  5AME A;  3UVX A;  4HXP A;  5CUE A;  4UIZ A;  5AD3 A;  4IR4 A;  4CUP A;  4O71 A;  5I7Y A;  2NXB A;  2L85 A;  4CL9 A;  4F3I A;  4YYG A;  3G0L A;  3MB3 A;  3JVM A;  4PCI A;  4QSU A;  3S91 A;  5DW2 A;  2OO1 A;  5LJ0 A;  2GRC A;  5IGK A;  5CQ3 A;  4A9K A;  4FLP A;  5DYA A;  2RNX A;  5CUB A;  4BW3 A;  3HMH A;  5EA1 A;  5DKC A;  4QEW A;  5F5Z A;  4YYD A;  4X2I A;  2FSA A;  4NUD A;  5F3A A;  3HME A;  4KCX A;  4HXN A;  5HM0 A;  5D26 A;  4O74 A;  4XY8 A;  5FFY A;  2R0S A;  4LDF A;  3IU5 A;  4ZC9 A;  1X0J A;  5HRW A;  4MR3 A;  4BW2 A;  2DVV A;  2D82 A;  5FE4 A;  5I29 A;  5KO4 A;  5FFW A;  4TT4 A;  4XY9 A;  4NRA A;  4UIX A;  2I8N A;  4Q0O A;  3O34 A;  4LYI A;  4N3W A;  5BT5 A;  4HXK A;  5CRM A;  2WP1 A;  2RNW A;  4QR5 A;  4N4H A;  2WP2 A;  4HXL A;  4UIV A;  5FH7 A;  5EGU A;  4J0R A;  5TCM A;  4TYL A;  5CY9 A;  4A9M A;  2N9G A;  2F6N A;  3MUL A;  4O7B A;  4O7C A;  2DAT A;  5G4R A;  4BW1 A;  5FH8 A;  4QC1 A;  2YEL A;  3AQA A;  5LUU A;  4CLB A;  4DON A;  4IOR A;  5A5Q A;  5EPR A;  5F36 A;  4LYW A;  5DY7 A;  5C8G A;  5G4S A;  4UYF B;  5CUG A;  4NR4 A;  5DBM A;  5L99 A;  5LKZ A;  3Q2F A;  4IOQ A;  3S92 A;  4Z1S A;  5FE8 A;  3JVL A;  2YW5 A;  5ETD A;  4NR6 A;  4UYF A;  5CQ6 A;  5E9Y A;  5I80 A;  4NUC A;  2R0V A;  5EIS A;  4ALH A;  5E9V A;  3UVW A;  2DKW A;  4HXS A;  4LZR A;  5EVA A;  5HRV A;  4A9I A;  2YEM A;  5CUC A;  4YAB A;  4LZS A;  5L8T A;  4TTE A;  5FG5 A;  5LVQ A;  5CQT A;  4QYD A;  5CS8 A;  4C66 A;  4QSX A;  2RFJ A;  4WIV A;  5ENE A;  4HXM A;  3LXJ A;  4YBT A;  3QZV A;  4A9N A;  4LYS A;  4XYA A;  5FBX A;  4NQN A;  5CPE A;  5D25 A;  3UV2 A;  5E73 A;  4CUR A;  3MUK A;  4N4I A;  4TS8 A;  5JI8 A;  5KTU A;  5ENJ A;  1WUM A;  5EWC A;  4Z1Q A;  5FE2 A;  5I88 A;  4LRG A;  4QEV A;  4UIY A;  4QSQ A;  3U5K A;  3K2J A;  4TU4 A;  3U5N A;  5FE3 A;  2DVQ A;  4MEN A;  5II2 A;  4Q0N A;  5LJ2 A;  5H1T A;  5DW1 A;  5FE7 A;  2G4A A;  4MEO A;  5DKD A;  4AKN A;  5IGM A;  5J0D A;  4O70 A;  5CU8 A;  3D7C A;  3QZT A;  4NQM A;  5HEN A;  2E3K A;  4TT6 A;  4QUT A;  5II1 A;  2D9E A;  1N72 A;  4KV4 A;  5D0C A;  5I7X A;  4OGJ A;  2YEK A;  2DVR A;  4A9H A;  4TU6 A;  5CQ7 A;  2YQD A;  5I40 A;  5FE9 A;  4CUQ A;  4PCE A;  5KTX A;  4QR3 A;  4YYM A;  5TB6 A;  3DAI A;  3LQJ A;  1WUG A;  4PKL A;  4QSP A;  5DFB A;  5C4Q A;  5IBN A;  5A5S A;  5EU1 A;  4YY4 A;  5CZG A;  5F61 A;  5I1Q A;  3QZS A;  5HJC A;  2L5E A;  5DLZ A;  5F1L A;  4LC2 A;  5L8U A;  4TZ8 A;  3HMF A;  4QSS A;  4ZW1 A;  5F1H A;  5D7X A;  5FG6 A;  4QUU A;  5E9K A;  5ENF A;  5CRZ A;  3AAD A;  4IR3 A;  5EQ1 A;  5IG6 A;  4YY6 A;  5CP5 A;  5EM3 A;  3SVH A;  3LQI A;  5H1V A;  5H85 A;  4YAD A;  5BT3 A;  5HLS A;  4A9L A;  4HXO A;  5IGN A;  5DYX A;  4A9O A;  5D3J A;  4QSR A;  5C85 A;  3Q2E A;  2I7K A;  4MEQ A;  4CFK A;  5FE1 A;  5FE5 A;  5CQ4 A;  5D3T A;  5E9M A;  5K29 A;  4LZ2 A;  3P5O A;  5E9L A;  3U5M A;  4UYG A;  4A9F A;  4YYJ A;  4CUT A;  5E3D A;  5E9I A;  5A5R A;  4IR6 A;  5ENC A;  3P1E A;  4NR8 A;  5E74 A;  5COI A;  3SVF A;  4UIW A;  3MXF A;  4UIU A;  4ALG A;  5EWD A;  3SVG A;  4WHU A;  5HEL A;  4YYI A;  3O36 A;  4YK0 A;  5E3G A;  4J0S A;  4TT2 A;  5H1U A;  4QZS A;  5DYC A;  5C89 A;  5F2P A;  4QEU A;  4YBM A;  5EWV A;  4HBW A;  1EQF A;  4NYW A;  4BJX A;  5LVR A;  4QSW A;  5ENG A;  4Z93 A;  5I86 A;  5C7N A;  3GG3 A;  1E6I A;  4NR7 A;  4Y03 A;  4UYH A;  4YYK A;  5FFV A;  3P1D A;  4O76 A;  5D3R A;  4O7A A;  5D3L A;  5DYU A;  5FDZ A;  4CUU A;  5KHM A;  4O77 A;  4QBM A;  2DWW A;  4YH3 A;  5DFD A;  4NUE A;  4QST A;  5CQ8 A;  4RVR A;  5ENI A;  4QB3 A;  4O75 A;  2R0Y A;  4YC9 A;  5JWM A;  3NXB A;  5FB0 A;  4YAX A;  5F63 A;  5EWH A;  4BW4 A;  3DWY A;  4YYH A;  5HFQ A;  4ZQL A;  1ZS5 A;  5L98 A;  5ETB A;  5A5O A;  5FE0 A;  3UV5 A;  5A7C A;  4XUA A;  4NYV A;  4IOO A;  2RO1 A;  2RI7 A;  4YBS A;  1JSP B;  5HRX A;  5ENB A;  5EI4 A;  3G0J A;  4PY6 A;  3U5P A;  2MJV B;  5HQ7 A;  5AD2 A;  5EWW A;  3MQM A;  5L97 A;  5HQ5 A;  4QY4 A;  5LKX A;  5CGP A;  4YH4 A;  4HBV A;  4Z6H A;  2L84 A;  4NYX A;  4CFL A;  3TLP A;  5IGL A;  5HEM A;  4QYL A;  3U5J A;  4NRC A;  4J1P A;  5LKT A;  2RS9 B;  3O33 A;  5A5N A;  5DX4 A;  5DLX A;  4YAT A;  5HFR A;  5EPS A;  4O7F A;  4NR9 A;  5EV9 A;  3UVY A;  4E96 A;  4OGI A;  5I83 A;  5DKH A;  4LR6 A;  3P1F A;  3JVK A;  4WHW A;  5IID A;  5E0R A;  3P1C A;  5A83 A;  5I89 A;  5A82 A;  3O37 A;  5CTL A;  5A85 A;  5D24 A;  5FG4 A;  2KTB B;  4O72 A;  3O35 A;  5CUD A;  4HXR A;  4IR5 A;  5D3P A;  5F25 A;  5CQA A;  4N4G A;  4O78 A;  4NRB A;  5CFW A;  5EP7 A;  4TQN A;  4NXJ A;  4YYN A;  4NS5 A;  5HCL A;  5LJ1 A;  3MB4 A;  3RCW A;  3I3J A;  5BT4 A;  4N4F A;  5AMF A;  4HBX A;  4PS5 A;  5EPB A;  3UV4 A;  3U5L A;  2E7N A;  4NR5 A;  5ENH A;  5EK9 A;  2E7O A;  5FE6 A;  3LQH A;  2F6J A;  4MR5 A;  4OUF A; 
#chains in the Genus database with same CATH topology
 5F60 A;  3ONI A;  4QR4 A;  2DVS A;  4Z6I A;  2YDW A;  5A81 A;  5D3N A;  2LSP B;  5F62 A;  3JVJ A;  5ACY A;  4MR6 A;  3UW9 A;  2YYN A;  3IU6 A;  5LKU A;  4CUS A;  4QC3 A;  4BHW A;  2RNY A;  3U5O A;  5EIC A;  5FB1 A;  4UIT A;  4A9J A;  3D1B A;  2OUO A;  4UYD A;  5KU3 A;  4GPJ A;  4MEP A;  4AKI A;  3FKM X;  5D3H A;  3UVD A;  3LJW A;  5HQ6 A;  4HBY A;  5FH6 A;  2H60 A;  5A5P A;  3ZYU A;  5E7D A;  1JM4 B;  5CQ5 A;  5KTW A;  5C87 A;  5DFC A;  4QSV A;  4PTB A;  4A9E A;  4J3I A;  4MR4 A;  4UYE A;  5CUA A;  2OSS A;  5D3S A;  4O7E A;  4TZ2 A;  4KV1 A;  4C67 A;  2R10 A;  4QNS A;  1F68 A;  4XUB A;  5L96 A;  5AME A;  3UVX A;  4HXP A;  5CUE A;  4UIZ A;  5AD3 A;  4IR4 A;  4CUP A;  4O71 A;  5I7Y A;  2NXB A;  2L85 A;  4CL9 A;  4F3I A;  4YYG A;  3G0L A;  3MB3 A;  3ERR A;  3JVM A;  4PCI A;  4QSU A;  3S91 A;  5DW2 A;  2OO1 A;  5LJ0 A;  2GRC A;  5IGK A;  5CQ3 A;  4A9K A;  4FLP A;  5DYA A;  2RNX A;  5CUB A;  4BW3 A;  3HMH A;  5EA1 A;  5DKC A;  4QEW A;  5F5Z A;  4YYD A;  4X2I A;  2FSA A;  4NUD A;  5F3A A;  3HME A;  4KCX A;  4HXN A;  5HM0 A;  5D26 A;  4O74 A;  4XY8 A;  5FFY A;  2R0S A;  4LDF A;  3IU5 A;  4ZC9 A;  1X0J A;  5HRW A;  4MR3 A;  4BW2 A;  2DVV A;  2D82 A;  2EJN A;  5FE4 A;  5I29 A;  5KO4 A;  5FFW A;  4TT4 A;  4XY9 A;  4NRA A;  4UIX A;  2I8N A;  4Q0O A;  3O34 A;  4LYI A;  4N3W A;  5BT5 A;  4HXK A;  5CRM A;  2WP1 A;  2RNW A;  4QR5 A;  4N4H A;  2WP2 A;  4HXL A;  4UIV A;  5FH7 A;  5EGU A;  4J0R A;  5TCM A;  4TYL A;  5CY9 A;  4A9M A;  2N9G A;  2F6N A;  3MUL A;  4O7B A;  4O7C A;  2DAT A;  5G4R A;  4BW1 A;  5FH8 A;  4QC1 A;  2YEL A;  3AQA A;  5LUU A;  4CLB A;  4DON A;  1ZKR A;  4IOR A;  5A5Q A;  5EPR A;  5F36 A;  4LYW A;  5DY7 A;  5C8G A;  5G4S A;  4UYF B;  5CUG A;  4NR4 A;  5DBM A;  5L99 A;  5LKZ A;  3Q2F A;  4IOQ A;  3S92 A;  4Z1S A;  5FE8 A;  3JVL A;  2YW5 A;  5ETD A;  4NR6 A;  4UYF A;  5CQ6 A;  5E9Y A;  5I80 A;  4NUC A;  2R0V A;  5EIS A;  4ALH A;  5E9V A;  3UVW A;  2DKW A;  4HXS A;  4LZR A;  5EVA A;  5HRV A;  4A9I A;  2YEM A;  5CUC A;  4YAB A;  4LZS A;  5L8T A;  4TTE A;  5FG5 A;  5LVQ A;  5CQT A;  4QYD A;  5CS8 A;  4C66 A;  4QSX A;  2RFJ A;  4WIV A;  5ENE A;  4HXM A;  3LXJ A;  4YBT A;  4AKH A;  3VKH A;  3QZV A;  4A9N A;  4LYS A;  1PUO A;  4XYA A;  5FBX A;  4NQN A;  5CPE A;  5D25 A;  4AKG A;  3UV2 A;  5E73 A;  4CUR A;  3MUK A;  4N4I A;  4TS8 A;  5JI8 A;  5KTU A;  5ENJ A;  1WUM A;  5EWC A;  4Z1Q A;  5FE2 A;  5I88 A;  4LRG A;  4QEV A;  4UIY A;  4QSQ A;  3U5K A;  3K2J A;  4TU4 A;  3U5N A;  5FE3 A;  2DVQ A;  4MEN A;  5II2 A;  4Q0N A;  5LJ2 A;  5H1T A;  5DW1 A;  5FE7 A;  2G4A A;  4MEO A;  5DKD A;  4AKN A;  5IGM A;  5J0D A;  4O70 A;  5CU8 A;  3D7C A;  3QZT A;  4NQM A;  5HEN A;  2E3K A;  4TT6 A;  4QUT A;  5II1 A;  2D9E A;  1N72 A;  4KV4 A;  5D0C A;  5I7X A;  4OGJ A;  2YEK A;  2DVR A;  4A9H A;  4TU6 A;  3VKG A;  5CQ7 A;  2YQD A;  5I40 A;  5FE9 A;  4CUQ A;  4PCE A;  5KTX A;  4QR3 A;  4YYM A;  5TB6 A;  3DAI A;  3LQJ A;  1WUG A;  4PKL A;  4QSP A;  5DFB A;  5C4Q A;  5IBN A;  5A5S A;  5EU1 A;  4YY4 A;  5CZG A;  5F61 A;  5I1Q A;  3QZS A;  5HJC A;  2L5E A;  5DLZ A;  5F1L A;  4LC2 A;  5L8U A;  4TZ8 A;  3HMF A;  4QSS A;  4ZW1 A;  5F1H A;  5D7X A;  5FG6 A;  4QUU A;  5E9K A;  5ENF A;  5CRZ A;  3AAD A;  4IR3 A;  5EQ1 A;  5IG6 A;  4YY6 A;  5CP5 A;  5EM3 A;  3SVH A;  3LQI A;  5H1V A;  5H85 A;  4YAD A;  5BT3 A;  5HLS A;  4A9L A;  4HXO A;  5IGN A;  5DYX A;  4A9O A;  5D3J A;  4QSR A;  5C85 A;  3Q2E A;  2I7K A;  4MEQ A;  4CFK A;  5FE1 A;  5FE5 A;  5CQ4 A;  5D3T A;  5E9M A;  5K29 A;  4LZ2 A;  3P5O A;  5E9L A;  3U5M A;  4UYG A;  4A9F A;  4YYJ A;  4CUT A;  5E3D A;  5E9I A;  5A5R A;  4IR6 A;  5ENC A;  3P1E A;  4NR8 A;  5E74 A;  5COI A;  3SVF A;  4UIW A;  3MXF A;  4UIU A;  4ALG A;  5EWD A;  3SVG A;  4WHU A;  5HEL A;  4YYI A;  3O36 A;  4YK0 A;  5E3G A;  4J0S A;  4TT2 A;  5H1U A;  4QZS A;  5DYC A;  5C89 A;  5F2P A;  4QEU A;  4YBM A;  5EWV A;  4HBW A;  1EQF A;  4NYW A;  4BJX A;  5LVR A;  4QSW A;  5ENG A;  4Z93 A;  5I86 A;  5C7N A;  3GG3 A;  1E6I A;  4NR7 A;  3D1D A;  4Y03 A;  4UYH A;  4YYK A;  5FFV A;  3P1D A;  4O76 A;  5D3R A;  4O7A A;  5D3L A;  5DYU A;  5FDZ A;  4CUU A;  5KHM A;  4O77 A;  4QBM A;  2DWW A;  4YH3 A;  5DFD A;  4NUE A;  4QST A;  5CQ8 A;  4RVR A;  5ENI A;  4QB3 A;  4O75 A;  2R0Y A;  4YC9 A;  5JWM A;  3NXB A;  5FB0 A;  4YAX A;  5F63 A;  5EWH A;  4BW4 A;  3DWY A;  4YYH A;  5HFQ A;  4ZQL A;  1ZS5 A;  5L98 A;  5ETB A;  5A5O A;  5FE0 A;  3UV5 A;  5A7C A;  4XUA A;  4NYV A;  4IOO A;  2RO1 A;  2RI7 A;  4YBS A;  1JSP B;  5HRX A;  5ENB A;  5EI4 A;  3G0J A;  4PY6 A;  3U5P A;  2MJV B;  5HQ7 A;  5AD2 A;  5EWW A;  3MQM A;  5L97 A;  5HQ5 A;  4QY4 A;  5LKX A;  5CGP A;  4YH4 A;  4HBV A;  4Z6H A;  2L84 A;  4NYX A;  4CFL A;  3TLP A;  5IGL A;  5HEM A;  4QYL A;  3U5J A;  4NRC A;  4J1P A;  5LKT A;  2RS9 B;  4AI6 A;  3O33 A;  5A5N A;  5DX4 A;  5DLX A;  4YAT A;  5HFR A;  5EPS A;  4O7F A;  4NR9 A;  5EV9 A;  3UVY A;  4E96 A;  4OGI A;  5I83 A;  5DKH A;  4LR6 A;  3P1F A;  3JVK A;  4WHW A;  5IID A;  5E0R A;  3P1C A;  5A83 A;  5I89 A;  5A82 A;  3O37 A;  5CTL A;  5A85 A;  5D24 A;  5FG4 A;  2KTB B;  4O72 A;  3O35 A;  5CUD A;  4HXR A;  4IR5 A;  5D3P A;  5F25 A;  5CQA A;  4N4G A;  4O78 A;  4NRB A;  5CFW A;  5EP7 A;  4TQN A;  4NXJ A;  4YYN A;  4NS5 A;  5HCL A;  5LJ1 A;  3MB4 A;  3RCW A;  3I3J A;  5BT4 A;  4N4F A;  5AMF A;  4HBX A;  4PS5 A;  5EPB A;  3UV4 A;  3U5L A;  2E7N A;  4NR5 A;  5ENH A;  5EK9 A;  2E7O A;  5FE6 A;  3LQH A;  2F6J A;  4MR5 A;  4OUF A; 
#chains in the Genus database with same CATH homology
 5F60 A;  3ONI A;  4QR4 A;  2DVS A;  4Z6I A;  2YDW A;  5A81 A;  5D3N A;  2LSP B;  5F62 A;  3JVJ A;  5ACY A;  4MR6 A;  3UW9 A;  2YYN A;  3IU6 A;  5LKU A;  4CUS A;  4QC3 A;  4BHW A;  2RNY A;  3U5O A;  5EIC A;  5FB1 A;  4UIT A;  4A9J A;  2OUO A;  4UYD A;  5KU3 A;  4GPJ A;  4MEP A;  3FKM X;  5D3H A;  3UVD A;  3LJW A;  5HQ6 A;  4HBY A;  5FH6 A;  2H60 A;  5A5P A;  3ZYU A;  5E7D A;  1JM4 B;  5CQ5 A;  5KTW A;  5C87 A;  5DFC A;  4QSV A;  4PTB A;  4A9E A;  4J3I A;  4MR4 A;  4UYE A;  5CUA A;  2OSS A;  5D3S A;  4O7E A;  4TZ2 A;  4KV1 A;  4C67 A;  2R10 A;  4QNS A;  1F68 A;  4XUB A;  5L96 A;  5AME A;  3UVX A;  4HXP A;  5CUE A;  4UIZ A;  5AD3 A;  4IR4 A;  4CUP A;  4O71 A;  5I7Y A;  2NXB A;  2L85 A;  4CL9 A;  4F3I A;  4YYG A;  3G0L A;  3MB3 A;  3JVM A;  4PCI A;  4QSU A;  3S91 A;  5DW2 A;  2OO1 A;  5LJ0 A;  2GRC A;  5IGK A;  5CQ3 A;  4A9K A;  4FLP A;  5DYA A;  2RNX A;  5CUB A;  4BW3 A;  3HMH A;  5EA1 A;  5DKC A;  4QEW A;  5F5Z A;  4YYD A;  4X2I A;  2FSA A;  4NUD A;  5F3A A;  3HME A;  4KCX A;  4HXN A;  5HM0 A;  5D26 A;  4O74 A;  4XY8 A;  5FFY A;  2R0S A;  4LDF A;  3IU5 A;  4ZC9 A;  1X0J A;  5HRW A;  4MR3 A;  4BW2 A;  2DVV A;  2D82 A;  5FE4 A;  5I29 A;  5KO4 A;  5FFW A;  4TT4 A;  4XY9 A;  4NRA A;  4UIX A;  2I8N A;  4Q0O A;  3O34 A;  4LYI A;  4N3W A;  5BT5 A;  4HXK A;  5CRM A;  2WP1 A;  2RNW A;  4QR5 A;  4N4H A;  2WP2 A;  4HXL A;  4UIV A;  5FH7 A;  5EGU A;  4J0R A;  5TCM A;  4TYL A;  5CY9 A;  4A9M A;  2N9G A;  2F6N A;  3MUL A;  4O7B A;  4O7C A;  2DAT A;  5G4R A;  4BW1 A;  5FH8 A;  4QC1 A;  2YEL A;  3AQA A;  5LUU A;  4CLB A;  4DON A;  4IOR A;  5A5Q A;  5EPR A;  5F36 A;  4LYW A;  5DY7 A;  5C8G A;  5G4S A;  4UYF B;  5CUG A;  4NR4 A;  5DBM A;  5L99 A;  5LKZ A;  3Q2F A;  4IOQ A;  3S92 A;  4Z1S A;  5FE8 A;  3JVL A;  2YW5 A;  5ETD A;  4NR6 A;  4UYF A;  5CQ6 A;  5E9Y A;  5I80 A;  4NUC A;  2R0V A;  5EIS A;  4ALH A;  5E9V A;  3UVW A;  2DKW A;  4HXS A;  4LZR A;  5EVA A;  5HRV A;  4A9I A;  2YEM A;  5CUC A;  4YAB A;  4LZS A;  5L8T A;  4TTE A;  5FG5 A;  5LVQ A;  5CQT A;  4QYD A;  5CS8 A;  4C66 A;  4QSX A;  2RFJ A;  4WIV A;  5ENE A;  4HXM A;  3LXJ A;  4YBT A;  3QZV A;  4A9N A;  4LYS A;  4XYA A;  5FBX A;  4NQN A;  5CPE A;  5D25 A;  3UV2 A;  5E73 A;  4CUR A;  3MUK A;  4N4I A;  4TS8 A;  5JI8 A;  5KTU A;  5ENJ A;  1WUM A;  5EWC A;  4Z1Q A;  5FE2 A;  5I88 A;  4LRG A;  4QEV A;  4UIY A;  4QSQ A;  3U5K A;  3K2J A;  4TU4 A;  3U5N A;  5FE3 A;  2DVQ A;  4MEN A;  5II2 A;  4Q0N A;  5LJ2 A;  5H1T A;  5DW1 A;  5FE7 A;  2G4A A;  4MEO A;  5DKD A;  4AKN A;  5IGM A;  5J0D A;  4O70 A;  5CU8 A;  3D7C A;  3QZT A;  4NQM A;  5HEN A;  2E3K A;  4TT6 A;  4QUT A;  5II1 A;  2D9E A;  1N72 A;  4KV4 A;  5D0C A;  5I7X A;  4OGJ A;  2YEK A;  2DVR A;  4A9H A;  4TU6 A;  5CQ7 A;  2YQD A;  5I40 A;  5FE9 A;  4CUQ A;  4PCE A;  5KTX A;  4QR3 A;  4YYM A;  5TB6 A;  3DAI A;  3LQJ A;  1WUG A;  4PKL A;  4QSP A;  5DFB A;  5C4Q A;  5IBN A;  5A5S A;  5EU1 A;  4YY4 A;  5CZG A;  5F61 A;  5I1Q A;  3QZS A;  5HJC A;  2L5E A;  5DLZ A;  5F1L A;  4LC2 A;  5L8U A;  4TZ8 A;  3HMF A;  4QSS A;  4ZW1 A;  5F1H A;  5D7X A;  5FG6 A;  4QUU A;  5E9K A;  5ENF A;  5CRZ A;  3AAD A;  4IR3 A;  5EQ1 A;  5IG6 A;  4YY6 A;  5CP5 A;  5EM3 A;  3SVH A;  3LQI A;  5H1V A;  5H85 A;  4YAD A;  5BT3 A;  5HLS A;  4A9L A;  4HXO A;  5IGN A;  5DYX A;  4A9O A;  5D3J A;  4QSR A;  5C85 A;  3Q2E A;  2I7K A;  4MEQ A;  4CFK A;  5FE1 A;  5FE5 A;  5CQ4 A;  5D3T A;  5E9M A;  5K29 A;  4LZ2 A;  3P5O A;  5E9L A;  3U5M A;  4UYG A;  4A9F A;  4YYJ A;  4CUT A;  5E3D A;  5E9I A;  5A5R A;  4IR6 A;  5ENC A;  3P1E A;  4NR8 A;  5E74 A;  5COI A;  3SVF A;  4UIW A;  3MXF A;  4UIU A;  4ALG A;  5EWD A;  3SVG A;  4WHU A;  5HEL A;  4YYI A;  3O36 A;  4YK0 A;  5E3G A;  4J0S A;  4TT2 A;  5H1U A;  4QZS A;  5DYC A;  5C89 A;  5F2P A;  4QEU A;  4YBM A;  5EWV A;  4HBW A;  1EQF A;  4NYW A;  4BJX A;  5LVR A;  4QSW A;  5ENG A;  4Z93 A;  5I86 A;  5C7N A;  3GG3 A;  1E6I A;  4NR7 A;  4Y03 A;  4UYH A;  4YYK A;  5FFV A;  3P1D A;  4O76 A;  5D3R A;  4O7A A;  5D3L A;  5DYU A;  5FDZ A;  4CUU A;  5KHM A;  4O77 A;  4QBM A;  2DWW A;  4YH3 A;  5DFD A;  4NUE A;  4QST A;  5CQ8 A;  4RVR A;  5ENI A;  4QB3 A;  4O75 A;  2R0Y A;  4YC9 A;  5JWM A;  3NXB A;  5FB0 A;  4YAX A;  5F63 A;  5EWH A;  4BW4 A;  3DWY A;  4YYH A;  5HFQ A;  4ZQL A;  1ZS5 A;  5L98 A;  5ETB A;  5A5O A;  5FE0 A;  3UV5 A;  5A7C A;  4XUA A;  4NYV A;  4IOO A;  2RO1 A;  2RI7 A;  4YBS A;  1JSP B;  5HRX A;  5ENB A;  5EI4 A;  3G0J A;  4PY6 A;  3U5P A;  2MJV B;  5HQ7 A;  5AD2 A;  5EWW A;  3MQM A;  5L97 A;  5HQ5 A;  4QY4 A;  5LKX A;  5CGP A;  4YH4 A;  4HBV A;  4Z6H A;  2L84 A;  4NYX A;  4CFL A;  3TLP A;  5IGL A;  5HEM A;  4QYL A;  3U5J A;  4NRC A;  4J1P A;  5LKT A;  2RS9 B;  3O33 A;  5A5N A;  5DX4 A;  5DLX A;  4YAT A;  5HFR A;  5EPS A;  4O7F A;  4NR9 A;  5EV9 A;  3UVY A;  4E96 A;  4OGI A;  5I83 A;  5DKH A;  4LR6 A;  3P1F A;  3JVK A;  4WHW A;  5IID A;  5E0R A;  3P1C A;  5A83 A;  5I89 A;  5A82 A;  3O37 A;  5CTL A;  5A85 A;  5D24 A;  5FG4 A;  2KTB B;  4O72 A;  3O35 A;  5CUD A;  4HXR A;  4IR5 A;  5D3P A;  5F25 A;  5CQA A;  4N4G A;  4O78 A;  4NRB A;  5CFW A;  5EP7 A;  4TQN A;  4NXJ A;  4YYN A;  4NS5 A;  5HCL A;  5LJ1 A;  3MB4 A;  3RCW A;  3I3J A;  5BT4 A;  4N4F A;  5AMF A;  4HBX A;  4PS5 A;  5EPB A;  3UV4 A;  3U5L A;  2E7N A;  4NR5 A;  5ENH A;  5EK9 A;  2E7O A;  5FE6 A;  3LQH A;  2F6J A;  4MR5 A;  4OUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...