4TVPH

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
232
structure length
228
Chain Sequence
QVHLQESGPGLVKPSETLSLTCNVSGTLVRDNYWSWIRQPLGKQPEWIGYVHDSGDTNYNPSLKSRVHLSLDKSKNLVSLRLTGVTAADSAIYYCATTKHGRRIYGVVAFKEWFTYFYMDVWGKGTSVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 30
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpH01
2XKNA 2GAZB 2AJXL 2IC2A 2OTUA 1OLZA 4XC1H 3MBEB 3VRIB 3S96B 3RZCD 3QAZC 2B0SL 1HXYB 3MPCA 4XPHH 2LQRA 1OGTB 3D48R 3EJZD 2VE6B 3OHXB 1XR9B 3CVHB 4NFDA 5GGSB 4GFTB 5I1GL 4TULL 3A6BL 1YYMH 5KZCB 3K8MA 4GRWB 3QJFB 1WICA 2LU3A 3VG0H 1ZEAH 1J0KA 4LLUB 4Q9QL 2Y4SA 4MAUH 5J12C 3ILQC 1G9NL 4XCCL 4I3RL 4X7SH 4M1DL 4QY8B 3GSOA 3VA2C 4L8SB 5IW1B 3AVEA 3MRPB 5EBWB 5E6YA 3SDAD 1P53A 3RIFK 1OLLA 5F96L 2R0ZH 1PFCA 1S7SA 3JTTA 1TFHA 2VC2H 4HH8A 1UB5A 5FFLA 2X70A 2HN7A 1I7UA 3OKMA 3TLRA 3K2UL 1ND0A 2G75A 4AQOA 5EO0B 1IKFL 4ZAKA 4K7FA 4N0UE 2IANB 2PXYD 4YUEH 3TVMB 1YN7B 5CEYA 4G6FB 3U7YL 4BQBA 2FGWH 1BF8A 2NY5C 5F7NC 3SE3C 2I9LA 4FTVE 4EXPX 1RUQH 1GIGL 2DIBA 2J6EH 2Y07L 4K7PX 2FZ3B 5E2JA 4XP9L 2XWTB 4IS6A 3DIFA 4XHJD 1MCSA 1SEQL 4RZCB 3CXDH 3QIWD 3WSQL 1Z9MA 5I1LB 2GSGB 1ZLSH 1FIGL 5JHLH 2DM4A 4MD0A 4PJFB 5C9JA 4RAVB 1F2XK 1MCPH 4PJIE 5C0BA 2ZKHH 3HI1A 2BY0A 2KPNA 2OJEA 4QHUA 3CVHH 3RZWA 3E3QE 1ZLWH 3QQ4B 5H37H 1T2XA 3BRDA 4GRWH 4TUJA 5DHXB 1IQDA 5HDQL 1U8JB 1TZGL 2ZOLA 1CE1H 5IQ7H 2ZCKH 1T20B 3KPRA 1NAMB 3KPQA 3SBWA 1NFIA 4XNZC 3OF6A 2WIIA 1LE5B 3DXAE 3G5XA 3TA3B 3S37X 3U4EA 1QBMH 1KBGH 2H9GA 5EU7E 1YMMA 4X4YB 2BCKB 4XVJL 1UH3A 1NBQA 3GMQA 3L7FA 3FFCD 1XGUA 1PG7W 3DHJA 5B3JE 1RY7B 4D8PA 5BVPL 2JB6B 1GXEA 4Z5RA 2EDEA 3X11B 5D1XD 3EYUL 3O6KH 5JOPE 2Q7NA 1EFXD 3L6FA 3VG9C 4J3SA 4FFWC 4JPKL 3O6LL 3SDDA 2YD8A 4U1NB 1OF2B 1YEGH 2EDOA 4PRNA 2EECA 3U7AA 2MHAA 1OD9A 2YD7A 5I1CH 4GXUM 3W39A 2JJWA 3G04B 4GRWE 3QQ9C 3Q3GA 1I9EA 4N0CD 4JZNA 1AR1D 5BO1L 3HB3C 1BOYA 4ZAKD 3DX8A 5GISH 4M8QB 4X9HA 1J5OH 4XNYH 1IGTB 1ODAA 3MRIB 4N9GB 5C0AB 4JJHA 1OT1A 1I8KA 5D7SH 4JAMB 4ESKA 5FF6A 4LFHD 1JPGB 4FQIH 1EEZA 1ULVA 4M6NH 2VL4A 4NFCA 2F74B 4YGVB 4BJLA 1NAMH 3TBVA 3U36A 5A2JH 4LARL 2R9HD 2ERJB 3OGOE 1O7SA 2QQNH 4U0RC 2QHRL 3BX7C 4QRSB 1GC1H 2DMKA 5C0BD 5IFHH 2OP4L 1KB5L 2ZUWA 5DD0H 2W9DL 5DMGD 5F1KC 3B4NA 5DI8B 5IBUB 3T0EA 3S4SG 5F6HI 4X7TA 2GUOB 5ID1A 3BZEA 2DQDL 2AV1B 1EEUA 5INCB 2D9CA 1QFWI 3OXSA 3KYMB 1QSEB 5ESQA 4ZSOB 3KPRD 1YY9C 3SKOB 2OXGA 3RP1A 2EYSA 3OF6D 3BPOB 1LEKA 1OY3B 3DX9A 5DD6B 4J3VA 4GKNB 5CWSB 1T0NA 2Y5TB 1FNEA 3GRWL 3BP7B 1PZUB 4O5LL 3CLEL 1YMMD 3QFDB 4LLWB 3GM0A 4AMKH 3BMVA 4NBYB 5CMAA 2HYMA 4OFYA 3MACH 1NFDF 2WZPD 5EZIL 3CZFA 4L8BB 1R3JA 4M48H 5DHYA 3DBXA 5D93C 4YPGB 2ZCLH 5B3NA 2BNRB 2CXKA 2XN9D 4YO0B 4PJDB 1CXFA 1P84K 3IGAA 5BMFH 2DI7A 1FORL 4L4VB 5SWSD 3JV4B 3RVXD 2FWOB 4HFWA 1EAPB 3O4LA 1JGLL 5DK2B 1G6RL 4MD5B 4QT5B 4ZNEE 3CFCL 3UTTB 2A1WH 2EO9A 1C16B 4RNRA 4XPFL 4PG9B 4B50A 3VFSB 5TDPA 1T04A 1KN2L 4FMKA 4UINL 2AK1H 3SCMB 3KPRE 3AXLB 1HXMB 4P23C 2FJFB 1OTUD 3CUPA 1TJIL 1CF8H 3FQTA 2EDLA 3CDGA 3RUGF 3WS3B 3QO0A 5K33A 4GAYB 2OM5A 4PUBL 2CIIB 3FONB 2YRPA 5CCKL 5K93A 1FFOB 1HK6A 1J7VR 3OPZH 2YPKA 3TIDA 3MRLA 3FB5A 2XOTA 35C8H 3AU1A 4QYOB 2EDFA 3CXHK 2ICES 3HNSH 1YC7A 4YDJA 5DVOA 4CRPA 1SJEB 1G0YR 5MP6H 5GHWH 3O2DH 1T03H 1CFVH 1WUNT 2EIBA 1KC5H 1KCUL 4NQDB 1OPGH 2YWZA 3RWDB 4ODXA 4WUUA 3X3FL 5E70A 4I1NB 1CQKA 1JNNL 3PHOA 4HZAA 5CP3H 5FYJU 1B0WA 2J5LB 1H3PL 2ICWA 1Z5LA 3IYLW 3GNMH 3NCJH 4HGWA 4ALAH 3DV6A 4KTEL 4WWKA 1VDGA 1WIPA 3GFUA 1MHPH 1QBAA 4NGHH 2IBZX 5ESVA 1DBJH 1S9VB 4G6JH 3MGAA 4LSSH 3P9MA 3T8XA 1Q9KA 4AEIH 3SDXB 3DTXB 1U58B 4D0BB 4PJEF 1PKQB 4GBXC 4KK8C 1ZLUK 3VRLE 3KNBA 1LO2H 4PJXB 4XC3H 2CGRL 1H15A 3CD4A 5A2LH 2VISB 5MEPB 2AK4D 3U9PH 2VDPH 3O3BA 1L7TH 3FOLA 3REWB 5HYQA 2ZP0T 1G1YA 4DOHB 3UBXI 1D5BA 4E42A 3PP3H 3BP6B 2VLRB 3RDTC 2HFEB 1UVQA 3O8XB 1GCFA 2VNCA 3DARA 2ICEB 1N7ML 3SGKA 2V5YA 4HS8H 2H8PA 3OB8A 3O4LD 3VXMB 1N5AA 3P9LB 3TESA 3NACH 5IHZA 5I1EH 2OZ4H 5LVEA 3T0EE 1GOHA 5B4MD 4RRPG 3SKNA 5DC9B 4IRJA 1F2QA 3ZYJA 4H25B 1BBDH 2YMXH 3O2WL 3NIDF 4HF5H 5SX4H 3EZJB 1XIWC 5KSVA 1JK8A 4P3DA 3QIUA 1VHPA 2JCCA 2BNRE 1PQZB 5D5MA 4IM8A 1NMAH 1LEGB 4HUXB 4KI5D 2FRGP 3B9AA 5SWQA 1RD6A 4J3WA 1KCSL 4P46C 1A7OH 4XP6H 5I1AA 3B2VH 5ICZA 1S7RA 3UAJD 1XF2B 1FAIH 1Y18B 4NKDB 1MVUB 2A38A 4HIJB 2JIXA 5KSBA 2L7UA 4UBDD 4YE4L 3G6AB 4GS7B 3T77B 4OF5A 3PDOA 2IH3B 5FGCB 1AIFA 1X4YA 4MWFA 4X4MA 3TBYA 2GEEA 3D3VA 1CR9H 3MOQA 3S4SA 5JW4R 2R2EA 3I6LD 1YEDB 2P47B 2DYPA 3WO4C 3HE7A 5C9KA 3GI9H 4F15B 1DVFB 2Q6WA 1XR8B 1EXUB 4M7LH 4LF3B 1AE6H 2IQ9L 4Q9RL 3O3DB 3QNZB 1ADQL 1QVOA 3G5ZA 4OLYL 4QRRA 3QRGL 4UTAH 3DURA 1BFVH 3G08B 4NYLB 3TPKA 1OGAE 2EIZB 1IC5L 3QJHB 3FCTB 3IDMA 1S9WA 2GT9A 4UDUB 3RHWF 3DMMB 4NQCD 1WISA 1CICA 4EOWL 1JBJA 4UUJB 3OKEA 1MJUL 4I9WE 2DI9A 4FQXB 4W4OC 1U8PA 5JDSB 1MH5A 2FD6L 2HTLD 2FEEL 1NDGB 4H20L 1PVHA 2DDQH 4Y89A 1AFVL 2P7TA 4XPGH 5EU5B 3B3IA 5IB3A 3ARGB 4WUUE 2DQIL 4EUPG 3MZGB 4HH9B 2A73A 4HDIA 2XFXA 5MENB 3RX8A 2CRMA 4PV8B 3O9WA 5TGBB 3Q6FA 1BJ1H 3MROB 1BQHG 5DS8B 4IRJD 4TOYL 3VRJA 3QISA 2E9BA 2AKRA 3BHBB 1T1ZA 5CJXA 5A3IC 5FECB 4JVUA 2XACC 4HD9A 5F71A 1AGBA 2A0LC 4NT6B 3QIUD 4Z7VE 5HHNA 2APXA 4JO4L 2QSQA 4Z77A 2R29H 5K9OB 2AEPH 5A16B 1IGIH 1E27A 1HHIB 1CXEA 3FHQA 4GKSA 4JM4H 4H0IA 2IPTL 1FDLL 1H3GA 5CBAB 1QZ1A 3HC3L 4BUGA 5FCUH 5D2LF 3QUMA 3L3OA 4NC1E 1UM4H 4G6AC 1V3KA 2E9IA 3CX5J 1E0OB 1FLRH 1MUJB 1HILA 4R2GD 5A2KH 4XCNB 1FYTA 1A7QL 4TUKL 4YBHA 4QRRD 2C7UB 3KLDA 4C59B 1UXWA 5JW3H 3KPLB 4NPYB 1RUAH 3NFSH 3QP3A 3ZKND 5D5ME 4GW5B 5ETUB 4BFIA 1DQDL 1F4YH 4JN2B 4LDLB 1VPOL 3D0LB 5JOFB 4U7KA 5C07D 5GIRA 3MRQA 1HQ4A 2OR8A 1CICD 1X5YA 2WANA 4RISL 4PJDF 5FO7B 1JZ5A 5CFHA 3C8HA 2GK2A 3BD5A 2IF7A 5CILH 3MFGB 3F5WA 3INUH 2MPAL 3PWJB 1AGCA 3LKQA 4XB8A 1FVEB 3D3VE 1UB6B 4J3XA 4AEEA 3EJJX 4RRPA 4IRSC 2E27H 2LAAA 5HVGB 3UTZA 4AENA 5I2IA 1B0GB 1ZE3C 1DEDA 2DQTL 4Z7UA 4XMPH 3WKMH 1B4JH 4FQHA 5FYLE 1OP5K 3FKUS 4MNQD 5HVHB 3TWCL 3WFCH 5B38G 2DJUA 3RWJA 1U8KB 4YHNA 3RTQC 4PV9A 3PWNA 1R3HB 1R5VA 3CDCA 4PJ9B 2VIRB 1XF1A 4UT7H 5C7XH 4M61A 5H2BB 1DEEB 3C2AH 5LKNA 3VFNB 1EMTL 4JGUA 5H35B 2XZAL 1JNHA 2FECI 4A6YL 8FABB 2L0DA 3DGCR 4MAYA 1F13A 1UM6L 2HLFC 3RWGA 5GS3A 2P8LB 3ZYOA 1U8NB 5HDBE 1HI6B 3S97C 5C0IA 3RNQB 3LKRA 2D7MA 5C09B 3VD3A 7CGTA 4QWWC 5JORB 1M7IA 1NMBH 4HJJL 1WZ1L 1OAXL 4P2OD 4V1DE 4FXGA 3V4VH 1IRAY 1FYTD 4HXBH 3B9KC 3JUYA 2FBOJ 2IADB 4OCYH 3SDXF 3J8F7 3TEUA 1YY8B 4J6RL 1O5DT 3IU3B 3KYOA 3K1KC 4WHTB 5IJKC 3I6GA 4LCWE 3KDMA 1RZ8B 3EYOA 1A7NH 3KJ6H 1WSST 3O0RL 2EYRB 1RFDH 3RWIA 3LDBC 1XH3A 4ETQB 3BAEL 4PJ8D 5EZJB 5JUEH 5E9DD 1KFAH 4JEGB 3JV6A 3QEHB 3L9RA 2R4SH 5E8PB 5HGGS 1EVUA 1J8HA 4ENED 3WJJC 4EUPA 3PGFH 1A3RL 4LAJH 2VDRH 5D72H 1HH9B 2B20A 3W9EA 1RZJH 4P5MB 4PB0L 3LKSA 4HBCH 1DE4B 4ZUVB 1J11A 1BQHA 3EAKA 1CFQB 4K3JL 1S3KL 2AJSH 4O02H 3FT3B 5C0NC 3SE3A 3NCEB 5FKPB 1SVZA 3QUXC 3U2SB 4MNGB 4I3GA 3LEVL 4QTHA 4U3CA 3EYFB 1T0MB 1TTGA 1F11A 1JGEB 4UV7L 2VL5B 4FQJH 2Y23A 4ODHH 5GQBA 2H2SD 3FTGA 5CIPA 3RKDD 1MNUH 5EA0L 3QNXB 1NLDH 4GQ9H 4QRTA 3BIKA 3P0VH 5I15H 3RX7A 1CDCA 1JPTH 4I18C 5K59E 1Y0LA 5JA8B 2B39A 3GIZL 4MAYD 5EIIB 3VXSA 2NY1C 3ZMRA 2NY6C 4HK0B 3JWOL 5FYKL 4Z76A 2OTPA 1ZWIA 3GB7A 1SYVA 4MHHG 1P7QA 4HWBH 3LEYL 4G80A 1J05A 4L29A 1FFPB 1V3MA 2QBWA 4LDEB 3TPUB 4HHAA 5EBMB 4RWHA 2QADC 1A22B 2A74A 1YYML 1NANH 3JXAA 4Z7UE 3HCVB 3QIBD 4GRMB 5T3XL 2DM2A 2XPGB 2FEDC 4NQXA 1E6JH 2CH8A 2P8PB 3P4MB 4X4ZA 3MRDA 3ILQD 5F89A 2DWEB 1UWEH 4CMMA 3BZDA 4KRPC 5C0JA 5TQ2H 1WBZA 4YNYB 1IGYB 4TSBL 5DD3H 4RWYL 4LSPH 2IH1A 5IOPB 5E2UL 3WFDL 4GQPH 2FO4A 4R4FH 5C09E 4FQLL 4WFFD 1GHFH 4XTRD 1S5HB 1VADB 3HZYB 4OZ4A 4DUWA 4X83A 2CKBB 3DX6A 1NDMA 1HHKB 2HKHH 1QSVA 1JHKL 2D31A 3IDJB 5JO5A 3OKOA 4KROC 3GI8L 2NY4B 4YUEL 4BSVB 5E56A 5LGJB 3IJHA 4NHUB 2HH0L 2ATPB 2MKWA 3O4OC 5C2UB 5F7DA 2OL3L 2X89A 4G8GA 4UQ2A 1BIHA 4OCSL 5B38A 3V52L 4DAGH 4HPOH 1MF2L 2AXJA 4N0YL 4GXUN 5JIPA 4DGYH 4GAJL 4XVSH 1AD0B 5F7EH 4S1SL 3RNKB 1RU9H 3GGWB 1TJHL 2JELH 4Y88A 2YPLA 2PTTA 3RIFF 4FFVD 4U1LA 2VLJA 1T5XA 3DUSA 2A2QT 4DVBA 2P5WA 3NVQA 4FP8L 1XGYH 4XXCC 4OLZL 4PRHB 3VXOB 4S11A 4TPRH 2GQHA 4XP4L 3ULSB 4OFDA 4JZOB 4YFDB 3VXSD 1J8HE 3BRGC 5ISZB 1HSBA 4LCUA 1G84A 3VDAA 5DEFA 1P7QD 1Z0MA 3W81A 4HIHB 4R8WH 1VGEL 1WJ3A 5SV4A 1NLBL 1NCBH 3BP4B 5DRWA 4H0GA 5EUKA 5DUMH 1MCOH 1QLFB 5E94A 3X3GH 1NCTA 4V2CB 1FZKB 2CKBH 1DL7H 4M03A 1K4DA 4IOFC 3ETBF 3QHZL 4HIXH 1NGWB 4JFEA 5CJOL 2A6DA 3L5WB 3BH9A 5I16A 1KLUB 4UNTA 3LQAL 4NM8H 4AH2A 5KVFL 1J0HA 2FL5B 1L0QA 4NIKB 4OM0H 2IEPA 1PZ5B 5C2BH 3FB7A 1CLCA 4OTXL 3EYVB 1MCKA 1NJ9B 4FFWD 1PSKL 4WCYH 3UP1A 3JWDL 4LMQE 4WDIA 2DQHL 2FJHA 1LNUB 3TYFB 4NKOB 1JWUA 4X99A 4HUWB 1S9YB 3RFZC 4GJTB 4Z8FL 3OG6B 1D6VL 3CVIL 3IKKA 5HHPA 3ABZA 3MO1A 4J3TA 3WFEH 5D1QC 3VCLA 1G7QA 5D2NB 1LK2B 3ESVF 5I0DA 2ZUQB 4XVTH 4U2YA 4JPIB 1RMFH 3QQ9D 4K3EH 1F6AB 4P23A 3HB3D 3IDXH 1Q0XL 3VH8B 1XF4A 3QWOA 4WEUD 1BZ9B 1DQLH 2AXFA 1KIQA 3H8NA 4P57A 5M94B 2CK0H 2X89D 4BKLB 4F8TA 2NXYD 1LDSA 3MV7B 1HWHB 4TYUA 4LASL 3MA7A 2BDNL 3BT2L 3DVGA 4Y8DC 4OCXL 4JFOA 3R0NA 4NN6B 4OFPA 2HVKB 1W2KT 1KJVA 1Q94B 4UAOC 2YPLD 4ONHA 4NRYB 4HUVA 3T3MF 2UWEA 1C7TA 2Z31B 5MI0C 2IBGA 4XBPA 2DIJA 1NFKA 4JFDB 4NQEE 5ANMA 4ISVA 1ZGLP 2P5WD 3PL6B 5F6HJ 5GJTL 1CYGA 4LKCB 3G9AB 5I0ZA 5CD3B 1ORQA 3DGGA 4Z78A 1AD9A 3VFUB 1TCRB 5IHBA 3GO1H 2ESVB 1NL0H 3FB6B 1AHWC 5HVWA 1YY9D 2A83A 4JY5L 1BPVA 5ACZB 1QQDB 5IBLD 3O3UN 4Y2DB 2V2WA 32C2A 4GBXA 1QFWL 5DSCA 3VFTB 3IFLL 5FM4A 4G8GE 4OLXL 4HWZA 3O45B 4OSUL 3V0WL 1UJTA 1WT5C 3VMPA 3U0TA 3CFEA 1CGVA 4JFED 2EDTA 4U1MB 3P30H 5FYJH 4LQFH 4NQSA 3J7HA 3GSXA 5E4EB 4YHML 3H9SE 5BMFL 5KSAC 3RDTA 2A6KB 5IMLA 1Q8MA 3VE0B 5F9JB 1EHLH 2VXQH 1INQB 2GIYA 3VXPA 1V8HA 3GSVB 3CGTA 3CH1B 1EGJL 2VLJE 2EC9T 2P5WE 1A9EA 4HGKC 3UTPE 3RZCB 2H6PA 4OF3A 3R06A 4JHAL 4TVPD 4WEBH 3WUWB 3RY4A 4GXVL 3LHPL 1IAMA 4AG4H 5ALBH 1XIWA 1GZQA 5I71C 2R1WA 4P23D 3P2TA 4EBQL 1A1OB 5LWYL 4KKBC 3ZL4H 3C6LC 2Z35B 5AZEH 3ZSSA 4FQ1L 3JV0A 5HHQA 3PHQA 2XG4A 3K80A 4JRWA 4U31A 2NLJB 3M17B 3M45A 5FA4B 3C5JA 3SDAB 3WXVH 2E7LC 2E9JA 1WCBA 3IFNH 3PE9A 2GSIA 3AUVA 4MLIA 4CDGC 4CUCA 1T03L 2OXHA 2XA8H 4HLZG 3PGDB 5I1DA 3RWCB 3QHFL 5IFAL 1QA9B 4JDVB 2N56A 2XRAL 3L7EB 4XNQA 3V9FA 3QQ3B 3FAXA 4PB9H 2ZUTA 1LEIA 5C0CE 1EX0A 1HNGA 1N8ZA 2P49B 3LIZH 1PG7H 4QOKB 2EH8L 1MHPL 3CCHB 1LDPH 1A6PA 1F4WH 3MV7E 1P4LB 2QSCH 2AGJH 3O41A 1NGYA 4P59H 5EOCL 1V05A 3MRCA 4YR6B 3WEXA 2Y7QB 2R1XA 4CVZB 3OJDB 3O6FC 3QIWB 5IP4A 3ZTNL 4GBXD 4KK8D 4XI5C 5AUMB 3BEVA 4JPVH 5ICXB 3CFJB 1NBZA 2HWZL 3EO1B 5DJ8B 2VQ1A 4CN6A 2Q86A 4JFDE 3WN5C 3NIGF 1KXQE 4JB9L 4JFXA 2XTJD 2OQJA 3MLYH 1FG2B 4OJFH 3K46A 2VDLL 3DOSA 3OZ9H 2X09A 3L3HB 2FJGA 5D70L 1D7FA 4PLJC 4HIEA 1VFOA 1MVFA 3R8BB 4JY6A 5GGTA 4GG8A 4PRBB 1IARB 2OTUB 3JV5A 4W6WB 5J56B 1CFNB 5KS9A 5IEKB 1T7XA 5LBSH 4X98A 3LV3B 3SE4C 1XF3B 2B1HH 4NO0A 4QXWA 4BH7A 3NCCB 3G5YA 1MI5A 2NY3B 1RAMA 3QUYB 4JO3H 4M8VA 5HI5C 2NR6C 2DKMA 1C5DA 2ADFL 3MXWH 2DL9A 1CGYA 3VFRA 1MCRA 1TCMA 3FFCB 2BVQB 3NZHL 2GTZA 4XP5H 2K7QA 4PIRF 1YEEH 4U6YB 5D1XB 3QEQD 4P46D 3GSOB 1EFXB 2K7PA 4JM2D 4X8XA 5GGQL 4OKDA 3AREC 4K3GA 2YD6A 3V6ZA 3DV4B 4X80L 2PW1A 5HD8D 1W8NA 1JGDB 4ZOBA 4UT9L 4IDLA 2HKFL 3LS5L 1I7UB 3ZE0F 1MJJB 3EBAA 1BWMA 4DN3L 3GI9L 3MUY1 3OKMB 2NX5E 5ITFA 1XGRA 1ND0B 2G75B 4Y16A 4FA8A 4K7FB 5IB5A 5HPMA 3KPMA 4M7ZC 1AE6L 4ZXBC 1TVBA 5CEYB 4TTGA 4MDIA 1I4FA 4OZHB 1CDUA 5DHVA 5DK3A 4ONGH 5E5MA 3KYNA 1MFNA 4UTAL 4Z0BH 1KYOK 4YLQT 3T1WA 5DZNA 4R97C 4L4TA 3SJVA 5L2KA 3BE1H 5LGHH 3I85A 3SOBL 4IS6B 1ZVSA 2R0WL 3EYQC 3HRPA 1N59B 1JZ4A 4NJAL 1DBBH 3DWTA 1R24A 2DQEL 5C0BB 1XEDA 5EOTA 5DGRA 2CJUH 4NUGL 2E7CA 2VR5A 4MA1C 5LGKA 1GYAA 3E6FB 1UCBL 1XF5A 1QR1B 2DDQL 2XQBH 3GMLA 3FRUB 4ZFGL 4QOKE 1LP9A 4WTZA 4NQVA 3UJIH 3TIEA 1BJ1J 2ZOLB 1A4JB 3D9AH 4YHLH 1ROWA 2HRLA 4OLUL 1ZT7A 1AI1L 1HH6A 3KPQB 5AWNH 3RQ3A 2FIKA 1RUPL 1RK0B 2Q8AL 2V5TA 4IRSA 1RZ7H 5DA4A 5TJWK 1G7IB 1MI5D 3U4EB 1JZ8A 3AAZA 3TZVB 2YA0A 3SE9H 3O6MH 2ADJB 1X5AA 4RFOL 2DQFB 3RTQA 2R29L 1S7XA 3C08L 3GMQB 2VAAB 4ODTH 3L7FB 3SPVB 1XGUB 2R39A 4WGWB 2Y5EA 3MGOA 2XN9B 3VGAC 3WXWH 4GLRI 3IFOA 2BVTA 4K71B 4OZIF 1I9JH 1HE7A 3MA9L 5E8EA 5F1NA 4M7JH 5SWSB 3OKDA 3KPNA 3ZE2F 4NCC1 3K7UA 4YDVA 3KPPA 2EDYA 4EI6B 3SE8H 3SQOL 4PRNB 2APBA 2MHAB 2PO6C 5DJXA 2VDKH 4G6AD 1UT9A 5E5UB 3MLUH 3RVTC 5JW4N 3Q3GB 2OJZH 4JZNB 2CDFA 1R3KA 5I8OL 4J4PC 1NEZA 1OSPL 1JFQH 4R96B 4YHZH 3B9KA 4WFGD 4U1IB 1UZ6E 3WDIA 2J8UE 1XAUA 1DUZA 1I8KB 2XWJA 3BUYA 5FF6B 1NMCC 1EEZB 3TNNB 4L4TD 5L2KD 1SY6A 3MV9A 5IJKA 3TBVB 2YD2A 3U36B 2G5BA 4X9FA 4HK3J 4LEXH 3SDYH 2P8MA 1EO8L 4OGYL 3MV8A 3NABL 4YEEA 3CFBA 3MOAL 5C0RL 1OAZL 3GM8A 4IHOB 1OTTC 4NM4H 3QDMA 3TT1H 2QQLL 4R7DA 2WLYA 3WJJA 5ID1B 3WCYA 3ZE1F 5HHXL 4DUXA 1QG3A 5EB9A 3REVA 1I9RL 1HKLL 5ESQB 4Y4KB 2KQNA 5SX5H 3WKML 3GSQA 1B4JL 2YOCA 3LRHA 4RAUB 1QKZH 1NCWL 2CLRA 2X4UA 3I9GH 3MOBL 3QUXA 4K8RC 2BX5A 4O4YH 5GRJH 5DQDH 2PNDA 3TFKD 1RIHL 2AK4B 2OMNA 5CMAB 3SJVE 5DVLA 5EPMB 1R3JB 4UT7L 3RTQD 4Z0XA 1DQJB 3C5SB 1AGEB 3T0AA 3MR9A 1NH6A 5IB1B 4PJIF 3OXRA 5TPWL 4DK6A 1EAJA 2ZWLT 3D85A 4EDXA 1EFQA 3IFPA 4NZRL 5C0EB 1FH5L 2QJDA 1MRCL 4I18A 2SEBB 3PUCA 3MZTA 4PGEA 5IMOA 3O4LB 1EEYA 1I85C 2HLFD 1YJDH 1J12A 4FFZH 4KMTL 4YQXL 5IKCB 4KZEL 2NY0D 3H3PL 1P7KA 3FN3A 4RNRB 1G7HA 1FGVL 3SGEH 4ZODA 2X7LB 2C4FT 1K6QH 1KPRB 3NPSB 3BQUB 2MQ0A 1MFBH 4QWWD 5I1JH 4WU7A 3RL2B 4IEFB 2A6JA 4LCIL 1C5BL 1F3JB 4XBEH 5FGBC 5KAQF 5T3ZD 4Z7NF 3CDGB 3MRNA 4WI9A 1OP3K 3CPLA 4Q6IC 2GJ6B 4HUMB 3B9KD 3H7BA 2BSTB 3WS6C 1FIEA 6FABH 43C9B 5J8OA 1A6VH 4PJAB 5CEXA 3HR5A 1ZTXH 1G9ML 3FQWB 2UUDK 4LLAA 1PD6A 1UXSB 5EU4A 3IJSA 4YDJB 3HUJB 4JE4B 4P2YA 3D5OF 4OGAD 4CJ0A 4F7PB 3H3BC 2YD5A 4ZYKA 5JPNA 4LNRB 3MV8D 3MODH 1EEQA 2FATH 4KMLB 3NA9L 5TE7H 4RBPH 2OR9H 4F7MA 4CN1A 2F5BH 4PJBF 4OAWB 3KPSA 3V4PH 4DZBA 1JF1A 2ICWB 1BZ7A 3QDMD 3ZSTA 2R0LL 1Z5LB 3DNKA 2C3VB 1N6QH 2C1OB 4WVRA 2VLKA 4OZFB 5D7KD 4NO5A 3PWLA 1T5WB 1QLRA 4IOSD 5ESVB 1AH1A 3G6JE 4XWGH 1QSFB 3OKKA 4XP1L 3F7YA 7FABH 3DYPA 2AJ3A 4GUPA 4LIQL 4JREC 5C0ND 2BVEA 1DLHA 4EI5D 1XMWA 1KNOA 3QCVH 3QUXD 4DGVL 2Q8BH 2PN5A 4X7CC 4YK4B 4NQCB 5MEOA 1KGCD 4X6CA 3VFGH 3O3BB 3BVNB 4L4JA 1R3LA 2VERN 5F1IB 1H0DB 3WDHA 3MV9E 5HHME 5IVZB 2BVPA 3K81A 2EKJA 4WV1A 3QZWG 5D9SB 3QDJE 5FO9B 4PJ5A 2N7AA 2Z4QA 2EDRA 1BAFH 3KPTA 3IF1A 4XXCA 1N5AB 3B83A 3QDME 3KR3H 5KVGH 5K9QG 4R6UA 3SKNB 4IRJB 5FOBA 2ICWI 4D9QE 1UEYA 3OGCB 1OAQH 1L7IH 2JCCB 4FNLH 4F2MB 2BP3A 4NJ9L 1RUKH 2QADD 4IDJH 4JDTH 3C8KB 1BBJA 4DZ8A 4PR5A 3P3YA 2FEDD 3VDCA 3T1FB 3THML 1FRGH 2VXVH 3FQNB 5ICZB 2IGFL 4KY1L 3STLB 5FAAA 5F21B 4BSWB 1JPFB 1F8TH 1X6NA 12E8L 4KRPD 1H5BB 4KVCH 5KSBB 2MKLC 4RX4A 5IESL 3TBYB 4AM0A 3JZ7A 1BQSA 1YPZA 1BLNA 2Z8RA 3S4SB 2EEBA 4LDOB 5D1QA 3X12B 4ERSH 4BQ9A 4POZC 3DROB 3MRKA 4RGMB 5I76A 3IDYB 3L5XL 1IT9H 4KROD 4OF8A 5DJCB 4ZUTA 4PJAE 5AYUH 3G5ZB 4QRRB 2ORBL 3AS2A 4LGSB 1IEAB 1YA5A 4KRNA 1G7JA 1AJ7H 5BZDA 3ALWA 4RQQB 4MJ5A 2YKLH 5I1IH 5I8CB 5KOVC 5J11B 1S9WB 3EFFA 5C07B 3VFWA 3PWUA 4FFYL 3EO9L 4X7EC 4MJ4A 1CDJA 5CEZL 3W2DH 4NN5C 1MH5B 4U0QB 2O5XH 1DBKL 4KV5E 2AJYL 1F45A 2OI9B 2BNQE 3BZFA 3CXHJ 3H7LA 4JO2L 5E2VH 4GMSL 1XZ0A 4CGTA 1T1XB 4PJ5D 2B2XL 3P4OB 2V2TA 5IB3B 4JFZH 1KIRB 3QWRA 4HCRH 4ZPTB 4JKKA 1QSFE 4L9LA 4XXDA 3B9EA 3LMJL 3H9HA 3KPSE 3G9VA 1FL6B 4TVSa 1HQRA 4DKEL 2BOCB 4M43L 2VLKE 1UZ8B 4MNQB 1AHWA 2B4CH 1T1ZB 5I19L 3SDCA 5CJBA 3LH2L 5DEZA 3VRLF 3A6CL 3LQZA 2NY7L 4PRAB 3GHBH 3LKNA 5FHBH 1WT5A 4YXKL 3IRZA 3T08A 4HKJA 5DURD 5IG7A 3MBXL 4KKLD 3DETC 1FAKT 4K94L 1KELH 1LD9B 2ADIA 2V2XA 4QXUH 2HJKA 4X6CE 1QD0A 4L3AA 3RVWC 1I8IA 4KK5D 5KSAA 5IBTL 4K9EL 4C83A 5HYJA 3BPNB 5T5FH 3U83A 5K9JH 2WP3O 1KJMB 3NIFE 2E8ZA 3QUMB 1D5MA 1J0ZA 3OR7A 5E1HB 4FABH 3M8OH 3K2MC 5LG1A 3FN0L 3P11H 2GK0B 5BZWA 3MLWH 5JW5A 4P2OB 3PNWB 1HILB 5D1QD 4K2UH 1RMFL 4D0DB 4QRPA 4H8WH 4YFLI 1FYTB 2F58L 2Z92A 4UU9A 1MREL 5EULV 1NGZB 2QTEA 5KN5A 4U6XA 4DVRH 3PJSA 1I7RB 1C1EH 4MB4A 1T80A 4KAQL 1A6UL 3HMXH 4UDTA 4DGIL 2DQGH 1FC2D 2VABB 1QP1A 3MRRB 4C4KO 5L9DH 4NO2A 3CDFA 5J06A 4PJ8B 5E9DB 5HI4D 2E7LA 1U8OB 1WFUA 1CG9A 2PW2A 3QZWA 1OWWA 1PY9A 2RB8A 3RL1A 3T0VA 1T7WA 2BSRB 5DK0B 4QRQA 5JHDD 5JQHC 3AC0A 3AROA 3ZTJG 2Q3AA 4OD2A 5DEGA 1P5VA 5KANI 4OUOA 5ID0B 1YPZE 1BF2A 1X7QA 1Q0YH 3ILPB 5J89A 4I5BA 3MJ9L 5FYKD 4F7TB 4C4KT 5I2IB 4Y19B 4LSVL 1U3HC 5EUOB 1CD9B 2H41A 2FH8A 3UZEA 4UT6H 1U41A 1T66C 1JE6A 1QOKA 1RZKL 3O6FA 3RWJB 2NW2B 4ZS6C 4P9HC 2NXZC 3V4UL 5E2WL 3X17A 1FE8H 3FO0H 4JFHD 4OUUB 5JXEC 5KG9B 3WN5A 3ZKXC 2X9XA 1E4JA 4LLYB 1AY1H 3FOMA 4MCZA 4Z7WA 1TVHA 4MAYB 5HYJD 3GUTA 5A43C 3RWGB 2VOTA 3EOAB 1BOGA 4DW2L 4OD1H 4PJGA 1BJ8A 1JZ2A 5J1AB 3BKJL 3STBA 4IBLT 4XX1G 3P4LA 4S1QL 3IETA 4MVBD 1N3NA 3LKRB 4HZLA 5GRUL 1KTDB 4PS4H 4X5XA 4U6VH 4WY7H 3QAZB 4C56B 1N5YL 1TZHA 1Q9OB 4QRPD 1VGKA 2X4TB 3QIBB 3ULVH 4H5SA 5IUSA 3ELAT 2IFFH 1A7PL 4UV4L 1M6OB 3LOWA 5I9QC 2H32B 1HHJA 3V6FA 2P24B 1CD1B 3TO4B 3LRSA 4KKBD 3C6LD 3MJ8B 5IHUH 5E0QA 4HMEA 1JN6B 3CZJA 4PJCE 3VFOA 3KDMB 1XGTB 4P4KC 3WDJA 3AREA 3CK0H 1I1AC 5ILTL 5EC2A 5CHNA 1YECL 4I4WB 4QKXB 4QRUB 1WCQA 5HYJE 2HLAA 5B8CB 1R5IB 4M6ML 3LEXB 1R5WA 3TBTA 1NGXA 2XWBB 1ES0B 4LSQH 4KJYA 4YGAB 3W9EB 2DBLH 1VEMA 1KCLA 2QR0A 3LKSB 1B0RA 1ED3A 4ZXBA 5ADPH 3T4AA 2VXUH 2VB5A 1UA6H 1XCQA 1U8MA 2QSCL 1AO7A 4O00A 2NY2C 5ESAA 3NFPA 2KBGA 4OQTA 4MJ2A 1A14L 4GG6B 3H9ZA 1FNSL 4PYGA 4KRMB 2JCCF 3DYOA 1D5XA 1HINL 4NO3B 5I73B 5D5MF 2W65A 2UZIH 3HZVA 5D7JC 1K4CB 1U93A 3O6FD 1QFUL 3S35X 3Q6GL 5E03A 5HGAB 4ZUSA 1FPTL 4XI5D 4MX7A 4NKQB 3ULVE 3VI4F 2DBJA 3AFLA 4K3HA 4AL8L 3GBLA 1NUNB 1RV6X 3S34H 5C3TA 1WBXA 1YQVH 4L5FL 3NGBC 4OLEA 2MQCA 3BIKB 1IAOA 4QRTB 5E8NA 2VN4A 4YX2H 5KSBF 4LAQH 4R4BA 4YHPA 3WIHH 4PLJD 1DJSA 5EU6D 2BY1A 3VXSB 4WO4B 5BVJA 1FSKC 3LB6C 4RCAA 4Z76B 1I3RB 2RFXA 4F8QA 4XNZB 1Q72H 1J05B 2ED8A 3HG1D 3STZB 3GK8H 5D7IE 2A74B 1RULL 1LK3L 4WI7A 4NRZA 4Q0XL 5CUSH 1I9IH 3DVNA 1KEML 2ZSVB 5DJ6B 3VMNA 2FX7H 2DLEA 4MA7L 4ZOCA 2K9UA 4JQIL 3CFDA 4U1HA 5DC0A 3MYZA 5D8JL 3O3AA 5C0JB 1T0PB 2DQJH 1WBZB 1T3FA 4PYHA 5C3LD 2IH1B 3ARED 2FDBP 1DZBA 4OZGA 4GAFB 2OMBA 2FO4B 4ODVH 1FBIL 1B4RA 4KTDL 5HXMA 4Z7WE 4O2FA 4OZ4B 5GS0H 4UNVA 2LTQC 2PO6A 4OGXH 3DX6B 2J8OA 2YBRB 3K1DA 2D31B 1J0YA 1RJCA 4YFLF 3OKOB 1U6AH 4WFHD 3QPXH 3WFBL 3OAUH 1MRDH 1IL1B 5GJSL 1GPOH 1K8IB 4ZXBD 4J4PA 3MREA 5F7DB 2V9TA 5BV7C 3F6IA 1XCTB 3CDYA 3UJTL 2NXYB 1HHGA 5DMIL 5HGDB 1OQXA 5B38B 4TRPL 1T4KA 5C8JA 1OVZA 3NCYS 4NHCL 1FHGA 4XH2A 1N4XH 4OBSA 3EOYG 4BK5A 5IGXL 3TGXA 1A4KA 4Y8AA 3C60A 1ZT4B 5EN2B 2P48B 3KYKL 3V6BR 1MJ7H 2WW8A 1RZFL 4S10A 3F8UB 1GAFL 3HAEB 2YPLB 2AXHA 4DFIA 1OAKH 3BGFC 5DJAA 4U1LB 2W9EH 1T5XB 4MMZC 1TTFA 4N0RA 5SWZE 1T2QH 3VD9A 4YH6A 4Z6AT 3F6LA 5FDWA 2F19H 4OKVA 3ULUC 3ARSA 4EDWH 3H0TA 3CLFL 3U1SL 1D9KC 2Z8SA 1CT8B 1AO7E 1WEJH 5FUOH 2HMIC 5HYSG 4ODUA 2PF6A 1Q1JL 5GZND 1CFTA 4JFEB 4E0RB 4U1JA 3P9WB 2AEQH 2A6DB 4WU5A 4O51A 4PBWD 1GSMA 4PTUB 3IXAA 4OCNC 1FVDA 4AH2B 1MFAH 1C7SA 5DUPH 4M1CC 2BJMH 4O58H 3R8QA 3OJMB 4HS6A 4Y5YC 3WLBB 1DN2A 5K59F 2IFGA 4G7YL 1YNTA 3ZTJH 5ABDE 1I1RA 5FGRA 2VZUA 4L8DA 1ETZA 2ZCHH 3BKMH 5FM5M 2OS7A 4X99B 5F7LB 1GZPA 3BWAB 4MXQC 3ARDC 2D7TL 2PO6D 4UTBH 5HHPB 4CN4A 4HFUL 3VCLB 3QCTL 4NZUL 2UZYB 3S3PA 5DLMH 2WBJB 5JLZB 4M02A 3HAEH 3RVTD 3IS1X 1TJGL 1HNFA 5FGBA 2VZ1A 2R69L 3QWOB 4F57H 4KKCD 1QPXA 4J4PD 4Z7UF 2AXFB 4Q6IA 4H1LG 4P57B 4YWGL 3GMPA 3WS6A 2AJXH 4LHJB 2I9TB 2COQA 2F53A 4JKWA 5J0BA 1HOCA 3MA7B 2DM7A 2KL6A 2HA1A 2C9AA 3DVGB 3ZYIA 2BMKB 3QEUA 2B0SH 2VDML 3EYSL 1F02I 2KUTA 2QV2A 1OSZB 2QQKL 4YHKL 4JRYD 5DTFB 5E00B 5I1GH 3H9YA 2VZTA 4TULH 5LXGL 3A6BH 1BQUA 3IAPA 1FZOA 2X2YA 4HUVB 4OZGE 2UWEB 1QRNE 3RKPA 1KJ2A 1TIUA 3UYRL 2CLZA 4Q9QH 1OTTD 5ANMB 4ISVB 4LCCC 1G9NH 1U36A 4XCCH 4I3RH 2APTA 3PQYE 4M1DH 4LQ1A 4WGVB 1X5KA 4EIGB 1ORQB 4KKAC 3DGGB 3E3QC 5DVKA 3ARBC 4ZUUB 3ARXA 3FRPG 4FZ8L 4JRXA 2D7QA 2A83B 3BO8B 4OCMC 3L1OL 3VXQB 5FHAL 1KPVB 1IVLA 3QPQC 3MTRA 3K2UH 3V5KA 1IKFH 4LLMA 3U0TB 4AT6A 2HG5A 2XTJB 3U7YH 1IMHC 3GSXB 4JANA 3BD4A 5HJ3A 4PJHB 3UXFA 3IRPX 5EU7C 1M05A 5E6IC 3CFKA 3W9DA 4LSUL 4U1KB 2P5EA 1GIGH 2A9NL 2Y07H 3AMKA 1CS6A 2VUOA 5C1MB 4CKVX 1PYWA 4XP9H 4MQXC 1SEQH 2EE6A 4HPYL 2CIKA 4XGZA 4HS3A 3TBSB 1FIGH 2IPKB 3SKMA 1TXKA 2D7OA 5I6XB 3PIQB 5D6CB 3MBEC 1IEBA 1BJMA 5ENWA 1GZQB 4N8CL 2KZ1B 4CBPA 4Q7DA 3OAZK 3TH2T 5EU3A 5BS0E 5HDQH 2VITA 3WHE1 1OD7A 1TZGH 3OR6A 3M1BA 1WWWX 3QEQB 1IM3A 4P46B 5HHQB 4JM2B 2X4PB 4YHOL 1EO5A 2DIAA 4R7NB 4X6DA 2HVJA 3C6SB 3D39E 1WBYA 1HSAA 2YR3A 4U6HA 3RU8L 3C5JB 3IJYB 4X4XA 4M7KL 4WNQB 3VJ6B 4OI8A 4L8SC 5IVXB 4JG0L 3IVKA 4EZMA 4WI6A 2GSIB 3RWFA 1KB5B 1ZHLB 1YDPA 3EO0B 4YIQA 2BNUA 2EDNA 4CW1A 3V7MA 4XVJH 3H3KA 1UM5L 5EO1A 5DUBA 3V4PL 4ZFOA 5GGSY 3WO4B 1A9BA 5BVPH 1BD2E 2MNUA 1EJOL 3EYUH 1FL5A 3FQXA 3WD5L 1YEFL 4HGMA 4GSDL 1JMZA 4CVXB 4JPKH 4XWGL 3O6LH 1F90L 3TVMC 4JFYA 1PLGL 3WHE0 4PBVC 4HAFA 4JRXD 2C4FU 4F9LC 5IK3A 2XKSA 3JTSB 3MNVB 5HYSA 4TSCH 1D3CA 1NC4B 4I77L 4OLVL 1A3LL 5GS2D 4NWTH 3MJ6A 4V2BA 2X1OA 4UIMA 2F53E 3B9VA 1WIUA 4WRLA 4QTIL 3VXNA 5BO1H 5CZKA 5C6TL 3BSZL 4P5TA 2Q86B 2CDGA 5IB2A 5F1OB 4PGZA 4X5WA 1T7YA 2YXFA 3N85L 3T2PA 4XAKE 4HIEB 3BESR 3HLAA 2UVEA 2P5ED 4ONOA 1G6RB 4Y1AB 2J88L 2BVOA 5FUZL 4GG8B 4MMXC 4G6ML 1LO5A 2YEZA 4YFEA 2FHBA 3V95A 5KS9B 4LARH 3DJ9A 5EIQA 4B41A 5L8JB 3KXFA 1GGYA 2QHRH 4QF1A 2EXYC 3G5YB 1MI5B 4PGCA 4QHMA 2ICWJ 2OP4H 4WJ5A 1KB5H 2ZJSL 3BI9X 1C5DB 4CJ1A 3BH8B 1ZGLA 2W9DH 2C1PA 1H3XA 1U3JA 4LKXB 4H1LA 1U8IA 1GC1C 3BPCA 1UC6A 2CMRL 3VWKB 1BGXL 2DQDH 2F9BT 3MXVL 5I66A 3RPIB 3CIQA 4HEME 4M5ZH 4GOSA 4BA8A 3CU1A 5JMOC 1JZ6A 3UEZA 2PCPA 2UZXB 3QCUL 5JPMA 1E4XI 3BJLA 5DGQA 3GRWH 1S9XA 2P5EE 4O5LH 2W60B 3CLEH 1YMHB 5EZIH 3OSKA 3C2SA 2OTWA 1W72A 4N68A 1IBGL 5F7HA 3MYJA 2X4NA 4LNVA 1E4XH 3QFJA 1FO0A 4QXGL 4POZD 5DDHA 4YDLB 3BXNA 1TVBB 1P1ZB 1XGQB 3UTSD 2QKIB 1MCBA 1FORH 5DHVB 4GRLC 5F70A 2H3NA 1QO3A 5E5MB 4TNVK 5CLTA 4HSQA 2VR9A 1NSNL 3MNZA 2WINA 1JGLH 1G6RH 1FJ1B 1TDQA 1FZJA 1A6TA 3CFCH 1NCAL 5CD5C 5J6HA 4PRPA 3TYGL 4HJGA 3MJGX 1LE9B 1KN2H 3PG2A 5HHOA 4UINH 4W6XB 4X6DE 1IZJA 1BFSA 1R24B 1CDBA 5EOTB 4CU8A 1UFUA 3L3IB 4G6KH 1TJIH 3P73A 4E41A 4UILL 5CBEA 4JY4A 1WAAA 5I8EB 4PUBH 5CCKH 2R0KL 2EC8A 4P99A 3WYRA 4X7FC 4NQVB 2C5DC 3TIEB 4P2CG 1SEBB 2NZ9C 5J7CC 2UV3A 2Q76A 3WKNA 3X14B 1MLCA 1HH6B 2B7DT 1RHFA 3WL9A 1IM9D 5JDJA 5IWLC 2A9ML 3NZ8B 2IBZY 3KXFD 1KB9J 3EDJA 1A1NB 1S8DA 3EOBB 1KCUH 5C0FB 3DO7A 5J4MA 3X3FH 1KCRL 3D0VA 1NC2B 3BPOC 4ZO9A 1JNNH 5IMMB 4D2NA 1CGUA 4F37K 1H3PH 2CDEB 2WM0A 3BPLB 3GSNA 2J3SA 1FGNL 5BRZD 5JXEA 3SO3C 4Y1AE 4HKZA 3DETD 4FQCL 3RVWD 1KULA 5TE6L 1OAUL 4ELMA 1UYWL 4FQQA 5T1MB 3KPPB 2NY0B 2R1YA 3Q48A 4LLVB 1KG0B 3VD5A 2UWEF 2CGRH 3M8OL 3GSRB 2EKSA 5DJXB 4N1EA 2O61A 1UH2A 1Y6MR 4OT1L 2IQAB 3AB0C 2K1MA 3AY4C 1CLYH 5DA0B 1RJYA 4XCYB 4CVUA 4KHTL 1JNLL 4Y5VC 3VFVB 3QFJD 4MA3A 3FB8A 3QBTB 4N8PA 1NEZB 5DQ9A 4PD4K 3SCMC 3KG5A 3RAJL 3QDAA 3BUYB 1DUZB 1MFDL 1N7MH 4QHKJ 1C1EL 5KOMC 3ZO0A 4GKZB 2F54E 3PABA 4YXHL 3IDNA 1NBYA 1I1FA 3GJFA 4IIQB 2VZSA 2FR4A 1FYHB 4LCYA 5KBNC 4PRPD 4S1DC 4XBGB 2G5BB 4EIZC 4P4KA 2C4XA 2PYEE 2P8MB 1I1AA 5HHOD 3LDBB 3MV8B 3L5HA 4RFEB 1A64A 1F6LL 3CFBB 1HCFX 5F7MC 3O11B 1KCSH 4OV5B 2H26A 3GMNB 1SJXA 2ZG2A 1FV1B 4S2SB 1L6XA 2YUXA 5IQ9B 2E6PA 2J5LC 4X8JA 4KVNL 4F80A 2X4QB 4G3YL 1EHNA 4YE4H 4R4NC 3HZMA 4HX1B 4EI5B 4UI2A 4F7CB 3QUXB 2CLRB 4J8RA 3UROR 3QUML 1U3HD 4XMKL 5T1LD 2J4WL 4X0KB 4CMHB 3LY6A 4MQTB 1CE6A 1MHCB 1S7QA 3TO2A 3IDIA 5D7JA 2DQUL 1T66D 4PP1C 3NFNA 4JLRA 1AR2A 3EZ8A 4PTTB 3GSWA 3NMEA 2MFNA 5CGYC 4PRPE 2Z93B 3L3GB 3MR9B 3TNMA 1L9MA 4J2XA 4YPJA 4ZQKA 4DCQB 1RSFA 2IQ9H 1UQSB 5BQ7A 4Q9RH 5ADOL 1ADQH 5JXED 5HHOE 4PRIA 4OLYH 3TP4A 3QRGH 2D0HA 3LAFA 4OIIL 1JNJA 2EXWC 5ERWB 4E41E 4PGEB 1WAAE 2FEEI 4PP2B 1IC5H 2CK2A 3EKCA 1P7KB 4Y4FA 1J1XL 5FM8A 5LQBL 3HE6B 2VLMD 5GGRB 4EOWH 2I24N 1MJUH 1MCDA 3AM8C 2FD6H 3O81A 1P69B 4H20H 4NC1C 3S35L 3MRNB 2QADB 1AFVH 1PX3A 2R56L 4IJ3C 1IGFL 1NUDA 1RHHB 3D18B 2DQIH 5CEXB 2R8SL 3ROOA 3W82A 3JWNC 2D7NA 2FYYA 5C86A 5AD0B 3HZKB 4KXZI 5F3HA 3O3EA 1OTSC 5HI3C 2G2RB 4TOYH 1C12A 4HK3N 15C8L 4P4KD 5E2TL 1BMGA 1IE5A 3QUZA 5CEZD 1SJHA 4PLNC 2DL2A 1M7DA 4GS7C 4P2QA 1JWMB 1SYSB 5MHSE 1VACB 5ECJE 4JO4H 2CPCA 4F7MB 1K5NA 4DZBB 3MRJB 4OCLC 3N06B 1LGVA 3ES6A 4KROB 3PWLB 4NO5B 5KS9F 1QLRB 1DVFC 4XZUB 4AJ0A 1A7BA 2IPTH 2IG2L 3AS3A 5DQJB 1FDLH 3U6RA 3F7YB 3MRFA 3HC3H 3ECBB 4G42A 3Q5OA 3X13A 1DLHB 2XG5A 4LRNL 5H37G 3VXUD 5IF0B 3BFOA 5I17A 2Q20A 1HEZB 3BP5A 5MEOB 5D7JD 3T4YA 2NQCA 3WO3B 1R3LB 4NUJA 3IKCA 3OX8A 1IAKB 3PWPE 5K9KA 1A7QH 4TUKH 5HGBB 5C08E 4PRID 4FQXC 4PJ5B 2Z4QB 3WIHL 5DMKB 5TQ0L 1IGCL 2X4SB 3NA4A 3ARWA 4MDJB 3QUKB 3GMOB 5TDOA 5EDXA 1DQDH 3LB6D 3H42L 2P4AB 1VPOH 4NCDA 3L3KB 4RGNE 1ZKAA 3D2UA 5FOBB 3ZZ1A 1I8MB 1BX2B 4HC1A 4RISH 4ZG1A 1U8HB 1MFCL 1LILA 1D9KA 1YN6A 4LEOB 2DLFL 3QDGA 2C3WA 2MPAH 4DZ8B 4JGMA 2APWA 1RIVL 5DURB 2NW3B 5DJDB 1S5IL 1F4HA 4TN9A 5I1HL 3QG6A 2F15A 1WV7T 1N2RB 2DQTH 2NY5L 3QULB 2BOBA 4Y5YA 3DRTA 4PJ7A 4H26A 3TWCH 3T2NL 4P4RA 5D1ZC 1W0WA 4E9LA 5T1KA 1AKJA 4P2QD 3TCXA 1LP9F 2VKWA 1BVKA 4BZ2L 3ARDA 4I2XE 4JN1L 5D1QB 3FT4A 5CJ5A 1Z0NA 3MRKB 1A1MA 1E28A 3QPXL 5T33L 4N90D 1EMTH 1RJLB 5DJ2A 4D9RD 1WITA 2XZAH 4GT7A 1KT2A 2Z0BA 5DRZB 4ZUTB 4A6YH 5GZOD 2Y36L 4L3CA 2WK2A 3QNYA 5F72S 4EVNA 1UM6H 4TQEL 4QGTA 2KZWA 1BQLL 5BZDB 4P2RD 2AI0L 2R2BA 3RA7L 2Z91B 3QDHA 5CP7A 1FZMB 4APQA 3GMRA 4HJJH 1WZ1H 1OAXH 4FTVA 3IB4A 2Q7YB 1H3VA 3VGDA 1U8QB 3B6SA 2G60H 5F6IC 3EW3B 2AJVL 2ARWA 1Q9WA 2NTFA 5JHDB 1XZ0B 3BOVA 5MI0B 1NFDB 4J6RH 4LCCA 2EYTA 2ZPKL 4P2QE 4XCFL 3WJLC 4F33A 1FNFA 4LHUG 2E6JA 1F6FB 3CC5A 4XXDB 3LN4A 5CZVL 4LLQA 2FCBA 4HMDA 2AW2A 3O0RH 3ULUD 4N90E 3BAEH 3DI3B 4FMFA 2ZUXA 1JYNA 1AHWB 3VWJC 5D7LB 4U6TA 1A0QL 2G5RA 5FUOL 5HY9A 1D9KD 3KLHC 5HVHC 1A3RH 1K2DB 1KTLB 4WFEE 5IG7B 1ACZA 4PB0H 3CSYA 4IMLB 2V2XB 1CGSL 4TTDC 1I8IB 4K3JH 3RUGB 5M95B 4UQ3A 1ZSDA 1S3KH 1P2CB 1KF9B 1RZJC 3TH3T 2JK5A 5E6IA 4C83B 4F58L 5L7XL 2B5IB 4M1CD 1A6AB 3LEVH 2ED7A 4D0CB 2WUBH 4UV7H 2OL3A 3OR7B 2AEWA 4K3DL 1DANT 3E2HC 5T1KD 1AKJD 4UIKL 5EA0H 2GAZA 3F7PC 4MXQD 3MRHB 3ARDD 5IB4B 5I30L 5EFIA 5E4IA 4QRPB 3MBEA 4P48A 3SY0B 1HXYA 1Z3GL 4HV8B 5I71B 1OGTA 3F7RA 3GIZH 2VE6A 3KLAB 1XR9A 2FX9L 3CVHA 5GGSA 4JPWL 1S7UA 3C6LB 3MLXL 3QJFA 1YEIL 3Q2CA 1G1CA 3QDGE 3JWOH 5FYKH 4NZDA 4LLUA 1UGNA 3LEYH 4K7PH 4NO2B 1YNLL 1ZXQA 2WWKO 4QY8A 4HBQA 4L8SA 5B39A 2AXGA 5IW1A 1CXKA 1IAIM 4O9HL 4FTVD 2FLBT 5EBWA 1CG9B 2PW2B 4PJEB 2HJFB 3RL1B 5T3XH 3N0PB 2UY7A 1OW0C 2FHFA 4PJ7E 4QRQB 3L95B 1YNKL 1DQQB 3SGJC 1GGCL 4G7VL 4BFBD 3K3QA 3G6DL 4P5KB 4I5BB 4WTWA 4X6EB 4TSBH 4OF7A 4RWYH 5EO0A 3ARBD 3H2WA 5E2UH 3WFDH 2IANA 2WWKT 4MZ2A 3TVMA 4HXAL 4FQLH 1T7VA 4ZTPL 4F9LA 2ADGB 3GBML 5HGHA 1F58L 1JHKH 4TVPL 3OG4B 2FZ3A 3QPQD 1AC0A 5DD1L 3ZDYE 3GI8H 4PLOB 1VFBB 3LD8B 3DXAD 2HH0H 2GSGA 2OL3H 4PJFA 4KK9C 3P40A 2V7HA 4JVPA 1JZ7A 1MPAL 1TVHB 5DJYA 4XNMB 5EU6B 5E6ID 4OCSH 3WHXB 3GUTB 3V52H 3QQ4A 4BK4A 1MF2H 1BOGB 4N0YH 4PJGB 4GAJH 1N3NB 5D7LE 1U8JA 4S1SH 5JOPD 2IALB 1K9TA 2BERA 1QFPA 1TJHH 5T3XE 3S6CA 2L7JA 3HG1B 1T20A 1PGRB 1NAMA 4Q6YA 1TZHB 1G0XA 5T5NF 3MBED 4ZNEA 5ITBH 3U4BH 1ZLVH 4H5SB 1LE5A 2PUQT 4PY8I 3TA3A 2O5ZL 4FP8H 1RZGB 4OLZH 2APFA 2AJUL 3V6FB 2C3GA 4XP4H 3RUGE 3QH3B 4S0TD 3LRSB 4XAWL 4X4YA 2BCKA 3N9GL 3IDGB 5FEBA 5DT1L 4HWEL 4X6CF 2VDQL 3AREB 2HP4A 2JB6A 1VGEH 3X11A 1DQML 5CHNB 3HI6L 1NLBH 4U2ZA 1L9NA 5F9WB 1T22A 4NBZB 1X5LA 5FB8B 4UB0L 1ZHBA 3W0WE 2MCPL 5DVNA 1R5WB 3QHZH 3TBTB 1NGXB 5CJOH 4L3EE 4LHUA 4KJYB 3LQAH 5KVFH 4M7ZB 5EZLA 4P3WA 5E08L 3T4AB 3T2OA 1SHMA 5L2JB 2F5AH 4GRLA 3ZHLA 4G9FB 4OTXH 5ESAB 1PSKH 3JWDH 4M8QA 4G6FD 4KUCF 2DQHH 3QXDA 4R97B 1IGTA 1D5XB 1HHHB 3MRIA 5C0AA 1XFPA 4Z8FH 3HZVB 4TSCL 1IC7L 1U93B 4JAMA 4LPTA 1AQDA 1D6VH 3CVIH 1JPGA 4NWTL 1KTKE 4CU6A 4AY0A 4G5ZL 4MA1B 5E8NB 1Q0XH 1IAOB 3PGCB 1A2YA 1NCUA 4OF0A 1M71A 4QRSA 4JFFB 1VKXB 3HMWL 1TNNA 4H88L 3HPJB 5BVJB 4LASH 3IDUA 3HNTL 1YPZF 2BDNH 3BT2H 5DI8A 4OCXH 3RVUC 2GUOA 2RFXB 3SEPA 3U9UA 5IWLA 2AV1A 1EO7A 1Y6NR 4HUUB 3SQBA 3KYMA 4I0CC 2JJUA 5D2LB 4ZSOA 2EXYD 1WZLA 5GSVA 1AXIB 3SKOA 2WWMC 3EJYC 2IANE 4U1GB 2A6IB 4NRZB 5DD6A 3O2DA 4LOUD 4PPTA 3DVNB 4GKNA 2Y5TA 3RRQA 4FQPA 3BP7A 5GJTH 4KC3B 1G6VK 3QFDA 4LLWA 5CP3A 3CFDB 3PF2A 3VGAB 3VD7A 3O3AB 4M5ZL 2X5PA 4YPGA 2BNRA 4YO0A 4JY5H 1VA9A 5IV2B 4PJFE 2HFTA 1J18A 3ZHDA 1U91A 1QFWH 4L4VA 3IFLH 3JV4A 4M5YL 4OLXH 4OSUH 2YK1L 3V0WH 2PO6B 1EAPA 1X5FA 5DK2A 2H45A 4MD5A 3FMGL 5CINL 3NN8A 3AY4A 3UTTA 3TV3L 1C16A 1UCTA 1Z9LA 1E4XL 4LHUD 1MJ8L 4G9DB 4ONFL 4YHMH 2GW5A 3VFSA 4Y5VA 4OFVA 2I27N 4R3SB 3MREB 1MWAB 3RWEB 1P4IL 3SCMA 4GRLD 3AXLA 1HXMA 3SDDD 4WUKL 3Q1SH 1JZ3A 2FJFA 4OIAA 3LS4L 1EGJH 3WS3A 4GAYA 2LU7A 4XH2B 1ORSA 2CIIA 3FONA 3GJFK 2ZG3A 1BVLA 1A4KB 5C0AD 3ZDXF 3U0PB 4MJIB 1WZKA 4JHAH 5IW3A 1MAML 3VI3F 1IJ9A 1CVRA 1AP2B 4JRYB 4GXVH 2OZ4A 3LHPH 4AQ1B 2DI8A 4QYOA 4G6KL 1EIBA 1INEL 5H94B 4EBQH 4NN6C 1OGAA 2DAVA 1SJEA 4Q58C 3K0WA 5DJAB 1FL3B 3WE6A 1BIIA 4NKMB 1MCFA 3A6OA 5LWYH 1IFHL 4FQ1H 4HKBA 3BN3B 3UBXB 1JVKA 4ORZC 2Z31C 5FM5O 2I07B 2CO6B 3E6HB 4OKVB 2NZ9D 3VW3L 3KJ4B 2KH2B 2VWEE 1V7NL 2BFVL 3OKLA 3HS0B 1TZIB 3WNKA 3QHFH 3L3JA 1S9VA 4TNVF 5IFAH 2HAZA 3LN5B 3L3DA 1YEHL 3VMOA 2XRAH 2RCSL 2YZ1A 4ZFZB 5I18L 3FO2A 3RY5A 4XRCB 4Y2DC 4JG1L 4ZMAT 4D0BA 3T0ED 1PKQA 5C0AE 4U1JB 4PJXA 2VISA 4W81A 4JFFE 4O51B 4ODWB 2EH8H 4WU5B 5GGVL 5MEPA 1FVDB 2EDBA 1C08A 3O2VL 5IT2L 3REWA 2WMPA 2Z8WC 5EOCH 4Z7VA 1X5JA 1YNTB 2BNRD 3BP6A 4U7SA 2HFEA 4L8DB 3CX5K 1MCCA 2XZQL 1NEUA 3ZTNH 5GRXG 3GIVB 2ICEA 1GZPB 2HWZH 4OFYD 1CLYL 1QHPA 3VXMA 2ID5A 3P9LA 4JGJA 4HG4J 5GS1B 1IC4L 3EDEA 3AM8A 4JB9H 1JI2A 4NQTA 2VDLH 5D70H 4GMTL 4LPYA 4RSVA 4HEPG 1QSEE 4U33A 3BDBA 4IMKC 4ZSOE 3SCMD 3KWWB 3BDYL 5TDNB 1PQZA 3S36X 4F37F 1FNAA 2DKUA 4WENB 1LEGA 1P5UA 3K4DA 2GY5A 4HUXA 3QEUB 5D96B 4PGBB 4S1DD 1XF2A 4IOIA 1Y18A 2ADFH 5JIIA 3RWHB 3G6AA 4Z7WF 1OGAD 4PJDE 3T77A 3OAYK 3NZHH 4M1GL 4U3HA 4MB5A 2IH3A 1XGPB 4L4VE 5CSGA 1CXHA 4G8EA 4PJGF 1ZA6B 5GGQH 4I9WD 4G8FA 4EXKA 3UTTE 1DVFA 4XPBL 1NAKL 1XR8A 3GEWB 4JRXB 4LF3A 4X80H 3O3DA 3QNZA 4G43B 4MJIE 5EO9B 4MCYA 2HRPL 1WK0A 4JREB 4TUOB 4AIOA 4WUUD 4UT9H 2HKFH 3LS5H 3V5HB 1PX4A 4DN3H 2QHLA 4NYLA 1B2WH 3V5KB 1I3VA 1Q9LB 3QJHA 4PY7B 5E8OA 3ARTA 5CGYD 4UDUA 5T3ZL 4WWKD 4JANB 5HJ3B 3AMLA 4UUJA 5DMYA 3CFKB 3W9DB 4ELKA 4FQXA 5I75C 5F8QC 5JDSA 1X5ZA 1OCWH 5LAXA 4U05A 2EXWD 3SOBH 1RJZB 2D03L 2R0WH 1KN4L 4Z95L 4NQDE 4ODSH 4NJAH 5HYIA 3SKMB 3MRMB 2DQEH 1AGDA 4NUGH 4HH9A 5MENA 1IEBB 2FLRT 1UCBH 5ENWB 5TGBA 1LMKA 1A6ZB 3FL7A 3GJEB 2NY3C 5DS8A 2VLLB 4ZFGH 1DFBL 3QUYC 4LPWA 5FECA 3AS0A 4GW4B 1I7ZB 2IPUG 1QNZL 4NT6A 3SDXE 4P49A 4OLUH 1AI1H 2HJLB 4V1DA 1HSAB 4U6HB 2YN5A 1PKQE 1RUPH 2DLHA 2Q8AH 5D1XC 4PJXE 4J1UB 2VXTL 3IVKB 1JYVA 3QA3A 1OTSD 4F3FA 5HI3D 2HT4D 3FT2B 4LVNB 3I3EA 3MLVH 5D1ZA 2BNUB 4DOHE 5EH1A 3DPBA 4CW1B 5CBAA 2D0GA 2W0FB 4RFOH 2VLRE 4LCWA 3N1FC 5EO1B 3C08H 4FZEL 3UTSB 2VUYA 3FQXB 1CDIA 3MA9H 4PGDB 2YHGA 3VXME 1WC7B 1AR1C 1EK3A 1MUJA 2JIXD 2PYFB 3WNMA 2BXZA 4XCNA 1QEWB 3VXRB 1KACB 3CFIC 2BZDA 1AXSB 2CUHA 5C0GA 3SQOH 3MLSL 4PRDB 3KS0H 3ORJA 4MGXA 2C7UA 2BHYA 5HYSB 3MCKB 3D3VD 3KPLA 4NPYA 3MMEB 4Y16C 2DYPD 1CVSC 3HE7D 5DZLA 1JWSB 2GTWB 4NC0B 4GW5A 4UIMB 5ETUA 5KJRL 2VQUA 4JN2A 3S5LB 5I8OH 5FYLD 1IILE 5JOFA 1OSPH 3T0DA 1FNGB 3FFDB 4GW1A 3QXVA 4OZGF 4TNWK 3HLAB 4FQXD 1RURL 2BSSB 1IAIL 5DMGC 4HT1L 2BVOB 1MCIA 4HQQH 3WJLA 2HT3C 2YC1B 2YEZB 1A6WL 5EBGA 5FGCE 1IM9B 1JUFB 5DO2D 4XVUC 4I13B 1EO8H 1FVEA 4OGYH 3KXFB 1UB6A 2KKQA 3D69B 4QHMB 2X40A 1N0XH 3VWJA 1M7XA 3NABH 5J9PB 3I02B 3QI9B 3MOAH 5C0RH 1OAZH 4M6AA 4WW1B 3DO3A 1B0GA 4H1LB 4YZFF 4DJMA 1A21A 1YUHB 3LKOB 2QQLH 4X9BA 2I60L 1JPSL 3TZVC 5F88B 3TH4T 5HHXH 4OB5H 2ITDA 5BRZB 1U8KA 1I1YA 2Y06L 1FNLA 1I9RH 1HKLH 4U49A 4DQOL 4V1DD 4AIZB 5EOQH 2WIMA 3O9WD 2RGSA 3C5ZC 5KVDL 1CL7I 1WLHA 4M4RA 1NCWH 1DEEA 3MOBH 3VFNA 5JPMB 5H35A 3VGGA 1CGWA 8FABA 1RIHH 2PETA 5D1ZD 4LPVA 4R0LB 1QSZA 3CAFA 1MQKL 2P8LA 2IBBA 5DFWH 4LCWD 2E5EA 1U8NA 2OTWB 1RK1B 1CL7H 5TPWH 3RNQA 1RVFL 3MRBA 3QFJB 4YBLC 5C09A 2CRZA 3BXNB 5JW4M 1NUGA 4NZRH 4LLDA 1FH5H 1MRCH 4XPAL 1TITA 3P77B 4KUZL 3MNZB 5MENE 4C57C 4KZEH 4KMTH 4YQXH 3T65B 3H3PH 1ZLWK 2PR4L 1FGVH 5J6HB 4I8DA 1YY8A 5L0QC 3T0XA 4RDQG 1AQKL 1YJDC 2RHEA 3IU3A 5BW7C 2EIDA 1J0JA 4LCIH 1C5CL 1C5BH 1RZ8A 4CL7A 2CRYA 1KLGA 2G60L 4HWBA 2EYRA 4JY4B 4ETQA 5EZJA 1OW0A 1ZVHA 2W0LA 1JRHL 3ZDZF 3QEHA 4X6BA 5AZ2L 3WIIL 3SGJA 2GJZA 1G9MH 1MRFL 5E8PA 5IIEB 3VXRE 1MLCB 3G5VB 3WL9B 3MLTB 3EFDL 1E4KC 4D3CL 1KEGL 3V8OA 1LO3L 4UNUA 4ZUVA 4Y4KC 1U3HB 5T1LB 3DO7B 3VWJD 1TLKA 2LU4A 4FQ2L 1CFQA 5JTWA 3NA9H 3VH8G 1CBVL 3U2SA 4MNGA 3NCYP 3RY6C 3KLHD 3LPGA 2R0LH 5TH2A 1T0MA 1NGQL 4QO1A 1JGEA 1HDMB 2VL5A 4N8VB 1BFOA 4YDIL 3GSNB 4XHQA 4ZFFA 1UACL 4HKZB 3WMSA 5DXWA 4TTDD 4XP1H 4ELMB 4FQQB 3QNXA 4LIQH 2VDOL 3DECA 4OLWL 2WUBL 2R1YB 4DGVH 1N6UA 1H8SA 1NKRA 2EKSB 5J6GB 5EIIA 1GVIA 4NC2B 1WFTA 3NAAL 1RJYB 2DLGA 4HK0A 1L0YA 3NPSC 1CD0A 5F8RC 3FB8B 3BQUC 4MSWB 2ZZUT 5C09D 4RFNC 3CMOL 3TPUA 5EBMA 3DHMA 1SM3L 5AEAA 3FQUB 3IDNB 4KI5C 4GRMA 1U92B 2XPGA 3WIFA 5E7FA 3QO1B 5E1AB 4K7PL 3QEGL 4P4KB 5GXBB 5AAMA 2DWEA 2R15A 3GSUB 3HI5L 4I0KA 2W38A 3WNOA 5FA3B 3BW9B 4YNYA 1S9KC 1OAYL 4B5EA 5IOPA 3FJTA 4NJ9H 1MCJA 1EBAA 2XICA 2H26B 5F1SA 3THMH 3T3ME 1V7ML 1VADA 2IGFH 1S7VB 1GL4B 1WQVT 3HZYA 4KY1H 3T04D 2CKBA 4LIQE 4X8JB 1HHKA 12E8H 1MFEL 5MERA 1ZS8B 5F9OL 4YAQA 4XNUL 4NRXB 1DANU 3I75B 3WUWG 1ZMYA 5LGJA 4NQEA 1JHLL 1J0IA 1QBLH 4X9GA 4J8RB 4JFPB 1MHEA 1A5FL 3HFML 5IESH 3VXUB 2OBGA 1CE6B 3TO2B 3IDIB 5KTEL 1J8HD 5FCSH 4WHCA 3S37L 2BC4B 1O7VA 1AGFB 2JJTC 4X6DF 3TNMB 2B8OT 3L5XH 4ZQKB 1AD0A 1I3GL 1TPXB 1KPUA 3PXJA 4PRIB 3NGBB 2VDNL 2ORBH 3GGWA 4Y4HC 4KK9D 1BREA 1OB1B 4N5UA 1ONQB 4M62L 1FSKB 5INDB 1VERA 4ORGA 5CSZB 3UZQA 4BQCA 4PRHA 3H9SA 3VXOA 4PBXA 4FFYH 3EO9H 3D25B 3ULSA 4JZOA 4JZJC 3E8UL 4BQ6A 5CEZH 1ZHKA 3C8DA 5ISZA 4WV1C 1DBKH 2AJYH 1W0VB 5CS7A 2GHWB 3U4BL 5ITBL 4JO2H 2V5SA 4GMSH 2VR4A 4HIHA 1SMAA 4KJWC 3I2CL 2B2XH 2DTSA 2XZCL 4PY8J 5FV1L 3BP4A 4A2LA 1QLFA 2W0KA 3PV6B 3LMJH 1FZKA 3EOTL 4MNGE 1ZGLM 5A40E 2LE9A 6CGTA 4HWUA 3MJ7B 1NGWA 4DKEH 4M43H 4B0MM 5D4QA 3L5WA 4JJ5A 4BELD 2O93L 1KLUA 5I19H 2OK0L 1DN0B 3LH2H 2FL5A 1H5BC 1SJHB 4U1SA 2AERT 3A6CH 1GGIL 1PZ5A 2NY7H 2B4CC 1MIML 2Y25A 3MGTB 3EYVA 1NJ9A 4YXKH 1LNUA 3TYFA 4NKOA 4M93B 3MBXH 4HUWA 4K94H 1S9YA 1IGMH 2VH5L 4QCIA 5KVMC 3VFPA 2F5AL 5IBTH 4K9EH 1LK2A 1U3ZA 4RGMC 3IDYC 4BH8B 3TBWB 4JPIA 1ZLUH 4P2RB 3PP3K 3OKYA 4NQED 4MA8L 1UENA 1JYXA 5C0CA 2YD4A 2H1PL 1A3QA 3FN0H 4BKLA 3T0WA 3BP5B 3TCLB 1DLFL 3MV7A 4HAGA 3BKCL 4NUJB 5KW9L 2FSEB 1KLFA 3ARPA 2F58H 5K9KB 3MUGB 4LVHC 2FNBA 1BEYL 1MREH 1S7WB 1X44A 3MNWB 1EZVY 2HVKA 2V7NA 3WLWC 3K8KA 4H8WC 5EBLB 3NIGE 43CAA 4G8GD 1Q94A 2I5YL 3I50H 2VRAA 2MTPA 4KAQH 1A6UH 1CFBA 5FO8B 2CD0A 4DGIH 4KZDL 2Z31A 4U3XA 5IM7B 4L8CA 4OZIB 4JFDA 3MFFB 3IXTB 1URLA 1T1YB 3H9SD 3RVUD 3S98A 5CD3A 5DC4B 4MD4A 5JQ6L 1TCRA 5ISZD 1NCCL 3HNVL 1YN6B 4LSRL 2ESVA 3LZFL 2VLJD 2WWMD 3EJYD 1QQDA 4Y2DA 4DTGL 3UTQB 4L9LC 4OM1L 1D6EA 3UTPD 3VFTA 5F3BB 1FVCA 3MJ9H 1A47A 3QG6B 1NCDL 3HRZB 2WAHA 4U1MA 4LSVH 3SDCC 5DD5L 1EVTC 4OQTL 4P4RB 1W0WB 3UYOD 3CMGA 1WAAF 1RZKH 3VE0A 1UH4A 5F9JA 2OYPA 1VFAB 5T1KB 4CAGA 1INQA 3V4UH 1AKJB 1S78C 5E2WH 4LVOB 3CH1A 3ARDB 1T21A 1ZANL 1A1MB 2XT1B 4MXVF 4PRHE 3RZCA 4QHLB 4JQXC 2X1WL 5TFSL 2ENSA 2MJWA 2X1QA 4L3CB 1I7TB 3QNYB 4EVNB 3WUWA 5ISZE 3QRFM 4LP5A 3Q1SL 4HUKB 4IMKA 2VZVA 1WFNA 2NX5A 1INDH 3BZ4B 3FO9B 2DWDB 3GBNL 4DW2H 3BKJH 1A1OA 4N0UB 4S1QH 5C0CD 4XPTL 5GRUH 2Z35A 1N5YH 3MV7D 4FTVB 2M1KA 2NLJA 4MXWL 3SDAA 4I0PC 4L1DA 4PJ8C 1A7PH 3F12B 4QHNA 4UV4H 4ELMF 5EORL 3PGDA 3RWCA 1DUYB 3ULVC 4ZDHB 4F33B 4JDVA 2CKNA 4PJIB 1IGJB 3CC5B 3ARFC 4GH7B 3LN4B 4KGLA 2Z31D 5EIVA 4LBEA 2BVUA 2MWCA 3ARBB 4JFDD 4DKAA 5CJQL 1GGTA 4LSTL 5ILTH 3AGVA 3OKNB 1LVEA 2MQ3A 3S36L 1YECH 4QOKA 3ISWA 1OOAA 5DRNA 5MEQB 1L0XA 5D2NE 1U8LB 1G7LB 1P4LA 5FYJE 4RGOL 4M6MH 4YR6A 2JE8A 1B9ZA 4KH2A 4CVZA 1U9KA 3OJDA 3ZHKA 2PXYB 3MSPA 4Y2DD 4ZTOL 2ZOKA 5EOCJ 3DXAB 3N1PC 3TJHC 1PBYA 4WHYG 1REIA 5AUMA 5ICXA 5DJ8A 2FX8L 1WF5A 4G8IB 3F7VA 1MWAL 3NCMA 4KDWA 5A2IH 5E6IB 2CXGA 2IWGA 4NZTL 4Z7OE 1A14H 2DICA 1FG2A 1FNSH 1HINH 3L3HA 5IEHB 2GITB 1WVZA 1QFUH 1HYSC 3OMZA 3Q6GH 4OCRL 5E99H 1FPTH 4PRBA 4AL8H 1EERB 1LHZA 4DUVA 2UYLB 5EFIB 1MCNA 2VSCA 1CFNA 5IEKA 1N6VA 4L5FH 3N50A 3LV3A 2EICA 2JTDA 1D5IH 1XF3A 4UZGA 3RDTD 2X1PA 4LK4A 4PJBB 3QUYA 3CX2A 2XKNB 1S7UB 3QIBC 2ESVE 1T83C 3QXWA 2NX5D 2GCYA 3F7QA 3FFCA 4JDZA 2BVQA 2HFFA 3TO4C 3U7WL 2V9RA 4U6YA 3U30B 5D1XA 2FB4L 2O26U 1EFXA 5B39B 2AXGB 4JO1L 2J8UA 3V7AG 3BISA 4HULB 3F65A 4K8RL 1J1PL 3T0BA 1RULH 1XIWD 3KAAA 1LK3H 4GAGL 5E7BA 4RMRA 2Z9TA 3DV4A 4Q0XH 1MOEA 1E6OL 1KEMH 1JPST 4XTRC 1HZHL 2FIRT 4MA7H 1JGDA 4JQIH 4F7EA 5B8CC 3NTCL 5D8JH 5KVEL 1MJJA 5I8KH 3A67L 3ZE1E 3EHBC 1OP5H 1OL0A 5J1SC 3EDKA 1S7SB 3JTTB 1JTTA 2E9WA 3GKWL 1UB5B 2NCMA 4OZHA 4QOKD 1FBIH 3RBGA 2X70B 4KTDH 5ICYA 2YUZA 1CK0L 2HN7B 3B43A 3E0GA 1R0AL 5HGHB 2O5YL 3OWEA 1B2WL 2X6MA 4ZAKB 5I73C 1H3UA 5GS0C 2VTFA 3WFBH 1BP3B 1N59A 3PWVA 5GJSH 4QNPF 1A02N 1AC6A 2A77L 2I25N 2V7HB 2I9LB 3UJTH 1X5HA 5DJYB 4FFVC 5DMIH 1OCWL 4TRPH 3E6FA 4NHCH 1QR1A 2P43B 3DIFB 3FRUA 4RMSA 5IGXH 3VDBA 1WWCA 2AQ1A 4ODSL 4WO4C 5EWIL 4MD0B 4JKMA 5C9JB 5EZOL 1A4JA 3KYKH 3V0VA 1V3LA 3HI1B 2YD3A 2CO7B 2OJEB 4QHUB 1RZFH 3VGHA 2R23A 1GAFH 4OZFG 1RPQA 1RK0A 2XXMB 1B6UA 4TUJB 3W5MA 1KJ2L 1IQDB 1G7IA 1UWXH 2NY3D 4CU7A 3K74B 3QUYD 4Z7NE 5FOJA 3TZVA 4B7LA 2ADJA 3KPRB 2WNGA 2DQFA 2E8YA 1NFIB 2ITCA 2VAAA 3SPVA 3R1GL 2WIIB 5GSRA 2V9QA 3CLFH 1WTGT 2XN9A 4NO0D 3G5XB 2Y6SC 1I3UA 3AS1A 3C5ZA 3U1SH 3C9NA 3MLVL 1T22B 2H9GB 4Z9KB 5SWSA 1KV3A 5A3ID 1YMMB 1ZHBB 1HKFA 2A0LD 4EI6A 3B8YA 1Q1JH 4NNPL 3DSFL 4D8PB 4LHUB 3JUZA 2VXSL 4Z5RB 4QGYA 1RUML 2Y72A 4PJBE 3ULUF 5EZLB 3L6FB 4Z7QF 3KS0J 4GRLB 3SDDB 4G7YH 1DQTA 2BRRL 5GGUA 2E3VA 3DI2B 4GLRH 3MLRL 3QXDB 5ALCL 3UYPA 2AABL 4R96A 4U1IA 2NXYC 4JR9L 2D7TH 1AQDB 4HFUH 3W39B 3QCTH 4NZUH 3TNNA 3G6JA 5BW7A 4Y16D 3S88L 3FFCE 2R4RL 3DX8B 1TJGH 1DBML 4WI2A 4I3SL 2R69H 1A2YB 4QXTA 4TSAL 4UOW1 2XV6B 2WBKA 4LGPB 1M71B 4YWGH 3EGSA 4PJ7F 2EZ0C 2PTUA 4HQQL 3SJVD 4IHOA 4WW2C 4Q2ZA 1JHTA 1A7RL 2P1YA 3C60C 2HT3D 2VDMH 3EYSH 3RIAK 2GKIA 1E4KA 3U9UB 3QDJA 4YHKH 2QQKH 1M4KA 4XVUD 1N0XL 1QFHA 5LXGH 4Y4KA 1B88A 5DFTA 5GSVB 2VYRE 3SGDI 3UYRH 5IBLC 4RAUA 3T0EB 1H8OA 4OZHE 4ZFOL 4X7TB 3RY6A 3BZEB 4OB5L 5DWUL 5GRYA 2IPUK 1J9CT 2AK4A 3TZVD 3CSPA 3V8CA 3KPOA 3WBDA 3ZDYF 3OXSB 2E7MA 3SGDH 5EPMA 1G9NC 5EOQL 3SO3B 1DQJA 3C5SA 1AGEA 2UY6A 4UOW0 4FZ8H 2EYSB 5IB1A 1LEKB 4IRSD 3DX9B 2XYCA 3ZKSD 1MY5A 1WIOA 1MLBA 2FH6A 1T0NB 3L1OH 3C5ZD 1KJ3L 1J1OL 1FNEB 5FHAH 3TT3L 5C0BE 1U91B 5C0EA 4TNWF 5CZXC 2SEBA 2NNAA 3CZFB 5DHYB 3DBXB 4N9OB 5IKCA 3AB0B 3NN8B 1CL7L 1E4WL 3TN0C 4YC2B 2X7LA 3IGAB 1GGBL 1KPRA 3C09C 4Y5VB 2V6HA 3BQUA 25C8H 4LSUH 2WBJC 2A9NH 3RL2A 4OI7A 4HFWB 2WBWB 1F3JA 1ZT1A 4EKXA 4WHYH 4HPYH 1ORSB 2X44D 1MCWM 4NP4L 2GJ6A 3SO5A 1BVLB 4XMLL 2BSTA 2IJ0C 5TDPB 43C9A 2EDQA 4AEHL 1T04B 4FRWA 4JHWL 1YMME 1LO0L 4PJAA 1KCVH 3FQWA 3DVIA 4BZ1L 3CUPB 1CLOL 2BY2A 1KTRL 3FQTB 4N8CH 1UXSA 2XN9E 2ZSWA 3QO0B 3HUJA 1OGAB 3WE6B 4FOMA 4P3CL 1BIIB 4R90L 4F7PA 1IEHA 1X9QA 4D9LL 4KQ4L 4LNRA 5F9AC 5SWSE 4HKBB 2YPKB 2YD9A 5HYEA 3TIDB 3MRLB 5KANG 5B3JF 3FB5B 4YHOH 4EN3C 1P4BL 3AU1B 3RU8H 4OAWA 1W0YT 3MV9D 5HHMD 4M7KH 2ICCA 2C3VA 2C1OA 4JG0H 1MEXL 2BNQA 4IRZL 4NQUA 4OZFA 3GDBA 3QDJD 1T5WA 3OKLB 2VZOA 4ODXB 4WUUB 3L3JB 4Y4KD 1ZOXA 2IAMC 1QSFA 2YUVA 3L3DB 3PHOB 3MCLL 1UM5H 3FO2B 1F97A 1W72L 1EJOH 4GRWF 4HGWB 2HFGL 1EUTA 3WNNA 2JJTA 3WD5H 3DV6B 1FO0L 4WWKB 1YEFH 4NQCA 4D9QD 4GSDH 1C08B 3BVNA 5BJTA 5DR5L 3PXHA 3P9MB 3BKYL 5F1IA 1F90H 3T8XB 1H0DA 1Q9KB 1PLGH 2XTJC 5IVZA 5D71L 4Z7VB 4Y4HA 3UJJH 2BXYA 1SBSL 3KNBB 2VAJA 5D9SA 5FO9A 1H15B 4KDTC 4I77H 4OLVH 1OP9A 3UC0L 1A3LH 3FOLB 5J1TC 5HYQB 5SX4I 4YXLL 4QTIH 1D5BB 3BSZH 4JZJA 5C6TH 4E42B 3I3BA 3D85D 3N85H 5I6XC 1UVQB 3F58L 1H3WM 4KHXL 3BQUD 4LU5L 1N64L 1FCGA 4LPCA 4IJ3B 2J88H 2H8PB 4ZS7L 3OGCA 5FUZH 4F2MA 5IHZB 2NY1D 4G6MH 4J3OC 2CR6A 2DS4A 3C8KA 4NWUL 2NY6D 5F7KC 2GJ6D 1UJ3C 3HPLA 4JM2C 3T1FA 4HCRA 3FQNA 2AK4E 1EUUA 1OARL 3STLA 4BSWA 4DN4L 1IC1A 2VO5A 1JPFA 3UO1L 4U7MA 2ZJSH 4IOIB 2EH7L 1JK8B 1LO4L 4KPHL 5HHVL 5I1KL 2AJZA 5KSVB 4P3DB 1H5BA 3QIUB 4PJFF 1SVCP 1CGXA 3V7AE 1CU4L 5D5MB 2WUCL 1BM3L 5HD8C 2CMRH 4P9HL 2DQCL 5SWQB 1BGXH 1JCKA 5JIHA 5I1AB 3MXVH 3D1MC 4G8EB 1S7RB 3P4NA 4OZFH 3GSNL 1NBVL 4WI4A 3O4LE 4G8FB 2JIXB 3X12A 2NTSP 3DROA 3QCUH 1AXTL 2DTML 2BNQD 3PDOB 3U46A 5JR1L 3CU7A 1AIFB 1QBLL 3CNKA 5DJCA 1QFWM 4MWFB 4MCYB 1P84J 3KVQA