4TT6A

Crystal structure of atad2a bromodomain double mutant n1063a-y1064a in apo form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEAAPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 53
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tt6A00
5ACYA 4O71A 4NYVA 5FE6A 2D9EA 3DWYA 5DKDA 4Z1QA 2H60A 4Q0OA 4A9FA 5D3PA 5F63A 4YADA 4ZC9A 5AMFA 5CUAA 5FB1A 4YYKA 3UVXA 4UIWA 5K29A 5CRMA 5A85A 3ZYUA 5KU3A 5ETDA 4KV1A 5AD2A 5LJ1A 5E9KA 4BW3A 5I86A 4Z93A 5I7XA 4UIUA 4Z6IA 3K2JA 5H1UA 2F6NA 2RI7A 3IU5A 4O72A 5EQ1A 5BT3A 4LYSA 5F5ZA 5D26A 5DYUA 5DFBA 4QNSA 4KCXA 3JVMA 4QR3A 4TU4A 4A9KA 4BHWA 4CL9A 4HXLA 4YH3A 5CUDA 4BW4A 5HENA 4GPJA 5FFVA 5L97A 3LJWA 5KO4A 4NR8A 3HMHA 5BT5A 1JM4B 4PY6A 4UITA 4HBVA 4NQNA 4NS5A 3MQMA 2OSSA 4ZW1A 4PS5A 5HFRA 5LKZA 4TS8A 2DVQA 5DY7A 4N4GA 3S91A 4CLBA 4QSXA 5ENHA 4NYXA 5LJ2A 3QZVA 5LVQA 3LQHA 5A5RA 2WP1A 5CY9A 5F25A 3UV5A 5DFCA 5DLZA 5CP5A 5EWWA 2YQDA 4QEUA 4A9NA 5EWVA 2R0VA 5E3DA 5LKTA 2DATA 4CUPA 1X0JA 5LKXA 4QSTA 4QSVA 3LQIA 4NXJA 5H1TA 5I88A 2L84A 4CUSA 4O7EA 4QSSA 4A9OA 5FE3A 3P1EA 5COIA 4N4HA 5A5PA 4J0RA 5CUEA 3S92A 4YATA 3AQAA 5ENJA 5KTXA 5DKCA 2RNXA 4YY4A 5EP7A 3O37A 4O74A 4YABA 3JVKA 4FLPA 4Q0NA 3Q2EA 3JVJA 4XUBA 3UVYA 4J3IA 3HMEA 4QR5A 2NXBA 5ENGA 5EV9A 5FG5A 5CQ8A 4YYNA 5J0DA 4WHWA 5F2PA 2RFJA 5FDZA 3MB4A 4A9EA 5DYXA 5EICA 5EWHA 3UW9A 4QUTA 5FE9A 2DKWA 4HXOA 5FH8A 4ZQLA 5EGUA 4HXMA 4J0SA 4TQNA 5E74A 4HBYA 3SVHA 4NRCA 4UIVA 4NR4A 4TT6A 5DYAA 3MB3A 5CQTA 5E73A 3U5KA 3U5JA 5H85A 5TCMA 4TZ8A 5HJCA 4TYLA 5AD3A 4O7CA 5F60A 4HBXA 4NRBA 2E3KA 5E3GA 1JSPB 5DW2A 4QSQA 4HXSA 5C85A 4QYLA 4XYAA 4QSPA 5H1VA 4F3IA 4N4IA 3HMFA 4IR5A 4IORA 4O78A 4XY9A 5ETBA 5LVRA 4PKLA 4NYWA 4LZ2A 4WIVA 4KV4A 2R0SA 5F1HA 5A83A 5A5SA 5CUGA 5CQ3A 4O76A 5CUCA 2MJVB 5DKHA 5A81A 4QR4A 5ENEA 5EU1A 5A7CA 5HQ7A 4RVRA 3U5LA 5CQ7A 4UYGA 4MR4A 1N72A 4A9JA 4O75A 4QEVA 4DONA 3AADA 4UYFA 5EPBA 5ENIA 3O33A 3O36A 5KTUA 4NRAA 4N3WA 4E96A 5FH7A 2L85A 4PTBA 4A9IA 5E0RA 3TLPA 4QY4A 5ENBA 4O77A 5LUUA 5F36A 2N9GA 4PCIA 2RO1A 5C4QA 5E7DA 4YYGA 5C7NA 5I1QA 5I83A 3QZTA 5CQ5A 5FE0A 5HQ6A 5CQ6A 4A9LA 4YYIA 2LSPB 3P1DA 4UIXA 4UYFB 5FE1A 4N4FA 5I89A 3P1CA 5CZGA 4IOOA 5F1LA 5E9VA 5C87A 3G0LA 4LDFA 4YYDA 2F6JA 3SVGA 5FG6A 3MXFA 4O7AA 4MR5A 2R0YA 4LC2A 4CUQA 4TZ2A 3D7CA 4HXKA 5FE5A 5I29A 5I80A 4HXRA 4NQMA 4MR3A 5A5OA 5JI8A 5CQAA 5EWDA 3P5OA 5HRWA 4C66A 4QZSA 1EQFA 2YEKA 3NXBA 3SVFA 1WUGA 5G4SA 4YY6A 4ALGA 5IGMA 5AMEA 2YDWA 5E9YA 4QC1A 3FKMX 4C67A 4LR6A 5L98A 5D7XA 5II1A 4Z1SA 3I3JA 3DAIA 3UV4A 5L8TA 2FSAA 5JWMA 3UVDA 5C89A 3MULA 5FE4A 3U5MA 2E7OA 2KTBB 4QYDA 5II2A 5E9LA 5HM0A 5FE7A 5EA1A 3MUKA 4HBWA 2RNWA 3ONIA 5HCLA 5D3TA 5F3AA 4X2IA 1E6IA 5FBXA 5I7YA 4Y03A 4CUTA 2DVSA 5I40A 4A9HA 4YC9A 5EI4A 2DWWA 5ENCA 4XUAA 2I7KA 5D3RA 5F61A 5IG6A 5IGNA 5L8UA 5ENFA 3IU6A 4HXPA 3JVLA 2D82A 4NUCA 5DX4A 3U5NA 4WHUA 5L96A 5D3JA 4HXNA 4IR4A 5A5QA 4NR9A 5D0CA 2YW5A 5D3NA 5FFYA 4IOQA 4IR3A 4YYJA 3UV2A 5EISA 5CPEA 4CFLA 5CQ4A 2YELA 4LZRA 4ALHA 5HLSA 2DVVA 5KHMA 4LRGA 4YAXA 5A82A 5FB0A 5D3SA 4O70A 4BW2A 5FE2A 4TT2A 5E9MA 2DVRA 3Q2FA 4QEWA 5L99A 5D25A 3G0JA 4TTEA 5E9IA 4MEQA 3LXJA 3GG3A 5D3LA 5F62A 5TB6A 4CFKA 5IBNA 5CRZA 2E7NA 2RNYA 4CURA 3UVWA 3P1FA 4LYIA 5LKUA 5CTLA 4Z6HA 5EWCA 5HELA 4QSWA 5EK9A 2I8NA 4A9MA 5FE8A 5BT4A 4AKNA 5EM3A 4NR7A 4NR5A 5CU8A 4YBTA 5IGKA 4UIYA 2R10A 4YBSA 5IIDA 5HFQA 4QBMA 4J1PA 5CFWA 1F68A 4MEOA 5DYCA 5KTWA 4OUFA 3O34A 4CUUA 5LJ0A 5IGLA 4OGJA 4UIZA 4QSUA 3QZSA 5CUBA 5G4RA 4YYMA 4NUDA 4QUUA 3U5PA 5DBMA 2L5EA 2RS9B 4QC3A 5CS8A 5D24A 4MR6A 4TT4A 5HRXA 4BW1A 2OO1A 5FG4A 4YYHA 5DLXA 4MEPA 4YK0A 5D3HA 5DFDA 2OUOA 4OGIA 3O35A 4PCEA 4QB3A 5A5NA 4LYWA 5FH6A 5CGPA 4YBMA 1WUMA 2WP2A 2G4AA 5DW1A 1ZS5A 3U5OA 2YEMA 4LZSA 4MENA 4O7FA 2GRCA 5EPSA 4QSRA 3LQJA 4TU6A 5C8GA 3RCWA 5HEMA 5EVAA 4BJXA 4IR6A 4UYHA 4O7BA 5FFWA 4UYDA 4NUEA 4YH4A 5HQ5A 4XY8A 5HRVA 2YYNA 4NR6A 4UYEA 5EPRA
chains in the Genus database with same CATH superfamily
5ACYA 4O71A 4NYVA 5FE6A 2D9EA 3DWYA 5DKDA 4Z1QA 2H60A 4Q0OA 4A9FA 5D3PA 3D1DA 5F63A 4YADA 4ZC9A 5AMFA 5CUAA 5FB1A 4YYKA 3UVXA 4UIWA 5K29A 5CRMA 5A85A 3ZYUA 5KU3A 5ETDA 4KV1A 5AD2A 5LJ1A 5E9KA 4BW3A 5I86A 4Z93A 5I7XA 4UIUA 4Z6IA 3K2JA 5H1UA 2F6NA 2RI7A 3IU5A 4O72A 5EQ1A 5BT3A 4LYSA 5F5ZA 5D26A 5DYUA 5DFBA 4QNSA 4KCXA 3JVMA 4QR3A 4TU4A 4A9KA 4BHWA 4CL9A 4HXLA 4YH3A 5CUDA 4BW4A 5HENA 4GPJA 5FFVA 5L97A 3LJWA 5KO4A 4NR8A 3HMHA 5BT5A 1JM4B 4PY6A 1ZKRA 4UITA 4HBVA 4NQNA 4NS5A 3MQMA 2OSSA 4ZW1A 4PS5A 5HFRA 5LKZA 4TS8A 2DVQA 5DY7A 4N4GA 3S91A 4CLBA 4QSXA 5ENHA 4NYXA 5LJ2A 3QZVA 5LVQA 3LQHA 5A5RA 2WP1A 5CY9A 5F25A 3UV5A 5DFCA 5DLZA 5CP5A 5EWWA 2YQDA 4QEUA 4A9NA 5EWVA 2R0VA 5E3DA 5LKTA 2DATA 4CUPA 1X0JA 5LKXA 4QSTA 4QSVA 3LQIA 4NXJA 2EJNA 5H1TA 5I88A 2L84A 4CUSA 4O7EA 4QSSA 4A9OA 5FE3A 3P1EA 5COIA 4N4HA 5A5PA 4J0RA 5CUEA 3S92A 4YATA 3AQAA 5ENJA 5KTXA 5DKCA 2RNXA 4YY4A 5EP7A 3O37A 4O74A 4YABA 3JVKA 4FLPA 4Q0NA 3Q2EA 3JVJA 4XUBA 3ERRA 3UVYA 4J3IA 3HMEA 4QR5A 2NXBA 5ENGA 5EV9A 5FG5A 5CQ8A 4YYNA 5J0DA 4WHWA 5F2PA 2RFJA 5FDZA 3MB4A 4A9EA 5DYXA 5EICA 5EWHA 3UW9A 4QUTA 5FE9A 2DKWA 4HXOA 5FH8A 4ZQLA 5EGUA 4HXMA 4J0SA 3VKHA 4TQNA 5E74A 4HBYA 3SVHA 4NRCA 4UIVA 4NR4A 4TT6A 5DYAA 3MB3A 5CQTA 5E73A 3U5KA 3U5JA 5H85A 5TCMA 4TZ8A 5HJCA 4TYLA 4AI6A 5AD3A 4O7CA 5F60A 4HBXA 4NRBA 2E3KA 5E3GA 1JSPB 5DW2A 4QSQA 4HXSA 5C85A 4QYLA 4XYAA 4QSPA 5H1VA 4F3IA 4N4IA 3HMFA 4IR5A 4IORA 4O78A 4XY9A 5ETBA 5LVRA 4PKLA 4NYWA 4LZ2A 4WIVA 4KV4A 2R0SA 5F1HA 5A83A 5A5SA 5CUGA 5CQ3A 4O76A 5CUCA 2MJVB 5DKHA 5A81A 4QR4A 5ENEA 5EU1A 5A7CA 5HQ7A 4RVRA 3U5LA 5CQ7A 4UYGA 4MR4A 1N72A 4A9JA 4O75A 4QEVA 4DONA 3AADA 4UYFA 5EPBA 5ENIA 3O33A 3O36A 5KTUA 4NRAA 4N3WA 4E96A 5FH7A 2L85A 4PTBA 4A9IA 5E0RA 3TLPA 4QY4A 5ENBA 4O77A 5LUUA 5F36A 2N9GA 4PCIA 2RO1A 5C4QA 5E7DA 4YYGA 5C7NA 5I1QA 5I83A 3QZTA 5CQ5A 5FE0A 5HQ6A 5CQ6A 4A9LA 4YYIA 2LSPB 3P1DA 4UIXA 4UYFB 5FE1A 4N4FA 5I89A 3P1CA 5CZGA 4IOOA 5F1LA 5E9VA 5C87A 3G0LA 4LDFA 4YYDA 2F6JA 3SVGA 5FG6A 3MXFA 4O7AA 4MR5A 2R0YA 4LC2A 4CUQA 4TZ2A 4AKGA 3D7CA 4HXKA 5FE5A 5I29A 5I80A 4HXRA 4NQMA 4MR3A 5A5OA 5JI8A 5CQAA 5EWDA 3P5OA 5HRWA 4C66A 4QZSA 1EQFA 2YEKA 3NXBA 3SVFA 1WUGA 5G4SA 4YY6A 4ALGA 5IGMA 5AMEA 2YDWA 5E9YA 4QC1A 3FKMX 4C67A 4LR6A 5L98A 5D7XA 5II1A 4Z1SA 3I3JA 3DAIA 3UV4A 5L8TA 2FSAA 5JWMA 3UVDA 5C89A 3MULA 5FE4A 3U5MA 2E7OA 2KTBB 4QYDA 5II2A 5E9LA 5HM0A 5FE7A 5EA1A 3MUKA 4HBWA 2RNWA 3ONIA 5HCLA 5D3TA 5F3AA 4X2IA 1E6IA 5FBXA 5I7YA 4Y03A 4CUTA 2DVSA 5I40A 4A9HA 4YC9A 5EI4A 2DWWA 5ENCA 4XUAA 2I7KA 5D3RA 5F61A 5IG6A 5IGNA 5L8UA 5ENFA 3IU6A 4HXPA 3JVLA 2D82A 4NUCA 5DX4A 3U5NA 4WHUA 5L96A 5D3JA 4HXNA 4IR4A 5A5QA 4NR9A 5D0CA 2YW5A 5D3NA 5FFYA 4IOQA 4IR3A 4YYJA 3UV2A 5EISA 5CPEA 4CFLA 5CQ4A 2YELA 4LZRA 4ALHA 5HLSA 2DVVA 3VKGA 5KHMA 4LRGA 4YAXA 5A82A 3D1BA 5FB0A 5D3SA 4O70A 4BW2A 5FE2A 4TT2A 5E9MA 2DVRA 3Q2FA 4QEWA 5L99A 5D25A 3G0JA 4TTEA 5E9IA 4MEQA 3LXJA 3GG3A 5D3LA 5F62A 5TB6A 4CFKA 5IBNA 5CRZA 2E7NA 2RNYA 4CURA 3UVWA 3P1FA 4LYIA 5LKUA 5CTLA 4Z6HA 5EWCA 5HELA 4QSWA 5EK9A 2I8NA 4A9MA 5FE8A 5BT4A 4AKNA 4AKHA 5EM3A 4NR7A 4NR5A 5CU8A 4YBTA 5IGKA 4UIYA 2R10A 4YBSA 5IIDA 5HFQA 4QBMA 4J1PA 5CFWA 1F68A 4MEOA 5DYCA 5KTWA 4OUFA 3O34A 4CUUA 5LJ0A 5IGLA 4OGJA 4UIZA 4QSUA 3QZSA 5CUBA 5G4RA 4YYMA 4NUDA 4AKIA 4QUUA 3U5PA 5DBMA 2L5EA 2RS9B 4QC3A 5CS8A 5D24A 4MR6A 4TT4A 5HRXA 4BW1A 2OO1A 5FG4A 4YYHA 5DLXA 4MEPA 4YK0A 5D3HA 5DFDA 2OUOA 4OGIA 3O35A 4PCEA 4QB3A 5A5NA 4LYWA 5FH6A 1PUOA 5CGPA 4YBMA 1WUMA 2WP2A 2G4AA 5DW1A 1ZS5A 3U5OA 2YEMA 4LZSA 4MENA 4O7FA 2GRCA 5EPSA 4QSRA 3LQJA 4TU6A 5C8GA 3RCWA 5HEMA 5EVAA 4BJXA 4IR6A 4UYHA 4O7BA 5FFWA 4UYDA 4NUEA 4YH4A 5HQ5A 4XY8A 5HRVA 2YYNA 4NR6A 4UYEA 5EPRA
chains in the Genus database with same CATH topology
5ACYA 4O71A 4NYVA 5FE6A 2D9EA 3DWYA 5DKDA 4Z1QA 2H60A 4Q0OA 4A9FA 5D3PA 5F63A 4YADA 4ZC9A 5AMFA 5CUAA 5FB1A 4YYKA 3UVXA 4UIWA 5K29A 5CRMA 5A85A 3ZYUA 5KU3A 5ETDA 4KV1A 5AD2A 5LJ1A 5E9KA 4BW3A 5I86A 4Z93A 5I7XA 4UIUA 4Z6IA 3K2JA 5H1UA 2F6NA 2RI7A 3IU5A 4O72A 5EQ1A 5BT3A 4LYSA 5F5ZA 5D26A 5DYUA 5DFBA 4QNSA 4KCXA 3JVMA 4QR3A 4TU4A 4A9KA 4BHWA 4CL9A 4HXLA 4YH3A 5CUDA 4BW4A 5HENA 4GPJA 5FFVA 5L97A 3LJWA 5KO4A 4NR8A 3HMHA 5BT5A 1JM4B 4PY6A 4UITA 4HBVA 4NQNA 4NS5A 3MQMA 2OSSA 4ZW1A 4PS5A 5HFRA 5LKZA 4TS8A 2DVQA 5DY7A 4N4GA 3S91A 4CLBA 4QSXA 5ENHA 4NYXA 5LJ2A 3QZVA 5LVQA 3LQHA 5A5RA 2WP1A 5CY9A 5F25A 3UV5A 5DFCA 5DLZA 5CP5A 5EWWA 2YQDA 4QEUA 4A9NA 5EWVA 2R0VA 5E3DA 5LKTA 2DATA 4CUPA 1X0JA 5LKXA 4QSTA 4QSVA 3LQIA 4NXJA 5H1TA 5I88A 2L84A 4CUSA 4O7EA 4QSSA 4A9OA 5FE3A 3P1EA 5COIA 4N4HA 5A5PA 4J0RA 5CUEA 3S92A 4YATA 3AQAA 5ENJA 5KTXA 5DKCA 2RNXA 4YY4A 5EP7A 3O37A 4O74A 4YABA 3JVKA 4FLPA 4Q0NA 3Q2EA 3JVJA 4XUBA 3UVYA 4J3IA 3HMEA 4QR5A 2NXBA 5ENGA 5EV9A 5FG5A 5CQ8A 4YYNA 5J0DA 4WHWA 5F2PA 2RFJA 5FDZA 3MB4A 4A9EA 5DYXA 5EICA 5EWHA 3UW9A 4QUTA 5FE9A 2DKWA 4HXOA 5FH8A 4ZQLA 5EGUA 4HXMA 4J0SA 4TQNA 5E74A 4HBYA 3SVHA 4NRCA 4UIVA 4NR4A 4TT6A 5DYAA 3MB3A 5CQTA 5E73A 3U5KA 3U5JA 5H85A 5TCMA 4TZ8A 5HJCA 4TYLA 5AD3A 4O7CA 5F60A 4HBXA 4NRBA 2E3KA 5E3GA 1JSPB 5DW2A 4QSQA 4HXSA 5C85A 4QYLA 4XYAA 4QSPA 5H1VA 4F3IA 4N4IA 3HMFA 4IR5A 4IORA 4O78A 4XY9A 5ETBA 5LVRA 4PKLA 4NYWA 4LZ2A 4WIVA 4KV4A 2R0SA 5F1HA 5A83A 5A5SA 5CUGA 5CQ3A 4O76A 5CUCA 2MJVB 5DKHA 5A81A 4QR4A 5ENEA 5EU1A 5A7CA 5HQ7A 4RVRA 3U5LA 5CQ7A 4UYGA 4MR4A 1N72A 4A9JA 4O75A 4QEVA 4DONA 3AADA 4UYFA 5EPBA 5ENIA 3O33A 3O36A 5KTUA 4NRAA 4N3WA 4E96A 5FH7A 2L85A 4PTBA 4A9IA 5E0RA 3TLPA 4QY4A 5ENBA 4O77A 5LUUA 5F36A 2N9GA 4PCIA 2RO1A 5C4QA 5E7DA 4YYGA 5C7NA 5I1QA 5I83A 3QZTA 5CQ5A 5FE0A 5HQ6A 5CQ6A 4A9LA 4YYIA 2LSPB 3P1DA 4UIXA 4UYFB 5FE1A 4N4FA 5I89A 3P1CA 5CZGA 4IOOA 5F1LA 5E9VA 5C87A 3G0LA 4LDFA 4YYDA 2F6JA 3SVGA 5FG6A 3MXFA 4O7AA 4MR5A 2R0YA 4LC2A 4CUQA 4TZ2A 3D7CA 4HXKA 5FE5A 5I29A 5I80A 4HXRA 4NQMA 4MR3A 5A5OA 5JI8A 5CQAA 5EWDA 3P5OA 5HRWA 4C66A 4QZSA 1EQFA 2YEKA 3NXBA 3SVFA 1WUGA 5G4SA 4YY6A 4ALGA 5IGMA 5AMEA 2YDWA 5E9YA 4QC1A 3FKMX 4C67A 4LR6A 5L98A 5D7XA 5II1A 4Z1SA 3I3JA 3DAIA 3UV4A 5L8TA 2FSAA 5JWMA 3UVDA 5C89A 3MULA 5FE4A 3U5MA 2E7OA 2KTBB 4QYDA 5II2A 5E9LA 5HM0A 5FE7A 5EA1A 3MUKA 4HBWA 2RNWA 3ONIA 5HCLA 5D3TA 5F3AA 4X2IA 1E6IA 5FBXA 5I7YA 4Y03A 4CUTA 2DVSA 5I40A 4A9HA 4YC9A 5EI4A 2DWWA 5ENCA 4XUAA 2I7KA 5D3RA 5F61A 5IG6A 5IGNA 5L8UA 5ENFA 3IU6A 4HXPA 3JVLA 2D82A 4NUCA 5DX4A 3U5NA 4WHUA 5L96A 5D3JA 4HXNA 4IR4A 5A5QA 4NR9A 5D0CA 2YW5A 5D3NA 5FFYA 4IOQA 4IR3A 4YYJA 3UV2A 5EISA 5CPEA 4CFLA 5CQ4A 2YELA 4LZRA 4ALHA 5HLSA 2DVVA 5KHMA 4LRGA 4YAXA 5A82A 5FB0A 5D3SA 4O70A 4BW2A 5FE2A 4TT2A 5E9MA 2DVRA 3Q2FA 4QEWA 5L99A 5D25A 3G0JA 4TTEA 5E9IA 4MEQA 3LXJA 3GG3A 5D3LA 5F62A 5TB6A 4CFKA 5IBNA 5CRZA 2E7NA 2RNYA 4CURA 3UVWA 3P1FA 4LYIA 5LKUA 5CTLA 4Z6HA 5EWCA 5HELA 4QSWA 5EK9A 2I8NA 4A9MA 5FE8A 5BT4A 4AKNA 5EM3A 4NR7A 4NR5A 5CU8A 4YBTA 5IGKA 4UIYA 2R10A 4YBSA 5IIDA 5HFQA 4QBMA 4J1PA 5CFWA 1F68A 4MEOA 5DYCA 5KTWA 4OUFA 3O34A 4CUUA 5LJ0A 5IGLA 4OGJA 4UIZA 4QSUA 3QZSA 5CUBA 5G4RA 4YYMA 4NUDA 4QUUA 3U5PA 5DBMA 2L5EA 2RS9B 4QC3A 5CS8A 5D24A 4MR6A 4TT4A 5HRXA 4BW1A 2OO1A 5FG4A 4YYHA 5DLXA 4MEPA 4YK0A 5D3HA 5DFDA 2OUOA 4OGIA 3O35A 4PCEA 4QB3A 5A5NA 4LYWA 5FH6A 5CGPA 4YBMA 1WUMA 2WP2A 2G4AA 5DW1A 1ZS5A 3U5OA 2YEMA 4LZSA 4MENA 4O7FA 2GRCA 5EPSA 4QSRA 3LQJA 4TU6A 5C8GA 3RCWA 5HEMA 5EVAA 4BJXA 4IR6A 4UYHA 4O7BA 5FFWA 4UYDA 4NUEA 4YH4A 5HQ5A 4XY8A 5HRVA 2YYNA 4NR6A 4UYEA 5EPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ACY A;  4O71 A;  4NYV A;  5FE6 A;  2D9E A;  3DWY A;  5DKD A;  4Z1Q A;  2H60 A;  4Q0O A;  4A9F A;  5D3P A;  5F63 A;  4YAD A;  4ZC9 A;  5AMF A;  5CUA A;  5FB1 A;  4YYK A;  3UVX A;  4UIW A;  5K29 A;  5CRM A;  5A85 A;  3ZYU A;  5KU3 A;  5ETD A;  4KV1 A;  5AD2 A;  5LJ1 A;  5E9K A;  4BW3 A;  5I86 A;  4Z93 A;  5I7X A;  4UIU A;  4Z6I A;  3K2J A;  5H1U A;  2F6N A;  2RI7 A;  3IU5 A;  4O72 A;  5EQ1 A;  5BT3 A;  4LYS A;  5F5Z A;  5D26 A;  5DYU A;  5DFB A;  4QNS A;  4KCX A;  3JVM A;  4QR3 A;  4TU4 A;  4A9K A;  4BHW A;  4CL9 A;  4HXL A;  4YH3 A;  5CUD A;  4BW4 A;  5HEN A;  4GPJ A;  5FFV A;  5L97 A;  3LJW A;  5KO4 A;  4NR8 A;  3HMH A;  5BT5 A;  1JM4 B;  4PY6 A;  4UIT A;  4HBV A;  4NQN A;  4NS5 A;  3MQM A;  2OSS A;  4ZW1 A;  4PS5 A;  5HFR A;  5LKZ A;  4TS8 A;  2DVQ A;  5DY7 A;  4N4G A;  3S91 A;  4CLB A;  4QSX A;  5ENH A;  4NYX A;  5LJ2 A;  3QZV A;  5LVQ A;  3LQH A;  5A5R A;  2WP1 A;  5CY9 A;  5F25 A;  3UV5 A;  5DFC A;  5DLZ A;  5CP5 A;  5EWW A;  2YQD A;  4QEU A;  4A9N A;  5EWV A;  2R0V A;  5E3D A;  5LKT A;  2DAT A;  4CUP A;  1X0J A;  5LKX A;  4QST A;  4QSV A;  3LQI A;  4NXJ A;  5H1T A;  5I88 A;  2L84 A;  4CUS A;  4O7E A;  4QSS A;  4A9O A;  5FE3 A;  3P1E A;  5COI A;  4N4H A;  5A5P A;  4J0R A;  5CUE A;  3S92 A;  4YAT A;  3AQA A;  5ENJ A;  5KTX A;  5DKC A;  2RNX A;  4YY4 A;  5EP7 A;  3O37 A;  4O74 A;  4YAB A;  3JVK A;  4FLP A;  4Q0N A;  3Q2E A;  3JVJ A;  4XUB A;  3UVY A;  4J3I A;  3HME A;  4QR5 A;  2NXB A;  5ENG A;  5EV9 A;  5FG5 A;  5CQ8 A;  4YYN A;  5J0D A;  4WHW A;  5F2P A;  2RFJ A;  5FDZ A;  3MB4 A;  4A9E A;  5DYX A;  5EIC A;  5EWH A;  3UW9 A;  4QUT A;  5FE9 A;  2DKW A;  4HXO A;  5FH8 A;  4ZQL A;  5EGU A;  4HXM A;  4J0S A;  4TQN A;  5E74 A;  4HBY A;  3SVH A;  4NRC A;  4UIV A;  4NR4 A;  4TT6 A;  5DYA A;  3MB3 A;  5CQT A;  5E73 A;  3U5K A;  3U5J A;  5H85 A;  5TCM A;  4TZ8 A;  5HJC A;  4TYL A;  5AD3 A;  4O7C A;  5F60 A;  4HBX A;  4NRB A;  2E3K A;  5E3G A;  1JSP B;  5DW2 A;  4QSQ A;  4HXS A;  5C85 A;  4QYL A;  4XYA A;  4QSP A;  5H1V A;  4F3I A;  4N4I A;  3HMF A;  4IR5 A;  4IOR A;  4O78 A;  4XY9 A;  5ETB A;  5LVR A;  4PKL A;  4NYW A;  4LZ2 A;  4WIV A;  4KV4 A;  2R0S A;  5F1H A;  5A83 A;  5A5S A;  5CUG A;  5CQ3 A;  4O76 A;  5CUC A;  2MJV B;  5DKH A;  5A81 A;  4QR4 A;  5ENE A;  5EU1 A;  5A7C A;  5HQ7 A;  4RVR A;  3U5L A;  5CQ7 A;  4UYG A;  4MR4 A;  1N72 A;  4A9J A;  4O75 A;  4QEV A;  4DON A;  3AAD A;  4UYF A;  5EPB A;  5ENI A;  3O33 A;  3O36 A;  5KTU A;  4NRA A;  4N3W A;  4E96 A;  5FH7 A;  2L85 A;  4PTB A;  4A9I A;  5E0R A;  3TLP A;  4QY4 A;  5ENB A;  4O77 A;  5LUU A;  5F36 A;  2N9G A;  4PCI A;  2RO1 A;  5C4Q A;  5E7D A;  4YYG A;  5C7N A;  5I1Q A;  5I83 A;  3QZT A;  5CQ5 A;  5FE0 A;  5HQ6 A;  5CQ6 A;  4A9L A;  4YYI A;  2LSP B;  3P1D A;  4UIX A;  4UYF B;  5FE1 A;  4N4F A;  5I89 A;  3P1C A;  5CZG A;  4IOO A;  5F1L A;  5E9V A;  5C87 A;  3G0L A;  4LDF A;  4YYD A;  2F6J A;  3SVG A;  5FG6 A;  3MXF A;  4O7A A;  4MR5 A;  2R0Y A;  4LC2 A;  4CUQ A;  4TZ2 A;  3D7C A;  4HXK A;  5FE5 A;  5I29 A;  5I80 A;  4HXR A;  4NQM A;  4MR3 A;  5A5O A;  5JI8 A;  5CQA A;  5EWD A;  3P5O A;  5HRW A;  4C66 A;  4QZS A;  1EQF A;  2YEK A;  3NXB A;  3SVF A;  1WUG A;  5G4S A;  4YY6 A;  4ALG A;  5IGM A;  5AME A;  2YDW A;  5E9Y A;  4QC1 A;  3FKM X;  4C67 A;  4LR6 A;  5L98 A;  5D7X A;  5II1 A;  4Z1S A;  3I3J A;  3DAI A;  3UV4 A;  5L8T A;  2FSA A;  5JWM A;  3UVD A;  5C89 A;  3MUL A;  5FE4 A;  3U5M A;  2E7O A;  2KTB B;  4QYD A;  5II2 A;  5E9L A;  5HM0 A;  5FE7 A;  5EA1 A;  3MUK A;  4HBW A;  2RNW A;  3ONI A;  5HCL A;  5D3T A;  5F3A A;  4X2I A;  1E6I A;  5FBX A;  5I7Y A;  4Y03 A;  4CUT A;  2DVS A;  5I40 A;  4A9H A;  4YC9 A;  5EI4 A;  2DWW A;  5ENC A;  4XUA A;  2I7K A;  5D3R A;  5F61 A;  5IG6 A;  5IGN A;  5L8U A;  5ENF A;  3IU6 A;  4HXP A;  3JVL A;  2D82 A;  4NUC A;  5DX4 A;  3U5N A;  4WHU A;  5L96 A;  5D3J A;  4HXN A;  4IR4 A;  5A5Q A;  4NR9 A;  5D0C A;  2YW5 A;  5D3N A;  5FFY A;  4IOQ A;  4IR3 A;  4YYJ A;  3UV2 A;  5EIS A;  5CPE A;  4CFL A;  5CQ4 A;  2YEL A;  4LZR A;  4ALH A;  5HLS A;  2DVV A;  5KHM A;  4LRG A;  4YAX A;  5A82 A;  5FB0 A;  5D3S A;  4O70 A;  4BW2 A;  5FE2 A;  4TT2 A;  5E9M A;  2DVR A;  3Q2F A;  4QEW A;  5L99 A;  5D25 A;  3G0J A;  4TTE A;  5E9I A;  4MEQ A;  3LXJ A;  3GG3 A;  5D3L A;  5F62 A;  5TB6 A;  4CFK A;  5IBN A;  5CRZ A;  2E7N A;  2RNY A;  4CUR A;  3UVW A;  3P1F A;  4LYI A;  5LKU A;  5CTL A;  4Z6H A;  5EWC A;  5HEL A;  4QSW A;  5EK9 A;  2I8N A;  4A9M A;  5FE8 A;  5BT4 A;  4AKN A;  5EM3 A;  4NR7 A;  4NR5 A;  5CU8 A;  4YBT A;  5IGK A;  4UIY A;  2R10 A;  4YBS A;  5IID A;  5HFQ A;  4QBM A;  4J1P A;  5CFW A;  1F68 A;  4MEO A;  5DYC A;  5KTW A;  4OUF A;  3O34 A;  4CUU A;  5LJ0 A;  5IGL A;  4OGJ A;  4UIZ A;  4QSU A;  3QZS A;  5CUB A;  5G4R A;  4YYM A;  4NUD A;  4QUU A;  3U5P A;  5DBM A;  2L5E A;  2RS9 B;  4QC3 A;  5CS8 A;  5D24 A;  4MR6 A;  4TT4 A;  5HRX A;  4BW1 A;  2OO1 A;  5FG4 A;  4YYH A;  5DLX A;  4MEP A;  4YK0 A;  5D3H A;  5DFD A;  2OUO A;  4OGI A;  3O35 A;  4PCE A;  4QB3 A;  5A5N A;  4LYW A;  5FH6 A;  5CGP A;  4YBM A;  1WUM A;  2WP2 A;  2G4A A;  5DW1 A;  1ZS5 A;  3U5O A;  2YEM A;  4LZS A;  4MEN A;  4O7F A;  2GRC A;  5EPS A;  4QSR A;  3LQJ A;  4TU6 A;  5C8G A;  3RCW A;  5HEM A;  5EVA A;  4BJX A;  4IR6 A;  4UYH A;  4O7B A;  5FFW A;  4UYD A;  4NUE A;  4YH4 A;  5HQ5 A;  4XY8 A;  5HRV A;  2YYN A;  4NR6 A;  4UYE A;  5EPR A; 
#chains in the Genus database with same CATH topology
 5ACY A;  4O71 A;  4NYV A;  5FE6 A;  2D9E A;  3DWY A;  5DKD A;  4Z1Q A;  2H60 A;  4Q0O A;  4A9F A;  5D3P A;  3D1D A;  5F63 A;  4YAD A;  4ZC9 A;  5AMF A;  5CUA A;  5FB1 A;  4YYK A;  3UVX A;  4UIW A;  5K29 A;  5CRM A;  5A85 A;  3ZYU A;  5KU3 A;  5ETD A;  4KV1 A;  5AD2 A;  5LJ1 A;  5E9K A;  4BW3 A;  5I86 A;  4Z93 A;  5I7X A;  4UIU A;  4Z6I A;  3K2J A;  5H1U A;  2F6N A;  2RI7 A;  3IU5 A;  4O72 A;  5EQ1 A;  5BT3 A;  4LYS A;  5F5Z A;  5D26 A;  5DYU A;  5DFB A;  4QNS A;  4KCX A;  3JVM A;  4QR3 A;  4TU4 A;  4A9K A;  4BHW A;  4CL9 A;  4HXL A;  4YH3 A;  5CUD A;  4BW4 A;  5HEN A;  4GPJ A;  5FFV A;  5L97 A;  3LJW A;  5KO4 A;  4NR8 A;  3HMH A;  5BT5 A;  1JM4 B;  4PY6 A;  1ZKR A;  4UIT A;  4HBV A;  4NQN A;  4NS5 A;  3MQM A;  2OSS A;  4ZW1 A;  4PS5 A;  5HFR A;  5LKZ A;  4TS8 A;  2DVQ A;  5DY7 A;  4N4G A;  3S91 A;  4CLB A;  4QSX A;  5ENH A;  4NYX A;  5LJ2 A;  3QZV A;  5LVQ A;  3LQH A;  5A5R A;  2WP1 A;  5CY9 A;  5F25 A;  3UV5 A;  5DFC A;  5DLZ A;  5CP5 A;  5EWW A;  2YQD A;  4QEU A;  4A9N A;  5EWV A;  2R0V A;  5E3D A;  5LKT A;  2DAT A;  4CUP A;  1X0J A;  5LKX A;  4QST A;  4QSV A;  3LQI A;  4NXJ A;  2EJN A;  5H1T A;  5I88 A;  2L84 A;  4CUS A;  4O7E A;  4QSS A;  4A9O A;  5FE3 A;  3P1E A;  5COI A;  4N4H A;  5A5P A;  4J0R A;  5CUE A;  3S92 A;  4YAT A;  3AQA A;  5ENJ A;  5KTX A;  5DKC A;  2RNX A;  4YY4 A;  5EP7 A;  3O37 A;  4O74 A;  4YAB A;  3JVK A;  4FLP A;  4Q0N A;  3Q2E A;  3JVJ A;  4XUB A;  3ERR A;  3UVY A;  4J3I A;  3HME A;  4QR5 A;  2NXB A;  5ENG A;  5EV9 A;  5FG5 A;  5CQ8 A;  4YYN A;  5J0D A;  4WHW A;  5F2P A;  2RFJ A;  5FDZ A;  3MB4 A;  4A9E A;  5DYX A;  5EIC A;  5EWH A;  3UW9 A;  4QUT A;  5FE9 A;  2DKW A;  4HXO A;  5FH8 A;  4ZQL A;  5EGU A;  4HXM A;  4J0S A;  3VKH A;  4TQN A;  5E74 A;  4HBY A;  3SVH A;  4NRC A;  4UIV A;  4NR4 A;  4TT6 A;  5DYA A;  3MB3 A;  5CQT A;  5E73 A;  3U5K A;  3U5J A;  5H85 A;  5TCM A;  4TZ8 A;  5HJC A;  4TYL A;  4AI6 A;  5AD3 A;  4O7C A;  5F60 A;  4HBX A;  4NRB A;  2E3K A;  5E3G A;  1JSP B;  5DW2 A;  4QSQ A;  4HXS A;  5C85 A;  4QYL A;  4XYA A;  4QSP A;  5H1V A;  4F3I A;  4N4I A;  3HMF A;  4IR5 A;  4IOR A;  4O78 A;  4XY9 A;  5ETB A;  5LVR A;  4PKL A;  4NYW A;  4LZ2 A;  4WIV A;  4KV4 A;  2R0S A;  5F1H A;  5A83 A;  5A5S A;  5CUG A;  5CQ3 A;  4O76 A;  5CUC A;  2MJV B;  5DKH A;  5A81 A;  4QR4 A;  5ENE A;  5EU1 A;  5A7C A;  5HQ7 A;  4RVR A;  3U5L A;  5CQ7 A;  4UYG A;  4MR4 A;  1N72 A;  4A9J A;  4O75 A;  4QEV A;  4DON A;  3AAD A;  4UYF A;  5EPB A;  5ENI A;  3O33 A;  3O36 A;  5KTU A;  4NRA A;  4N3W A;  4E96 A;  5FH7 A;  2L85 A;  4PTB A;  4A9I A;  5E0R A;  3TLP A;  4QY4 A;  5ENB A;  4O77 A;  5LUU A;  5F36 A;  2N9G A;  4PCI A;  2RO1 A;  5C4Q A;  5E7D A;  4YYG A;  5C7N A;  5I1Q A;  5I83 A;  3QZT A;  5CQ5 A;  5FE0 A;  5HQ6 A;  5CQ6 A;  4A9L A;  4YYI A;  2LSP B;  3P1D A;  4UIX A;  4UYF B;  5FE1 A;  4N4F A;  5I89 A;  3P1C A;  5CZG A;  4IOO A;  5F1L A;  5E9V A;  5C87 A;  3G0L A;  4LDF A;  4YYD A;  2F6J A;  3SVG A;  5FG6 A;  3MXF A;  4O7A A;  4MR5 A;  2R0Y A;  4LC2 A;  4CUQ A;  4TZ2 A;  4AKG A;  3D7C A;  4HXK A;  5FE5 A;  5I29 A;  5I80 A;  4HXR A;  4NQM A;  4MR3 A;  5A5O A;  5JI8 A;  5CQA A;  5EWD A;  3P5O A;  5HRW A;  4C66 A;  4QZS A;  1EQF A;  2YEK A;  3NXB A;  3SVF A;  1WUG A;  5G4S A;  4YY6 A;  4ALG A;  5IGM A;  5AME A;  2YDW A;  5E9Y A;  4QC1 A;  3FKM X;  4C67 A;  4LR6 A;  5L98 A;  5D7X A;  5II1 A;  4Z1S A;  3I3J A;  3DAI A;  3UV4 A;  5L8T A;  2FSA A;  5JWM A;  3UVD A;  5C89 A;  3MUL A;  5FE4 A;  3U5M A;  2E7O A;  2KTB B;  4QYD A;  5II2 A;  5E9L A;  5HM0 A;  5FE7 A;  5EA1 A;  3MUK A;  4HBW A;  2RNW A;  3ONI A;  5HCL A;  5D3T A;  5F3A A;  4X2I A;  1E6I A;  5FBX A;  5I7Y A;  4Y03 A;  4CUT A;  2DVS A;  5I40 A;  4A9H A;  4YC9 A;  5EI4 A;  2DWW A;  5ENC A;  4XUA A;  2I7K A;  5D3R A;  5F61 A;  5IG6 A;  5IGN A;  5L8U A;  5ENF A;  3IU6 A;  4HXP A;  3JVL A;  2D82 A;  4NUC A;  5DX4 A;  3U5N A;  4WHU A;  5L96 A;  5D3J A;  4HXN A;  4IR4 A;  5A5Q A;  4NR9 A;  5D0C A;  2YW5 A;  5D3N A;  5FFY A;  4IOQ A;  4IR3 A;  4YYJ A;  3UV2 A;  5EIS A;  5CPE A;  4CFL A;  5CQ4 A;  2YEL A;  4LZR A;  4ALH A;  5HLS A;  2DVV A;  3VKG A;  5KHM A;  4LRG A;  4YAX A;  5A82 A;  3D1B A;  5FB0 A;  5D3S A;  4O70 A;  4BW2 A;  5FE2 A;  4TT2 A;  5E9M A;  2DVR A;  3Q2F A;  4QEW A;  5L99 A;  5D25 A;  3G0J A;  4TTE A;  5E9I A;  4MEQ A;  3LXJ A;  3GG3 A;  5D3L A;  5F62 A;  5TB6 A;  4CFK A;  5IBN A;  5CRZ A;  2E7N A;  2RNY A;  4CUR A;  3UVW A;  3P1F A;  4LYI A;  5LKU A;  5CTL A;  4Z6H A;  5EWC A;  5HEL A;  4QSW A;  5EK9 A;  2I8N A;  4A9M A;  5FE8 A;  5BT4 A;  4AKN A;  4AKH A;  5EM3 A;  4NR7 A;  4NR5 A;  5CU8 A;  4YBT A;  5IGK A;  4UIY A;  2R10 A;  4YBS A;  5IID A;  5HFQ A;  4QBM A;  4J1P A;  5CFW A;  1F68 A;  4MEO A;  5DYC A;  5KTW A;  4OUF A;  3O34 A;  4CUU A;  5LJ0 A;  5IGL A;  4OGJ A;  4UIZ A;  4QSU A;  3QZS A;  5CUB A;  5G4R A;  4YYM A;  4NUD A;  4AKI A;  4QUU A;  3U5P A;  5DBM A;  2L5E A;  2RS9 B;  4QC3 A;  5CS8 A;  5D24 A;  4MR6 A;  4TT4 A;  5HRX A;  4BW1 A;  2OO1 A;  5FG4 A;  4YYH A;  5DLX A;  4MEP A;  4YK0 A;  5D3H A;  5DFD A;  2OUO A;  4OGI A;  3O35 A;  4PCE A;  4QB3 A;  5A5N A;  4LYW A;  5FH6 A;  1PUO A;  5CGP A;  4YBM A;  1WUM A;  2WP2 A;  2G4A A;  5DW1 A;  1ZS5 A;  3U5O A;  2YEM A;  4LZS A;  4MEN A;  4O7F A;  2GRC A;  5EPS A;  4QSR A;  3LQJ A;  4TU6 A;  5C8G A;  3RCW A;  5HEM A;  5EVA A;  4BJX A;  4IR6 A;  4UYH A;  4O7B A;  5FFW A;  4UYD A;  4NUE A;  4YH4 A;  5HQ5 A;  4XY8 A;  5HRV A;  2YYN A;  4NR6 A;  4UYE A;  5EPR A; 
#chains in the Genus database with same CATH homology
 5ACY A;  4O71 A;  4NYV A;  5FE6 A;  2D9E A;  3DWY A;  5DKD A;  4Z1Q A;  2H60 A;  4Q0O A;  4A9F A;  5D3P A;  5F63 A;  4YAD A;  4ZC9 A;  5AMF A;  5CUA A;  5FB1 A;  4YYK A;  3UVX A;  4UIW A;  5K29 A;  5CRM A;  5A85 A;  3ZYU A;  5KU3 A;  5ETD A;  4KV1 A;  5AD2 A;  5LJ1 A;  5E9K A;  4BW3 A;  5I86 A;  4Z93 A;  5I7X A;  4UIU A;  4Z6I A;  3K2J A;  5H1U A;  2F6N A;  2RI7 A;  3IU5 A;  4O72 A;  5EQ1 A;  5BT3 A;  4LYS A;  5F5Z A;  5D26 A;  5DYU A;  5DFB A;  4QNS A;  4KCX A;  3JVM A;  4QR3 A;  4TU4 A;  4A9K A;  4BHW A;  4CL9 A;  4HXL A;  4YH3 A;  5CUD A;  4BW4 A;  5HEN A;  4GPJ A;  5FFV A;  5L97 A;  3LJW A;  5KO4 A;  4NR8 A;  3HMH A;  5BT5 A;  1JM4 B;  4PY6 A;  4UIT A;  4HBV A;  4NQN A;  4NS5 A;  3MQM A;  2OSS A;  4ZW1 A;  4PS5 A;  5HFR A;  5LKZ A;  4TS8 A;  2DVQ A;  5DY7 A;  4N4G A;  3S91 A;  4CLB A;  4QSX A;  5ENH A;  4NYX A;  5LJ2 A;  3QZV A;  5LVQ A;  3LQH A;  5A5R A;  2WP1 A;  5CY9 A;  5F25 A;  3UV5 A;  5DFC A;  5DLZ A;  5CP5 A;  5EWW A;  2YQD A;  4QEU A;  4A9N A;  5EWV A;  2R0V A;  5E3D A;  5LKT A;  2DAT A;  4CUP A;  1X0J A;  5LKX A;  4QST A;  4QSV A;  3LQI A;  4NXJ A;  5H1T A;  5I88 A;  2L84 A;  4CUS A;  4O7E A;  4QSS A;  4A9O A;  5FE3 A;  3P1E A;  5COI A;  4N4H A;  5A5P A;  4J0R A;  5CUE A;  3S92 A;  4YAT A;  3AQA A;  5ENJ A;  5KTX A;  5DKC A;  2RNX A;  4YY4 A;  5EP7 A;  3O37 A;  4O74 A;  4YAB A;  3JVK A;  4FLP A;  4Q0N A;  3Q2E A;  3JVJ A;  4XUB A;  3UVY A;  4J3I A;  3HME A;  4QR5 A;  2NXB A;  5ENG A;  5EV9 A;  5FG5 A;  5CQ8 A;  4YYN A;  5J0D A;  4WHW A;  5F2P A;  2RFJ A;  5FDZ A;  3MB4 A;  4A9E A;  5DYX A;  5EIC A;  5EWH A;  3UW9 A;  4QUT A;  5FE9 A;  2DKW A;  4HXO A;  5FH8 A;  4ZQL A;  5EGU A;  4HXM A;  4J0S A;  4TQN A;  5E74 A;  4HBY A;  3SVH A;  4NRC A;  4UIV A;  4NR4 A;  4TT6 A;  5DYA A;  3MB3 A;  5CQT A;  5E73 A;  3U5K A;  3U5J A;  5H85 A;  5TCM A;  4TZ8 A;  5HJC A;  4TYL A;  5AD3 A;  4O7C A;  5F60 A;  4HBX A;  4NRB A;  2E3K A;  5E3G A;  1JSP B;  5DW2 A;  4QSQ A;  4HXS A;  5C85 A;  4QYL A;  4XYA A;  4QSP A;  5H1V A;  4F3I A;  4N4I A;  3HMF A;  4IR5 A;  4IOR A;  4O78 A;  4XY9 A;  5ETB A;  5LVR A;  4PKL A;  4NYW A;  4LZ2 A;  4WIV A;  4KV4 A;  2R0S A;  5F1H A;  5A83 A;  5A5S A;  5CUG A;  5CQ3 A;  4O76 A;  5CUC A;  2MJV B;  5DKH A;  5A81 A;  4QR4 A;  5ENE A;  5EU1 A;  5A7C A;  5HQ7 A;  4RVR A;  3U5L A;  5CQ7 A;  4UYG A;  4MR4 A;  1N72 A;  4A9J A;  4O75 A;  4QEV A;  4DON A;  3AAD A;  4UYF A;  5EPB A;  5ENI A;  3O33 A;  3O36 A;  5KTU A;  4NRA A;  4N3W A;  4E96 A;  5FH7 A;  2L85 A;  4PTB A;  4A9I A;  5E0R A;  3TLP A;  4QY4 A;  5ENB A;  4O77 A;  5LUU A;  5F36 A;  2N9G A;  4PCI A;  2RO1 A;  5C4Q A;  5E7D A;  4YYG A;  5C7N A;  5I1Q A;  5I83 A;  3QZT A;  5CQ5 A;  5FE0 A;  5HQ6 A;  5CQ6 A;  4A9L A;  4YYI A;  2LSP B;  3P1D A;  4UIX A;  4UYF B;  5FE1 A;  4N4F A;  5I89 A;  3P1C A;  5CZG A;  4IOO A;  5F1L A;  5E9V A;  5C87 A;  3G0L A;  4LDF A;  4YYD A;  2F6J A;  3SVG A;  5FG6 A;  3MXF A;  4O7A A;  4MR5 A;  2R0Y A;  4LC2 A;  4CUQ A;  4TZ2 A;  3D7C A;  4HXK A;  5FE5 A;  5I29 A;  5I80 A;  4HXR A;  4NQM A;  4MR3 A;  5A5O A;  5JI8 A;  5CQA A;  5EWD A;  3P5O A;  5HRW A;  4C66 A;  4QZS A;  1EQF A;  2YEK A;  3NXB A;  3SVF A;  1WUG A;  5G4S A;  4YY6 A;  4ALG A;  5IGM A;  5AME A;  2YDW A;  5E9Y A;  4QC1 A;  3FKM X;  4C67 A;  4LR6 A;  5L98 A;  5D7X A;  5II1 A;  4Z1S A;  3I3J A;  3DAI A;  3UV4 A;  5L8T A;  2FSA A;  5JWM A;  3UVD A;  5C89 A;  3MUL A;  5FE4 A;  3U5M A;  2E7O A;  2KTB B;  4QYD A;  5II2 A;  5E9L A;  5HM0 A;  5FE7 A;  5EA1 A;  3MUK A;  4HBW A;  2RNW A;  3ONI A;  5HCL A;  5D3T A;  5F3A A;  4X2I A;  1E6I A;  5FBX A;  5I7Y A;  4Y03 A;  4CUT A;  2DVS A;  5I40 A;  4A9H A;  4YC9 A;  5EI4 A;  2DWW A;  5ENC A;  4XUA A;  2I7K A;  5D3R A;  5F61 A;  5IG6 A;  5IGN A;  5L8U A;  5ENF A;  3IU6 A;  4HXP A;  3JVL A;  2D82 A;  4NUC A;  5DX4 A;  3U5N A;  4WHU A;  5L96 A;  5D3J A;  4HXN A;  4IR4 A;  5A5Q A;  4NR9 A;  5D0C A;  2YW5 A;  5D3N A;  5FFY A;  4IOQ A;  4IR3 A;  4YYJ A;  3UV2 A;  5EIS A;  5CPE A;  4CFL A;  5CQ4 A;  2YEL A;  4LZR A;  4ALH A;  5HLS A;  2DVV A;  5KHM A;  4LRG A;  4YAX A;  5A82 A;  5FB0 A;  5D3S A;  4O70 A;  4BW2 A;  5FE2 A;  4TT2 A;  5E9M A;  2DVR A;  3Q2F A;  4QEW A;  5L99 A;  5D25 A;  3G0J A;  4TTE A;  5E9I A;  4MEQ A;  3LXJ A;  3GG3 A;  5D3L A;  5F62 A;  5TB6 A;  4CFK A;  5IBN A;  5CRZ A;  2E7N A;  2RNY A;  4CUR A;  3UVW A;  3P1F A;  4LYI A;  5LKU A;  5CTL A;  4Z6H A;  5EWC A;  5HEL A;  4QSW A;  5EK9 A;  2I8N A;  4A9M A;  5FE8 A;  5BT4 A;  4AKN A;  5EM3 A;  4NR7 A;  4NR5 A;  5CU8 A;  4YBT A;  5IGK A;  4UIY A;  2R10 A;  4YBS A;  5IID A;  5HFQ A;  4QBM A;  4J1P A;  5CFW A;  1F68 A;  4MEO A;  5DYC A;  5KTW A;  4OUF A;  3O34 A;  4CUU A;  5LJ0 A;  5IGL A;  4OGJ A;  4UIZ A;  4QSU A;  3QZS A;  5CUB A;  5G4R A;  4YYM A;  4NUD A;  4QUU A;  3U5P A;  5DBM A;  2L5E A;  2RS9 B;  4QC3 A;  5CS8 A;  5D24 A;  4MR6 A;  4TT4 A;  5HRX A;  4BW1 A;  2OO1 A;  5FG4 A;  4YYH A;  5DLX A;  4MEP A;  4YK0 A;  5D3H A;  5DFD A;  2OUO A;  4OGI A;  3O35 A;  4PCE A;  4QB3 A;  5A5N A;  4LYW A;  5FH6 A;  5CGP A;  4YBM A;  1WUM A;  2WP2 A;  2G4A A;  5DW1 A;  1ZS5 A;  3U5O A;  2YEM A;  4LZS A;  4MEN A;  4O7F A;  2GRC A;  5EPS A;  4QSR A;  3LQJ A;  4TU6 A;  5C8G A;  3RCW A;  5HEM A;  5EVA A;  4BJX A;  4IR6 A;  4UYH A;  4O7B A;  5FFW A;  4UYD A;  4NUE A;  4YH4 A;  5HQ5 A;  4XY8 A;  5HRV A;  2YYN A;  4NR6 A;  4UYE A;  5EPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...