4TVPH

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
232
structure length
228
Chain Sequence
QVHLQESGPGLVKPSETLSLTCNVSGTLVRDNYWSWIRQPLGKQPEWIGYVHDSGDTNYNPSLKSRVHLSLDKSKNLVSLRLTGVTAADSAIYYCATTKHGRRIYGVVAFKEWFTYFYMDVWGKGTSVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 30
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpH01
1HQRB 3BPOC 4ZSOB 1LK2A 2UY7A 4WI5A 4QRTB 5A3IC 3L95B 4MNGA 2GK0A 5EULV 3L3HA 1U8QA 3EYVA 5MENA 1ROWA 4GKSB 2G75B 5JW4M 5JW5B 3MRQB 2ERJC 4PJ8C 1T1YA 3P73A 3ES6A 2X4QA 3IDIB 3BP5B 5HXMA 2HAZA 4R26L 1NJ9A 5C0AD 4LVOC 2GUOA 4ZODA 4IDJH 4NQDB 2YS4A 4IHOB 1KIPB 2X4TA 5J57B 5T3ZH 4OKVA 2YK1L 1JFQH 4NO0A 5J12C 1UH4A 1AD0B 2PTUA 4KRPD 1BD2E 3RY4A 3PGFH 4MB3A 2FEEL 4OGZA 2H32B 3CDYA 5C08A 4YEFA 2YD4A 4L8BA 3QHFL 4WUUA 2OX5A 5GZND 3FN0H 5EIIA 5IT2L 1S9YA 3PDGA 3CZJA 3VD5A 1G0XA 1PY9A 1RMFL 4I4WB 3V6OA 4RMUA 4NKDB 5D7IF 5F1OB 3WFEL 1D5ZB 4J1UB 3GBNH 3FFCD 4HV8B 2ITDA 4YHIB 5DUPL 4RGMC 3ARBC 3BZ4A 4NBYB 5DT1H 5I1LB 3HC0A 5J1TC 5DD1H 4JG0H 2GSGB 4QY8B 2VXSH 3GSNH 3MLVH 3MRKB 2DLFH 4JRXB 4XPHH 1MI5E 4HQQH 4XMLL 5D1ZA 3RZCB 3AU1A 1MF2H 5TDPB 2HVKB 2OJZL 3CH1B 4RAVB 3S97C 2I5YL 3PGCB 4DJMA 4GQ9L 4ZOAA 4ETQA 3EJYC 2I26N 5FGBA 3BKCH 3ULVC 4KTYA 1F4YL 4FQIH 1LILA 4NQUA 4L3AA 2DWDA 2VLME 2AGJH 4U1NA 4M5ZL 2BNUB 2PW2B 1A5FL 1A3RH 4ORGB 4FQQB 2IANB 4XC1L 2A38A 2BNQD 4KZEH 3BEVB 4WDIA 1CTOA 4QRUA 2Q1EA 1NGXB 4GRWH 4KPHL 3W39A 1YECH 3U7WL 3GSWA 2QL1A 3QXTA 4YIQB 5D7JA 4XNZC 1U8HB 3OKLA 4Z0BL 3RL2B 1BX2B 1I8IA 5IB4B 3OSKA 4YC2B 5ETUA 5AD0A 4DFHA 5C0BD 2M8XA 4OT1L 5JDSB 1ADQA 5GS3A 4XPTH 5SX5K 5EUOB 4PJ7E 1I1AB 3V4UH 5KOVC 2YN5A 3DUUB 1RFDH 2IGFL 1X5AA 3DO7B 4I5BB 1SY6H 2Z8VC 3VFSB 4XPBH 4IJ3B 4QWWC 2WIMA 1MFBL 1LP9F 5DJCB 2EYSB 3FHQA 3RU8L 1R0AH 3IJSA 2ZKHH 2O26U 3PWUA 2YBRA 3KJ4C 3WHE1 5EN2B 3MRJB 4ZO7A 3BUTA 4PTUB 4NYLB 5I1JH 2Z93B 4TSCL 1U8JA 3QUYA 1B9ZA 1CXEA 5I0DA 4I13B 5DD6B 2BRRL 3BWUC 2K1MA 3STLB 2LU7A 5FYJD 1OAKH 5T3XE 1HI6B 4QXUL 4QRRE 4UIKL 1JPSL 3OKDA 4XVJH 1NBVL 2RCSH 4YHYC 3WUWG 2NY3D 1SVZA 1WZ1H 3T2PA 4D3CH 2OTUB 4QHKI 4QT5B 2ICEA 4X7TB 4YWGH 3QXVA 1A7NH 4JDVA 4N1EA 3GMNB 2Q20A 3QQ3A 1RK0B 4GAGH 4OZ4A 4GRLB 5GJTH 2PTVA 2OMBA 4TN9A 3QT2A 3QDJA 1UJ3C 3EJJX 5I17A 2X1PA 3GMOB 5E0QA 1HINH 4NC2B 4R0LC 1TETL 5GRXG 3LRGA 3ECBA 1N0XL 4CDHA 3QFDA 2NR6D 3MBEC 5EBGA 1SJHB 1FFQA 3QP3A 3AM8A 3MJGX 3O2WH 2VLKD 3PUCA 3TA3A 2ZSVB 1BOGA 4P5MB 1IGIL 5BXFB 1A1MA 2YUZA 4P46B 3HE6C 3L3GB 5GPRA 3P4OA 4HHAB 4TULL 3ULVH 1FZOB 4HGWA 3IU4H 1FORL 3WNNA 3P4NB 1JGUH 1LDPH 1ZK9A 3JWOL 5D9SA 2F8XC 1CDYA 4LCUB 3EW3B 4DUVA 1CDIA 2XACC 4GG8A 3E2HB 3LCYA 1U91B 5EC2A 2JCCA 5IMLA 3HI6H 3MRDB 1J10A 2QQKL 4D0DB 3ZT5A 4IOFD 4M6NH 5D1XA 1NLBL 5HHXL 4OZIF 5I1KH 1CL7L 1PQZA 3QIUB 2QTEA 3OWEA 8FABB 4KH2A 5J3HD 1JP5A 2DYPB 4Y5VC 5DJZB 1MJUH 1GXEA 1ERNA 3CX2A 1G9NL 3EO0A 1YNKH 5BV7B 1ZLSH 3I84A 3L5WA 1JNLH 4HH9A 1XGUB 4TRPH 1DANT 4Y4HA 3V6FB 4PP2B 2UUDH 1U8KA 3FQRA 1LEGB 2R0WL 4DAGH 3I50L 5E9DE 4OCMC 1EHNA 2BC4B 1OL0A 4A6YH 4P57B 2V6HA 1VGKB 3ULSB 5LBSH 5KG9A 1HXMA 2FCBA 2FGZA 4BQCA 3TVMD 3WHXA 4LIQE 3HLAB 4F33A 4N0UB 4PJFE 4PLKD 3H9HB 2HRLA 5EORH 4JFFB 5DMGC 1C16A 5E6IA 3SJVD 3LSOA 3LH2L 2CKBL 1CICD 2EXYD 3O81A 4HUMB 3V95A 3V52H 2VERN 3T3ME 2BSRA 4FN0A 5HHOA 1T21B 4HPOL 1BIIA 2VZVA 3CVIL 3DX7B 5KVDH 4FOMA 1GC1L 5JHDE 1N8ZA 1O7VA 5JPMA 4UQ3A 1KTKE 3VWJB 1IC7H 1EFXB 1RHHB 2NX5A 4X4XB 2VISB 4S1QH 3ZE2F 1JZ5A 1I1CA 3MRBA 3ELAT 4KZDL 2Z31C 3WNPA 1OTUD 3FB5B 4X6BB 3VRLF 3GBNL 3NABL 3UP1A 1ZT4B 4BUHA 4G6KL 1CFBA 4XH2A 3BE1L 1I85C 1PZUB 1T0MB 3C6LA 4N1CA 1DBKH 5IB3B 4YAQB 3OKNB 3HE7D 1NC4A 5I76B 5IW6A 5F1NB 1Q9LB 5D1QB 3QRGL 1UWXH 4FRWA 4KK6D 3K8LA 3WCYA 5CLWA 4K3EH 1VSCA 1QSZA 4W4OA 1B2WL 3NA4A 2DLFL 2AERT 5SWSA 4MQXD 4NZDA 1VA9A 1KIUA 4J3SA 25C8L 1DN2A 2BVYA 1TPXC 5I73C 1KNOA 2UVEA 5KSVB 1H3TA 1U8PA 4XNUH 1DFBH 3MA7B 5JQHC 1RZJC 3UTPE 1QRNA 5F3HB 5J13B 3PDOA 3QJFB 5FA3B 3S36L 1E4XH 2FX8L 1X4YA 3IJYA 5I6XB 3LN4B 5DEGB 3HG1D 4KZEL 3MJ8A 3W11D 5BJTA 4NN7B 1P69B 2ZNWA 1PBYA 3RAJL 3A6OA 4WEMB 5FYLD 4MD5B 1QG3A 4HG4J 3B5GA 5FUZL 4LLAA 2IPUK 1II4E 2BY1A 1F90H 1JPFB 1YEDA 3FT4B 1JYWA 2I25N 3ZTNL 3MNZB 3BZEA 1XF5A 4XPTL 1S9XB 2R0ZH 1D5XB 3V4UL 4Y1AD 1C1EL 5EUKB 3QNZB 1G7JB 1G6RA 3B9DA 4Z7UB 4E42A 4HIIB 3PWPD 2DM7A 3U7AA 1RUAH 1UKQA 4HT1H 3MRPA 3S9DB 1TCMA 1TVHB 2CKBB 4JDTH 4P23D 4QRQA 4XCNA 3VFPB 2DQIH 2HLFD 4LNVA 3SDAB 4PJCB 1JIBA 1JPTL 1JRHL 3TN0B 4X5LA 5ACZB 4MSWB 3WO4B 1NMBH 5FF6A 3MUJA 4AIZB 1ULVA 1N26A 1IEAB 2PXYA 4K3HA 5EU6D 3REWA 2BY3A 5IF0A 5KVGH 2X05A 2WNGA 3U46B 3CCHA 3L3IA 4Y4FC 4R7NA 4HC1L 1XGRA 1NDMA 4HBQA 4ONGH 1NCAH 4XZUA 4FFYH 4OQ1A 4YO0A 3RTQB 4FP8H 4XPFH 1F3JB 1BD2B 1OGTB 3PIQA 4YDLB 1VADA 4OM1L 2PYED 3QQ9C 3NTCH 4R6UA 4ENEC 1NCDH 3P30L 1W72A 5CFHA 2HG5A 1M7XA 2KBGA 5D7IE 1JWUB 4NN5B 4KROB 5JOPD 1MHCB 1DANU 2MQCA 3FQWB 1EFQA 4PLJC 2F54B 3UPRA 4H1LA 4U1KA 1MLBB 2ITCB 2HJKA 5D93B 5BRZD 1J1PH 1S8DB 4Z0XB 3O2WL 3F58H 2COQA 5HJ3A 3F6IA 1VFUA 2MNUA 1INQB 4OZHB 4X83A 4CU6A 4PJDF 1U93B 3FO0L 4OD1H 4WO4C 5C08E 1VDGA 1J12A 2QSVA 4XP4L 1JGUL 1LDPL 4YDKH 4K3JL 4XGZB 1MLCB 4X6EB 2F53A 2X70A 5DA0B 2FJFB 1M05B 1NC2A 1CGVA 1X4ZA 3QUMA 5HPMA 2B5IB 5BS0D 1UT9A 2FECI 3QUYC 3KHQA 3QDGE 5IEKB 5C0NC 2A73A 3QDAA 3HMXL 4N90D 3P9MA 4LMQE 1R5VA 1P4LB 4JN2A 1EO7A 1N64L 4MXQC 5I1KL 5F7UA 3VRIB 4JQVC 3WKML 3UZQA 1MJUL 4LLVA 3AMKA 2VABB 1YNKL 2QBWA 3FOMA 5T1DL 4CVZA 3C6SA 5KSBA 1KPRA 4OZFG 4U3CA 4K23L 1NANI 4BJLA 1ZTXH 3EOAB 3VWKA 5JNYA 5D2LA 3QDHA 3S5LG 1RV6X 3IFLH 3L3OA 4DAGL 1A6AB 3QI9A 4LPWA 1GIGL 1I9IL 3GJEA 3KPRB 4NQCD 1BVKB 1KCVL 3PDDA 2ZG1A 2D2OA 3FQUB 4AT6A 5C0GB 1T1XA 4BSJA 2CLZA 2LTQC 1LP9E 3B3IA 4GW4A 4NZUH 4YHKL 5LBSL 2AJZB 5FOBA 3LD8B 3UDWC 4BFIB 4WHCA 1GOGA 5CJBA 4GKOA 5B8CC 4UNTA 5L2KE 1LO4H 2XN9A 1OGAE 5CGMA 1KG0B 4FQLH 4YGVB 1HHHB 3DMMA 1JI1A 3T4AB 4MJIA 5AAMA 3ZTJH 4L4TE 2HJFA 3PHOB 4M62L 2ORBH 4PRDB 4DVRH 5E4EB 2YC1A 3VCLB 2A6IB 1FZKB 1NL0L 3X3GH 4HKBA 5D2LF 5JPNA 3MRIA 4G9FE 4QKXB 2EEDA 4QRRB 4DQOL 2EE3A 4K7PY 4P9HC 5F89B 4X6DB 3S35L 4OQTH 1XIWD 4G6JL 2EIZA 4LCCC 5ESAB 1SVCP 1JZ2A 1X5YA 3NZHL 4XP6H 3QWRD 1N6QL 5L9DH 1MQ8A 4NM8H 4Q97A 4I8DA 5D1XC 1JHKH 1S7SB 2ARJA 3UJIL 3MLPA 3KNBB 5HGBB 4XCYA 3GMPA 1M7IB 1I4FA 2EC9T 1BBJB 5BQ7A 3R8QA 3QIWC 5AEAA 1H3UA 2W38A 1NFIB 1I75A 1QQDA 2P42B 2ED9A 4LU5L 3U4EA 5EO0A 4OZGB 1DFBL 1OAUH 3ZE1F 1X5XA 1ZGLA 3CFEB 5BVPH 4KMTH 3TBWA 3BQUD 3CNKA 4MX7A 4M1CC 1YDPA 2GAZA 5DJAB 2YD1A 4D9LH 4LSDA 3BZFB 3QRFM 3F7PC 3MRRA 4OIAA 3MACL 1MWAH 3KYMA 1JPGA 1RJLA 4YFEA 2W0FA 3ARDA 2CR6A 1QVOB 3GB7B 2ESVA 3TJEH 4RFNB 1PVHA 4M6OH 5L0QC 3EO1B 5IB1B 2C1PA 1PX3A 5I2IB 4P9MH 4JFOA 1T5XB 3FFCE 1HSAB 5SWZB 5DDHB 4CL7A 2Y5TB 3RKPA 2XWBB 3G5VB 3LKSA 1RUPH 3MRNA 1SMAA 3BFOA 3HNVH 1MHHA 5FCUH 3B6SB 4PY7B 2VIRB 3TIEA 4GBXB 1K4DA 5HY9A 3T0ED 3D3VD 3JTSB 3BPLB 4O9HH 3NCJL 4YHZL 2VAAA 5F70A 2DBLH 1WITA 5EBLA 1F6AB 1MFCL 12E8L 1OB1A 2JK5A 3UJJH 3GI8H 2XI9A 4K94H 4OCLC 4HAFA 3KPSA 3GIVA 3HRZB 3TZVD 4KGLA 1LWRA 4FNLH 2EDBA 1HKLL 5HD8C 5HI5D 3SE8H 1YEKH 3VD4A 1KENH 4C4KO 3RKDD 3VFMB 4R2GB 4LLQB 1CK0H 4Q2ZA 5H8DA 4PY8I 3D0LB 4KAQL 2BNRA 2Y25A 4MQSB 4X6FB 3R0NA 3KS0J 2E5EA 4PJFB 3SKNA 4U1JB 4GSDH 1HKFA 3CFDB 1T83C 4LHUB 1OF2A 3D48R 1DBBL 3ARYA 1WEJL 4XPFL 2C3VB 3GIZH 1HK6A 3BVNA 2VN4A 4KI5D 1H0DB 3CLEL 4Q9QL 3QPQC 4P9HH 4XP9L 1BJ8A 3NTCL 4EI5C 4JCMA 2RGSA 4WJ5B 1H3XA 5HGHB 2PKDA 3EFDH 3ZE2E 1EJ6A 2HFFB 3BKJL 2CD0A 5GISL 1TTGA 3VRLE 3MR9A 4M43H 1S9WA 4NC0B 1QFUL 4AMKL 2FGWH 4KHXH 3VXUB 5I1AA 3NN8A 4Y2DB 3V7AG 2DKSA 2DRUA 4KK5D 1VFAA 4LEOA 1Z5LA 2WSKA 4S0SD 5EZOL 3TJHC 4ZG1A 1L0XA 5CD3A 1CZ8L 3EKCA 2GY5A 4V2BA 5HHOE 1XGQA 1RZJL 1Z0NA 4HH8A 4PJ9C 1KACB 1RK1A 2DAVA 1HH6A 4OF0A 3ME0A 5FYJE 4XCEB 4P2RB 1EX0A 5HDBF 4P2OA 1LD9A 2ZUYA 4MMXC 2DLEA 3VXTA 3FONA 4NDMA 2GTZA 2NTFB 1Q94B 4AEHH 2AI0L 2DQTH 1QTYT 2BHZA 1JWMA 2X4PB 2BSSA 4JANA 4KDWA 5E08H 1J7VR 4JHWL 1JZ3A 3R4DA 1IC5L 1S7RB 2GJ6A 3BP6B 2DF3A 5IFJB 3SN6N 2VXTL 4JQIH 3D87B 5IQ9B 4HUVB 1WCQA 3VRJA 4F8TA 1ZTXL 3I75A 1EIBA 1XZ0B 1E4KC 4OFVA 3TPUB 1I9RL 4UUJA 2W91A 1FZMB 2VLKE 3UBXA 1AO7A 4OM0L 1AGEB 3OKEA 4HDIA 5KJRL 1MCWW 1FFPA 3BDXA 3WFBH 4NM4H 5JXED 2WK2A 4I18C 4R4FH 5CJQH 1LO4L 4XP5H 2D9CA 3NCFB 4XTRC 2WINA 1HOCB 1T7WA 3QXWA 3NACH 1JHTA 1ACYH 1WT5A 5GGVL 3IFOA 5ANMA 4BQBA 1XF4B 4WRLA 4TUJB 4DVRL 3C60A 1MCPL 1EUTA 3BP7A 4LAQH 3DRQB 3X3GL 3T4YB 5EU7E 4QHNA 4E9LA 1VACB 4EUPB 1AR2A 4X4ZA 1HHGA 2YPVH 3CMOH 5DFVC 3HZMB 2X9WA 4OQTL 4G8EA 4OI9A 4IRJA 4RA3A 4RFEB 3AC0A 3KR3L 4HIEA 5HHVL 3SDDC 5A16A 4HF5H 5CP7B 1LK2B 1S7XA 4NZTH 1LO3L 1VENA 5F1KC 4C55A 3O6FC 4MNGB 1TJGL 2GK0B 1X5IA 3L3HB 3ARED 4LASL 1U8QB 3EYVB 5MENB 4HWUA 1UENA 3AGVA 1T1YB 3P73B 1D5IL 2VH5H 1N6VA 3ES6B 2X4QB 3VXOA 2Q8BL 2R0LL 1NJ9B 4JPVH 4OB5H 2GUOB 4P3DA 5C0RH 3VXRD 3VXNA 4TOYH 2X4TB 4OKVB 3V0WL 4P4KC 2AJUL 4PJDE 1CLOH 4BZ1L 2F5BH 3W0WA 1FV1A 2XRAL 3SJVE 4NIKB 5HYIA 4RRPG 1YY8A 3HR6A 4C4KT 4D9LL 5C08B 5ISZA 4L8BB 1QSED 4KQ3L 1MWAL 3VH8A 3WXVL 5EIIB 5T1MA 1S9YB 4KI5F 4RAUA 5L88H 1EH9A 4PRID 2IAMB 4TUOA 1V3KA 3JZ7A 4F9PC 2ITDB 3GHBH 5I6XC 2FLBT 2JELL 3MLRH 4JFZH 3B4NA 5JIHA 4JPKH 3LAFA 3C09C 2VXQH 4XNXL 3O9WD 4G8GA 4JG1L 5DD3L 3LS5L 1I3VA 4ODSL 1RZGA 1KC5L 1WGOA 4JN1L 1YYLH 5D1ZB 3AU1B 3DIFA 5CAYB 2D7MA 1MFAL 4YK4B 4ETQB 1UWGL 4RFOH 1UA6H 4M7LH 2KPNA 5HHPA 1QFPA 1NEUA 4U1NB 2VKXA 4YBLC 4AG4L 5BV7H 1KENL 3SGEI 1YNLL 3O3UN 4CU8A 4XPGL 1GCFA 5D8JH 1LP9B 2OSLA 4WDIB 1IAIH 4QRUB 2XYCA 4NJ9L 1MIMH 5ELIA 1I7RB 4LSSL 1TZIA 3W39B 2EZ0C 4WU7A 3GSWB 1A22B 5D7JB 1D6VL 4Y7MA 2LE9A 4GSDL 3N0PB 1QHOA 4QTIL 1KXVC 1ZKAA 5D2NC 3OKLB 5FYLE 3SDAC 3B9VA 1I8IB 1I9JL 4ORZC 1BZ7A 5ETUB 5AD0B 1KPUA 4YDIL 4EOWH 1PLGH 2NZIA 3GJFK 4P9HL 3O3AA 3IDGA 5D2LE 3VDAA 3MXVH 4LSUH 4G9FB 1CFNA 3F7YA 4DTGH 1CDHA 2YPLA 2OMNA 5IFAH 1NPUA 3CJJA 2YWYA 4N0YL 4Y1AE 3CPLA 2P5EA 3DX9A 4OFYA 4I3SL 3MC0A 1I3UA 3L1OL 1IQWL 5JIKA 3VGAC 1XF3A 2XN9E 3IJSB 3DJ9A 3PWUB 2YBRB 3UTTD 3HI5L 4JO2H 1CD8A 1DQTA 3MLZL 5A2FA 1UB5A 1OTTD 2EDYA 5EU6E 5IJKC 1M7DA 5HDOA 1J8HD 3UBXI 3I3DA 1F13A 4MNQA 2VQTA 2PCPA 3ZE1E 3K74B 4DCQA 5D93C 4TVPH 3OKDB 5EO9A 5J4MA 1RZ7H 1YEIL 1K4CA 3GKZA 1NKRA 2ICEB 5MEPB 4M1DH 4JDVB 5CZXD 4TNWK 2FECL 3QQ3B 5GGTH 4OZ4B 1G0YR 3WXWH 5T3ZD 3U1SL 3QDJB 2PYEE 5I17B 4PJ5A 1H3PH 7FABL 4Y16A 4I0PD 4ODBD 4QXGH 1U9KA 4NZRL 5DVKA 1EEZA 3ECBB 5TF0A 4Y19D 3QFDB 5FHAL 3H3PL 4FG6C 4EIZC 4JM2D 2R2CA 4I2XA 1BEYL 5TE6L 1PX4A 2HKHL 2AEIT 5BRZE 3OB8A 3E8UH 4KVCH 3TA3B 1BOGB 5HHNA 4HCRL 5MI0B 4F7PA 1A1MB 2YRPA 5AYQA 1QBLL 3P4OB 1INDH 3BYYA 4HGWB 4Q6IA 4S1DD 5IFHL 1MPAL 1OLLA 3ALWA 5CJQL 1P4IH 1E27A 5CZVH 4MYWB 5AYUH 4LSPH 1TCRA 1JL8A 1B4JH 4GG8B 2G5RA 3HMWL 3NACL 1A7PH 2JCCB 5IMLB 1P7QD 4JFDA 3CIQA 2FD6L 4NKOA 1U42A 5F96H 5C6TH 3LIZL 2XTJD 4N90E 5I19L 3BGFB 3SDCA 4MJ4A 3EO0B 2YPVL 3CMOL 3BRFA 3L5WB 1EZVY 4HH9B 4HF5L 5E99H 3HRPA 4Y4HB 2DI8A 4YLQT 1DBMH 4DK6A 1U8KB 1JF5A 3KPSE 15C8L 3FQRB 4Y8AA 4X4YA 5I1HH 1T89A 1XGYH 2VRAA 1KFAL 1CBVH 3T2OA 3OHXB 5M95B 4NQCE 5FK9A 2VDOL 5KG9B 3FT3A 3S98A 1QLRA 1HXMB 2YD8A 4FZ8H 3WHXB 4ZUSA 1MCOL 1IGFH 4F33B 3QPXH 4NQED 5C0RL 1PGRB 1R3IH 5A3ID 2EO9A 5F93C 3HPJA 1C16B 4MAYD 5E6IB 2EDEA 3VXMD 1FG9C 3LSOB 5F8RC 5IHLB 3EHBC 3VI3F 3NFNA 1N59A 3PWVA 1EEYB 5KW9L 2BSRB 1KLFA 5HHOB 5K33A 1BIIB 5JPMB 1N8ZB 4UQ3B 4G6FD 2M26A 3MLXH 3WUWA 5HDBE 1S7WA 3UTSA 5L88L 4PG9A 4KK9C 3MRBB 1U3HD 3JV6A 4NCC1 3P11L 1YQ2A 1AD9A 1WAAF 4KJYA 5E8EA 2FLRT 3NIGF 4GAYB 3UO1L 3QEQA 3C6LB 4J4PA 2OR9H 5DK0A 5IW6B 3ROLA 1ZHLA 4HWZA 4Y89A 1TVDA 2Y06H 4D94A 2P8PB 3RGVD 1W72L 3ZYJA 5SWSB 4KGJA 5ADOH 1KNOB 4EN3D 1PKQE 2J4WL 3ARBD 3MJ6A 3RWHA 4CUCA 1EO8H 1QRNB 5C07A 3FL7A 3IJYB 3T1WA 4WFFE 4WTWA 3MUGA 2G2RA 2IMNA 5D8JL 3MJ8B 3EAKA 5BJTB 2OXHA 3TV3L 1S7UA 3ZLQC 2Y5EA 5TPWL 3VFNA 1OCWL 5ABDE 4JDZB 1OAQH 3LKOB 4RGNE 1YJDC 3BH9A 1A9EB 1YUHA 4ZXBC 3ULVD 5C0AA 4O5LH 4QRSB 4JGUA 1O0VA 5FO7A 2EDHA 4MA7H 1PLGL 3AY4C 5DMKA 1YEDB 4NUJA 3TH4T 5I74B 5HYSG 1L7IL 4RQQA 3IDYC 1XF5B 4EBQL 2BVPA 2HTKD 5DFWH 2E27L 1WF5A 4JM2F 5IKCA 5F9DC 4L4VD 2DLGA 5LCVL 1G6RB 1AO7E 4E42B 4XVSL 1DCLA 2FH8A 4A2LA 4F57H 2HFGH 3NPSB 2MPAL 3EDDA 3IDMA 2OZ4A 4XHJD 3H2WA 4QRQB 1G1YA 4XCNB 1FL5A 4Z7VF 5T3XH 5A2KH 3QFJD 1RZIA 3EDFA 3BSZL 4MA3B 2NY4C 2VZ3A 1KLGA 5ID1A 2PXYB 3REWB 2Q8AL 1M1SA 4MCZA 5IF0B 5HDQH 1P53A 4DKDC 3CCHB 3QXDA 3L3IB 3INUL 1TNNA 4U6HA 4R7NB 5FKPB 1LHZA 1XGRB 1NDMB 4FFWD 3LZFH 4XZUB 4TQEH 4KHTH 2X9YA 4YO0B 4P59H 5FM5O 2NZ9D 4UMGA 4X9GA 1FNHA 5FO8A 5ID0A 3PIQB 4TTGA 3CSYA 5DVNA 1XGTA 2MCPH 4YDVA 4DEPB 4KI5E 4GRWF 1W72B 3WXWL 2F19H 4J6RH 1MREL 3H42L 2HG5B 1JTTA 1BGXH 2Y23A 1P9MC 2NY2C 4FQ1H 4RZCA 1BFVH 3LV3B 4RX4D 3I85A 3K7UA 1KBGH 4PBXA 3V5DA 3UPRB 4H1LB 4U1KB 2BZDA 4Y88A 1YZZA 3ARGC 4GRMA 3DVNA 5TF1L 2X7LA 5HJ3B 1JCKA 4GS7C 5C0BA 1AKJA 3HC4L 2YMXH 1FC1A 4OKDA 5ESVA 5IJVA 4LMQI 2B2XL 5TQ0H 5I15L 1MFDH 3QUXC 4XAKD 3ARRA 3MBED 2HJLA 1K8DA 5CLTA 1KCRH 2F53B 2X70B 3QUMB 5HPMB 5KSUA 4HUKB 4BUGA 3MV8D 3P3YA 3RNQA 5GS0H 5D5MA 3TYGL 3EUUA 5F96L 1PSKL 1YJDH 5C6TL 3P9MB 4HSQA 1T5WA 1R5VB 3IFNH 3Q5OA 4JN2B 4DGVH 1AC6A 3CLFH 2CIIA 2XIDA 1OSPL 1TQBC 2WMPA 4JFXA 4LLVB 3TEUA 1KJ2H 1AFVH 5DO2D 4RWYH 2DKUA 3HS0A 3FOMB 3RHWF 4FZEL 4CVZB 3J7HA 5IWLC 3O4LA 3P0GB 3C6SB 1NAKL 2CLVA 5KSBB 1KPRB 4LIQH 3D85D 5I71C 2EXWC 4WUKH 2FNBA 3VWKB 5D2LB 5JNYB 3L3OB 1G1CA 2WUCL 3QI9B 5I1HL 3GJEB 1XGYL 3C9NA 3DX6A 1WFTA 3M17A 4CJ1A 4AT6B 1T1XB 2CLZB 2J3SA 1CFSA 5KSAA 5F3BB 3B3IB 4GW4B 5CCKH 2VB5A 1WZMA 5FOBB 3HTLX 2XN9B 2O5YH 4M02A 4Y4KC 2XXMB 3UMTA 1R3IL 4Z7WA 2BVUA 1DUZA 3DMMB 5E5MA 4MJIB 3SKOA 5D7KE 2MQ0A 4UNVA 3CUPA 4PG2C 2HJFB 5I18H 2VO5A 4G7YH 4XCFH 2FZ3A 1CFVH 2YC1B 4BFGA 2W9DL 2FATH 3C8HA 4HKBB 3VXSA 5JPNB 3MRIB 2E7LA 1OVZA 1V7NH 4JFQA 2EIZB 3QUZC 2O93L 1HNFA 1YMHA 3BPNC 3WFDL 1ZLUH 3WN5A 3SOBH 2DTSA 2ARJB 3O8XD 1CQYA 5J11B 2OR9L 3WFZA 1DBAL 1AGDA 4F9LC 4Z7WF 1ZMYA 3R06A 3GMPB 4TNVK 5HVHB 1PZ5A 5BQ7B 5E94A 3RVWC 5I66A 2Y06L 3FQTB 4PYHA 3MCKA 2Z31D 2IAMC 1QQDB 4MNQE 2J88H 1NAMH 1G9ML 3OG6B 5JUEL 3U4EB 1UQSA 5EO0B 3VG0H 5HGDA 1BFOB 1EO8L 5AZ2L 3VXRE 2Q6WA 3TBWB 5DR5L 4MX7B 3T0DA 1VPOL 3MMEA 2V9TA 3D2UA 1YDPB 2VXUL 2GAZB 3EYQC 1PG7H 4ONHA 3U82B 3MRRB 5F6HJ 1OW0A 1XH3A 3QJHB 3N1PC 2QQNH 4UINH 3KYMB 1JPGB 1CXIA 1RJLB 4K3DH 4X6CA 1OP5K 2W0FB 3ARDB 5DD0L 2FWOA 4KKCC 4PIRF 4N0CC 5D4QA 3RIAF 1X5LA 4F37F 2EDWA 2C1PB 4JFOB 4I2XE 3BD3A 4HEPG 1S5HA 2ZUSA 1IL1A 1CIUA 4XP1L 3MRNB 3KPMA 5BMFH 2VC2L 1MHHB 2FSEB 3TIEB 1K4DB 1HXYA 1CLZH 3WDJA 5HY9B 4UTAL 1TJIH 4R3SB 2FRGP 3IXTA 4LCWA 2VAAB 4PV8A 5EBLB 3S5LA 2JK5B 1OB1B 3KPSB 3GIVB 1XGPA 3O3DA 5DHVH 4YXKH 4EUPH 5DC4B 1X4XA 4POYA 2YA2A 5ADPL 3GFUA 3RDTD 4G8IA 1KTDA 5IHUL 2V2TA 2X6MA 4MVBC 3LS4H 3UPAA 5F7KC 4Q2ZB 1UCBH 1A7QL 3B5TA 4YZFF 1AHWA 4N8VA 3SKNB 3BPCA 4CKVX 4KHTL 2C4XA 2XKUA 4Z5RA 1MY5A 3VI3E 1H5BC 4KY1H 3BVNB 4OGYH 1E28A 1J5OH 3GMRB 5L6YL 4NKMB 2Z35A 4HK3N 2KUTA 2NXZC 5EC1A 2F19L 2FDBP 5KVEH 1OSZA 4LCYA 3WFHA 4YBHA 4WTZA 3E1F1 4FFZL 1HIMH 2AEWA 3HG1A 3NGBB 1DEEA 2PTTA 4V1DA 1WAAE 1RZFH 1NBZA 3MR9B 4RISH 3DSFH 1KTRL 2VUYA 2VJXA 3I02A 3NIGE 1S9WB 2JE8A 2P5WD 4M61A 5I1AB 1I7UA 3NN8B 3SGDH 3WIIH 1VFAB 4LEOB 2R29H 1KIRA 2E3VA 3RBSA 4B7LA 4YXHH 4KRPC 2FX7H 5E00A 4JZNA 1Z5LB 1F8TH 3UTTE 2VLRD 3LHPL 5CD3B 3VGFA 1WFNA 5GZNC 4F58L 1HWGB 1XGQB 3TBTA 5IESL 4FMKA 1HQ4A 1RK1B 4PLJD 1J8HE 3MCG1 3X12A 3PWPA 4PJGF 3UTSE 2CXKA 4OV6F 5JW4Q 4C56D 4P2OB 3GSXA 4ZYKA 3K2MC 3G6JA 5EIVA 1LD9B 4I77L 1L9MA 4K71C 4JRWA 5CWSA 4JM4H 3VXTB 3FONB 4NDMB 2UZIL 5DHXB 2GTZB 5MEOB 4XXCA 5D7LD 4JZJC 2P46B 1YJDL 3GO1H 1OWWA 5F9JA 3SDYL 1F02I 1JWMB 3GUTB 2NY5L 3DGGA 2BSSB 2ZUVA 4PJBF 4JANB 3U48A 5T3ZE 4P4RB 4RGNB 1E4JA 4L9LC 5DJDB 4ODXA 2GJ6B 1AFVL 5B3JF 3EJZD 5E2WL 5CS7A 4BH7A 4JFED 4BH8B 1G7IA 2F74A 3I6KA 4DKEH 1R3LB 2OYPA 5I9QC 5L7XH 2GI7A 3G9AB 2ATKA 1HH9A 4RGOL 4M7KH 5KVFL 1P84J 5KZCD 3VRJB 2Y1VA 3PXHA 3MLTB 4KK8D 5EO1A 4OLWH 1QSFA 4UUJB 4HIXH 2BVEA 4X7CC 3UBXB 3SDXA 1AO7B 3OKEB 4HDIB 3G6JF 5HHME 1FFPB 1BVZA 4YBQC 1IM9A 4Z7VE 1ZHBA 3PL6D 3QNYB 4IS6A 4OFPA 2VL5A 1FYTE 1T7XA 1G0DA 2WINB 3FO9A 3KYAA 2XZQH 3ULUD 2JJVA 5I16A 4L8CA 1NFDF 3O0RH 1JHTB 4JY6A 4D0BA 5HTSA 3MLWH 3IFOB 4HXAH 2ADFH 5ANMB 1FO0H 1Q38A 3Q2CA 5JA9A 1QPXA 4YPGA 3C60B 1CFVL 3BP7B 4WW2F 3U30B 4NUGL 4MXVF 2FJHA 2FATL 1WC7A 1FRGH 4NWUL 3SGKC 2XTJE 2D7TH 2YKLL 1FE8H 3OXSA 3GHEL 1BZ9A 3DI3B 3B9KA 1GGCL 4G8EB 2R4SH 4IRJB 4OIBA 5JLZA 4HIEB 5A16B 3OGCA 5JXAH 1W8OA 4GRWE 2YUVA 3X3FH 5BS0A 3VGBA 2I24N 1IGML 1X5ZA 5ECJE 5EU3A 5EZIL 1EZVX 1P5UA 4JY4A 5ILTL 5IW3A 4P2QA 5TE4L 4XPAH 2A1WH 1BREA 3VXOB 2OL3H 1IGCH 1RUKH 3BO8A 4NQDD 4Z8FL 4O02H 3CFCL 1D9KA 1FFOA 4P3DB 1LQSR 4CMHC 3RPKA 3VXNB 1UKSA 2DQUH 2NY3C 1S5IH 1ORQA 2VMFA 2VZOA 3VI4F 1AP2A 2I9TA 3E6HA 1V8HA 3LRSA 2XZZA 1J0YA 4U2YA 4UU9A 4U6VH 3JWNC 3G08A 3Q6GL 1MELA 3FCTA 4UOW1 1FV1B 3DYMA 3OXRA 4GUPA 1FVEA 3VXME 1PG7L 5IBUG 2CMRH 4BZ2H 1PY4A 4FQXA 5ISZB 2NXYC 3VH8B 2DQFA 1EMTH 2NY0B 5T1MB 4RAUB 3OGOE 3OAYH 3RA7H 3HZYA 1AE6L 4WNQA 2Y6SD 2X4NA 1FDLH 4TUOB 4OTXH 4YR6B 4ZAKA 1IAOA 7CGTA 3WSQH 1A6VH 4DN4H 1Y6MR 4PRBB 5TE7H 3N06B 5DFTA 1FNAA 2VR5A 5EOTA 2YD2A 3PGDA 2DQCH 3VFGH 2YN3A 1Q8MA 2UWEA 1MCKA 4R7DA 2HFEA 3S96A 3QCTH 2QHRL 4OCSL 5J6GA 1D7FA 4OLVH 4G8GB 4JRXD 5IM7A 3JVGA 4HFUH 3BZDA 1TJIL 3OJVC 3B2VL 4GW5A 1P6FA 3CD4A 1NSNH 2AEQL 4U3HA 4L5FH 4IEFB 3WN5C 1KB5H 1MQKH 2A77L 3HUJF 2FIKA 1UZ6F 3A6CH 1YC8A 1XIWA 4YX2L 2IAND 5HHPB 3ZHDA 4O4YL 3VFTB 4PV9A 3ZTJG 1CE1L 1FVCA 3M45A 3D39A 4PYGA 2OSLB 5J3HC 2F5AL 1UCBL 1TZIB 1E4WL 4WU7B 4LLDA 5DMIH 4PRHE 4HUUA 4LDEB 1GZQA 4KI1A 1ACZA 3QEGH 3KPQA 3WV0A 3L5XL 1AIFA 4O2CA 5ICZA 3RHWK 4GXUN 1BZ7B 4N0FA 3MRLA 4HXBH 4WI6A 5HD8D 3O4LE 2HH0L 4MDIA 1J5OL 3D0VA 4L1HA 1FZJA 1I1AD 4GG6F 3O3AB 3IDGB 3BQUA 1MVFA 3OKOA 3F7YB 2YPLB 1X5HA 3GKWH 5LQBH 5GRJL 2CGRL 3TVMC 3QCUL 4ODTH 1IBGH 2B4CC 2AK4A 3CPLB 2W59A 3DX9B 3IVKA 4PLKC 3K2UH 5KANG 1C7SA 1TQCB 3ARSA 1XF3B 2EECA 3TO4A 5FYJH 2BVOA 4G3YH 4Z7WE 4YXHL 1CICC 2EXYC 3QPQD 3REVA 4AZ8A 3BI9X 3ESUF 4JFHD 3QFJE 5EOQH 4S0TD 4P48A 3S34H 1Z3GL 1UB5B 1QKZL 4WHYH 5E2VH 2CIKA 3PV6A 3ULUF 2XTLA 4AQOA 1M7DB 3GZKA 3IB4A 4MNQB 2QKIA 2HMID 3OR7A 4KU1A 2PCPB 1IGYB 5EWIH 4EDWH 2XICA 2P43B 1OAZL 1OTUC 4M3KB 1MAKA 5TJWK 4DCQB 1KXTB 4UT9L 4DGYH 4JEGB 1GPOH 1KUMA 2HA1A 5F7EL 3M1BA 4EVNB 4YFLF 3LPFA 1K4CB 4GRLD 4U49A 3RL1A 1V5JA 3KYNB 2RFXA 1KF9B 4BKLB 4JM4L 2A83A 3HE7C 3MX0A 8CGTA 2OS7A 5B39A 2HWZH 1C5BL 1HZHH 2GSIA 4KK6C 1T1ZB 3TC9A 4LLYB 4PJ5B 2YD9A 5H35B 5ENWA 3KLAA 4MQXC 4CN1A 1EEZB 2PN5A 2QQLL 4DKEL 1TFHA 4KWUA 2VDQH 4MB5A 2XFXB 1NCBL 1DN0A 4I2XB 3EYUH 4P46D 1JMZA 5B38G 1OWRM 4Z7QF 4LKXB 4UTBL 5HHNB 3W11C 3LMJL 4NOFA 3ZSTA 5T5NF 1MNUH 2XZCL 4ZTPH 3F6LA 3A6BH 4OF8A 5I8KL 3TWCH 1AI1H 4XAKE 2I9LA 4XNYL 2HVJB 5CEZE 3O4OC 5DHYA 2XZQL 1S7QB 5KOMC 1GVIA 4X98A 2V7NA 4LPVA 3EO9H 3O0RL 3UCRA 2QSCH 1NGPH 3I3EA 3TBSA 3RIAK 4OBRA 4F37K 1QNZH 1WBZA 3NCYP 1FO0L 3QIUD 1JZ4A 2CDFA 1ZHNA 3RX5A 2C3GA 5DS8A 1J88A 4E0RA 3IS0X 3SDCB 3O3EA 4XTRD 2IBBA 4LCWE 4P23C 1S3KL 1MIEL 2JLLA 2HLFC 4PD4J 4K8RD 2CKNA 3OR6A 1NCNA 3KS0H 1J1OL 2WBJA 2DM3A 4MAUL 1UWXK 1T2JA 4UT7H 4XPAL 5EA0H 3UZVB 3EDKA 1BIHA 3DURA 2OL3L 3FT3B 1QLRB 5L8LB 4JFFD 4ZUSB 5DJYA 1RI8A 2VQUA 2MFNA 3ZKXC 1MCEA 3SO5A 3OPZH 3FMGH 2R15A 3HPJB 2P47B 4OSUH 1EXUA 4G42A 3ILPA 4ODHH 5J11C 3VGDA 3NFNB 3PWVB 1Q9OA 4ZPTA 4H1LH 3NH7H 3F7VA 4BZ2L 3OTTA 3VWJD 3D18A 1F4XH 1EFXD 2DD8L 3AFLA 4FXGA 4PJGE 3X11A 4ZFZA 3TCLA 1BVLA 3K46A 3WUWB 1EMTL 1S7WB 3UTSB 5EUOF 4L8SA 4PG9B 1JWSA 4OTXL 5GSVA 3GMMA 3JV6B 1AD9B 3BDYH 4OLUH 4KJYB 2ARJQ 5E8EB 3GJFH 3OJDA 3RWJA 2A74A 3QEQB 4PJBE 4TVPD 1LK3H 3W9DA 4JO3L 2IBZY 3ARFC 3QCTL 1YEJL 5DK0B 5AAWA 1N5YL 4QF1A 1DQLH 5B3JE 1NCWH 4HWZB 5E8NA 4HFUL 4ELMA 4ZS7L 4EEEA 4M1GL 1VEMA 2J8OA 1JNJA 4LP4A 1FL3A 2H8PA 4MA8H 4NRYA 2LFGA 1F5WA 1WV7T 3MV11 3D5OF 3O11A 4HS3A 5C07B 5FYLH 1BECA 3G6JE 3G5XA 1TENA 3SPVA 5HHMB 3MUGB 3Q3GA 2G2RB 4XVTH 4J3XA 1TXKA 3QULA 4M6MH 2FBOJ 4WIQA 1S7UB 1YQVH 3VFNB 1L0YA 5DMIL 2H1PH 4M3JA 1FYTB 1NFDE 2P8MA 3BH9B 5JQ6H 1YUHB 1QBMH 3MJ9A 5C0AB 1KGCD 4BFEA 1B4RA 2A9NH 5FO7B 5DMKB 3QIBA 4NUJB 1RUQH 4MXVE 3U9PH 4RQQB 2CO6B 2D4DA 4PJAA 2BVPB 2AAVA 5BW7C 1FLRL 1JZ7A 1QSFE 4W4NA 5IKCB 3IXAA 2EZ0D 1FJ1A 5LQBL 3NIFF 3I3BA 2QQQA 2X44D 4G6ML 1QSEA 1EUUA 3SDAD 3IDMB 3K2UL 1S78D 3U9UA 3MV9E 3PWLA 4PRIA 5DZOA 4GLRH 4YUEL 1BLNA 3BIBX 5FYJL 4G3YL 4RBPH 2BJML 1RZ8B 3TCXA 2BOBA 4BFBD 1JYNA 5ID1B 2QADB 3FN9A 4RMSA 5D71H 4ZUVA 5GGUA 5E2VL 1LEIA 4NO2A 3QXDB 3O9WA 4U6HB 2WLZA 5BVJA 3RVTC 1RPQA 3BT2L 3VI4E 4C59B 3QG7H 5EWIL 4EDWL 5K9JH 4L3EA 2MMXA 2D7OA 1BD2D 1RVFH 4ZUTA 1N6UA 1AQDB 1YEEL 2DIBA 3EOBA 4PJEA 1A7BA 5FO8B 3AB0C 3PP3K 5ID0B 2L4OA 2LAAA 3CSYB 1XGTB 1SJVA 2YUXA 4YDVB 1DJSA 1QYGH 1CGSL 3BOVA 4KROD 1ZANH 1HZHL 3NAAH 4G5ZL 1OT2A 3QCVH 2ATPA 4B7IA 4Q6YA 3OKYA 4P2QE 4Z18A 4ONFL 4RZCB 2F54D 2N1KA 4E41A 2Z8WC 4LEXH 1LO2H 5DJ2A 5FDWA 3NCCB 1C08A 4X4ME 3T04D 4I3RL 2AW2A 4PB0H 5GS1C 3KDMA 4GRMB 1EEUA 2Y36H 3KPNA 3BQUC 3DV4B 2VL4A 4AEIH 4WV1A 2B1HH 2X7LB 1DQJA 4DUWA 1XCQA 4FQJH 3RPIA 5C0BB 1FIEA 2NW3A 1AKJB 1AGBA 1INEH 2PO6B 2BMKA 2UZXB 4JHAH 5ESVB 5IJVB 5DMYA 3KPPA 3HUJE 4JO1H 1UZ6E 3HNSH 3EOYG 5DRZA 4ZTPL 5HYQB 2VLMD 4FG6D 3A6BL 1J1XL 2HJLB 1K8DB 3PP4L 2IH1A 3MV7A 4PGZA 2BX5A 4BELD 3AVEA 5B4MD 5KSUB 4APQB 4ERSL 3T0BA 1NGPL 3RNQB 5CJ5A 4WU5A 5D5MB 4HBCL 2A2QT 4ALAH 2UWEE 1T5WB 5FXCH 5D7LE 1TJHL 3T0EC 2R56H 5BZWA 5C0CE 4JFXB 3ZKSD 2JB5H 4G7VL 1FSKC 4YHOL 2ZUTA 4TYUA 5F7NC 3HS0B 1XR9B 3P0VL 4RDQG 5HYSA 4GQPH 3O4LB 4LVHC 2CLVB 3TZVC 4JVWA 4QOKE 1CXLA 2OJEA 5LJYH 2X1XR 3KPRD 5HI5C 1QBBA 4URTB 3RKDC 2B4CL 4LLUA 1QA9B 2L0DA 2DMKA 3U4AA 5GS2H 4YXLH 3C9NB 3U30C 5IR1A 3HB3D 1YN6A 5EA0L 3DX6B 3M17B 5KSAB 2VDPL 4WWKA 3U7YL 4KXZI 1BWWA 1A6PA 1NQBA 2AJ3A 3V2AR 3SQBA 3DV6B 4Z7WB 4Y19A 4YHNA 1DUZB 3FMGL 3WO3B 1VEPA 1ORSA 4QLRA 1EBPA 2WANA 1MEXL 4KI5C 5E5MB 3PE9A 3ULUE 4LSQH 3SKOB 4M7ZB 1YN7A 1MJ7L 3CUPB 4LSVL 5T3XD 3BESR 2FZ3B 5DSCA 2CJUL 4QRRD 3M8OH 5FYJU 2ZCLL 3HI1A 1MCQA 3VXSB 2AEPH 3EYSL 3DYOA 1QO3A 4KKAD 4Z7UF 3FB6A 4JFQB 1MCIA 1YMHB 4ZSOE 4KK5C 3K8MA 4OLUL 5AWNH 4KKBD 3RWFA 3E6FA 4AYFA 2GTWA 4EXKA 3TP4A 4S2SA 1LK3L 4U0RB 1GL4B 4PJCF 5KAQG 3H9ZA 1AGDB 1PZ5B 1NCWL 3GSUA 5IOPB 5E94B 2VITA 4WWID 1VGEL 1GSMA 5I66B 3MCKB 5IW1B 1IFHL 4PRPA 3FRPG 1HEZA 1T2QL 1FIGL 4G8FA 3SEPA 1EJOH 1UQSB 4Z7QE 2VLJE 3HAEA 5HGDB 4KDTA 3KAAA 35C8H 5FYLL 4Z78A 3MMEB 3D2UB 4KFZC 1JI2A 3FAXA 4ONHB 1UWEH 4RMWA 2AJXH 3C5ZA 5IEHA 1EEQA 4X6CB 5C2UB 2VOTA 3BUYA 1WTLA 2CUMA 2FWOB 1QBML 1K6QH 5CJOH 3SQOH 3QO0A 3DHMA 4NQEA 2C26A 2P24A 3BGAA 3QISA 1P1ZA 2X4OA 1U0QA 3V8OA 3ROOA 3SE4C 4JQXC 3DWTA 1U6AH 4HWBL 4MB4A 1S5HB 4GBXD 1IL1B 3KPMB 4X9IA 3K0WA 3CK0H 4OIIH 5DQDH 4PJ8A 5GJSH 5JXEC 1OM3H 1FNSH 5GS0D 1WWBX 1HXYB 2CH8A 2FYYA 4JRXE 4XWGL 4OZHF 1U2HA 5HYJE 4LCWB 3IXTB 4PV8B 3VG9C 2Z92A 3OKKB 4XMKH 1IT9H 1U3HA 2DQDH 2JJSC 3CZFB 1JE6A 1XGPB 3O3DB 4HC1A 1UXSA 4M93C 3WNMA 5D6DC 1KTDB 1UXWA 5D71L 2V2TB 2WUBL 4WCYH 1A7OH 1W0YT 1T7VA 5CGYD 2NY6B 2O5ZL 5JW4N 5JR1H 4MHHG 4PJIA 5FGSA 1AHWB 4N8VB 4LHUD 4YE4H 4U1SB 3BPCB 2R2HA 1DQMH 1I7TA 1TQCC 1MRDH 4Z5RB 2BVQA 4X9BA 1JGLH 3VA2C 5D96C 2A6KA 3QZWG 1E28B 1UACH 3ARBA 3AREC 1BQSA 2E6JA 1QYGL 2Z35B 3KLHD 1ZANL 5EC1B 5EUOE 1OSZB 4LCYB 3WFHB 5JW3H 3QCVL 2R69H 3HG1B 3HNTL 4FMFA 3W81A 4CMMB 1QBAA 3LEYL 1DEEB 2PTTB 4F15C 4V1DB 3IGAA 1NBZB 3T08A 4HJJL 3I02B 4Y2DD 1WICA 4M61B 1X5KA 2VXVH 1D6EA 4KJPD 2WZPD 4PB0L 3NA9L 1I7UB 1NMCC 2R23A 4Q9RL 4PJBB 5GRZA 1KIRB 2J5LC 3O45A 4LARH 5E00B 4JZNB 2AK1H 3L7EB 2YOCA 1INEL 1ND0A 4KTDL 1DZBA 2FO4A 3TBTB 5D72H 3GBMH 4JO1L 1Q0YH 1URLA 1HHJA 1HQ4B 4OD2A 4UB0L 3X12B 2QSQA 3VFWA 4RAHA 3HMXA 5CIPH 3ZE0E 1CD0A 1ZA6A 4OD3L 1KJ3H 3GSXB 4CN4A 1H8SA 2AJYH 3Q1SH 4X6DF 4ZYKB 3G6JB 4G6AC 2N4IA 5CWSB 2DQJL 5ALBL 1RJZA 4QHUA 4M4RA 5I75B 1CR9H 3P9LA 5F9JB 4R4NC 5CEXA 5JA8B 4O2FA 3ARTA 2GJZA 3MZGB 5GGRB 1F4WH 3BHBA 4ODXB 4U1GC 5HVWA 3OZ9H 3GMLA 4BH7B 1G7IB 2F74B 3I6KB 4HMEA 2NY1B 5D70L 3GM8A 5HI4D 2ATKB 2NW2A 1HH9B 5BZDA 1NUFA 3EFFA 5J1AA 3MTRA 1MCCA 4H20H 4OZGF 2B8OT 2IPTL 1T20A 4MXWL 4PBWD 3UYOD 5EO1B 1QSFB 5DTFB 3NIFE 3GRWL 5E2TH 3SDXB 5C3LD 4BM7A 2BRQA 2D7PA 1GGYA 3RUGA 1IM9B 1ZHBB 3LQAC 2LQRA 4IS6B 4Q9BA 1MAJA 4OCYH 2A9MH 2VL5B 3FO9B 2ID5A 1HE7A 3AXLA 1K85A 5I16B 4ZTOL 4L8CB 4JY6B 4D0BB 1OQXA 1J18A 1VKXA 1DEDA 1U8OA 4TSAH 3CXDH 2V7HA 4YPGB 4XCCH 1MHPH 3M8OL 1UJ3A 1OP5H 2FJHB 4NQVA 1A6UH 1WC7B 1EO5A 3H8NA 3QEHA 2I27N 3OXSB 4ZNEE 4R0LA 1WISA 3SCMC 4Y4KD 1BZ9B 3B9KB 5IHZA 1CTNA 4JB9L 3ZYIA 3RQ3A 1AQKH 5JLZB 3MBEA 3OGCB 1K5NA 5DXWA 3OX8A 4OGXH 5C0FA 5MEND 1KPVA 1KT2A 3WHE0 3BP4B 4ACPA 1JGVH 3MV8A 4KVNL 4JY4B 1OTTC 4P2QB 3HE6A 3Q48A 3C8KA 4OLZH 3BO8B 4PRNA 2R1YA 1D9KB 3S4SB 3ESVF 4N0UE 1FFOB 3RVVD 4N0RA 1OAYL 2D7QA 1CN4A 1ORQB 4L3EE 2I9TB 1AP2B 3LRSB 4GMSH 4JO4L 5CJXC 4UU9B 1Y18A 3MODL 3G08B 4DW2L 5CZXC 5C08D 3OXRB 4GUPB 1FVEB 3KWWA 3EYOA 1QEWA 4NN6B 4FQXB 5J9PA 1UWEL 1DSFH 3HZKA 3DPBA 4IIQC 5T1KA 4NBZB 4I0PC 2IAMD 1QR4A 4Y5VA 3HZYB 5F1IB 5J7CC 4WNQB 1PEWA 4G43B 2X4NB 3QDGD 5EH1A 2H6PA 2IQ9L 4ZAKB 1IAOB 4ZOEA 4JM2C 5E03A 3SQOL 1YYMH 5EOTB 1IC4H 5IBTH 3PGDB 3BJ91 1RIHL 1MSPA 5JORA 4H8WC 3EYQD 5IP4A 2UWEB 1U6AL 2J7LA 4LHUG 4R7DB 1YPZF 3WL9A 3CFJA 4OCNC 4U6YA 1A7RH 5J6GB 1EBAA 4FABL 3CK0L 4W70A 5CILL 2GEEA 4JPIA 3CVHH 5D1ZD 2AV7A 4S1DC 5GJSL 5IM7B 1OM3L 3UJTH 2W0LA 4MA1C 5KN5A 1KEML 1FPTL 4U1HB 4Y5XA 2IBZX 2CDGA 1YEFH 1RULH 3RGHA 1H3WM 2PW1A 2IF7A 4JJHA 2Q86A 4PGCA 2FIKB 1CG9A 5FFLA 2XG5A 2AXGA 4PV9B 1IAMA 3TBYA 4U4BA 1FVCB 5D7SH 5ITFA 3LQAH 1YMMA 3D39B 4WCYL 2XTJC 3O8XA 5A2IH 1A7OL 3NCEB 2ADIB 2HKFH 5D7JD 1SMOA 4LLDB 2A6JB 2Q7YA 2L7JA 1GZQB 1SBSL 3JWDC 4ZS6C 3MNVA 1F6FB 2HN7A 1MRDL 3KPQB 2Z31A 3OAZK 1CD1A 4L4TD 1N4XL 4QRPE 4EDXA 2CSPA 1AIFB 1F58L 4NPYA 3TH3T 3WIHH 5FYKD 5ICZB 3WEXA 4RIRA 2F58H 2H9GB 1X9QA 4N0FB 4BZYA 1T04A 4MDIB 3D0VB 4LPCA 5IMKA 1I85A 1FZJB 4D9RD 4F7MA 3AS0A 4G9FD 4ZFGL 1EHLH 4JKPH 3OKOB 4MZ3A 1KN2H 2QJDA 4H0GA 4F7EA 4FQCH 2OK0H 4ODVH 2Y07L 2IADB 4LRNH 2P1YA 2AK4B 3SE3C 3C5JA 3IVKB 2XQYG 1FFRA 2RQ8A 4MAYC 1NCCL 5CJ8A 3TO4B 4PJCE 2BSTA 4L4JA 3CFBA 2BVOB 3I9GL 3REVB 4LARL 4M48L 2NXZD 3V5KA 5EOCL 1K3IA 2YSSB 5JHLL 3V6ZA 1I1FA 1BJMA 2CIKB 3PV6B 3KVQA 4ZO8A 1OP3K 3OR7B 1U3HC 2VDMH 5DEZA 2VLJB 2WBWB 2ADGB 2AVGA 1VCAA 3WD5H 1KJ3L 4Q58C 3M1BB 4AL8L 1P6AB 3QDJD 2A83B 3QAZC 1GGIL 1T0NB 4Q0XL 5B39B 1GHFL 2PO6C 2VDNH 3GNMH 1QLEL 1MCJA 1P7KA 1JYXA 1KJVA 5HGAA 3WE6A 3RGVC 1Q0XH 4I0KA 5ENWB 3KLAB 4H8WH 3HC3H 4AY0A 2D4FA 3OZ9L 2F54E 3B9EA 5ALCL 3IAGC 4EN3C 3KYOA 1KCKA 4PRPE 3SO3B 4APQC 3TA3D 1FVDA 4EUPG 5CEYA 3VDCA 2CK0H 1B0WA 1FH5H 2DIAA 2BFVL 3Q6FA 4OZHE 5DUML 5GRUH 4PJHA 1UYWH 3HN3A 4P2YA 3RJDA 5F97E 2OP4L 5LGHH 5HYJB 3EBAA 4Y4FA 3OKMB 5CMAA 4MD0B 2AXFA 3CXHK 1E4XI 1CDJA 2I9LB 4OCYL 4UT6H 3VMPA 5DHYB 3QWQB 2X9XA 3VFRA 5FKAA 4NHCH 3ZMRA 2P5WA 4X98B 2V7NB 4WTXA 4HK0A 1QR1A 3TBSB 3MRFA 1WBZB 2HTKC 1IGTA 3JWDH 3CXDL 4OQTA 2CDFB 4KDVA 4JPWL 4WEBL 1ZHNB 4YBQD 2CRYA 4UILL 1KJMA 5DS8B 3MOBH 5E2UH 4E0RB 1P4BH 4FTVA 4OCRH 4YHML 5IHBA 3O3EB 4XHJC 4Y4HD 1R6VA 4OLXL 2AKRA 2ED7A 4LNRA 5LAXA 4I9WD 5E5UB 3OR6B 4DGIH 1KCLA 2WAHA 4K3GA 3MJ9L 5F44A 2WBJB 1U8IA 3KPRE 1JGVL 3MJ7A 1ZEAH 1R3JA 3FZUD 1A02N 4UV4L 1C5CH 4YJZL 3DURB 3Q5TA 4WO4A 4NNPH 4W6WB 1M71A 4FFWC 1XCTB 3RY6C 1BZQK 4UOJA 4LVNB 1CXFA 5E6ID 3VFOA 3U4BL 2ZCHH 4IRZH 5JTWA 5MERA 4I48A 4Y5YC 2NZ9C 5DJ0A 2B1AH 4JFEA 1V05A 4LCIL 1EXUB 1MWAA 2IPKA 4G42B 3ILPB 5HHOD 4PJXA 2YRZA 4QGYA 1A47A 5HDLA 1Q9OB 2NY7L 3QDMA 4ZPTB 1PDKA 4R90H 1KYOK 1YNTA 2LU3A 4FXGB 1DSFL 4QCIB 3X11B 2WWKT 3R1GH 4ZFZB 3TCLB 3K1DA 1BVLB 4JQVA 2V2XA 4L8SB 4X6DE 1NEZA 5GSVB 3GMMB 5FV1L 3C6LD 3UC0L 4XRCA 5FEBA 1YY9D 2YPKA 5IBTL 2AABH 3OJDB 2ZOLA 3RWJB 2A74B 2NNAB 3P0YH 3W9DB 4KJWD 1MCLA 4HKJA 1A7RL 2NXYD 2J2ZA 4QF1B 5F7HA 4QEGA 5SWSD 1T4KA 3CVHL 1DQQA 5K9KA 2J8UA 3OAUH 4ELMB 4MS8D 1ZE3C 4KTEL 5I1GL 3UDWA 5T5FH 1K9TA 4ZMAT 5B8CA 2XZAH 5B38A 1FBIL 3DTXA 1QRND 4OZGE 4NBXB 2JTDA 3WDIA 2OCFD 1HQRA 4PB9H 1FL3B 2H8PB 4NRYB 2KZ1B 3ZL4H 3EZ8A 4LSRH 3MLUL 4OV5A 4HS3B 3G5XB 4X7DC 1FGVL 2CRMA 3MRQA 3SPVB 1T2XA 4M5YH 4WY7H 1RU9L 3EDEA 3Q3GB 1MRFH 3QULB 1JN6A 1CD9B 1AY1L 5J6HA 3S88L 5DO2C 2MWCA 3U0WH 4QHKJ 5DWUH 2P8MB 1TZHA 2JKXA 1U8LA 1C5DB 3F8UB 1U95A 4LCCA 2X5PA 3WIHL 3RVUD 5E24E 3IETA 1AD0A 1BQHG 4S1RH 5SWZE 5F9WC 3QIBB 3MBXL 5AZEL 2X89A 1VFOA 4XC3H 2O5XH 2EH7H 3QHZL 4XBPA 3IXAB 1KN2L 4F2MA 3QIWA 3VW3H 2FBJL 1A6WL 3BIKA 1G7HA 1SM3L 3KPLA 4NKDA 3GK8H 4WI4A 3LEVH 3PWLB 2Y72A 1BLNB 2PXYD 1OY3B 5I1CH 4TPRH 3H0TA 4PGJA 3GM0A 4HX1A 2BOBB 1LO0H 5FUOH 3C2AH 4ZUVB 4D2NA 2JCCF 5GGUB 3ZKND 4Y5XC 4H25A 5JO5B 4NO2B 4O58H 3O9WB 5BVJB 1X5JA 4IDJL 5HVFB 4X0KA 5ACLA 2KKQA 5TDPA 4RAVA 2EDLA 4L3EB 5T3ZL 1JFQL 4ZUTB 4XVUD 4PJEB 1FG2A 3TLRA 3PGFL 2ZP0T 5C6WH 2BNUA 3O8XC 1J9CT 4MJ6A 2E7HA 4FQQA 2DL2A 1OD7A 4OUUA 1DDHA 4J2XA 3FN0L 1SJEA 2ATPB 2DN7A 4ZFFA 4PGDA 1R3HA 1WFOA 2P44B 1NCTA 4E41B 3EGSA 4H8WL 2IFFH 4JRYA 5DJ2B 4BSVA 1C08B 4HCRA 4JR9H 1U58A 1MJ8H 2IG2H 1M6OA 3VXUE 2W0KA 5DT1L 1YPZE 3KDMB 4NCC2 3KPNB 5E5RB 5DD1L 5CEZH 4JG0L 4WV1B 1MH5A 1DQJB 2VXSL 3GSNL 3MLVL 1XCQB 1U2CA 3RPIB 5GRUL 5IMOA 1WJ3A 2H26A 4XPHL 4HQQL 2FJGA 1PD6A 1RHFA 1MF2L 3KPPB 2D03H 2F53D 5KANI 4DK3A 1WSST 5DRZB 4P0DA 3BKCL 1NCUA 4HAGA 4P2RE 2ICWA 2IH1B 4FQIL 3MV7B 4QHMA 2EYSA 4RMRA 2DLTA 4WW2C 1T83A 2AGJL 3U79A 5MP6H 1EPFA 1A3RL 1MOEA 1N2RB 3LRHA 4AEEA 4WU5B 4M8QA 3PNWB 4EI5A 4JFYA 5KS9A 1YECL 5ESQA 4HZLB 5BZWB 2GITA 5LXGH 3VJ6A 2X4RA 4QRPB 5C2BH 3PF2A 3QO1B 4PS4H 5HYSB 2QEJA 5DK2A 3VWKD 4OAWA 1ZLUK 5LGJA 2EKSA 5F6IC 4UNUA 3QI9D 2OJEB 1IC1A 5IVXA 3GGWA 3RDTC 4LLUB 1DVFB 1XF1A 3CSPA 4WHYG 5IVOA 1RFDL 1SY6L 5IR1B 1YN6B 3TBVB 1NUDA 4XPBL 1J0HA 2FH6A 2XN9D 1HSBA 1JGDB 1UM5H 1CGWA 4PJ9A 4WWKB 1OARH 2AJ3B 2ZUQC 2ADJA 3KXFA 1R0AL 2ZKHL 2ZCHL 1MCRA 4YFLI 1KCUH 1SJHA 2XQYK 3WYRA 2E8YA 1ETZA 1ORSB 5JZ7D 5I1JL 5TQ2H 4P5MA 2ZCKH 5FOJA 1YN7B 3NCMA 5H94A 5DSCB 4K7PH 3ALXA 1OAKL 3R1GL 4F3FA 1I3GH 4K9EC 4ZO9A 4XVJL 2X1WL 2RCSL 1QO3B 4QHLA 4XBEH 3FB6B 1FNEA 1WZ1L 4D3CL 2WBKA 4YWGL 1A7NL 1EGJH 3E6FB 2GTWB 3AS2A 2AABL 2FL5A 4GAGL 1ZGLM 5GJTL 1B6DA 2E7MA 4MNGE 3VFUB 3FTGA 4IRSB 1RZKC 1UM4H 5MENE 3G5YA 1E4KA 1ZS8B 2V17H 2E8ZA 1HINL 3G6DH 5C09A 5IROC 3IDUA 2YD5A 3GSUB 2EH8H 2VITB 8FABA 3F12A 4I18A 3O6MH 4PRPB 2RJMA 1HEZB 32C2A 4G8FB 5SX4H 2I07A 2NQCA 3V6FA 3HAEB 3B5HA 4POZD 2G9HA 4X80H 3ARFD 4Z78B 2R9HD 2ZNXA 1OD9A 2OI9C 3ULVL 3IU4L 4HWEH 4UAOC 3ARDD 4WUUE 4P57A 3C5ZB 5IEHB 1WIUA 3UYRH 5DZNA 4NNYA 3EJZC 3HLAA 4MJ5B 1A3QA 3V6OE 3BUYB 5DD5H 1NLDH 1E6OH 4JFFA 2PUQT 3HI6L 3SDDA 3QO0B 3PP3H 4NQEB 4UV7H 2P24B 3BEWA 3BPOB 1P1ZB 2X4OB 3GSOA 1ZWIA 4KK8C 4M6NL 4S1RL 4WFGE 3O6FA 3ROOB 3WS6C 4OI7A 1T21A 1PYWA 2EH7L 4U1LA 3STBA 2ERJB 4PJ8B 4YHLH 2ZJSH 2N7AA 3VW3L 2FYYB 5E70A 1ZLSL 3PL6C 4L8DA 1JNLL 2Z92B 4G6FB 4TRPL 3KPSD 4LVOB 4QGTA 3ULUC 1BWMA 1MCHA 1ZT4A 4ZFOL 4J8RA 4LFHD 3BKYH 4P4KA 4TPRL 3SE9H 5J12B 4H1LG 5DVOA 4K94C 3LDBB 1IKFH 1LO0L 4GO6B 4P5TC 4JREC 4A6YL 1Q9LA 4KMLB 1MJJB 4MD4A 3SKMA 1AGCB 4DN3H 2WP3T 5GS2D 3DHJA 5EORL 5GGTA 2R2HB 4K7FA 1I7TB 3H9SA 3L3KA 5KSVA 3MA7A 2BVQB 2ICWI 1CGUA 4F9PA 3V52L 2BY2A 1HHKA 2ED8A 4U05A 2A6KB 3ARBB 4K9EH 5FYKE 1KCSH 2JJTC 3LN4A 5KSBF 5KVDL 3ETBF 4K2UH 4D9RE 1LNUA 3DSNA 1IC7L 3D9AH 3RVTD 1TZGH 3DX8A 3FJTA 4S1QL 1CT8A 1OHQA 1S7TB 2R1WB 3IGAB 1RIVH 1RZKH 3E3QE 2HRPH 5ICXA 1R3KA 4NGHH 2IG2L 4U1MA 5DVLA 3A0OA 3JV4A 1KIQB 4HIJA 2R23B 1DBKL 3BH8A 5F7LB 3O45B 4HG4K 5DRNA 4L1DA 1A0QH 2IALB 3WMSA 4PJXE 1DR9A 4K3EL 1ND0B 4MGXA 2AP2A 3QDME 3O2VH 3P4LA 4M7JH 2FO4B 1F42A 4Z95H 4OD2B 1HHJB 4P2OD 2Y6SC 4XNUL 1V7MH 3OL2A 3VFWB 4XNZB 1TVHA 2APBA 5D2NA 5DJ8A 1ZA6B 4CNIA 4WFFD 2Q76A 3SDAA 1E4XL 2M2DA 2Q3AA 1FCGA 5KVMC 5GGRY 4NOBA 1A3LH 2YUWA 1RJZB 4QHUB 4CU7A 2JB6A 1YC7A 3QDJE 3P77A 3P9LB 2HTLC 1ZA3B 4RGND 3RZCC 4GAJH 5CEXB 1RUMH 2GJ6D 4O2FB 2GJZB 3BHBB 5LXGL 2VLLA 3NFSH 3PHQB 5C2BL 3GMLB 5AUMA 4PS4L 1F90L 3QB7C 1F3JA 3DBXA 1Q72H 2NW2B 1KELH 5BZDB 3EFFB 1WIPA 1AO7D 1T20B 3KJ4B 4OLYH 1L4IA 2R0ZL 2APWA 5L8JB 5FB8A 5F88A 1CQKA 3A67H 3ULUH 2X10A 5TH2A 1RUAL 1JYVA 4HT1L 5FO9A 5EBWA 1F2QA 5IJKA 3T2NH 1MHCA 2J6EH 3MLYH 1IM3A 3RUGB 5F9OH 4PGEB 3TESA 4JDTL 1GGBH 1OARL 4N9OB 3QQ4A 4HK3J 2DQIL 1SYSA 4LSTH 4YC2C 5F7DA 5GGQH 3TNNA 2NCMA 2IJ0C 2ITCA 2GKIA 1J0JA 1KCUL 2AQ3A 1QPPA 3WIFA 1NMBL 5I1EH 4YHYB 1K8IB 2JCCE 2PYFA 1IAII 1I1AC 3O2DH 3C60D 5KVGL 2ZCKL 1U8OB 3RI5F 3WJJC 4IJ3C 1UJ3B 1MI5A 4ONGL 4JFPA 3L7FA 1C12A 1TNMA 1NCAL 3BYTA 5IB5A 3QEHB 4IRJD 1I8MA 3OAYK 4LVNC 2BK8A 4R0LB 4FFYL 3QZWA 1JV5A 4FP8L 5IHZB 2FJFA 1F3DJ 3K4DA 3MBEB 1IKNC 1UEYA 1K5NB 2EYTA 3OX8B 5C0FB 2AJVH 1KPVB 1KT2B 1NCDL 2EDTA 1Q9KA 4I9WE 5FGRA 3HE6B 1CLYH 4XWOD 4X5XA 3C8KB 4WENB 1EVTC 4ZUWA 3N9GH 4NNXB 2H32H 2HMIC 4PRNB 2BCKA 2R1YB 1J1PL 3NIDF 4P3WA 1YPZB 1AXTH 3U0TA 1NKOA 1WUNT 1I3RB 4GRLC 5H2BA 3F58L 4ZUUA 3QBTB 3O3BB 1Y18B 1NGYB 2YD7A 1H9VA 4PY8J 5I8OH 4PJ7A 5ISZD 3KWWB 1QZ1A 2QV2A 4W6YB 2MJWA 4OD1L 1HNGA 3EYOB 1QEWB 1FAIH 2NY0D 4H88H 5C0GA 5J9PB 2XA8H 3T77A 4LRIC 3HZKB 5T1KB 4YDKL 3MFGB 4NO3A 5EU5A 2NX5E 4LQFH 4KQ4H 4Y5VB 5TGBA 4D0CA 1BAFH 1OPGH 1JNHA 2VZUA 1HHHA 4NO5A 3WLWC 1UM6H 5CBEA 5F7FA 3S3PA 4P46C 1KB9J 5JORB 4G8GD 4N8CH 2DS4A 3WL9B 4PRDA 1PG7W 4U6YB 4JPIB 2AV7B 1HYRC 3SKJH 5KN5B 3O6LH 2B0SH 5SWSE 2CDGB 3DRTB 2Y4SA 5F89A 3E2HC 3DXAA 5FGCE 5ESAA 2PW1B 4P3CH 2EC9U 2BOCA 4PGCB 2Q86B 2P48B 5IUSA 1CG9B 1QRNE 3IFLL 1OOAA 2AXGB 1J86A 4F8QA 2DIJA 1RURH 3TBYB 3QIUC 3BN9D 5ITFB 1YMMB 3C87A 3OJ2C 4NZUL 2EEAA 2Z91A 1A1NA 4GT7A 2YWZA 5BV7C 2IH3B 4F7TA 4B5EA 5I8EA 4R26H 1F00I 4LPYA 1L6XA 2Q7YB 4FQLL 4NRXA 4WW1A 3MNVB 2HN7B 3BWAA 5D7KD 2Z31B 1CD1B 4NC1E 2ENYA 4EDXB 4K8RC 4NPYB 5GQBA 4RIRB 3WEXB 3CFEA 1T04B 2ORBL 3IJHA 5IMKB 4F7MB 3P4MA 2YPLD 1I8KB 5FUCE 4DVBA 3QHFH 1TZGL 3DUSA 2X09A 4OFYD 5EPMA 1GAFH 1RMFH 1RZKL 5E8PA 3NCBB 2HRPL 4XP6L 3C5JB 1W2KT 5L9DL 1A4KA 4N9GA 3WFEH 4NM8L 2H2PC 4GXVH 1TPXB 5I73B 1JHKL 2BSTB 1MCWM 4U1IA 5DUPH 1SYVA 1VFBA 2XWTA 4NFBA 3S37X 2DLHA 1HSAA 3V5KB 2XWBA 2EO1A 3KJ6H 4LVEA 3VWJC 4MNQD 3FT2A 3V6ZB 1I1FB 4GOSA 2RHEA 1ES0A 4M8VA 1KTLA 4J3WA 4XMLH 2NMSA 2OJZH 2I5YH 1J05A 1OAUL 4TUKH 4ZXBA 5BVPL 4KMTL 2O61A 4NO0B 2IC2A 1F4YH 4NT6A 1Z6JT 2VDRH 5D1QC 1A5FH 3AY4A 5E9DA 3V9FA 3IDXH 4PJ5D 1KJ2A 3VFMA 4WUUB 3KLDA 5GRWA 1P7KB 4R96A 4MHHI 3L5JA 5HGAB 3WE6B 4KPHH 1BOYA 5C09E 3RIFF 3U36A 4CVXA 4X6FA 4PJFA 4U1JA 3TJEL 4U6XA 4Z0BH 1HILA 5J13C 4M6OL 3RVXC 3KYOB 3BZ4B 4G6AD 4P9ML 1FVDB 5CEYB 2W60A 3HC0B 1RUPL 3BD4A 4JE4B 4OT1H 3HNVL 5BOZG 4NN7C 5FCUL 3W82A 3OG4B 4R4ND 5TDOA 5JHDA 4U33A 3Q6FB 4PJHB 2HFFA 3ULUL 4O9HL 2IGFH 2DBLL 5IV2A 3UROR 4U7KA 4C83A 4Y4FB 1UVQA 2IFGA 5MHSE 3I6LE 3UJJL 3GI8L 3F7RA 3HCVA 5CMAB 4K94L 1D3CA 2AXFB 2F53E 4LOUD 1FP5A 1N3NA 2FX9H 2DWDB 4FNLL 4Y2DA 1MRCH 5DUBA 3RU8H 5FKAB 5C0EA 3SE8L 1YEKL 2P5WB 3MO1A 4HK0B 1QR1B 2DM4A 4ZQKA 2N56A 1DVFC 1QLFA 1YEHH 2H3NA 3MRFB 4WGWB 4YH6A 4P49A 4TSCH 1CK0L 1E6JH 1IGTB 4S11A 5EDXA 2BRRH 3SDCD 3CC5A 4K8RH 1HDMA 1P9MA 5CINH 2NPLX 1KJMB 4O2EA 2VUOA 4HFWA 4FTVB 1MCNA 4QXUH 4UIKH 1WBYA 1S78C 1JPSH 3TN0C 3WO4C 1NBVH 3GIZL 2AKRB 5DJXA 3VH8G 5KSBE 2YR3A 3P2TA 5LAXB 3CGTA 3ARGA 4XNMA 3LN5A 4Y2OA 4XI5C 5I8CA 1Q94A 3EFDL 1U8IB 1NAMA 2V5YA 1CLYL 2VAJA 3N9GL 4WO4B 4M43L 5CD5D 3SCMD 1FNFA 1TETH 2NTSP 3RTQC 5GRVK 1M71B 2FGWL 1BM3H 3QUXA 4OF3A 1I8LC 4KHXL 4ZPVA 5MERB 4YDLC 3VD9A 2JJWA 4I48B 4IMLA 5DJ0B 4JFEB 1MWAB 2FEDD 2M1KA 4MJIE 1U8JB 3QUYB 4PJXB 2YA1A 1IGIH 4XMPH 4NN5C 4KROC 3QDMB 3WJLC 1CXKA 3UTSD 4TULH 2XA8L 3D1MC 1TITA 4UBDD 2LAGB 1FORH 3K80A 2V2XB 1IZJA 2ZUWA 1CIDA 3FO1A 4KQ4L 4IMKA 3OAZH 3JWOH 1NEZB 1OPGL 4GJTB 1CVSC 3DO3A 4XRCB 1K2DA 1NMAH 2E7BA 4J4PD 1UM6L 2YPKB 5IWLA 4AEHL 2ZOLB 2KH2B 2P7TA 2DQTL 3QEUA 4H5SA 2QQKH 4GW1A 1BFSA 1Y6NR 2FHFA 5E1HB 4HKJB 4AENA 2XXCB 5E08L 4ZDHA 5HHXH 43C9A 1CL7H 1T4KB 2W92A 1DQQB 1CYGA 4G80A 5C70A 2LTQB 2J8UB 1IAKA 3O6LL 3G04A 5DHVA 1G9NH 2YA0A 2B5IC 1D5BA 3Q5YA 4JQIL 4P5KA 5B8CB 5B38B 2EDRA 3DTXB 3HKFA 4Y4KA 5C07D 2YD3A 5B4MC 5D2NE 3IKCA 4RBPK 1VFMA 5HHMD 4OV5B 1NUGA 2R0WH 1RURL 1NGZA 3I50H 2FO1A 2Q7NA 1ZT1A 4NM4L 4PG2A 5D7IA 3WFBL 4R4FL 1OP3H 1JN6B 1FYTD 4YDJA 2Z0BA 4XP5L 5J6HB 5D9SB 3TT1H 3PQYA 4H0HB 3UX9B 2ESVE 1TZHB 1U8LB 2K3TA 4JKKA 5DURB 1U95B 5EC2B 1ACYL 3QUZA 4LCCB 1UG9A 4NRZA 1QFWM 2AXHA 3IETB 3LH2H 2CKBH 3LDBC 3LOWA 5D1XB 5CGTA 1F2XK 4LAQL 1DLHA 2Y9RT 2JIXA 1PQZB 3HB3C 4HPOH 3LD8C 3CVIH 4F9LA 5F7WC 4YNYA 1FN4A 4XBPB 1ZVYA 1GC1H 4F2MB 4PBVC 4DOHE 3QIWB 5I30H 1GAFL 1RSFA 4LDLB 4ZS6D 3BIKB 2YXFA 1G7HB 4J3UA 2IAMA 1OP9A 3KPLB 4KZDH 1IEBA 4O51A 4NZTL 4I0CC 1AJ7H 4FA8A 4GXVL 2XWJA 3NABH 2EDQA 3QDGA 3JUYA 4G6KH 2ZUUA 3BE1H 2QADD 2E9WA 5E4EC 1UCTA 3H0TB 3MUY1 4HX1B 4WI2A 2NYYC 2EIDA 2VH5L 3KJ6L 5EZLA 4ODUA 4H25B 3QRGH 3NIDE 4JPVL 3RI5K 3V6BR 4LPUA 1B2WH 2BNRE 4OB5L 2EYRA 2A6DA 4GAFB 5CBAA 4X0KB 4TOYL 4KKAC 3CX5J 5IGXH 25C8H 3VE0A 1L6ZA 1T6VN 3FB8A 4TUKL 1N7MH 2EE9A 4KKBC 1QP1A 1CLOL 2F5BL 1FG2B 5DGRA 2VDRL 3S36H 5L0QB 2FX8H 4MJ6B 4MMZC 1GJIA 4Z76A 3IDXL 4OUUB 2MOVA 2LV4A 1LP9A 1SBBA 1DDHB 3CDFA 4KMQA 3HAEH 1SJEB 4MNHA 3VFVA 4ZFFB 2NX5B 1I7RA 4PGDB 5L2KA 1R3HB 1OGAA 1DE4A 2XG4A 3RAJH 3EGSB 4WEUD 1UKTA 4JRYB 4BSVB 1U58B 3GHBL 4K7PX 1M6OB 4XH2B 5FUZH 4ZOCA 3MLRL 4JFZL 1LMKA 4JPKL 3C08H 4L4TA 1NC4B 5HHQA 1AKJD 2PO6D 2VXQL 3ZTNH 5JIPA 1MH5B 5J0BA 5E8DH 3NPZB 1BQUA 5E95B 5IMOB 4G9FA 1C1EH 1YYLL 2H26B 2KZWA 2VSCA 5T1LA 2FJGB 5CP3A 5IQ7H 3AS1A 2I60H 5FGCB 1JPST 3SKUD 3RRQA 4RFNC 3LEXA 3LN9A 1U8PB 4RFOL 4MWFA 1UA6L 4HWNA 4M7LL 4APQD 1FO0A 2ICWB 4QHMB 2FX9L 3OF6A 3PDOB 1MRCL 3QSKB 4HPYH 2W65A 3VU2A 1JRHH 1H5BA 1JPTH 1G7PA 1Z9LA 5BV7L 4IM8A 1YEHL 4GBXC 2BSED 1UEMA 4M8QB 1IAIL 1MIML 1E6JL 4PRHD 3BPLC 4EI5B 4JFYB 4L3CA 5KS9B 1ZVHA 4K07A 5F1SA 5GS0C 4K8RL 5A2JH 4HC1H 3N1FC 5CINL 5ESQB 2GITB 4FXLA 2EDFA 3SY0A 2GJ6E 3O4LD 3VJ6B 5HPOA 2X4RB 1CCZA 1BQHA 1WLHA 2VN7A 1EHAA 3O41A 3KGRA 5DK2B 3ORJA 3DXAE 4OAWB 4EOWL 3WKNA 1L0QA 5LGJB 2C9AA 2EKSB 3RX7A 2OL3A 5BCAA 5MEPA 3BZEB 5IVXB 4OM1H 3GGWB 4R2GC 3ISWA 3MXVL 2VDKH 4LSUL 3P30H 5KSAD 4DTGL 5IFAL 3ARWA 4JCLA 5CGYC 4YQXH 5INDA 4HMCA 3MRPB 1HSBB 3TM6A 4PJ9B 3IU3A 1BM3L 4HLZH 3W9EA 3PXJA 3KXFB 2ADJB 4WHTA 5C9JA 2MKLC 5FF6B 3ZDYF 3JV0A 4OZIA 1ETZB 3FFCA 4JO2L 2D7NA 1SEBA 6FABH 3U0PA 5ANME 4XMPL 3KLHC 4JZJA 2HT4C 5H94B 3VXSD 2DI7A 3CFIC 3MOAH 3FO0H 1G7QA 4F3FB 3GSRA 5EZJA 4TVPL 4XP4H 2OLDA 4Y2DC 4L9LA 4K3JH 4QHLB 4LHJB 1RZ7L 1FNEB 4KJPC 4OFKA 2CRIA 4M1DL 2ILLA 1NMAL 2LU4A 1JGEA 1VADB 4M9OA 4J23A 5GGTL 2FL5B 3VGGA 3FTGB 3DECA 2WWMD 3G5YB 3HMXH 2JJUA 1H3PL 4X9FA 2BNQA 1KB5A 1WFUA 1CI5A 1N64H 5C09B 4QXGL 3WKMH 1B90A 3F12B 4I18B 2V5SA 3SGDI 2HJKB 2XY2A 5T1DH 32C2B 1LGVA 3CMGA 2I07B 4HGMA 3E8UL 3D2UD 4KVCL 4OLEA 4K23H 5DK3A 2G9HB 3W0WE 5I1DA 1BBDH 4QTHA 3FO2A 1Z2KA 1INDL 3OMZA 3OBAA 1GIGH 1I9IH 3MYJA 1KCVH 3RX8A 5ISZE 3OHXA 5CEZD 1QOKA 4YHKH 4B41A 1P4IL 2QHLA 3IDNA 4HS6A 4XX1G 5CZVL 3SGKA 1GOFA 3TT1L 5AYUL 4NNYB 2C1OA 4LSPL 3RIFK 1NC2B 2E9JA 1B4JL 4XT1C 5HI4C 1A7PL 3VMNA 4NP4H 3SDDB 3BEWB 2A73B 3GSOB 1ZWIB 3O6FB 4NKIH 4M62H 1EEYA 3CX5K 4G8GE 3ZSSA 1WWAX 1PYWB 4U1LB 3FB7A 4LCWD 3X13A 1NL0H 4IMKC 2OM5A 4DQOH 5I30L 2MHAA 4L8DB 3S35H 2EIEA 5E99L 4G6JH 2X4SA 4UZGA 3NZHH 3ALPA 1H3VA 1AJ7L 1DBML 1N6QH 4GKNA 4GAYA 4J8RB 3BRDA 4JVPA 2R4RH 4P4KB 5FECA 3QHTC 3UJIH 4GFTB 3SGJC 1CBVL 5H37H 2NY6D 1ZLWH 5DI8A 5D5MF 4FZ8L 4MD4B 3JTTA 3SKMB 1ZV5A 1IGFL 2P8PA 4RMVA 3QPXL 5FM8A 4YEEA 4LU5H 5IGXL 4TTDC 4K7FB 3H9SB 3L3KB 1N7ML 4RMTA 5FA4A 2F8VA 1JNNH 4BSWA 1HCFX 1HHKB 1CF8H 2VLKA 1UADC 1R5WA 4M4PA 5E1AA 1LNUB 3C09B 3MLXL 4V1DD 2H2SD 4BK5A 3MACH 1EV2E 5K59F 2YPLE 3BMVA 3DX8B 2MQ3A 2APVA 3DUHA 1CT8B 3C5SA 3ILQD 4JDZA 3LKOA 2P5EE 1W8NA 5E2JA 5ICXB 1A9EA 1R3KB 3RVVC 2C3XA 1KULA 4QRSA 4OGAD 4U1MB 3JV4B 4F80A 4HIJB 1AR1D 3BH8B 1QSVA 1BMGA 3C08L 5IK3A 4PRAA 4XCYB 5DRNB 4UOW0 1I4FB 4UIMA 4YBLB 5E8DL 5C1MB 2ZG3A 1A21A 3V6OC 4MZ2A 3QXUA 3WNKA 1BP3B 1RAMA 5IQ7L 5ADOL 3NCJH 4YHZH 2I60L 4IDLA 3BGMA 3LB6C 1MFCH 12E8H 5D2NB 5DJ8B 2XA3A 1ZGLB 4CNIB 4HPYL 2Q76B 4MA3A 2E9IA 3MYZA 1U3JA 1HKLH 2AS5M 5AG9A 3D25A 3IDJA 1CWVA 5DQ9A 4QYOA 2JB6B 3P77B 4WFEE 2GFBA 5D1ZC 1NGQH 3MFFA 4PJ5E 1OAQL 4KAQH 4YK4C 5FKPA 5DVMA 5FGBC 2ESVB 2YRLA 3CAFA 2NY1D 3TVMA 2VLLB 4O5LL 5HI3C 4LDOB 5AUMB 3ZT7A 1DBBH 1WEJH 4MA7L 4PJDA 3T0XA 3VGAB 3DBXB 4N5ED 3SJVA 1QSFD 3RWGA 3LKSB 3UZEA 1CICA 3CLEH 4Q9QH 1CLCA 4XP9H 2VDKL 4BK4A 4LBEA 5FB8B 5F88B 1T80A 3FFDA 5CSGA 4DOHB 1IM9D 5D7JC 4YQXL 4GKZA 5TH2B 3MV9D 3BKJH 2G5BA 4OZFA 4F57L 5FO9B 2HFGL 1X6NA 5EBWB 3LV3A 2C3WA 5GISH 1IM3B 2GHWB 4JGJA 1NUNB 2EEBA 3QQ4B 1SYSB 1QFUH 5T3XL 5F7DB 3FRUA 3TNNB 4AMKH 5JW4R 3PQYE 5CKGA 4X6CF 3WIFB 2R39A